BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21268_g1_i1 len=2470 path=[1180:0-785 1966:786-915 2096:916-1177
2358:1178-1217 2500:1218-1237 2520:1238-1261 2544:1262-1309
2592:1310-1345 2653:1346-1377 2685:1378-2469]

Length=2470
                                                                      Score     E

ref|XP_011101109.1|  PREDICTED: branchpoint-bridging protein            294   5e-83   
ref|XP_009611673.1|  PREDICTED: splicing factor 1-like                  288   1e-80   
ref|XP_009802234.1|  PREDICTED: branchpoint-bridging protein-like       287   2e-80   
ref|XP_006358238.1|  PREDICTED: branchpoint-bridging protein-like       280   2e-78   
ref|XP_006358239.1|  PREDICTED: branchpoint-bridging protein-like       280   2e-78   
ref|XP_002283115.1|  PREDICTED: branchpoint-bridging protein            280   3e-78   Vitis vinifera
ref|XP_006355551.1|  PREDICTED: branchpoint-bridging protein-like...    276   2e-76   
ref|XP_010318168.1|  PREDICTED: LOW QUALITY PROTEIN: branchpoint-...    275   2e-76   
ref|XP_009768171.1|  PREDICTED: branchpoint-bridging protein-like       276   2e-76   
emb|CDP05352.1|  unnamed protein product                                274   2e-75   
ref|XP_009607008.1|  PREDICTED: branchpoint-bridging protein-like       273   3e-75   
ref|XP_007038338.1|  Splicing factor-related                            272   3e-75   
gb|KDP22445.1|  hypothetical protein JCGZ_26276                         271   1e-74   
gb|KDO49948.1|  hypothetical protein CISIN_1g040243mg                   269   6e-74   
ref|XP_006421619.1|  hypothetical protein CICLE_v10004301mg             269   9e-74   
ref|XP_006490149.1|  PREDICTED: branchpoint-bridging protein-like       268   1e-73   
ref|XP_008453901.1|  PREDICTED: branchpoint-bridging protein            265   1e-72   
gb|KHG02926.1|  Branchpoint-bridging                                    265   1e-72   
ref|XP_004146904.1|  PREDICTED: uncharacterized protein LOC101205455    264   2e-72   
ref|XP_004169681.1|  PREDICTED: uncharacterized LOC101205455            264   2e-72   
ref|XP_011018352.1|  PREDICTED: branchpoint-bridging protein-like       263   4e-72   
ref|XP_002303489.1|  hypothetical protein POPTR_0003s10640g             261   3e-71   Populus trichocarpa [western balsam poplar]
ref|XP_011027963.1|  PREDICTED: branchpoint-bridging protein-like       260   5e-71   
ref|XP_006368238.1|  hypothetical protein POPTR_0001s00850g             260   5e-71   
gb|EYU31311.1|  hypothetical protein MIMGU_mgv1a001841mg                259   7e-71   
ref|XP_006280024.1|  hypothetical protein CARUB_v10025900mg             259   1e-70   
ref|XP_010482464.1|  PREDICTED: branchpoint-bridging protein-like       259   1e-70   
ref|XP_002865852.1|  hypothetical protein ARALYDRAFT_495202             259   2e-70   
ref|XP_010442612.1|  PREDICTED: branchpoint-bridging protein            259   2e-70   
ref|XP_010443022.1|  PREDICTED: branchpoint-bridging protein-like       256   1e-69   
ref|XP_006409296.1|  hypothetical protein EUTSA_v10022568mg             255   2e-69   
gb|EPS70750.1|  hypothetical protein M569_04006                         249   2e-69   
ref|NP_199943.1|  splicing factor 1-like protein                        255   4e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AAK43947.1|AF370132_1  unknown protein                               255   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010035039.1|  PREDICTED: branchpoint-bridging protein-like       255   4e-69   
ref|XP_007218922.1|  hypothetical protein PRUPE_ppa001547mg             250   2e-67   
ref|XP_008234420.1|  PREDICTED: branchpoint-bridging protein            250   2e-67   
ref|XP_010102701.1|  Branchpoint-bridging protein                       248   9e-67   
ref|XP_006401991.1|  hypothetical protein EUTSA_v10013307mg             241   1e-66   
ref|XP_002510980.1|  zinc finger protein, putative                      246   3e-66   Ricinus communis
ref|XP_010264378.1|  PREDICTED: splicing factor 1                       247   4e-66   
ref|XP_004514517.1|  PREDICTED: branchpoint-bridging protein-like...    246   5e-66   
ref|XP_002886939.1|  hypothetical protein ARALYDRAFT_475645             246   6e-66   
gb|KEH29408.1|  splicing factor-like protein                            241   1e-64   
ref|XP_006401996.1|  hypothetical protein EUTSA_v10012746mg             242   1e-64   
ref|XP_009372856.1|  PREDICTED: branchpoint-bridging protein-like       241   3e-64   
ref|XP_006842180.1|  hypothetical protein AMTR_s00078p00155240          240   5e-64   
emb|CDY32633.1|  BnaC03g16010D                                          238   1e-63   
ref|XP_009370447.1|  PREDICTED: branchpoint-bridging protein-like       238   2e-63   
ref|XP_009374466.1|  PREDICTED: branchpoint-bridging protein-like       238   2e-63   
ref|XP_009132612.1|  PREDICTED: branchpoint-bridging protein            238   2e-63   
ref|XP_010680635.1|  PREDICTED: branchpoint-bridging protein            238   3e-63   
ref|XP_008347216.1|  PREDICTED: branchpoint-bridging protein-like       238   3e-63   
ref|XP_003539505.1|  PREDICTED: branchpoint-bridging protein-like...    237   5e-63   
ref|XP_003534409.1|  PREDICTED: branchpoint-bridging protein-like       236   8e-63   
ref|XP_007131353.1|  hypothetical protein PHAVU_011G006700g             234   9e-62   
ref|XP_004307795.1|  PREDICTED: uncharacterized protein LOC101299...    232   2e-61   
ref|XP_006393481.1|  hypothetical protein EUTSA_v100114671mg            213   8e-59   
ref|XP_008669507.1|  PREDICTED: branchpoint-bridging protein-like       223   3e-58   
ref|XP_002465427.1|  hypothetical protein SORBIDRAFT_01g038690          221   5e-58   Sorghum bicolor [broomcorn]
ref|XP_006414750.1|  hypothetical protein EUTSA_v10024523mg             221   8e-58   
ref|XP_009402178.1|  PREDICTED: branchpoint-bridging protein-like       221   8e-58   
ref|XP_004975388.1|  PREDICTED: branchpoint-bridging protein-like       221   1e-57   
ref|XP_008801638.1|  PREDICTED: branchpoint-bridging protein-like       221   2e-57   
ref|XP_003579604.1|  PREDICTED: branchpoint-bridging protein            220   2e-57   
ref|XP_002448361.1|  hypothetical protein SORBIDRAFT_06g025810          219   2e-57   Sorghum bicolor [broomcorn]
ref|XP_010905186.1|  PREDICTED: branchpoint-bridging protein-like       219   3e-57   
emb|CBI20199.3|  unnamed protein product                                207   4e-57   
ref|NP_001169335.1|  hypothetical protein                               218   8e-57   Zea mays [maize]
gb|EMT18286.1|  Branchpoint-bridging protein                            218   9e-57   
ref|XP_008801838.1|  PREDICTED: branchpoint-bridging protein-like       217   1e-56   
ref|XP_010917529.1|  PREDICTED: branchpoint-bridging protein-like       216   6e-56   
gb|AEW07878.1|  hypothetical protein 0_13604_02                         196   7e-55   
ref|XP_010926686.1|  PREDICTED: branchpoint-bridging protein-like       212   1e-54   
ref|XP_010532355.1|  PREDICTED: branchpoint-bridging protein            211   3e-54   
ref|XP_004305301.1|  PREDICTED: uncharacterized protein LOC101296792    207   4e-53   
ref|XP_009340604.1|  PREDICTED: branchpoint-bridging protein-like       198   3e-50   
gb|KHN11669.1|  Branchpoint-bridging protein                            197   4e-50   
gb|KHN32434.1|  Branchpoint-bridging protein                            196   8e-50   
ref|NP_001173909.1|  Os04g0385700                                       182   1e-48   
ref|XP_001766808.1|  predicted protein                                  192   2e-48   
ref|XP_001771487.1|  predicted protein                                  190   2e-47   
dbj|BAK04277.1|  predicted protein                                      184   1e-45   
emb|CAE05015.1|  OSJNBa0044M19.2                                        183   2e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ30506.1|  hypothetical protein OsJ_14553                          183   2e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EAY93866.1|  hypothetical protein OsI_15642                          183   2e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_006644320.1|  PREDICTED: branchpoint-bridging protein-like       183   2e-45   
ref|XP_008805310.1|  PREDICTED: branchpoint-bridging protein-like       180   9e-45   
gb|EMS55585.1|  Branchpoint-bridging protein                            178   8e-44   
ref|XP_006827746.1|  hypothetical protein AMTR_s00009p00262590          159   2e-37   
ref|XP_010273178.1|  PREDICTED: uncharacterized protein LOC104608792    142   2e-31   
ref|XP_002263312.1|  PREDICTED: uncharacterized protein LOC100261746    127   9e-27   Vitis vinifera
gb|KDD72497.1|  hypothetical protein H632_c3271p0                       115   2e-24   
emb|CDP05215.1|  unnamed protein product                                116   1e-23   
gb|ABR18258.1|  unknown                                                 114   1e-22   Picea sitchensis
gb|KDD73228.1|  hypothetical protein H632_c2405p0                       102   2e-21   
ref|XP_008812234.1|  PREDICTED: uncharacterized protein LOC103723178  98.6    2e-19   
gb|ESA14251.1|  hypothetical protein GLOINDRAFT_172480                  100   4e-19   
gb|KFH65616.1|  hypothetical protein MVEG_09092                         101   9e-19   
ref|XP_010041144.1|  PREDICTED: branchpoint-bridging protein-like     99.8    2e-18   
gb|EXX61176.1|  Msl5p                                                 99.4    3e-18   
gb|KFM25385.1|  Branchpoint-bridging protein                          99.8    6e-18   
gb|KCW46415.1|  hypothetical protein EUGRSUZ_K00247                   98.2    8e-18   
ref|XP_010038431.1|  PREDICTED: branchpoint-bridging protein-like     97.8    1e-17   
gb|EXX61177.1|  Msl5p                                                 95.5    3e-17   
gb|EIE86835.1|  hypothetical protein RO3G_11546                       95.9    4e-17   
gb|EKC39213.1|  Splicing factor 1                                     95.1    4e-17   
ref|XP_005102930.1|  PREDICTED: splicing factor 1-like isoform X1     95.5    9e-17   
ref|XP_001637547.1|  predicted protein                                91.3    1e-16   Nematostella vectensis
emb|CEI94815.1|  hypothetical protein RMCBS344292_09020               93.2    2e-16   
emb|CEG63079.1|  Putative Zinc knuckle transcription factor splic...  93.2    2e-16   
emb|CEJ03890.1|  hypothetical protein RMCBS344292_17865               92.4    3e-16   
ref|XP_005102932.1|  PREDICTED: splicing factor 1-like isoform X3     93.6    3e-16   
ref|XP_008326232.1|  PREDICTED: splicing factor 1                     93.2    3e-16   
ref|XP_008433150.1|  PREDICTED: splicing factor 1                     93.2    3e-16   
ref|XP_005807962.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...  93.2    4e-16   
ref|XP_007567934.1|  PREDICTED: splicing factor 1                     92.8    4e-16   
ref|XP_005754765.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...  92.8    5e-16   
ref|XP_004576135.1|  PREDICTED: splicing factor 1-like                92.8    5e-16   
ref|XP_006809913.1|  PREDICTED: splicing factor 1-like                92.8    5e-16   
ref|XP_005951329.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...  92.8    5e-16   
ref|XP_005465438.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...  92.8    5e-16   
ref|XP_009301351.1|  PREDICTED: splicing factor 1 isoform X2          92.4    6e-16   
gb|AAI63938.1|  Sf1 protein                                           92.4    7e-16   Danio rerio [leopard danio]
ref|XP_009301350.1|  PREDICTED: splicing factor 1 isoform X1          92.4    7e-16   
ref|NP_001080780.1|  splicing factor 1                                92.0    7e-16   Xenopus laevis [clawed frog]
ref|XP_010749843.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...  92.0    8e-16   
ref|XP_008283418.1|  PREDICTED: splicing factor 1                     91.7    1e-15   
emb|CCX34375.1|  Similar to Branchpoint-bridging protein; acc. no...  91.3    1e-15   
ref|XP_007250246.1|  PREDICTED: splicing factor 1                     90.9    1e-15   
ref|XP_382256.1|  hypothetical protein FG02080.1                      92.0    1e-15   Fusarium graminearum PH-1
ref|XP_007703846.1|  hypothetical protein COCSADRAFT_243802           87.4    1e-15   
ref|XP_002837836.1|  hypothetical protein                             90.5    2e-15   Tuber melanosporum Mel28
ref|XP_002167761.2|  PREDICTED: splicing factor 1-like                89.0    2e-15   
ref|NP_997818.1|  splicing factor 1                                   90.1    2e-15   Danio rerio [leopard danio]
ref|XP_570209.1|  splicing factor SF1                                 90.1    3e-15   Cryptococcus neoformans var. neoformans JEC21
gb|EKV07295.1|  Branchpoint-bridging protein                          90.1    3e-15   
ref|NP_001011340.1|  splicing factor 1                                89.7    3e-15   Xenopus tropicalis [western clawed frog]
gb|AFR94987.1|  branchpoint-bridging protein                          89.7    3e-15   
ref|XP_002561926.1|  Pc18g00800                                       89.7    3e-15   Penicillium rubens Wisconsin 54-1255
gb|KGB74893.1|  splicing factor SF1                                   89.7    3e-15   
ref|XP_010886232.1|  PREDICTED: splicing factor 1                     89.7    3e-15   
ref|XP_002796190.1|  branchpoint-bridging protein                     86.3    3e-15   Paracoccidioides lutzii Pb01
gb|EMS24331.1|  splicing factor 1 SF1                                 89.7    3e-15   
ref|XP_011125723.1|  hypothetical protein AOL_s00169g64               89.7    3e-15   
ref|XP_011112405.1|  hypothetical protein H072_6622                   89.7    4e-15   
ref|XP_007286952.1|  zinc knuckle transcription factor splicing f...  87.8    4e-15   
ref|XP_003193642.1|  splicing factor SF1                              89.4    4e-15   
gb|EFA83129.1|  hypothetical protein PPL_03919                        89.0    4e-15   Polysphondylium pallidum PN500
gb|KGO64052.1|  K Homology domain, type 1                             89.4    4e-15   
gb|EFX80726.1|  hypothetical protein DAPPUDRAFT_303941                88.2    4e-15   
emb|CDM33928.1|  Branchpoint-bridging protein                         89.4    4e-15   
tpe|CBF76509.1|  TPA: zinc knuckle transcription factor/splicing ...  89.4    5e-15   
gb|KFY30798.1|  hypothetical protein V493_01663                       89.4    5e-15   
ref|XP_003016147.1|  hypothetical protein ARB_05544                   86.3    5e-15   
ref|XP_003661986.1|  hypothetical protein MYCTH_2314770               85.9    6e-15   
emb|CCJ30428.1|  unnamed protein product                              89.0    6e-15   
gb|EPB83741.1|  hypothetical protein HMPREF1544_09482                 88.6    6e-15   
dbj|GAD96713.1|  zinc knuckle transcription factor/splicing facto...  88.6    7e-15   
gb|ELQ38565.1|  branchpoint-bridging protein                          89.0    8e-15   
dbj|GAM39257.1|  zinc finger protein                                  88.6    8e-15   
gb|EPS30080.1|  hypothetical protein PDE_05030                        88.6    8e-15   
ref|XP_003709462.1|  branchpoint-bridging protein                     88.6    8e-15   
gb|KHN97274.1|  Zinc knuckle domain containing protein                88.6    8e-15   
emb|CDQ77395.1|  unnamed protein product                              89.0    8e-15   
gb|EYE94603.1|  hypothetical protein EURHEDRAFT_80013                 88.6    8e-15   
ref|XP_007583360.1|  putative branchpoint-bridging protein            87.8    9e-15   
ref|XP_008179372.1|  PREDICTED: splicing factor 1                     88.2    9e-15   
gb|KFY33042.1|  hypothetical protein V495_08485                       88.2    9e-15   
dbj|GAA82104.1|  zinc knuckle transcription factor/splicing facto...  88.2    9e-15   
ref|XP_006642895.1|  PREDICTED: splicing factor 1-like                88.6    9e-15   
ref|XP_002509405.1|  predicted protein                                89.0    9e-15   Micromonas commoda
gb|KFY09295.1|  hypothetical protein V491_08267                       87.8    1e-14   
ref|XP_001271088.1|  zinc knuckle transcription factor/splicing f...  88.2    1e-14   Aspergillus clavatus NRRL 1
ref|XP_007592088.1|  zinc knuckle                                     88.2    1e-14   
ref|XP_002480389.1|  zinc knuckle transcription factor/splicing f...  88.2    1e-14   Talaromyces stipitatus ATCC 10500
ref|XP_007811916.1|  Zinc knuckle domain containing protein           88.2    1e-14   
ref|XP_003000220.1|  branchpoint-bridging protein                     88.2    1e-14   
gb|KEY82589.1|  transcription factor zinc knuckle MSL5/ZFM1           88.2    1e-14   
ref|XP_001399793.1|  branchpoint-bridging protein                     88.2    1e-14   Aspergillus niger CBS 513.88
ref|XP_001263374.1|  zinc knuckle transcription factor/splicing f...  88.2    1e-14   Aspergillus fischeri NRRL 181
ref|XP_002144012.1|  zinc knuckle transcription factor/splicing f...  88.2    1e-14   Talaromyces marneffei ATCC 18224
gb|ENH80879.1|  branchpoint-bridging protein                          88.2    1e-14   
ref|XP_009652551.1|  branchpoint-bridging protein                     88.2    1e-14   
gb|ELR06706.1|  hypothetical protein GMDG_00323                       88.2    1e-14   
emb|CCF44509.1|  zinc knuckle                                         88.2    1e-14   
gb|EEH08472.1|  branchpoint-bridging protein                          88.2    1e-14   Histoplasma capsulatum G186AR
ref|XP_754535.1|  zinc knuckle transcription factor/splicing fact...  88.2    1e-14   Aspergillus fumigatus Af293
gb|KFY51470.1|  hypothetical protein V497_09111                       88.2    1e-14   
gb|KFX86791.1|  hypothetical protein V490_08846                       88.2    1e-14   
gb|KFY81872.1|  hypothetical protein V500_11017                       88.2    1e-14   
ref|XP_002374691.1|  zinc knuckle splicing factor Zfm1                87.8    1e-14   Aspergillus flavus NRRL3357
gb|KID75768.1|  Zinc knuckle domain containing protein                87.8    1e-14   
gb|KFZ15578.1|  hypothetical protein V502_05533                       88.2    1e-14   
gb|EGD94942.1|  zinc knuckle transcription factor/splicing factor...  87.8    1e-14   
gb|EQB56438.1|  zinc knuckle                                          87.8    1e-14   
gb|KFY60323.1|  hypothetical protein V496_05365                       87.8    1e-14   
gb|KFY73533.1|  hypothetical protein V499_06394                       87.8    1e-14   
gb|KFY08302.1|  hypothetical protein V492_06347                       87.8    1e-14   
ref|XP_003177063.1|  branchpoint-bridging protein                     87.8    1e-14   
ref|XP_003728254.1|  PREDICTED: uncharacterized protein LOC754661...  88.2    1e-14   
ref|XP_001186560.2|  PREDICTED: uncharacterized protein LOC754661...  88.2    1e-14   Strongylocentrotus purpuratus [purple urchin]
ref|XP_003852129.1|  hypothetical protein MYCGRDRAFT_71918            87.4    2e-14   
gb|EZF32451.1|  branchpoint-bridging protein                          87.8    2e-14   
gb|KFX50717.1|  Branchpoint-bridging protein                          88.2    2e-14   
gb|KFY39287.1|  hypothetical protein V494_04039                       87.8    2e-14   
ref|XP_006674210.1|  peptidase family M28 family                      88.6    2e-14   
gb|KID91681.1|  Zinc knuckle domain containing protein                87.4    2e-14   
ref|XP_007820715.1|  Zinc knuckle domain containing protein           87.4    2e-14   
gb|KFG78945.1|  Zinc knuckle domain containing protein                87.4    2e-14   
gb|EEH39889.2|  branchpoint-bridging protein                          87.8    2e-14   Paracoccidioides lutzii Pb01
ref|XP_003238380.1|  zinc knuckle transcription factor/splicing f...  87.4    2e-14   
ref|XP_009170462.1|  hypothetical protein T265_06824                  87.4    2e-14   
ref|XP_010756504.1|  branchpoint-bridging protein                     87.4    2e-14   
gb|EFQ26078.1|  zinc knuckle                                          87.4    2e-14   
gb|EER42445.1|  branchpoint-bridging protein                          87.4    2e-14   Histoplasma capsulatum H143
pdb|2M0G|A  Chain A, Structure, Phosphorylation And U2af65 Bindin...  82.4    2e-14   
gb|EKG17291.1|  Zinc finger CCHC-type protein                         87.4    2e-14   
gb|KDN69795.1|  putative zinc knuckle                                 87.4    2e-14   
ref|XP_007920793.1|  hypothetical protein MYCFIDRAFT_97070            87.0    2e-14   
gb|KDB13964.1|  Zinc knuckle domain containing protein                87.4    2e-14   
ref|NP_524654.2|  splicing factor 1, isoform A                        87.8    2e-14   Drosophila melanogaster
ref|XP_001544877.1|  hypothetical protein HCAG_01924                  87.0    2e-14   Histoplasma capsulatum NAm1
gb|EMF16645.1|  hypothetical protein SEPMUDRAFT_152816                87.0    2e-14   
gb|EXM33352.1|  branchpoint-bridging protein                          87.0    2e-14   
gb|EGU85930.1|  hypothetical protein FOXB_03597                       87.0    3e-14   
gb|EWZ00481.1|  branchpoint-bridging protein                          86.7    3e-14   
emb|CAB64937.1|  SF1 protein                                          87.4    3e-14   Drosophila melanogaster
gb|ENH65357.1|  Branchpoint-bridging protein                          86.7    3e-14   
emb|CCT72179.1|  related to branch point bridging protein (MSL5)      86.7    3e-14   
gb|EXK43815.1|  branchpoint-bridging protein                          86.7    3e-14   
gb|KIH88470.1|  splicing factor 1                                     87.0    3e-14   
gb|ELU40740.1|  splicing factor SF1                                   87.4    3e-14   
gb|EWG47432.1|  branchpoint-bridging protein                          86.7    3e-14   
emb|CCO28600.1|  Branchpoint-bridging protein                         86.3    3e-14   
ref|XP_002626957.1|  branchpoint-bridging protein                     86.7    3e-14   Blastomyces gilchristii SLH14081
gb|KEQ73680.1|  hypothetical protein M436DRAFT_9822                   86.7    3e-14   
ref|XP_007288066.1|  branchpoint-bridging protein                     86.7    3e-14   
emb|CCU80215.1|  Zinc knuckle domain containing protein               86.7    3e-14   
gb|KDE03660.1|  hypothetical protein MVLG_05850                       86.7    3e-14   
ref|XP_007518639.1|  PREDICTED: splicing factor 1 isoform X1          86.7    3e-14   
gb|AAR88778.1|  splicing factor I                                     81.3    4e-14   Musa acuminata [banana]
gb|EPQ67366.1|  Component of the commitment complex                   86.7    4e-14   
gb|EPY78881.1|  hypothetical protein CB1_000996012                    82.0    4e-14   
gb|ERT02177.1|  branchpoint-bridging protein                          86.7    4e-14   
emb|CEF63043.1|  Splicing factor 1                                    85.9    4e-14   
gb|KEQ63982.1|  hypothetical protein M437DRAFT_65273                  86.3    4e-14   
gb|KEQ94558.1|  hypothetical protein AUEXF2481DRAFT_30521             86.3    4e-14   
ref|XP_003082157.1|  RNA-binding protein ELAV/HU (RRM superfamily...  86.7    4e-14   
emb|CEF99753.1|  Nucleotide-binding, alpha-beta plait                 86.7    5e-14   
emb|CAA03883.1|  splicing factor SF1                                  83.6    5e-14   Homo sapiens [man]
ref|XP_004264362.1|  PREDICTED: splicing factor 1 isoform 2           86.3    5e-14   
ref|XP_010836308.1|  PREDICTED: splicing factor 1 isoform X1          86.3    5e-14   
ref|XP_001868293.1|  zinc finger protein                              86.3    5e-14   Culex quinquefasciatus
ref|XP_008157302.1|  PREDICTED: splicing factor 1 isoform X1          86.3    5e-14   
ref|XP_005063993.1|  PREDICTED: splicing factor 1 isoform X1          86.3    5e-14   
ref|XP_004383818.1|  PREDICTED: splicing factor 1 isoform 1           86.3    5e-14   
ref|XP_007518642.1|  PREDICTED: splicing factor 1 isoform X4          85.9    5e-14   
ref|XP_004656690.1|  PREDICTED: splicing factor 1 isoform X1          86.3    5e-14   
ref|XP_005384614.1|  PREDICTED: splicing factor 1 isoform X1          86.3    5e-14   
ref|XP_005660786.1|  PREDICTED: splicing factor 1 isoform X4          86.3    5e-14   
ref|XP_004823279.1|  PREDICTED: splicing factor 1 isoform X1          86.3    5e-14   
ref|XP_004596762.1|  PREDICTED: splicing factor 1 isoform X1          86.3    5e-14   
ref|NP_004621.2|  splicing factor 1 isoform 1                         86.3    5e-14   Homo sapiens [man]
ref|XP_004618447.1|  PREDICTED: splicing factor 1 isoform X1          86.3    5e-14   
ref|XP_006861022.1|  PREDICTED: splicing factor 1 isoform X1          86.3    5e-14   
ref|XP_006901533.1|  PREDICTED: splicing factor 1 isoform X1          86.3    5e-14   
gb|EAW74292.1|  splicing factor 1, isoform CRA_g                      85.9    5e-14   
gb|AAH09091.1|  Sf1 protein                                           86.3    5e-14   Mus musculus [mouse]
dbj|BAE26935.1|  unnamed protein product                              86.3    5e-14   Mus musculus [mouse]
ref|XP_007518640.1|  PREDICTED: splicing factor 1 isoform X2          86.3    5e-14   
gb|EYB25943.1|  hypothetical protein FG05_02080                       85.9    6e-14   
ref|NP_001104261.1|  splicing factor 1 isoform 1                      85.9    6e-14   Mus musculus [mouse]
gb|AAB04033.1|  transcription factor ZFM1                             85.9    6e-14   Homo sapiens [man]
ref|XP_003649555.1|  hypothetical protein THITE_2108151               85.9    6e-14   
gb|KEF54997.1|  branchpoint-bridging protein                          85.9    6e-14   
ref|XP_005351860.1|  PREDICTED: splicing factor 1 isoform X1          85.9    6e-14   
ref|XP_001357885.2|  GA19167                                          86.3    6e-14   
ref|XP_006980761.1|  PREDICTED: splicing factor 1 isoform X2          85.9    6e-14   
gb|KHJ34772.1|  putative branchpoint-bridging protein                 85.9    6e-14   
ref|XP_762533.1|  hypothetical protein UM06386.1                      85.9    6e-14   
ref|XP_001591750.1|  hypothetical protein SS1G_07196                  85.9    6e-14   
ref|XP_005384616.1|  PREDICTED: splicing factor 1 isoform X3          85.9    6e-14   
ref|XP_005577427.1|  PREDICTED: splicing factor 1 isoform X3          85.9    6e-14   
ref|XP_008837130.1|  PREDICTED: splicing factor 1 isoform X3          85.9    6e-14   
gb|KEQ80593.1|  hypothetical protein M438DRAFT_377457                 85.9    6e-14   
ref|XP_009256562.1|  hypothetical protein FPSE_05169                  85.9    6e-14   
ref|XP_005351862.1|  PREDICTED: splicing factor 1 isoform X3          85.9    6e-14   
ref|XP_006230704.1|  PREDICTED: splicing factor 1 isoform X2          85.9    7e-14   
gb|EDM12600.1|  zinc finger protein 162                               85.9    7e-14   
ref|XP_008837129.1|  PREDICTED: splicing factor 1 isoform X2          85.9    7e-14   
ref|XP_005351863.1|  PREDICTED: splicing factor 1 isoform X4          85.9    7e-14   
ref|XP_008157305.1|  PREDICTED: splicing factor 1 isoform X4          85.5    7e-14   
ref|XP_007942992.1|  PREDICTED: splicing factor 1 isoform X1          85.9    7e-14   
dbj|BAA05116.1|  ZFM1 protein alternatively spliced product           85.5    7e-14   
ref|XP_004264364.1|  PREDICTED: splicing factor 1 isoform 4           85.5    7e-14   
ref|XP_004618448.1|  PREDICTED: splicing factor 1 isoform X2          85.9    7e-14   
gb|AAX29226.1|  splicing factor 1                                     85.5    7e-14   
ref|XP_007991675.1|  PREDICTED: splicing factor 1 isoform X7          85.9    7e-14   
dbj|BAE34225.1|  unnamed protein product                              85.5    7e-14   
pir||S52735  CW17R protein - mouse                                    85.5    7e-14
gb|EDL33242.1|  splicing factor 1, isoform CRA_b                      85.9    7e-14   
ref|XP_007873097.1|  hypothetical protein PNEG_01182                  85.5    7e-14   
dbj|BAE01434.1|  unnamed protein product                              84.7    7e-14   
ref|XP_007991659.1|  PREDICTED: splicing factor 1 isoform X5          85.5    7e-14   
gb|ACA64876.1|  splicing factor 1 isoform 2 (predicted)               85.9    7e-14   
gb|EUC54652.1|  branchpoint-bridging protein                          85.1    7e-14   
ref|XP_009183984.1|  PREDICTED: splicing factor 1 isoform X5          85.5    7e-14   
ref|XP_004383820.1|  PREDICTED: splicing factor 1 isoform 3           85.5    7e-14   
ref|XP_009244450.1|  PREDICTED: splicing factor 1 isoform X4          85.5    7e-14   
ref|XP_005577428.1|  PREDICTED: splicing factor 1 isoform X4          85.5    7e-14   
ref|XP_004852520.1|  PREDICTED: splicing factor 1 isoform X2          85.9    7e-14   
ref|XP_010836311.1|  PREDICTED: splicing factor 1 isoform X4          85.5    7e-14   
ref|XP_008157303.1|  PREDICTED: splicing factor 1 isoform X2          85.9    7e-14   
ref|NP_035880.2|  splicing factor 1 isoform 2                         85.5    7e-14   
dbj|GAA97667.1|  hypothetical protein E5Q_04345                       85.1    7e-14   
ref|XP_009183983.1|  PREDICTED: splicing factor 1 isoform X4          85.5    7e-14   
ref|XP_006056587.1|  PREDICTED: splicing factor 1 isoform X2          85.9    7e-14   
ref|NP_973724.1|  splicing factor 1 isoform 2                         85.9    7e-14   
ref|XP_008837132.1|  PREDICTED: splicing factor 1 isoform X5          85.5    7e-14   
ref|XP_005631572.1|  PREDICTED: splicing factor 1 isoform X13         85.5    7e-14   
ref|XP_004823282.1|  PREDICTED: splicing factor 1 isoform X4          85.5    7e-14   
ref|XP_003353830.1|  PREDICTED: splicing factor 1 isoformX2           85.5    7e-14   
ref|XP_004618450.1|  PREDICTED: splicing factor 1 isoform X4          85.5    7e-14   
ref|XP_006718747.1|  PREDICTED: splicing factor 1 isoform X4          85.5    7e-14   
ref|XP_008837133.1|  PREDICTED: splicing factor 1 isoform X6          85.5    7e-14   
ref|NP_973727.1|  splicing factor 1 isoform 3                         85.5    8e-14   
gb|EFB26239.1|  hypothetical protein PANDA_004836                     84.7    8e-14   
ref|XP_006531797.1|  PREDICTED: splicing factor 1 isoform X2          85.5    8e-14   
ref|XP_006230705.1|  PREDICTED: splicing factor 1 isoform X3          85.5    8e-14   
ref|XP_006980763.1|  PREDICTED: splicing factor 1 isoform X4          85.5    8e-14   
ref|XP_006531798.1|  PREDICTED: splicing factor 1 isoform X3          85.5    8e-14   
ref|XP_006230706.1|  PREDICTED: splicing factor 1 isoform X4          85.5    8e-14   
ref|XP_006901534.1|  PREDICTED: splicing factor 1 isoform X2          85.5    8e-14   
ref|XP_004596763.1|  PREDICTED: splicing factor 1 isoform X2          85.5    8e-14   
gb|ETO10094.1|  hypothetical protein RFI_27285                        85.5    8e-14   
gb|KEI39764.1|  hypothetical protein L969DRAFT_40612                  85.1    8e-14   
ref|XP_004656691.1|  PREDICTED: splicing factor 1 isoform X2          85.5    8e-14   
ref|XP_007942995.1|  PREDICTED: splicing factor 1 isoform X4          85.5    8e-14   
ref|XP_004656693.1|  PREDICTED: splicing factor 1 isoform X4          85.5    8e-14   
ref|XP_004823280.1|  PREDICTED: splicing factor 1 isoform X2          85.5    8e-14   
ref|XP_003353831.1|  PREDICTED: splicing factor 1 isoformX3           85.5    8e-14   
ref|XP_007991622.1|  PREDICTED: splicing factor 1 isoform X1          85.9    8e-14   
ref|NP_001171501.1|  splicing factor 1 isoform 6                      85.9    8e-14   
ref|XP_009006683.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...  85.9    8e-14   
ref|XP_006861025.1|  PREDICTED: splicing factor 1 isoform X4          85.5    8e-14   
ref|XP_005063996.1|  PREDICTED: splicing factor 1 isoform X4          85.5    8e-14   
ref|XP_005631571.1|  PREDICTED: splicing factor 1 isoform X12         85.5    8e-14   
ref|XP_009183988.1|  PREDICTED: splicing factor 1 isoform X9          85.5    8e-14   
ref|NP_001164798.1|  splicing factor 1                                85.5    8e-14   
ref|XP_005351865.1|  PREDICTED: splicing factor 1 isoform X6          85.5    8e-14   
ref|XP_006697113.1|  hypothetical protein CTHT_0068240                85.5    8e-14   
ref|XP_004264363.1|  PREDICTED: splicing factor 1 isoform 3           85.5    8e-14   
ref|XP_006901536.1|  PREDICTED: splicing factor 1 isoform X4          85.5    8e-14   
ref|XP_004596765.1|  PREDICTED: splicing factor 1 isoform X4          85.5    8e-14   
ref|XP_003798670.1|  PREDICTED: splicing factor 1 isoform 2           85.5    8e-14   
ref|XP_004478608.1|  PREDICTED: splicing factor 1 isoform 3           85.5    8e-14   
dbj|BAA05117.1|  ZFM1 protein                                         85.5    8e-14   
gb|ACC64575.1|  splicing factor 1 isoform 2 (predicted)               85.5    8e-14   
ref|XP_006980766.1|  PREDICTED: splicing factor 1 isoform X7          85.5    8e-14   
gb|ACQ62991.1|  splicing factor 1 isoform 2 (predicted)               85.5    8e-14   
gb|EHH22723.1|  hypothetical protein EGK_06045                        85.1    8e-14   
gb|KEZ46657.1|  hypothetical protein SAPIO_CDS0489                    85.5    8e-14   
ref|XP_005660787.1|  PREDICTED: splicing factor 1 isoform X5          85.5    8e-14   
gb|EDL33243.1|  splicing factor 1, isoform CRA_c                      85.5    8e-14   
ref|XP_007778716.1|  hypothetical protein W97_02626                   85.5    8e-14   
ref|XP_006718745.1|  PREDICTED: splicing factor 1 isoform X2          85.5    8e-14   
ref|XP_006980762.1|  PREDICTED: splicing factor 1 isoform X3          85.5    8e-14   
ref|XP_005660788.1|  PREDICTED: splicing factor 1 isoform X6          85.5    8e-14   
ref|XP_008078087.1|  Eukaryotic type KH-domain (KH-domain type I)     84.3    8e-14   
ref|XP_005063994.1|  PREDICTED: splicing factor 1 isoform X2          85.5    8e-14   
ref|XP_003777765.1|  PREDICTED: splicing factor 1 isoform X1          85.5    8e-14   
ref|XP_003274213.1|  PREDICTED: splicing factor 1 isoform 1           85.5    8e-14   
gb|EPQ03996.1|  Splicing factor 1                                     84.3    8e-14   
ref|XP_001166494.2|  PREDICTED: splicing factor 1 isoform X6          85.5    8e-14   
ref|XP_004478606.1|  PREDICTED: splicing factor 1 isoform 1           85.5    8e-14   
ref|XP_004383819.1|  PREDICTED: splicing factor 1 isoform 2           85.5    8e-14   
ref|XP_006861023.1|  PREDICTED: splicing factor 1 isoform X2          85.5    8e-14   
emb|CAA73359.1|  CW17                                                 85.5    8e-14   
ref|XP_004051516.1|  PREDICTED: splicing factor 1 isoform 3           85.5    8e-14   
ref|XP_005351861.1|  PREDICTED: splicing factor 1 isoform X2          85.5    9e-14   
ref|XP_005227222.1|  PREDICTED: splicing factor 1 isoform X1          85.5    9e-14   
gb|EFN61440.1|  Splicing factor 1                                     85.1    9e-14   
ref|XP_002808110.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...  85.5    9e-14   
ref|XP_008558068.1|  PREDICTED: splicing factor 1-like                85.5    9e-14   
ref|XP_006718744.1|  PREDICTED: splicing factor 1 isoform X1          85.5    9e-14   
ref|XP_005533276.1|  PREDICTED: splicing factor 1                     85.1    9e-14   
ref|XP_005351864.1|  PREDICTED: splicing factor 1 isoform X5          85.1    9e-14   
ref|XP_004359662.1|  hypothetical protein DFA_01698                   84.7    9e-14   
ref|XP_005063995.1|  PREDICTED: splicing factor 1 isoform X3          85.1    9e-14   
ref|XP_005384618.1|  PREDICTED: splicing factor 1 isoform X5          85.1    9e-14   
ref|XP_008758288.1|  PREDICTED: splicing factor 1 isoform X9          85.5    9e-14   
sp|Q64213.6|SF01_MOUSE  RecName: Full=Splicing factor 1; AltName:...  85.5    9e-14   
ref|XP_866899.2|  PREDICTED: splicing factor 1 isoformX8              85.5    9e-14   
gb|EDL33241.1|  splicing factor 1, isoform CRA_a                      85.1    9e-14   
ref|XP_004087882.1|  PREDICTED: splicing factor 1 isoform 2           85.5    9e-14   
ref|XP_007518641.1|  PREDICTED: splicing factor 1 isoform X3          85.1    9e-14   
pdb|4FXX|A  Chain A, Structure Of Sf1 Coiled-coil Domain              79.7    9e-14   
ref|XP_007942993.1|  PREDICTED: splicing factor 1 isoform X2          85.5    1e-13   
ref|XP_006531803.1|  PREDICTED: splicing factor 1 isoform X8          85.5    1e-13   
gb|AAH55370.1|  Splicing factor 1                                     85.1    1e-13   
ref|XP_005384617.1|  PREDICTED: splicing factor 1 isoform X4          85.1    1e-13   
ref|XP_004264361.1|  PREDICTED: splicing factor 1 isoform 1           85.5    1e-13   
emb|CCD34265.1|  hypothetical protein BofuT4P201000002001             85.1    1e-13   
gb|EFN87831.1|  Splicing factor 1                                     85.1    1e-13   
ref|XP_003704131.1|  PREDICTED: splicing factor 1-like                85.1    1e-13   
ref|XP_007506719.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...  85.1    1e-13   
gb|EHK49521.1|  hypothetical protein TRIATDRAFT_234969                85.1    1e-13   
ref|XP_007837673.1|  Branchpoint-bridging protein                     85.1    1e-13   
ref|XP_004394119.1|  PREDICTED: splicing factor 1                     85.1    1e-13   
ref|XP_003122635.2|  PREDICTED: splicing factor 1 isoformX1           85.5    1e-13   
ref|XP_007991669.1|  PREDICTED: splicing factor 1 isoform X6          85.1    1e-13   
ref|XP_010836309.1|  PREDICTED: splicing factor 1 isoform X2          85.1    1e-13   
gb|ESZ95118.1|  branchpoint-bridging protein                          85.1    1e-13   
gb|EMR84599.1|  putative branchpoint-bridging protein                 85.1    1e-13   
gb|AAB03514.1|  transcription factor ZFM1                             85.1    1e-13   
gb|EHK19514.1|  hypothetical protein TRIVIDRAFT_209878                85.5    1e-13   
ref|XP_006033264.1|  PREDICTED: splicing factor 1                     84.7    1e-13   
ref|XP_001554255.1|  hypothetical protein BC1G_07392                  85.1    1e-13   
ref|XP_005577429.1|  PREDICTED: splicing factor 1 isoform X5          85.1    1e-13   
pdb|2M09|A  Chain A, Structure, Phosphorylation And U2af65 Bindin...  79.7    1e-13   
emb|CDP25361.1|  Putative branchpoint-bridging protein                85.1    1e-13   
ref|XP_009183985.1|  PREDICTED: splicing factor 1 isoform X6          85.1    1e-13   
ref|XP_006056588.1|  PREDICTED: splicing factor 1 isoform X3          85.1    1e-13   
ref|XP_005631573.1|  PREDICTED: splicing factor 1 isoform X14         85.1    1e-13   
ref|XP_009244451.1|  PREDICTED: splicing factor 1 isoform X5          85.1    1e-13   
dbj|GAC97398.1|  zinc knuckle transcription factor                    85.5    1e-13   
ref|XP_008495968.1|  PREDICTED: splicing factor 1                     82.4    1e-13   
ref|XP_005660789.1|  PREDICTED: splicing factor 1 isoform X7          85.1    1e-13   
ref|XP_004852521.1|  PREDICTED: splicing factor 1 isoform X3          85.1    1e-13   
ref|XP_008203584.1|  PREDICTED: splicing factor 1-like                85.1    1e-13   
ref|XP_006901535.1|  PREDICTED: splicing factor 1 isoform X3          85.1    1e-13   
ref|XP_006718746.1|  PREDICTED: splicing factor 1 isoform X3          85.1    1e-13   
ref|XP_008157304.1|  PREDICTED: splicing factor 1 isoform X3          84.7    1e-13   
ref|XP_006861024.1|  PREDICTED: splicing factor 1 isoform X3          84.7    1e-13   
ref|XP_006276085.1|  PREDICTED: splicing factor 1                     85.1    1e-13   
ref|NP_973726.2|  splicing factor 1 isoform 4                         84.7    1e-13   
gb|KFO28438.1|  Splicing factor 1                                     85.1    1e-13   
ref|XP_003493829.1|  PREDICTED: splicing factor 1-like                85.1    1e-13   
ref|XP_001648609.1|  zinc finger protein                              85.1    1e-13   
ref|XP_008837131.1|  PREDICTED: splicing factor 1 isoform X4          84.7    1e-13   
ref|XP_007991682.1|  PREDICTED: splicing factor 1 isoform X8          84.7    1e-13   
ref|XP_010819440.1|  PREDICTED: splicing factor 1 isoform X4          85.1    1e-13   
ref|XP_006230710.1|  PREDICTED: splicing factor 1 isoform X8          84.7    1e-13   
ref|XP_006531801.1|  PREDICTED: splicing factor 1 isoform X6          84.7    1e-13   
ref|XP_005227227.1|  PREDICTED: splicing factor 1 isoform X3          85.1    1e-13   
ref|XP_010836310.1|  PREDICTED: splicing factor 1 isoform X3          84.7    1e-13   
ref|XP_004019706.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...  84.7    1e-13   
ref|XP_394596.2|  PREDICTED: splicing factor 1-like isoform X2        85.1    1e-13   
ref|XP_003399571.1|  PREDICTED: splicing factor 1-like                85.1    1e-13   
ref|XP_002850717.1|  branchpoint-bridging protein                     84.7    1e-13   
ref|XP_006230709.1|  PREDICTED: splicing factor 1 isoform X7          84.7    1e-13   
ref|XP_005227228.1|  PREDICTED: splicing factor 1 isoform X5          84.7    1e-13   
emb|CCE34094.1|  related to branch point bridging protein (MSL5)      84.7    1e-13   
ref|XP_009557781.1|  PREDICTED: splicing factor 1                     83.6    1e-13   
ref|XP_005660790.1|  PREDICTED: splicing factor 1 isoform X8          84.7    1e-13   
ref|XP_006056589.1|  PREDICTED: splicing factor 1 isoform X4          84.7    1e-13   
ref|XP_006531800.1|  PREDICTED: splicing factor 1 isoform X5          84.7    1e-13   
ref|XP_010955397.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...  84.7    1e-13   
ref|XP_006980764.1|  PREDICTED: splicing factor 1 isoform X5          84.7    1e-13   
ref|XP_005577430.1|  PREDICTED: splicing factor 1 isoform X6          84.7    1e-13   
ref|XP_004656692.1|  PREDICTED: splicing factor 1 isoform X3          84.7    1e-13   
ref|XP_007942994.1|  PREDICTED: splicing factor 1 isoform X3          84.7    1e-13   
ref|XP_004596764.1|  PREDICTED: splicing factor 1 isoform X3          84.7    1e-13   
ref|XP_006718748.1|  PREDICTED: splicing factor 1 isoform X5          84.7    1e-13   
gb|KGQ03389.1|  Branchpoint-bridging protein                          84.7    1e-13   
ref|XP_004478607.1|  PREDICTED: splicing factor 1 isoform 2           84.7    1e-13   
ref|XP_004823281.1|  PREDICTED: splicing factor 1 isoform X3          84.7    1e-13   
ref|XP_005631574.1|  PREDICTED: splicing factor 1 isoform X15         84.7    1e-13   
ref|XP_008603189.1|  branchpoint-bridging protein                     84.7    1e-13   
ref|XP_003774180.1|  PREDICTED: splicing factor 1                     84.7    1e-13   
ref|XP_005384619.1|  PREDICTED: splicing factor 1 isoform X6          84.7    1e-13   
ref|XP_004618449.1|  PREDICTED: splicing factor 1 isoform X3          84.7    1e-13   
gb|EJT48767.1|  splicing factor SF1                                   84.3    1e-13   
gb|KDR15002.1|  Splicing factor 1                                     84.7    1e-13   
gb|KDN45670.1|  hypothetical protein RSAG8_04754                      84.3    2e-13   
ref|XP_007915704.1|  putative branchpoint-bridging protein            84.3    2e-13   
ref|XP_005864264.1|  PREDICTED: splicing factor 1 isoform X1          84.3    2e-13   
ref|XP_003300752.1|  hypothetical protein PTT_12092                   84.3    2e-13   
ref|XP_003835123.1|  hypothetical protein LEMA_P072660.1              84.3    2e-13   
ref|XP_006745616.1|  PREDICTED: splicing factor 1                     84.7    2e-13   
ref|XP_007793812.1|  putative branchpoint-bridging protein            84.3    2e-13   
ref|XP_961266.1|  hypothetical protein NCU04110                       84.7    2e-13   
ref|XP_009847730.1|  hypothetical protein NEUTE1DRAFT_75523           84.7    2e-13   
ref|XP_006569562.1|  PREDICTED: splicing factor 1-like isoform X1     84.3    2e-13   
ref|XP_005864265.1|  PREDICTED: splicing factor 1 isoform X2          84.7    2e-13   
gb|EST06991.1|  hypothetical protein PSEUBRA_SCAF23g05214             84.7    2e-13   
ref|XP_005860348.1|  PREDICTED: splicing factor 1-like                84.3    2e-13   
ref|XP_001930355.1|  branchpoint-bridging protein                     84.3    2e-13   
gb|ETE65138.1|  Splicing factor 1                                     83.6    2e-13   
ref|XP_003343817.1|  hypothetical protein SMAC_04476                  84.3    2e-13   
gb|EPQ06499.1|  Splicing factor 1                                     84.7    2e-13   
ref|XP_001244327.1|  hypothetical protein CIMG_03768                  84.0    2e-13   
ref|XP_003068514.1|  Zinc knuckle domain containing protein           84.0    2e-13   
ref|XP_003022525.1|  hypothetical protein TRV_03367                   80.5    2e-13   
gb|EFW20339.1|  zinc knuckle transcription factor/splicing factor...  84.0    2e-13   
ref|XP_007800589.1|  Branchpoint-bridging protein                     84.0    2e-13   
ref|XP_009009993.1|  hypothetical protein HELRODRAFT_71408            82.4    2e-13   
ref|XP_002582739.1|  hypothetical protein UREG_07512                  83.6    2e-13   
gb|ENN72437.1|  hypothetical protein YQE_10928                        83.6    2e-13   



>ref|XP_011101109.1| PREDICTED: branchpoint-bridging protein [Sesamum indicum]
Length=811

 Score =   294 bits (753),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 215/312 (69%), Gaps = 44/312 (14%)
 Frame = -2

Query  2298  MDTLQSNYMDSQSEPGAASETQPQHSSRGLGsydqssfqnysdsssyyqnysdsYPQNPS  2119
             MDTLQSNYMDS S+P + S+ QPQ+S                              Q PS
Sbjct  1     MDTLQSNYMDSPSQPQSESQPQPQYSYD----------------------------QYPS  32

Query  2118  QTLDQSQSHSVAAYPQEQNQP-GKTLDSDRHNTHGSSEQQMDNNSAQNHEQTTPQDGAPK  1942
                 Q+ S+S   YPQ Q++   +TLD     T  SS Q  +N ++   E   P     K
Sbjct  33    Y---QNYSYS---YPQTQSEAQSETLD----KTLDSSGQIPENGASAAGESVPPL----K  78

Query  1941  VELRKPLLSENGLTNTHSGTDKD-QsggeeettsrrrrrsrwdpppsesSNdgtgtggdg  1765
              +  +PLLSENGLTNTHSGTDKD   G EE T+ RRRR     PP   ++N   GTGG G
Sbjct  79    PDFPRPLLSENGLTNTHSGTDKDFSGGEEETTSRRRRRSRWDPPPSESTNNGAAGTGGTG  138

Query  1764  sgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG  1585
              G     GRKRKSRWADDEPKP+IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG
Sbjct  139   DGNSGTGGRKRKSRWADDEPKPVIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG  198

Query  1584  LPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPAD  1405
             + LDDRPEGARSPSPEPIYDNMG+RINTREYRAREKLNRERQEIISQIIKKNPAFKPPAD
Sbjct  199   MLLDDRPEGARSPSPEPIYDNMGVRINTREYRAREKLNRERQEIISQIIKKNPAFKPPAD  258

Query  1404  YRPPKLQKKLYI  1369
             YRPPKLQKKLYI
Sbjct  259   YRPPKLQKKLYI  270


 Score = 51.6 bits (122),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  406   FKSDVLCKICGDGGHPTIDCPVK  428


 Score = 33.1 bits (74),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  392   PGHRQYACPSRTSTF  406


 Score = 23.9 bits (50),  Expect(3) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  332   LHVLVEAETQEALDAAAGMVEKLLQP  357



>ref|XP_009611673.1| PREDICTED: splicing factor 1-like [Nicotiana tomentosiformis]
Length=826

 Score =   288 bits (736),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 204/255 (80%), Gaps = 18/255 (7%)
 Frame = -2

Query  2130  QNPSQTLDQSQSHSVAAYPQEQ-NQPGKTLDSDRHNTHGSSEQQMDNNSAQNHEQTTPQD  1954
             QNPS+TL        ++YPQ+  NQ   + ++  H T    +  +++ S Q  E+   +D
Sbjct  40    QNPSETL-------ASSYPQDSSNQ--NSQENPNHETQ--VQAPVNSGSNQASEEQKLRD  88

Query  1953  GAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtg  1774
                K EL++PLLSENGLTNTHSGTD+DQSGGEEET+SRRRRRSRWDPPP+E    G   G
Sbjct  89    STQKRELQRPLLSENGLTNTHSGTDRDQSGGEEETSSRRRRRSRWDPPPTEDGTGGGDGG  148

Query  1773  gdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKL  1594
                 G      RKRKSRWADDEPKP+IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKL
Sbjct  149   SGTGG------RKRKSRWADDEPKPVIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKL  202

Query  1593  QSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKP  1414
             QSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQI+KKNPAFKP
Sbjct  203   QSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQILKKNPAFKP  262

Query  1413  PADYRPPKLQKKLYI  1369
             PADYRPPKLQKKLYI
Sbjct  263   PADYRPPKLQKKLYI  277


 Score = 52.0 bits (123),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  413   FKSDVLCKICGDGGHPTIDCPVK  435


 Score = 32.0 bits (71),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  399   PGHRQYACPSRTTTF  413



>ref|XP_009802234.1| PREDICTED: branchpoint-bridging protein-like [Nicotiana sylvestris]
Length=821

 Score =   287 bits (734),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 186/257 (72%), Positives = 202/257 (79%), Gaps = 22/257 (9%)
 Frame = -2

Query  2130  QNPSQTLDQSQSHSVAAYPQEQ-NQPGKTLDSDRHNTHGSSEQQMDNNSAQNHEQTTPQD  1954
             QNPSQTL        ++YPQ+  NQ   + ++  H TH     Q  +NS  N      + 
Sbjct  40    QNPSQTL-------ASSYPQDSSNQ--NSQENPNHETH----VQAPDNSGSNQASEEQKL  86

Query  1953  GAP--KVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtg  1780
             G    K EL++PLLSENGLTNTHSGTD+DQSGGEEET+SRRRRRSRWDPPP+E    G  
Sbjct  87    GGSTQKRELQRPLLSENGLTNTHSGTDRDQSGGEEETSSRRRRRSRWDPPPTEDGTGGGD  146

Query  1779  tggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISR  1600
              G    G      RKRKSRWADDEPKP+IQLPDFMKDFTGGIEFDPEIQALNSRLLEISR
Sbjct  147   RGSGTGG------RKRKSRWADDEPKPVIQLPDFMKDFTGGIEFDPEIQALNSRLLEISR  200

Query  1599  KLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAF  1420
             KLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIIS+I+KKNPAF
Sbjct  201   KLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISEILKKNPAF  260

Query  1419  KPPADYRPPKLQKKLYI  1369
             KPPADYRPPKLQKKLYI
Sbjct  261   KPPADYRPPKLQKKLYI  277


 Score = 54.7 bits (130),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  413   FKSDVLCKICGDGGHPTIDCPVK  435


 Score = 32.0 bits (71),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  399   PGHRQYACPSRTTTF  413



>ref|XP_006358238.1| PREDICTED: branchpoint-bridging protein-like [Solanum tuberosum]
Length=768

 Score =   280 bits (717),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 180/246 (73%), Positives = 196/246 (80%), Gaps = 16/246 (7%)
 Frame = -2

Query  2106  QSQSHSVAAYPQEQNQPGKTLDSDRHNTHGSSEQQMDNNSAQNHEQTTPQDGAPKVELRK  1927
             QSQS SV           +TLD +    H       ++   Q  E+    +   K E+++
Sbjct  4     QSQSPSV-----------ETLDHNSSLKHAQLHASDNSGPNQASEEQNLGEFTLKREIQR  52

Query  1926  PLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtgtg  1747
             PLLSENGLTNTHSGTD+DQSGGEEET+SRRRRRSRWDPPP+ES+NDG G G         
Sbjct  53    PLLSENGLTNTHSGTDRDQSGGEEETSSRRRRRSRWDPPPTESTNDGNGGGDGSGTG---  109

Query  1746  tGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDR  1567
               RKRKSRWADDEPKP+IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG+PLDDR
Sbjct  110   --RKRKSRWADDEPKPVIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGMPLDDR  167

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKL  1387
             P+GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKL
Sbjct  168   PDGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKL  227

Query  1386  QKKLYI  1369
             QKKLYI
Sbjct  228   QKKLYI  233


 Score = 51.6 bits (122),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  369   FKSDVLCKICGDGGHPTIDCPVK  391


 Score = 32.0 bits (71),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  355   PGHRQYACPSRTTTF  369



>ref|XP_006358239.1| PREDICTED: branchpoint-bridging protein-like [Solanum tuberosum]
Length=771

 Score =   280 bits (717),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 184/250 (74%), Positives = 200/250 (80%), Gaps = 20/250 (8%)
 Frame = -2

Query  2106  QSQSHSVAAYPQEQNQPGKTLDSDRHNTHGSSEQQM---DNNSA-QNHEQTTPQDGAPKV  1939
             QSQS SV           +TLD +      S + Q+   DN    Q  E+    +   K 
Sbjct  4     QSQSPSV-----------ETLDHNSSQNQASYDAQLHASDNTGPNQASEEQKLGEFTLKR  52

Query  1938  ELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsg  1759
             E+++PLLSENGLTNTHSGTD+DQSGGEEET+SRRRRRSRWDPPP+ES+NDGTG G     
Sbjct  53    EIQRPLLSENGLTNTHSGTDRDQSGGEEETSSRRRRRSRWDPPPTESTNDGTGGGDGSGT  112

Query  1758  tgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLP  1579
                   RKRKSRWADDEPKP+IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG+P
Sbjct  113   G-----RKRKSRWADDEPKPVIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGMP  167

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYR  1399
             LDDRP+GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYR
Sbjct  168   LDDRPDGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYR  227

Query  1398  PPKLQKKLYI  1369
             PPKLQKKLYI
Sbjct  228   PPKLQKKLYI  237


 Score = 51.6 bits (122),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  373   FKSDVLCKICGDGGHPTIDCPVK  395


 Score = 32.0 bits (71),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  359   PGHRQYACPSRTTTF  373



>ref|XP_002283115.1| PREDICTED: branchpoint-bridging protein [Vitis vinifera]
 ref|XP_010644125.1| PREDICTED: branchpoint-bridging protein [Vitis vinifera]
Length=794

 Score =   280 bits (717),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 176/255 (69%), Positives = 192/255 (75%), Gaps = 19/255 (7%)
 Frame = -2

Query  2133  PQNPSQTLDQSQSHSVAAYPQEQNQPGKTLDSDRHNTHGSSEQQMDNNSAQNHEQTTPQD  1954
             P  PSQ+LD S  +           P KTL SD  ++   +    +  S  N+ QT  + 
Sbjct  29    PSPPSQSLDSSFQN-----------PSKTLASDHPDSISPNSDSQNLASFSNNGQTHFE-  76

Query  1953  GAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtg  1774
               PK +L+KPL+SENG+TNT SGTDKD SGGEEETTSRRRRRSRWDPP    +       
Sbjct  77    -GPKFDLQKPLVSENGVTNTQSGTDKDYSGGEEETTSRRRRRSRWDPPSDSGNQTAGEAA  135

Query  1773  gdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKL  1594
                        RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISR L
Sbjct  136   EGTGA------RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRML  189

Query  1593  QSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKP  1414
             QSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARE+LNRERQEIISQI+K+NPAFKP
Sbjct  190   QSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARERLNRERQEIISQILKRNPAFKP  249

Query  1413  PADYRPPKLQKKLYI  1369
             PADYRPPKLQKKLYI
Sbjct  250   PADYRPPKLQKKLYI  264


 Score = 51.6 bits (122),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  400   FKSDVLCKICGDGGHPTIDCPVK  422


 Score = 33.1 bits (74),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  386   PGHRQYACPSRTSTF  400



>ref|XP_006355551.1| PREDICTED: branchpoint-bridging protein-like isoform X1 [Solanum 
tuberosum]
Length=814

 Score =   276 bits (706),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 199/255 (78%), Gaps = 18/255 (7%)
 Frame = -2

Query  2130  QNPSQTLDQSQSHSVAAYPQEQNQPGKTLDSDRHNTHGSSEQQMDNNSAQNHEQTTPQDG  1951
             QNPSQTL Q  +  V    +        L+    N   +S +  DNNSAQN       D 
Sbjct  30    QNPSQTLGQDPAPGVCENAE--------LNGSNSNFRENSAKPGDNNSAQNKLS----DL  77

Query  1950  APKVELRKPLLSENGLTNTHSG-TDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtg  1774
                + L+KPLLS NGLTNTHSG  ++DQSGGEEET+SRRRRRSRWDPPP++SS       
Sbjct  78    NSNLMLQKPLLSGNGLTNTHSGGAERDQSGGEEETSSRRRRRSRWDPPPTDSS-----ND  132

Query  1773  gdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKL  1594
             G G   GTG GRKRKSRWADDEPKP+IQLPDFMKDF GGIEFDPE+QALNSRLLEISRKL
Sbjct  133   GTGGNDGTGAGRKRKSRWADDEPKPVIQLPDFMKDFAGGIEFDPEVQALNSRLLEISRKL  192

Query  1593  QSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKP  1414
             QSG+PLDDRPEGARSPSPEPIYDNMG+RINTREYRAREKLNRERQEIISQIIKKNPAFKP
Sbjct  193   QSGMPLDDRPEGARSPSPEPIYDNMGVRINTREYRAREKLNRERQEIISQIIKKNPAFKP  252

Query  1413  PADYRPPKLQKKLYI  1369
             PADYRPPKL KKLYI
Sbjct  253   PADYRPPKLHKKLYI  267


 Score = 51.6 bits (122),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  403   FKSDVLCKICGDGGHPTIDCPVK  425


 Score = 32.0 bits (71),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  389   PGHRQYACPSRTTTF  403



>ref|XP_010318168.1| PREDICTED: LOW QUALITY PROTEIN: branchpoint-bridging protein 
[Solanum lycopersicum]
Length=756

 Score =   275 bits (703),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 177/192 (92%), Gaps = 5/192 (3%)
 Frame = -2

Query  1944  KVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdg  1765
             K+++++PLLSENGLTNTHSGTD+DQSGGEEET+SRRRRRSRWDPPP+E +NDGTG G   
Sbjct  44    KLKIQRPLLSENGLTNTHSGTDRDQSGGEEETSSRRRRRSRWDPPPTEFTNDGTGGGDGS  103

Query  1764  sgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG  1585
                     RKRKSRWADD PKP+IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG
Sbjct  104   GTG-----RKRKSRWADDGPKPVIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG  158

Query  1584  LPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPAD  1405
             +PLDDRP GARSPSPEPIYDNMGIRINTRE+RAREKLNRERQEIISQIIKKNPAFKPPAD
Sbjct  159   MPLDDRPXGARSPSPEPIYDNMGIRINTREFRAREKLNRERQEIISQIIKKNPAFKPPAD  218

Query  1404  YRPPKLQKKLYI  1369
             YRPPKLQKKLYI
Sbjct  219   YRPPKLQKKLYI  230


 Score = 50.1 bits (118),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +VLC+ICGDGGHPTIDCPVK
Sbjct  366   FKSEVLCKICGDGGHPTIDCPVK  388


 Score = 32.0 bits (71),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  352   PGHRQYACPSRTTTF  366



>ref|XP_009768171.1| PREDICTED: branchpoint-bridging protein-like [Nicotiana sylvestris]
Length=838

 Score =   276 bits (706),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 194/317 (61%), Positives = 211/317 (67%), Gaps = 43/317 (14%)
 Frame = -2

Query  2274  MDSQSEPGAASETQPQHSSRGLGsydqssfqnysdsssyyqnysdsYPQNPSQTLDQSQS  2095
             MDSQS P A SET  Q  S+ L SY+Q    +                QNPSQTLD    
Sbjct  1     MDSQSHPVAPSETLAQDPSQTLNSYEQYPPHSDPYY------------QNPSQTLD----  44

Query  2094  HSVAAYPQE------QNQPGKTLDSDRHN--THGSSEQQM--DNNSAQNHEQTTPQDGAP  1945
                 +YPQ+      +N     + SD  N   + S E Q    +NS Q+        G P
Sbjct  45    ----SYPQDLPPSVRENAQMNKMSSDNQNFLENSSHENQAHAGDNSVQHQLSLEQNQGDP  100

Query  1944  KVE----LRKPLLSENGLTN-THSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtg  1780
                    L+KPLLSENGLTN THSG ++DQSGGEEET+SRRRRR     PP         
Sbjct  101   NSNSDPMLQKPLLSENGLTNNTHSGAERDQSGGEEETSSRRRRRRSRWDPPPTEDGTEND  160

Query  1779  tggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISR  1600
               G G        RKRKSRWADDEPKP+IQLPDFMKDF GGIEFDPE+QALNSRLLEISR
Sbjct  161   GSGTG--------RKRKSRWADDEPKPVIQLPDFMKDFAGGIEFDPEVQALNSRLLEISR  212

Query  1599  KLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAF  1420
             KLQSGLPLDDRPEGARSPSPEPIYDNMG+RINTREYRAREKLNRERQEIISQIIKKNPAF
Sbjct  213   KLQSGLPLDDRPEGARSPSPEPIYDNMGVRINTREYRAREKLNRERQEIISQIIKKNPAF  272

Query  1419  KPPADYRPPKLQKKLYI  1369
             KPPADYRPPKLQKKLYI
Sbjct  273   KPPADYRPPKLQKKLYI  289


 Score = 51.6 bits (122),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  425   FKSDVLCKICGDGGHPTIDCPVK  447


 Score = 32.0 bits (71),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  411   PGHRQYACPSRTTTF  425



>emb|CDP05352.1| unnamed protein product [Coffea canephora]
Length=843

 Score =   274 bits (700),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 180/209 (86%), Gaps = 8/209 (4%)
 Frame = -2

Query  1989  SAQNHEQTTPQDGAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdp-  1813
             + +N E T      PK+E+ +PLLSENGLTNTHSGTDKDQSGGEEETTSRRRRRSRWDP 
Sbjct  104   TGENSEST------PKLEVLRPLLSENGLTNTHSGTDKDQSGGEEETTSRRRRRSRWDPP  157

Query  1812  -ppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEI  1636
                + S   G GTGG         GRKRKSRWADD+P+P+IQLPDFMK+ TGGIEFDPEI
Sbjct  158   PSEASSDGSGAGTGGGDGTGTGTGGRKRKSRWADDQPQPVIQLPDFMKELTGGIEFDPEI  217

Query  1635  QALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQE  1456
             QALNSRL+EI+RKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQE
Sbjct  218   QALNSRLIEITRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQE  277

Query  1455  IISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             IISQI+KKNPAFKPPADYRPPKLQKKLYI
Sbjct  278   IISQILKKNPAFKPPADYRPPKLQKKLYI  306


 Score = 54.3 bits (129),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  442   FKSDVLCKICGDGGHPTIDCPVK  464


 Score = 31.6 bits (70),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPS+TSTF
Sbjct  428   PGHRQYACPSKTSTF  442


 Score = 23.9 bits (50),  Expect(3) = 5e-09, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  368   LHVLVEAETQESLDAAAAMVEKLLQP  393



>ref|XP_009607008.1| PREDICTED: branchpoint-bridging protein-like [Nicotiana tomentosiformis]
Length=838

 Score =   273 bits (698),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 193/318 (61%), Positives = 212/318 (67%), Gaps = 45/318 (14%)
 Frame = -2

Query  2274  MDSQSEPGAASETQPQHSSRGLGsydqssfqnysdsssyyqnysdsYPQNPSQTLDQSQS  2095
             MDSQS P A SE   Q  S+ L SY+Q    +                QNPSQTLD    
Sbjct  1     MDSQSHPVAPSEALAQDPSQNLNSYEQYPPHSDPYY------------QNPSQTLD----  44

Query  2094  HSVAAYPQE------QNQPGKTLDSDRHN--THGSSEQQM--DNNSAQNH-----EQTTP  1960
                 +YPQ+      +N     + SD  N   + S E Q    +NS Q+       Q  P
Sbjct  45    ----SYPQDPPPSVRENAQMNKMSSDNQNFLENSSHENQAHAGDNSVQHQLSLEQNQVDP  100

Query  1959  QDGAPKVELRKPLLSENGLTN-THSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgt  1783
                +  + L+KPLLSENGLTN THSG ++DQSGGEEET+SRRRRR     PP        
Sbjct  101   NSNSDPM-LQKPLLSENGLTNNTHSGAERDQSGGEEETSSRRRRRRSRWDPPPTEDGTEN  159

Query  1782  gtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEIS  1603
                G G        RKRKSRWADDEPKP+IQLPDFMKDF GGIEFDPE+QALNSRLLEIS
Sbjct  160   DGSGTG--------RKRKSRWADDEPKPVIQLPDFMKDFAGGIEFDPEVQALNSRLLEIS  211

Query  1602  RKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPA  1423
             RKLQSGLPLDDRPEGARSPSPEPIYDNMG+RINTREYRAREKLNRERQEIISQIIKKNPA
Sbjct  212   RKLQSGLPLDDRPEGARSPSPEPIYDNMGVRINTREYRAREKLNRERQEIISQIIKKNPA  271

Query  1422  FKPPADYRPPKLQKKLYI  1369
             FKPPADYRPPKLQKKLYI
Sbjct  272   FKPPADYRPPKLQKKLYI  289


 Score = 51.6 bits (122),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  425   FKSDVLCKICGDGGHPTIDCPVK  447


 Score = 32.0 bits (71),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  411   PGHRQYACPSRTTTF  425



>ref|XP_007038338.1| Splicing factor-related [Theobroma cacao]
 gb|EOY22839.1| Splicing factor-related [Theobroma cacao]
Length=801

 Score =   272 bits (696),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 168/233 (72%), Positives = 186/233 (80%), Gaps = 13/233 (6%)
 Frame = -2

Query  2046  LDSDRHNTHGSSEQQMDNNSAQ---NHE---QTTPQDGAPKVELRKPLLSENGLTNTHSG  1885
             +D D   T GS+     NN+++   NH+    T   + + K E++KPLLSENGLTNTHSG
Sbjct  47    VDPDPSQTLGSAPNHGYNNNSRVQVNHDADSNTVNNNSSWKPEMQKPLLSENGLTNTHSG  106

Query  1884  T-DKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDE  1708
             T DKD SGGEEETTSRRRRRSRWDPP   ++N                 +KRKSRWADDE
Sbjct  107   TTDKDYSGGEEETTSRRRRRSRWDPPSDSNNNQSGNEETGSGT------KKRKSRWADDE  160

Query  1707  PKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIY  1528
             PKP+IQLPDFMKDFTGGI+FDPEIQALNSRLLEISR LQSGLPLDDRPEGARSPSPEPIY
Sbjct  161   PKPVIQLPDFMKDFTGGIQFDPEIQALNSRLLEISRMLQSGLPLDDRPEGARSPSPEPIY  220

Query  1527  DNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             DNMGIRINTREYRARE+L +ERQEIISQI+KKNPAFKPPADYRPPKLQKKLYI
Sbjct  221   DNMGIRINTREYRARERLTKERQEIISQILKKNPAFKPPADYRPPKLQKKLYI  273


 Score = 50.8 bits (120),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCP+K
Sbjct  409   FKSDVLCKICGDGGHPTIDCPMK  431


 Score = 33.1 bits (74),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  395   PGHRQYACPSRTSTF  409



>gb|KDP22445.1| hypothetical protein JCGZ_26276 [Jatropha curcas]
Length=800

 Score =   271 bits (692),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 178/213 (84%), Gaps = 5/213 (2%)
 Frame = -2

Query  2001  MDNNSAQNHEQTTPQDGAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsr  1822
             + N S   H Q   Q+  PK+E+ KPLLSENGLTNT+SG D+D SGGEEET+SRRRRRSR
Sbjct  59    LPNVSDNGHNQQIAQENIPKLEIPKPLLSENGLTNTYSG-DRDYSGGEEETSSRRRRRSR  117

Query  1821  wdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPK--PLIQLPDFMKDFTGGIEF  1648
             WDPP   ++N    +    +       RKRKSRWADDEPK  P+IQLPDFMKDFTGGIEF
Sbjct  118   WDPPADSTAN--NQSSDTSNNDTGSGTRKRKSRWADDEPKPGPVIQLPDFMKDFTGGIEF  175

Query  1647  DPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNR  1468
             DPEIQALN+RLLEISR LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARE+LN+
Sbjct  176   DPEIQALNARLLEISRMLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARERLNK  235

Query  1467  ERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             ERQEIISQIIK+NPAFKPPADYRPPKLQKKLYI
Sbjct  236   ERQEIISQIIKRNPAFKPPADYRPPKLQKKLYI  268


 Score = 51.2 bits (121),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  404   FKSDVLCKICGDGGHPTIDCPVK  426


 Score = 32.0 bits (71),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  390   PGHRQYACPSRTTTF  404


 Score = 23.5 bits (49),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  330   LHVLVEAETQEALDAAAGMVEKLLQP  355



>gb|KDO49948.1| hypothetical protein CISIN_1g040243mg [Citrus sinensis]
Length=797

 Score =   269 bits (687),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 178/256 (70%), Positives = 193/256 (75%), Gaps = 16/256 (6%)
 Frame = -2

Query  2118  QTLDQSQSHSVAAYPQE------QNQPGKTLDSDRHNTHGSSEQQMDNNSAQNHEQTTPQ  1957
             QTLD +Q+  +   PQ+      QN P      D  N   +SE   D N+  +       
Sbjct  12    QTLDFNQNPPL---PQDTLDHDSQNPPKTLAPPDAQNPQPASENGHDKNNENSCNNNNDV  68

Query  1956  DGAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgt  1777
               A  ++ +KPLLSENGLTNTHSGTDKDQSGGEEETTSRRRRRSRWDPPPSES       
Sbjct  69    AAADYIK-QKPLLSENGLTNTHSGTDKDQSGGEEETTSRRRRRSRWDPPPSESGGTEGNG  127

Query  1776  ggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRK  1597
                         RKR+SRWADDEPKP+IQLPDFMKDFTGGIEFDPEIQALNSRLLEISR 
Sbjct  128   DSGSGT------RKRRSRWADDEPKPVIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRM  181

Query  1596  LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFK  1417
             LQSGLPLDDRPEG RSPSPEPIYDNMGIRINTREYRARE+LN+ERQEIISQIIK+NPAFK
Sbjct  182   LQSGLPLDDRPEGQRSPSPEPIYDNMGIRINTREYRARERLNKERQEIISQIIKRNPAFK  241

Query  1416  PPADYRPPKLQKKLYI  1369
             PPADYRPPKLQKKLYI
Sbjct  242   PPADYRPPKLQKKLYI  257


 Score = 47.4 bits (111),  Expect(3) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDC VK
Sbjct  393   FKSDVLCKICGDGGHPTIDCLVK  415


 Score = 33.1 bits (74),  Expect(3) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  379   PGHRQYACPSRTSTF  393


 Score = 23.5 bits (49),  Expect(3) = 3e-07, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  319   LHVLVEAETQESLEGAAAMVEKLLQP  344



>ref|XP_006421619.1| hypothetical protein CICLE_v10004301mg [Citrus clementina]
 gb|ESR34859.1| hypothetical protein CICLE_v10004301mg [Citrus clementina]
Length=854

 Score =   269 bits (688),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 167/188 (89%), Gaps = 6/188 (3%)
 Frame = -2

Query  1932  RKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtg  1753
             +KPLLSENGLTNTHSGTDKDQSGGEEET+SRRRRRSRWDPPPSES               
Sbjct  133   QKPLLSENGLTNTHSGTDKDQSGGEEETSSRRRRRSRWDPPPSESGGTEGNGDSGSGT--  190

Query  1752  tgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
                 RKR+SRWADDEPKP+IQLPDFMKDFTGGIEFDPEIQALNSRLLEISR LQSGLPLD
Sbjct  191   ----RKRRSRWADDEPKPVIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRMLQSGLPLD  246

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
             DRPEG RSPSPEPIYDNMGIRINTREYRARE+LN+ERQEIISQIIK+NPAFKPPADYRPP
Sbjct  247   DRPEGQRSPSPEPIYDNMGIRINTREYRARERLNKERQEIISQIIKRNPAFKPPADYRPP  306

Query  1392  KLQKKLYI  1369
             KLQKKLYI
Sbjct  307   KLQKKLYI  314


 Score = 51.2 bits (121),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  450   FKSDVLCKICGDGGHPTIDCPVK  472


 Score = 33.1 bits (74),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  436   PGHRQYACPSRTSTF  450


 Score = 23.5 bits (49),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  376   LHVLVEAETQESLEGAAAMVEKLLQP  401



>ref|XP_006490149.1| PREDICTED: branchpoint-bridging protein-like [Citrus sinensis]
Length=797

 Score =   268 bits (685),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 167/188 (89%), Gaps = 6/188 (3%)
 Frame = -2

Query  1932  RKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtg  1753
             +KPLLSENGLTNTHSGTDKDQSGGEEETTSRRRRRSRWDPPPSES               
Sbjct  76    QKPLLSENGLTNTHSGTDKDQSGGEEETTSRRRRRSRWDPPPSESGGTEGNGDSGSGT--  133

Query  1752  tgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
                 RKR+SRWADDEPKP+IQLPDFMKDFTGGIEFDPEIQALNSRLLEISR LQSGLPLD
Sbjct  134   ----RKRRSRWADDEPKPVIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRMLQSGLPLD  189

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
             DRPEG RSPSPEPIYDNMGIRINTREYRARE+LN+ERQEIISQIIK+NPAFKPPADYRPP
Sbjct  190   DRPEGQRSPSPEPIYDNMGIRINTREYRARERLNKERQEIISQIIKRNPAFKPPADYRPP  249

Query  1392  KLQKKLYI  1369
             KLQKKLYI
Sbjct  250   KLQKKLYI  257


 Score = 47.4 bits (111),  Expect(3) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDC VK
Sbjct  393   FKSDVLCKICGDGGHPTIDCLVK  415


 Score = 33.1 bits (74),  Expect(3) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  1286  SPGQKQYACPSRTSTF  1239
              PG +QYACPSRTSTF
Sbjct  378   EPGHRQYACPSRTSTF  393


 Score = 23.5 bits (49),  Expect(3) = 3e-07, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  319   LHVLVEAETQESLEGAAAMVEKLLQP  344



>ref|XP_008453901.1| PREDICTED: branchpoint-bridging protein [Cucumis melo]
Length=778

 Score =   265 bits (677),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 154/212 (73%), Gaps = 16/212 (8%)
 Frame = -2

Query  1992  NSAQNHEQTTPQDG---APKVEL-RKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrs  1825
             +S   H +  P DG    PKVE+ +KPLLSENG TNTHSGTDKD         S     +
Sbjct  50    SSGNGHAENQPADGVNHGPKVEIIQKPLLSENGFTNTHSGTDKD--------FSGGEEET  101

Query  1824  rwdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFD  1645
                       +    +     G      RKRKSRWADD+PKP+IQLPDFM    GGIEFD
Sbjct  102   TSRRRRRSRWDPQPESNEQSGGESGSGTRKRKSRWADDDPKPVIQLPDFM----GGIEFD  157

Query  1644  PEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRE  1465
             PEIQALNSRLLEISR LQSG+PLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLN E
Sbjct  158   PEIQALNSRLLEISRMLQSGMPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNTE  217

Query  1464  RQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             RQEIISQIIKKNPAFKPPADYRPPKLQKKLYI
Sbjct  218   RQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  249


 Score = 51.2 bits (121),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  385   FKSDVLCKICGDGGHPTIDCPVK  407


 Score = 30.8 bits (68),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -3

Query  1280  GQKQYACPSRTSTF  1239
             G +QYACPSRTSTF
Sbjct  372   GHRQYACPSRTSTF  385


 Score = 23.5 bits (49),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  311   LHVLVEAETQESLEAAAEMVEKLLQP  336



>gb|KHG02926.1| Branchpoint-bridging [Gossypium arboreum]
Length=786

 Score =   265 bits (676),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 181/229 (79%), Gaps = 8/229 (3%)
 Frame = -2

Query  2052  KTLDSDRHNTHGSSEQQMDNNSAQNHEQTTPQDGAPKVELRKPLLSENGLTNTHSGT-DK  1876
             +T DSD    H ++     +N    H  T     + K ++ KPLLSENGLTNTHSGT DK
Sbjct  32    QTFDSDPVLEHNNANNGALSN-PDAHSNTINNTSSFKPDIHKPLLSENGLTNTHSGTTDK  90

Query  1875  DQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKPL  1696
             D SGGEEETTSRRRRRSRWDPP + +++                 +KRKSRWADDEPKP+
Sbjct  91    DYSGGEEETTSRRRRRSRWDPPSNSNNHQTGNDESASGT------KKRKSRWADDEPKPV  144

Query  1695  IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMG  1516
             IQLPDFMKDFTGGI+FDPEIQALNSRLLEISR LQSGLPLDDRPEGARSPSPEPIYDN+G
Sbjct  145   IQLPDFMKDFTGGIQFDPEIQALNSRLLEISRMLQSGLPLDDRPEGARSPSPEPIYDNLG  204

Query  1515  IRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             IRINTREYRARE+L +ERQEIISQI+KKNPAFKPPADYRPPKLQKKLYI
Sbjct  205   IRINTREYRARERLTKERQEIISQILKKNPAFKPPADYRPPKLQKKLYI  253


 Score = 50.4 bits (119),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCP+K
Sbjct  389   FKSDVLCKICGDGGHPTIDCPMK  411


 Score = 33.1 bits (74),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  375   PGHRQYACPSRTSTF  389


 Score = 23.9 bits (50),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  315   LHVLVEAETQESLDAAAAMVEKLLQP  340



>ref|XP_004146904.1| PREDICTED: uncharacterized protein LOC101205455 [Cucumis sativus]
 gb|KGN53152.1| hypothetical protein Csa_4G022880 [Cucumis sativus]
Length=777

 Score =   264 bits (674),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 154/212 (73%), Gaps = 16/212 (8%)
 Frame = -2

Query  1992  NSAQNHEQTTPQDGA---PKVEL-RKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrs  1825
             +S   H +  P DG    PKVE+ +KPL+SENG TNTHSGTDKD         S     +
Sbjct  49    SSGNGHAENQPADGVNYVPKVEIIQKPLVSENGFTNTHSGTDKD--------FSGGEEET  100

Query  1824  rwdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFD  1645
                       +    +     G      RKRKSRWADD+PKP+IQLPDFM    GGIEFD
Sbjct  101   TSRRRRRSRWDPQPESNEQSGGESGSGARKRKSRWADDDPKPVIQLPDFM----GGIEFD  156

Query  1644  PEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRE  1465
             PEIQALNSRLLEISR LQSG+PLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLN E
Sbjct  157   PEIQALNSRLLEISRMLQSGMPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNTE  216

Query  1464  RQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             RQEIISQIIKKNPAFKPPADYRPPKLQKKLYI
Sbjct  217   RQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  248


 Score = 51.2 bits (121),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  384   FKSDVLCKICGDGGHPTIDCPVK  406


 Score = 30.8 bits (68),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -3

Query  1280  GQKQYACPSRTSTF  1239
             G +QYACPSRTSTF
Sbjct  371   GHRQYACPSRTSTF  384


 Score = 23.9 bits (50),  Expect(3) = 7e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  310   LHVLVEAETQESLEAAAEMVEKLLQP  335



>ref|XP_004169681.1| PREDICTED: uncharacterized LOC101205455 [Cucumis sativus]
Length=778

 Score =   264 bits (674),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 154/212 (73%), Gaps = 16/212 (8%)
 Frame = -2

Query  1992  NSAQNHEQTTPQDGA---PKVEL-RKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrs  1825
             +S   H +  P DG    PKVE+ +KPL+SENG TNTHSGTDKD         S     +
Sbjct  49    SSGNGHAENQPADGVNYVPKVEIIQKPLVSENGFTNTHSGTDKD--------FSGGEEET  100

Query  1824  rwdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFD  1645
                       +    +     G      RKRKSRWADD+PKP+IQLPDFM    GGIEFD
Sbjct  101   TSRRRRRSRWDPQPESNEQSGGESGSGARKRKSRWADDDPKPVIQLPDFM----GGIEFD  156

Query  1644  PEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRE  1465
             PEIQALNSRLLEISR LQSG+PLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLN E
Sbjct  157   PEIQALNSRLLEISRMLQSGMPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNTE  216

Query  1464  RQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             RQEIISQIIKKNPAFKPPADYRPPKLQKKLYI
Sbjct  217   RQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  248


 Score = 51.6 bits (122),  Expect(3) = 6e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  384   FKSDVLCKICGDGGHPTIDCPVK  406


 Score = 30.8 bits (68),  Expect(3) = 6e-08, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -3

Query  1280  GQKQYACPSRTSTF  1239
             G +QYACPSRTSTF
Sbjct  371   GHRQYACPSRTSTF  384


 Score = 23.9 bits (50),  Expect(3) = 6e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  310   LHVLVEAETQESLEAAAEMVEKLLQP  335



>ref|XP_011018352.1| PREDICTED: branchpoint-bridging protein-like [Populus euphratica]
 ref|XP_011018354.1| PREDICTED: branchpoint-bridging protein-like [Populus euphratica]
Length=801

 Score =   263 bits (673),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 182/216 (84%), Gaps = 10/216 (5%)
 Frame = -2

Query  1998  DNNSAQNHEQTTPQDG------APKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrr  1837
             D     N  Q +P++G       PK E+ KPLLSENG+ NT+SG D+D SGGEEETTSRR
Sbjct  58    DKTLISNPPQFSPENGHNLQTTTPKPEIPKPLLSENGVANTNSG-DRDYSGGEEETTSRR  116

Query  1836  rrrsrwdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGG  1657
             RRRSRWDPP    ++ G  T  + SG+GT   RKRKSRWADDEPKP+IQLPDFMKDFTGG
Sbjct  117   RRRSRWDPPADSGTDGGGNTNNNDSGSGT---RKRKSRWADDEPKPVIQLPDFMKDFTGG  173

Query  1656  IEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREK  1477
             IEFDPEIQALN+RLLEISR LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARE+
Sbjct  174   IEFDPEIQALNARLLEISRMLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARER  233

Query  1476  LNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             LN+ERQEIISQIIK+NPAFKPPADYRPPKLQKKLYI
Sbjct  234   LNKERQEIISQIIKRNPAFKPPADYRPPKLQKKLYI  269


 Score = 50.1 bits (118),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCP+K
Sbjct  405   FKSDVLCKICGDGGHPTIDCPMK  427


 Score = 32.0 bits (71),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  391   PGHRQYACPSRTTTF  405


 Score = 23.5 bits (49),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  331   LHVLVEAETQEALDAAAGMVEKLLQP  356



>ref|XP_002303489.1| hypothetical protein POPTR_0003s10640g [Populus trichocarpa]
 gb|EEE78468.1| hypothetical protein POPTR_0003s10640g [Populus trichocarpa]
Length=794

 Score =   261 bits (667),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 167/198 (84%), Gaps = 7/198 (4%)
 Frame = -2

Query  1962  PQDGAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgt  1783
             PQ   PK E+ K LLSENG+ NT+SG D+D SGGEEETTSRRRRRSRWDPP    ++   
Sbjct  80    PQTTTPKPEIPKSLLSENGVANTNSG-DRDCSGGEEETTSRRRRRSRWDPPADAGADGSN  138

Query  1782  gtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEIS  1603
                           RKRKSRWADDEPKP+IQLPDFMKDFTGGIEFDPEIQALN+RLLEIS
Sbjct  139   NNDSGSGT------RKRKSRWADDEPKPVIQLPDFMKDFTGGIEFDPEIQALNARLLEIS  192

Query  1602  RKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPA  1423
             R LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARE+LN+ERQEIISQIIK+NPA
Sbjct  193   RMLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARERLNKERQEIISQIIKRNPA  252

Query  1422  FKPPADYRPPKLQKKLYI  1369
             FKPPADYRPPKLQKKLYI
Sbjct  253   FKPPADYRPPKLQKKLYI  270


 Score = 50.1 bits (118),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCP+K
Sbjct  406   FKSDVLCKICGDGGHPTIDCPMK  428


 Score = 33.1 bits (74),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  392   PGHRQYACPSRTSTF  406


 Score = 23.5 bits (49),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  332   LHVLVEAETQEALDAAAGMVEKLLQP  357



>ref|XP_011027963.1| PREDICTED: branchpoint-bridging protein-like [Populus euphratica]
Length=783

 Score =   260 bits (665),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 166/198 (84%), Gaps = 6/198 (3%)
 Frame = -2

Query  1962  PQDGAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgt  1783
             PQ   PK E+ KPLLSEN + NT+SG D+D SGGEEETTSRRRRR     PP+++     
Sbjct  74    PQTTTPKPEIPKPLLSENSVVNTNSG-DRDYSGGEEETTSRRRRRCSRWDPPADAG----  128

Query  1782  gtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEIS  1603
                G  +       RKRKSRWADDEPKP+IQLPDFMKDFTGGIEFDPEIQALN+RLLEIS
Sbjct  129   -ADGSNNNDSGSGTRKRKSRWADDEPKPVIQLPDFMKDFTGGIEFDPEIQALNARLLEIS  187

Query  1602  RKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPA  1423
             R LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARE+LN+ERQEIISQIIK+NPA
Sbjct  188   RMLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARERLNKERQEIISQIIKRNPA  247

Query  1422  FKPPADYRPPKLQKKLYI  1369
             FKPPADYRPPKLQKKLYI
Sbjct  248   FKPPADYRPPKLQKKLYI  265


 Score = 50.1 bits (118),  Expect(3) = 5e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCP+K
Sbjct  401   FKSDVLCKICGDGGHPTIDCPMK  423


 Score = 32.7 bits (73),  Expect(3) = 5e-08, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  387   PGHRQYACPSRTSTF  401


 Score = 23.5 bits (49),  Expect(3) = 5e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  327   LHVLVEAETQEALDAAAGMVEKLLQP  352



>ref|XP_006368238.1| hypothetical protein POPTR_0001s00850g [Populus trichocarpa]
 gb|ERP64807.1| hypothetical protein POPTR_0001s00850g [Populus trichocarpa]
Length=809

 Score =   260 bits (665),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 170/218 (78%), Gaps = 9/218 (4%)
 Frame = -2

Query  1998  DNNSAQNHEQTTPQDG------APKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrr  1837
             D     N  Q  P++G       PK E+ KPLLSENG+ NT+SG D+D SGGEEETTSRR
Sbjct  62    DKTLISNPPQFAPENGHNLQTTTPKPEIPKPLLSENGVANTNSG-DRDYSGGEEETTSRR  120

Query  1836  rrrsr--wdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFT  1663
             RRRSR             G  +    +       RKRKSRWADDEPKP+IQLPDFMKDFT
Sbjct  121   RRRSRWDPPADSGTDGGGGGSSSNTNNNDSGSGTRKRKSRWADDEPKPVIQLPDFMKDFT  180

Query  1662  GGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAR  1483
             GGIEFDPEIQALN+RLLEISR LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAR
Sbjct  181   GGIEFDPEIQALNARLLEISRMLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAR  240

Query  1482  EKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             E+LN+ERQEIISQIIK+NPAFKPPADYRPPKLQKKLYI
Sbjct  241   ERLNKERQEIISQIIKRNPAFKPPADYRPPKLQKKLYI  278


 Score = 50.1 bits (118),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCP+K
Sbjct  414   FKSDVLCKICGDGGHPTIDCPMK  436


 Score = 32.0 bits (71),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  400   PGHRQYACPSRTTTF  414



>gb|EYU31311.1| hypothetical protein MIMGU_mgv1a001841mg [Erythranthe guttata]
Length=751

 Score =   259 bits (662),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 169/194 (87%), Gaps = 1/194 (1%)
 Frame = -2

Query  1947  PKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggd  1768
             PK +   PL+S NGLT+T SG DKD SGGEEETTSRRRRRSRWDPPPSES+NDG+   G 
Sbjct  12    PKPDSSNPLVSGNGLTSTRSGADKDVSGGEEETTSRRRRRSRWDPPPSESTNDGSAGTGG  71

Query  1767  gs-gtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQ  1591
                      GRKRKSRWADDEPKPL+Q PDFMKDF GGIEFDPEIQ+LNS LLEISRKLQ
Sbjct  72    NGDVNSGAGGRKRKSRWADDEPKPLVQFPDFMKDFAGGIEFDPEIQSLNSMLLEISRKLQ  131

Query  1590  SGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPP  1411
             SGLPLDDRPEGARSPSPEP+YDNMG+RINTREYRAREKLNRERQEIISQIIKKNPAFKPP
Sbjct  132   SGLPLDDRPEGARSPSPEPVYDNMGVRINTREYRAREKLNRERQEIISQIIKKNPAFKPP  191

Query  1410  ADYRPPKLQKKLYI  1369
             ADYRPPKL KKLYI
Sbjct  192   ADYRPPKLHKKLYI  205


 Score = 54.3 bits (129),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 36/67 (54%), Gaps = 9/67 (13%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVKR*IKWHAWHLTAGKRSKTTNPRSLENIHVAGDQKSKQ  1061
             FK DVLC+ICGDGGHPTIDCPVK          T GK+        L  +   G + + +
Sbjct  341   FKSDVLCKICGDGGHPTIDCPVKN---------TTGKKMDDEYQNFLAELGGTGPESATK  391

Query  1060  KLNTQVA  1040
              L+  +A
Sbjct  392   SLSATLA  398


 Score = 29.3 bits (64),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +Q+ACPSR STF
Sbjct  327   PGHRQFACPSRLSTF  341



>ref|XP_006280024.1| hypothetical protein CARUB_v10025900mg [Capsella rubella]
 gb|AFJ66205.1| hypothetical protein 34G24.3 [Capsella rubella]
 gb|EOA12922.1| hypothetical protein CARUB_v10025900mg [Capsella rubella]
Length=806

 Score =   259 bits (663),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 175/248 (71%), Positives = 192/248 (77%), Gaps = 19/248 (8%)
 Frame = -2

Query  2097  SHSVAAYPQEQNQPGKTLDSDRHN-----THGSSEQQMDNNSAQNHEQTTPQDGAPKVEL  1933
             SH++   P   N     L SD  N      +GSS    D N +             K E 
Sbjct  13    SHTLNQPPPSSNGDTAPLASDHLNPDSLAQNGSSAPNPDTNGS-----------VAKPEF  61

Query  1932  RKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtg  1753
              +PL+SENG++ T SG DKDQSGGEEETTSRR+RRSRWDPPPSES N+ +  GG+ SGTG
Sbjct  62    LRPLISENGVSKTLSGNDKDQSGGEEETTSRRKRRSRWDPPPSESINNPSAEGGNDSGTG  121

Query  1752  tgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             T   RKRKSRWADDEPKP IQLPDFMKDFTGGIEFDPEIQALNSRLLEISR LQSG+PLD
Sbjct  122   T---RKRKSRWADDEPKPQIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRMLQSGMPLD  178

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
             DRPEG RSPSPEP+YDNMGIRINTREYRARE+LNRERQEII+QIIKKNPAFKPPADYRPP
Sbjct  179   DRPEGQRSPSPEPVYDNMGIRINTREYRARERLNRERQEIIAQIIKKNPAFKPPADYRPP  238

Query  1392  KLQKKLYI  1369
             KLQKKL+I
Sbjct  239   KLQKKLFI  246


 Score = 51.2 bits (121),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  382   FKSDVLCKICGDGGHPTIDCPVK  404


 Score = 32.0 bits (71),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  368   PGHRQYACPSRTNTF  382


 Score = 23.5 bits (49),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  308   LHVLVEAETQDALEAAAGMVEKLLQP  333



>ref|XP_010482464.1| PREDICTED: branchpoint-bridging protein-like [Camelina sativa]
Length=806

 Score =   259 bits (662),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 176/250 (70%), Positives = 194/250 (78%), Gaps = 19/250 (8%)
 Frame = -2

Query  2103  SQSHSVAAYPQEQNQPGKTLDSDRHN-----THGSSEQQMDNNSAQNHEQTTPQDGAPKV  1939
             S SH++   P   N     L SD  N      +GSS    D N +             K 
Sbjct  11    SDSHTLEQPPPPSNGDTAPLASDHLNPDSVALNGSSAPNPDTNGS-----------VAKP  59

Query  1938  ELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsg  1759
             EL +PL+SENG++ T SG DKDQSGGEEET+SRR+RRSRWDPPPSESSN+ +  GG+ SG
Sbjct  60    ELLRPLISENGVSKTLSGNDKDQSGGEEETSSRRKRRSRWDPPPSESSNNASVEGGNDSG  119

Query  1758  tgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLP  1579
             TGT   RKRKSRWADDEPK  IQLPDFMKDFTGGIEFDPEIQALNSRLLEISR LQSG+P
Sbjct  120   TGT---RKRKSRWADDEPKTQIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRMLQSGMP  176

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYR  1399
             LDDRPEG RSPSPEP+YDNMGIRINTREYRARE+LNRERQEII+QIIKKNPAFKPPADYR
Sbjct  177   LDDRPEGQRSPSPEPVYDNMGIRINTREYRARERLNRERQEIIAQIIKKNPAFKPPADYR  236

Query  1398  PPKLQKKLYI  1369
             PPKLQKKL+I
Sbjct  237   PPKLQKKLFI  246


 Score = 49.7 bits (117),  Expect(3) = 9e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +VLC+ICGDGGHPTIDCPVK
Sbjct  382   FKSEVLCKICGDGGHPTIDCPVK  404


 Score = 32.0 bits (71),  Expect(3) = 9e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  368   PGHRQYACPSRTNTF  382


 Score = 23.5 bits (49),  Expect(3) = 9e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  308   LHVLVEAETQDALEAAAGMVEKLLQP  333



>ref|XP_002865852.1| hypothetical protein ARALYDRAFT_495202 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42111.1| hypothetical protein ARALYDRAFT_495202 [Arabidopsis lyrata subsp. 
lyrata]
Length=798

 Score =   259 bits (661),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 180/213 (85%), Gaps = 6/213 (3%)
 Frame = -2

Query  1998  DNNSAQNHEQTT---PQDGAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrr  1828
             D+ + QN E  T       + K E  +PLLSENG++ T SG DKDQSGGEEETTSRR+RR
Sbjct  33    DHMNPQNSESVTLNGTNGSSAKPEFLRPLLSENGVSKTLSGNDKDQSGGEEETTSRRKRR  92

Query  1827  srwdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEF  1648
             SRWDPPPSES N+ +  G   SGTGT   RKRKSRWADDEPKP IQLPDFMKDFTGGIEF
Sbjct  93    SRWDPPPSESGNNPSAEGSTDSGTGT---RKRKSRWADDEPKPHIQLPDFMKDFTGGIEF  149

Query  1647  DPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNR  1468
             DPEIQALNSRLLEISR LQSG+PLDDRPEG RSPSPEP+YDNMGIRINTREYRARE+LNR
Sbjct  150   DPEIQALNSRLLEISRMLQSGMPLDDRPEGQRSPSPEPVYDNMGIRINTREYRARERLNR  209

Query  1467  ERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             ERQEII+QIIKKNPAFKPPADYRPPKL KKL+I
Sbjct  210   ERQEIIAQIIKKNPAFKPPADYRPPKLHKKLFI  242


 Score = 51.2 bits (121),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  378   FKSDVLCKICGDGGHPTIDCPVK  400


 Score = 32.0 bits (71),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  364   PGHRQYACPSRTNTF  378


 Score = 23.5 bits (49),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  304   LHVLVEAETQDALEAAAGMVEKLLQP  329



>ref|XP_010442612.1| PREDICTED: branchpoint-bridging protein [Camelina sativa]
Length=806

 Score =   259 bits (661),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 176/250 (70%), Positives = 193/250 (77%), Gaps = 19/250 (8%)
 Frame = -2

Query  2103  SQSHSVAAYPQEQNQPGKTLDSDRHN-----THGSSEQQMDNNSAQNHEQTTPQDGAPKV  1939
             S SH++   P   N     L SD  N      +GSS    D N +             K 
Sbjct  11    SDSHTLEQPPPPSNGDTAPLASDHLNPDSVALNGSSAPNPDTNGS-----------VAKP  59

Query  1938  ELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsg  1759
             EL +PL+SENG++ T SG DKDQSGGEEETTSRR+RRSRWDPPPSE SN+ +  GG+ SG
Sbjct  60    ELLRPLISENGVSKTLSGNDKDQSGGEEETTSRRKRRSRWDPPPSELSNNASAEGGNDSG  119

Query  1758  tgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLP  1579
             TGT   RKRKSRWADDEPK  IQLPDFMKDFTGGIEFDPEIQALNSRLLEISR LQSG+P
Sbjct  120   TGT---RKRKSRWADDEPKTQIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRMLQSGMP  176

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYR  1399
             LDDRPEG RSPSPEP+YDNMGIRINTREYRARE+LNRERQEII+QIIKKNPAFKPPADYR
Sbjct  177   LDDRPEGQRSPSPEPVYDNMGIRINTREYRARERLNRERQEIIAQIIKKNPAFKPPADYR  236

Query  1398  PPKLQKKLYI  1369
             PPKLQKKL+I
Sbjct  237   PPKLQKKLFI  246


 Score = 51.6 bits (122),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  382   FKSDVLCKICGDGGHPTIDCPVK  404


 Score = 32.0 bits (71),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  368   PGHRQYACPSRTNTF  382



>ref|XP_010443022.1| PREDICTED: branchpoint-bridging protein-like [Camelina sativa]
Length=793

 Score =   256 bits (655),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 175/192 (91%), Gaps = 3/192 (2%)
 Frame = -2

Query  1944  KVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdg  1765
             K E  +PL+SENG++ T SG DKDQSGGEEETTSRR+RRSRWDPPPS+SSN+ +  GG+ 
Sbjct  52    KPEFLRPLISENGVSKTLSGNDKDQSGGEEETTSRRKRRSRWDPPPSDSSNNASAEGGND  111

Query  1764  sgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG  1585
             SGTGT   RKRKSRWADDEPK  IQLPDFMKDFTGGIEFDPEIQALNSRLLEISR LQSG
Sbjct  112   SGTGT---RKRKSRWADDEPKTQIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRMLQSG  168

Query  1584  LPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPAD  1405
             +PLDDRPEG RSPSPEP+YDNMGIRINTREYRARE+LNRERQEII+QIIKKNPAFKPPAD
Sbjct  169   MPLDDRPEGQRSPSPEPVYDNMGIRINTREYRARERLNRERQEIIAQIIKKNPAFKPPAD  228

Query  1404  YRPPKLQKKLYI  1369
             YRPPKLQKKL+I
Sbjct  229   YRPPKLQKKLFI  240


 Score = 51.2 bits (121),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  376   FKSDVLCKICGDGGHPTIDCPVK  398


 Score = 32.0 bits (71),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  362   PGHRQYACPSRTNTF  376


 Score = 23.5 bits (49),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  302   LHVLVEAETQDALEAAAGMVEKLLQP  327



>ref|XP_006409296.1| hypothetical protein EUTSA_v10022568mg [Eutrema salsugineum]
 gb|ESQ50749.1| hypothetical protein EUTSA_v10022568mg [Eutrema salsugineum]
Length=776

 Score =   255 bits (652),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -2

Query  1929  KPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtgt  1750
             +PLLSENG+  T +G DKDQSGGEEETT+RR+RRSRWDPPP++S N+    GG       
Sbjct  39    RPLLSENGVKETLNGNDKDQSGGEEETTNRRKRRSRWDPPPTQSVNNPVTEGGGSGSDSK  98

Query  1749  gtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
                RKRKSRWADDEPKP+IQLPDFMKDFT GIEFDPEIQALNSRLLEISR LQSG+ LDD
Sbjct  99    TGTRKRKSRWADDEPKPVIQLPDFMKDFTSGIEFDPEIQALNSRLLEISRMLQSGVTLDD  158

Query  1569  RPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPK  1390
             RPEG RSPSPEP+YDNMGIRINTREYRARE+LNRERQEIISQIIKKNPAFKPPADYRPPK
Sbjct  159   RPEGQRSPSPEPVYDNMGIRINTREYRARERLNRERQEIISQIIKKNPAFKPPADYRPPK  218

Query  1389  LQKKLYI  1369
             LQKKL+I
Sbjct  219   LQKKLFI  225


 Score = 51.2 bits (121),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  361   FKSDVLCKICGDGGHPTIDCPVK  383


 Score = 32.0 bits (71),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  347   PGHRQYACPSRTNTF  361


 Score = 23.5 bits (49),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  287   LHVLVEAETQEALEAAAGMVEKLLQP  312



>gb|EPS70750.1| hypothetical protein M569_04006, partial [Genlisea aurea]
Length=504

 Score =   249 bits (635),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRKSRWADDEP PLIQLPDFMKD  GG++FDPE+QALNSRLLEISRKLQSGLPLDDRPE
Sbjct  60    RKRKSRWADDEPNPLIQLPDFMKDLAGGVDFDPEVQALNSRLLEISRKLQSGLPLDDRPE  119

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             GARSPSPEPIYDN+G+RINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK
Sbjct  120   GARSPSPEPIYDNIGVRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  179

Query  1380  KLYI  1369
             KLYI
Sbjct  180   KLYI  183


 Score = 51.6 bits (122),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -1

Query  1249  LPPFKVDVLCEICGDGGHPTIDCPVK  1172
             L  FK DVLC+ICGDGGHPTIDCPVK
Sbjct  316   LTTFKSDVLCKICGDGGHPTIDCPVK  341


 Score = 28.9 bits (63),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -3

Query  1286  SPGQKQYACPSRTSTF  1239
              PG +Q+ACPSR +TF
Sbjct  304   EPGHRQFACPSRLTTF  319



>ref|NP_199943.1| splicing factor 1-like protein [Arabidopsis thaliana]
 ref|NP_851169.1| splicing factor 1-like protein [Arabidopsis thaliana]
 ref|NP_001032055.1| splicing factor 1-like protein [Arabidopsis thaliana]
 dbj|BAA97393.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN13087.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH19518.1| AT5G51300 [Arabidopsis thaliana]
 dbj|BAH19750.1| AT5G51300 [Arabidopsis thaliana]
 gb|AED96063.1| splicing factor 1-like protein [Arabidopsis thaliana]
 gb|AED96064.1| splicing factor 1-like protein [Arabidopsis thaliana]
 gb|AED96065.1| splicing factor 1-like protein [Arabidopsis thaliana]
Length=804

 Score =   255 bits (651),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 173/192 (90%), Gaps = 3/192 (2%)
 Frame = -2

Query  1944  KVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdg  1765
             K EL +PLLSENG++ T SG DKDQSGGEEETTSRR+RRSRWDPPPSES N+ +  GG  
Sbjct  59    KPELLRPLLSENGVSKTLSGNDKDQSGGEEETTSRRKRRSRWDPPPSESINNPSAEGGTD  118

Query  1764  sgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG  1585
             SGTGT   RKRKSRWADDEP+  IQLPDFMKDFTGGIEFDPEIQALNSRLLEISR LQSG
Sbjct  119   SGTGT---RKRKSRWADDEPRTQIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRMLQSG  175

Query  1584  LPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPAD  1405
             +PLDDRPEG RSPSPEP+YDNMGIRINTREYRARE+LNRERQEII+QIIKKNPAFKPPAD
Sbjct  176   MPLDDRPEGQRSPSPEPVYDNMGIRINTREYRARERLNRERQEIIAQIIKKNPAFKPPAD  235

Query  1404  YRPPKLQKKLYI  1369
             YRPPKL KKL+I
Sbjct  236   YRPPKLHKKLFI  247


 Score = 51.2 bits (121),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  383   FKSDVLCKICGDGGHPTIDCPVK  405


 Score = 32.0 bits (71),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  369   PGHRQYACPSRTNTF  383


 Score = 23.5 bits (49),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  309   LHVLVEAETQEALEAAAGMVEKLLQP  334



>gb|AAK43947.1|AF370132_1 unknown protein [Arabidopsis thaliana]
Length=804

 Score =   255 bits (651),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 172/192 (90%), Gaps = 3/192 (2%)
 Frame = -2

Query  1944  KVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdg  1765
             K EL +PLLSENG++ T SG DKDQSGGEEETTSRR+RRSRWDPPPSES N+ +  GG  
Sbjct  59    KPELLRPLLSENGVSKTLSGNDKDQSGGEEETTSRRKRRSRWDPPPSESINNPSAEGGTD  118

Query  1764  sgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG  1585
             SGT T   RKRKSRWADDEP+  IQLPDFMKDFTGGIEFDPEIQALNSRLLEISR LQSG
Sbjct  119   SGTET---RKRKSRWADDEPRTQIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRMLQSG  175

Query  1584  LPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPAD  1405
             +PLDDRPEG RSPSPEP+YDNMGIRINTREYRARE+LNRERQEII+QIIKKNPAFKPPAD
Sbjct  176   MPLDDRPEGQRSPSPEPVYDNMGIRINTREYRARERLNRERQEIIAQIIKKNPAFKPPAD  235

Query  1404  YRPPKLQKKLYI  1369
             YRPPKL KKL+I
Sbjct  236   YRPPKLHKKLFI  247


 Score = 51.6 bits (122),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  383   FKSDVLCKICGDGGHPTIDCPVK  405


 Score = 32.0 bits (71),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  369   PGHRQYACPSRTNTF  383


 Score = 23.5 bits (49),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  309   LHVLVEAETQEALEAAAGMVEKLLQP  334



>ref|XP_010035039.1| PREDICTED: branchpoint-bridging protein-like [Eucalyptus grandis]
Length=808

 Score =   255 bits (651),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 150/196 (77%), Gaps = 5/196 (3%)
 Frame = -2

Query  1950  APKVELRKPLLSENG-LTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtg  1774
              P+ E+ K +LS+ G +TNTHSGTDKD             RR R       S ++    G
Sbjct  81    GPRPEIAKVVLSDGGAITNTHSGTDKD---ASGGEEETTSRRRRRSRWDPPSESNEQSGG  137

Query  1773  gdgsgtgtgtGRKRKSRWADDEPK-PLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRK  1597
                        RKRKSRWADDEPK P IQLPDFMKDFTGGIEFDPEIQALN+RLLEISR 
Sbjct  138   SGVGNDSGSGTRKRKSRWADDEPKLPTIQLPDFMKDFTGGIEFDPEIQALNARLLEISRM  197

Query  1596  LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFK  1417
             LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARE+LN+ERQ+II+QIIK+NPAFK
Sbjct  198   LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARERLNKERQDIITQIIKRNPAFK  257

Query  1416  PPADYRPPKLQKKLYI  1369
             PPADYRPPKLQKKLYI
Sbjct  258   PPADYRPPKLQKKLYI  273


 Score = 51.2 bits (121),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  409   FKSDVLCKICGDGGHPTIDCPVK  431


 Score = 33.1 bits (74),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  395   PGHRQYACPSRTSTF  409


 Score = 23.5 bits (49),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  335   LHVLVEAETQEALDAAAGMVEKLLQP  360



>ref|XP_007218922.1| hypothetical protein PRUPE_ppa001547mg [Prunus persica]
 gb|EMJ20121.1| hypothetical protein PRUPE_ppa001547mg [Prunus persica]
Length=804

 Score =   250 bits (639),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 182/230 (79%), Gaps = 15/230 (7%)
 Frame = -2

Query  2058  PGKTLDSDRHNTHGSSEQQMDNNSAQNHEQTTPQDGAPKVELRKPLLSENGLTNTHSGTD  1879
             P +TL S+  N     +   +N ++ +  +T     A + +++KPLLSENGLTNTHSGTD
Sbjct  57    PSETLASNAQNPAQIPQTGTENGNSNDGSKTL----ALRPDIQKPLLSENGLTNTHSGTD  112

Query  1878  KDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKP  1699
             +D SGGEEETTSRRRRRSRWDP P   +  G G  G G        RKRKSRWAD+EPKP
Sbjct  113   RDGSGGEEETTSRRRRRSRWDPQPESDNQSGGGESGSGP-------RKRKSRWADEEPKP  165

Query  1698  LIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNM  1519
             +IQLPDFM    GGIEFDPEIQALNSRLLEISR L SGLPLDDRPEGARSPSPEPIYDNM
Sbjct  166   VIQLPDFM----GGIEFDPEIQALNSRLLEISRMLSSGLPLDDRPEGARSPSPEPIYDNM  221

Query  1518  GIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             GIRINTRE+RARE+LN+ERQEII+QIIK+NPAFKPPADYRPPKLQKKLYI
Sbjct  222   GIRINTREFRARERLNKERQEIIAQIIKRNPAFKPPADYRPPKLQKKLYI  271


 Score = 51.2 bits (121),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  407   FKSDVLCKICGDGGHPTIDCPVK  429


 Score = 33.1 bits (74),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  393   PGHRQYACPSRTSTF  407



>ref|XP_008234420.1| PREDICTED: branchpoint-bridging protein [Prunus mume]
Length=799

 Score =   250 bits (639),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 182/230 (79%), Gaps = 15/230 (7%)
 Frame = -2

Query  2058  PGKTLDSDRHNTHGSSEQQMDNNSAQNHEQTTPQDGAPKVELRKPLLSENGLTNTHSGTD  1879
             P +TL S+  N     +   +N ++ +  +T     A + +++KPLLSENGLTNTHSGTD
Sbjct  57    PSETLASNAQNPGQIPQTGTENGNSNDGSKTL----ALRPDIQKPLLSENGLTNTHSGTD  112

Query  1878  KDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKP  1699
             +D SGGEEETTSRRRRRSRWDP P   +  G G  G G        RKRKSRWAD+EPKP
Sbjct  113   RDGSGGEEETTSRRRRRSRWDPQPESDNQSGGGESGSGP-------RKRKSRWADEEPKP  165

Query  1698  LIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNM  1519
             +IQLPDFM    GGIEFDPEIQALNSRLLEISR L SGLPLDDRPEGARSPSPEPIYDNM
Sbjct  166   VIQLPDFM----GGIEFDPEIQALNSRLLEISRMLSSGLPLDDRPEGARSPSPEPIYDNM  221

Query  1518  GIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             GIRINTRE+RARE+LN+ERQEII+QIIK+NPAFKPPADYRPPKLQKKLYI
Sbjct  222   GIRINTREFRARERLNKERQEIIAQIIKRNPAFKPPADYRPPKLQKKLYI  271


 Score = 51.2 bits (121),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  407   FKSDVLCKICGDGGHPTIDCPVK  429


 Score = 33.1 bits (74),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  393   PGHRQYACPSRTSTF  407



>ref|XP_010102701.1| Branchpoint-bridging protein [Morus notabilis]
 gb|EXB93953.1| Branchpoint-bridging protein [Morus notabilis]
Length=770

 Score =   248 bits (632),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 170/195 (87%), Gaps = 10/195 (5%)
 Frame = -2

Query  1950  APKVELRKPLLSENGLT-NTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtg  1774
             A K E++KPL+SENGLT NTHSGTD+D SGGEEETTSRRRRRSRWDP P   S  G G G
Sbjct  57    ATKPEIQKPLVSENGLTGNTHSGTDRDGSGGEEETTSRRRRRSRWDPQPESDSQSGGGEG  116

Query  1773  gdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKL  1594
               GSGT     RKRKSRWADD+PKP+IQLPDFM    GGIEFDPEIQALNSRLLEISR L
Sbjct  117   DSGSGT-----RKRKSRWADDDPKPVIQLPDFM----GGIEFDPEIQALNSRLLEISRML  167

Query  1593  QSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKP  1414
              SGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARE+LN+ERQEII+QIIK+NPAFKP
Sbjct  168   SSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARERLNKERQEIIAQIIKRNPAFKP  227

Query  1413  PADYRPPKLQKKLYI  1369
             PADYRPPKLQKKLYI
Sbjct  228   PADYRPPKLQKKLYI  242


 Score = 51.2 bits (121),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  378   FKSDVLCKICGDGGHPTIDCPVK  400


 Score = 33.1 bits (74),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  364   PGHRQYACPSRTSTF  378


 Score = 23.5 bits (49),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  304   LHVLVEAETQEALDAAAGMVEKLLQP  329



>ref|XP_006401991.1| hypothetical protein EUTSA_v10013307mg [Eutrema salsugineum]
 gb|ESQ43444.1| hypothetical protein EUTSA_v10013307mg [Eutrema salsugineum]
Length=507

 Score =   241 bits (616),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 162/196 (83%), Gaps = 1/196 (1%)
 Frame = -2

Query  1956  DGAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgt  1777
             D   K EL +PLLSEN ++ T +  +KDQSGGEEE TSRR+RRSRWDP P++  N+    
Sbjct  23    DSVAKPELLQPLLSENAVSKTLN-DNKDQSGGEEENTSRRKRRSRWDPLPTQLVNNPITE  81

Query  1776  ggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRK  1597
             GG G        +KRKSRWADDEPKP+IQLPDFMKDF  GIEFDPEIQ LNSRLLEISR 
Sbjct  82    GGGGGSDSNTGMKKRKSRWADDEPKPVIQLPDFMKDFASGIEFDPEIQTLNSRLLEISRM  141

Query  1596  LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFK  1417
             LQSG+ LDDRPEG RSPSPEP+YDNMGIRINTREYR RE+LNRERQEIISQIIKKNPAFK
Sbjct  142   LQSGMALDDRPEGQRSPSPEPVYDNMGIRINTREYRVRERLNRERQEIISQIIKKNPAFK  201

Query  1416  PPADYRPPKLQKKLYI  1369
             PPADYRPPKLQKKL+I
Sbjct  202   PPADYRPPKLQKKLFI  217


 Score = 48.5 bits (114),  Expect(3) = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK+DVLC+ICGDGGHPTIDC VK
Sbjct  353   FKIDVLCKICGDGGHPTIDCLVK  375


 Score = 27.3 bits (59),  Expect(3) = 5e-06, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = -3

Query  1280  GQKQYACPSRTSTF  1239
             G +QY CPSRT TF
Sbjct  340   GHRQYMCPSRTITF  353


 Score = 23.5 bits (49),  Expect(3) = 5e-06, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  279   LHVLVEAETQEALEAAAGMVEKLLQP  304



>ref|XP_002510980.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF51582.1| zinc finger protein, putative [Ricinus communis]
Length=798

 Score =   246 bits (629),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 164/197 (83%), Gaps = 7/197 (4%)
 Frame = -2

Query  1941  VELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrr------srwdpppsesSNdgtg  1780
             +++ KPLLSENGLTNT+SG D+D SGGEEETTSRRRRR      +      + ++N  + 
Sbjct  67    LKIPKPLLSENGLTNTNSG-DRDFSGGEEETTSRRRRRSRWDPPADSTANSNSNNNSQST  125

Query  1779  tggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISR  1600
                +      GT RKRKSRWADDEPKP IQLPDFMKDFTGGIEFDPEIQALN+RLLEI+R
Sbjct  126   DANNSDSGTGGTTRKRKSRWADDEPKPTIQLPDFMKDFTGGIEFDPEIQALNARLLEITR  185

Query  1599  KLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAF  1420
               QSG+PLDDRPEGARSPSPEPIYDNMGIRINTRE+RARE+L +ERQ+I++Q+IK+NPAF
Sbjct  186   LFQSGMPLDDRPEGARSPSPEPIYDNMGIRINTREFRARERLTKERQDILTQMIKRNPAF  245

Query  1419  KPPADYRPPKLQKKLYI  1369
             KPPADYRPPKLQKKLYI
Sbjct  246   KPPADYRPPKLQKKLYI  262


 Score = 51.2 bits (121),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  398   FKSDVLCKICGDGGHPTIDCPVK  420


 Score = 29.6 bits (65),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -3

Query  1280  GQKQYACPSRTSTF  1239
             G +QYACPSRT+TF
Sbjct  385   GHRQYACPSRTTTF  398


 Score = 23.9 bits (50),  Expect(3) = 1e-07, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  324   LHVLVEAETQEALDAAAGMVEKLLQP  349



>ref|XP_010264378.1| PREDICTED: splicing factor 1 [Nelumbo nucifera]
Length=851

 Score =   247 bits (630),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 168/204 (82%), Gaps = 12/204 (6%)
 Frame = -2

Query  1980  NHEQTTPQDGAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppse  1801
             N ++T+ Q   PK E++KPL S+NG+ NTHSGTDKD SGGEEETTSRRRRRSRWDPP   
Sbjct  132   NDQETSAQ--IPKPEIQKPLWSDNGVNNTHSGTDKDYSGGEEETTSRRRRRSRWDPPSES  189

Query  1800  sSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNS  1621
              +  G    G          RKRKSRW+++EPKP  QLPDFMKD TGGIE DPEIQALN 
Sbjct  190   DNQKGDAGTGT---------RKRKSRWSEEEPKPF-QLPDFMKDLTGGIELDPEIQALNI  239

Query  1620  RLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQI  1441
             RLLEI+R LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARE+L RERQEIISQ+
Sbjct  240   RLLEINRMLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARERLTRERQEIISQM  299

Query  1440  IKKNPAFKPPADYRPPKLQKKLYI  1369
             IK+NPAFKPPADYRPPKLQKKLYI
Sbjct  300   IKRNPAFKPPADYRPPKLQKKLYI  323


 Score = 52.8 bits (125),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCP+K
Sbjct  459   FKSDVLCKICGDGGHPTIDCPMK  481


 Score = 32.0 bits (71),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RTSTF
Sbjct  445   PGHRQYACPARTSTF  459



>ref|XP_004514517.1| PREDICTED: branchpoint-bridging protein-like isoform X1 [Cicer 
arietinum]
 ref|XP_004514518.1| PREDICTED: branchpoint-bridging protein-like isoform X2 [Cicer 
arietinum]
Length=783

 Score =   246 bits (627),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 158/191 (83%), Gaps = 14/191 (7%)
 Frame = -2

Query  1935  LRKPLLSENGLT-NTHSGT-DKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgs  1762
             + KPLLSENGLT NT SGT DKDQSGGEEETTS+RRRRSRW        +    +     
Sbjct  55    ITKPLLSENGLTGNTRSGTTDKDQSGGEEETTSKRRRRSRW--------DPQPDSNDQAG  106

Query  1761  gtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGL  1582
             G      +KRKSRWADDEPKP+IQLPDFM    GGIEFDPEIQALNSRLLEISR LQSGL
Sbjct  107   GELGAGTKKRKSRWADDEPKPVIQLPDFM----GGIEFDPEIQALNSRLLEISRMLQSGL  162

Query  1581  PLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY  1402
             PLDDRPEGARSPSPEPIYDNMGIRINTREYRARE+L +ERQEIISQIIKKNPAFKPPADY
Sbjct  163   PLDDRPEGARSPSPEPIYDNMGIRINTREYRARERLQKERQEIISQIIKKNPAFKPPADY  222

Query  1401  RPPKLQKKLYI  1369
             RPPKLQKKLYI
Sbjct  223   RPPKLQKKLYI  233


 Score = 44.7 bits (104),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V+C+ CGDGGHP+IDCPVK
Sbjct  369   FKSEVVCKHCGDGGHPSIDCPVK  391


 Score = 32.0 bits (71),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RTSTF
Sbjct  355   PGHRQYACPTRTSTF  369



>ref|XP_002886939.1| hypothetical protein ARALYDRAFT_475645 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63198.1| hypothetical protein ARALYDRAFT_475645 [Arabidopsis lyrata subsp. 
lyrata]
Length=782

 Score =   246 bits (627),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRKSRWADDEPKP IQLPDFMKDFTGGIEFDPEIQALNSRLLEISR LQSG+PLDDRPE
Sbjct  109   RKRKSRWADDEPKPQIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRMLQSGMPLDDRPE  168

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             G RSPSPEP+YDNMGIRINTREYRARE+LNRERQEII+QIIKKNPAFKPPADYRPPKL K
Sbjct  169   GQRSPSPEPVYDNMGIRINTREYRARERLNRERQEIIAQIIKKNPAFKPPADYRPPKLHK  228

Query  1380  KLYI  1369
             KL+I
Sbjct  229   KLFI  232


 Score = 51.2 bits (121),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  368   FKSDVLCKICGDGGHPTIDCPVK  390


 Score = 32.0 bits (71),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  354   PGHRQYACPSRTNTF  368


 Score = 23.5 bits (49),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  294   LHVLVEAETQDALEAAAGMVEKLLQP  319



>gb|KEH29408.1| splicing factor-like protein [Medicago truncatula]
Length=767

 Score =   241 bits (616),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 156/187 (83%), Gaps = 15/187 (8%)
 Frame = -2

Query  1923  LLSENGLT--NTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtgt  1750
             LLSENGLT  NT SGTDKDQSGGEEETTS+RRRRSRWDP P  +           +G   
Sbjct  47    LLSENGLTGGNTRSGTDKDQSGGEEETTSKRRRRSRWDPQPDSND---------QNGEAA  97

Query  1749  gtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
                +KRKSRWADDEPKP+IQLPDFM    GGIEFDPEIQ LNSRLLEISR LQSGLPLDD
Sbjct  98    TGTKKRKSRWADDEPKPVIQLPDFM----GGIEFDPEIQTLNSRLLEISRMLQSGLPLDD  153

Query  1569  RPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPK  1390
             RPEGARSPSPEPIYDNMGIRINTREYRARE+  +ERQEIISQIIKKNPAFKPPADYRPPK
Sbjct  154   RPEGARSPSPEPIYDNMGIRINTREYRARERFQKERQEIISQIIKKNPAFKPPADYRPPK  213

Query  1389  LQKKLYI  1369
             LQKKLYI
Sbjct  214   LQKKLYI  220


 Score = 44.7 bits (104),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V+C+ CGDGGHP+IDCPVK
Sbjct  356   FKSEVVCKHCGDGGHPSIDCPVK  378


 Score = 32.0 bits (71),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RTSTF
Sbjct  342   PGHRQYACPTRTSTF  356



>ref|XP_006401996.1| hypothetical protein EUTSA_v10012746mg [Eutrema salsugineum]
 gb|ESQ43449.1| hypothetical protein EUTSA_v10012746mg [Eutrema salsugineum]
Length=773

 Score =   242 bits (617),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 163/196 (83%), Gaps = 1/196 (1%)
 Frame = -2

Query  1956  DGAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgt  1777
             D   K EL +PLLSEN ++ T +  +KDQSGGEEE TSRR+RRSRWDPPP++  N+    
Sbjct  30    DSVAKPELLQPLLSENAVSKTLN-DNKDQSGGEEENTSRRKRRSRWDPPPTQLVNNPITE  88

Query  1776  ggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRK  1597
             GG G        +KRKSRWADDEPKP+IQLPDFMKDFT GIEFDPEIQ LNSRLLEISR 
Sbjct  89    GGGGGSDSNTGMKKRKSRWADDEPKPVIQLPDFMKDFTSGIEFDPEIQTLNSRLLEISRM  148

Query  1596  LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFK  1417
             LQS + LDDRPEG RSPSPEP+YDNMGIRINTREYR RE+LNRERQEIISQIIKKNPAFK
Sbjct  149   LQSSMALDDRPEGQRSPSPEPVYDNMGIRINTREYRVRERLNRERQEIISQIIKKNPAFK  208

Query  1416  PPADYRPPKLQKKLYI  1369
             PPADYRPPKLQKKL+I
Sbjct  209   PPADYRPPKLQKKLFI  224


 Score = 51.2 bits (121),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  360   FKSDVLCKICGDGGHPTIDCPVK  382


 Score = 32.0 bits (71),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  346   PGHRQYACPSRTNTF  360


 Score = 23.5 bits (49),  Expect(3) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  286   LHVLVEAETQEALEAAAGMVEKLLQP  311



>ref|XP_009372856.1| PREDICTED: branchpoint-bridging protein-like [Pyrus x bretschneideri]
 ref|XP_009372857.1| PREDICTED: branchpoint-bridging protein-like [Pyrus x bretschneideri]
Length=781

 Score =   241 bits (614),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 158/238 (66%), Positives = 175/238 (74%), Gaps = 20/238 (8%)
 Frame = -2

Query  2058  PGKTLDSDRHNTHGSSEQQMDNNSAQN--------HEQTTPQDGAPKVELRKPLLSENGL  1903
             P +TL SD +        +   + AQN         E     D   K+ + KPLLSENGL
Sbjct  25    PAETLASDSNGPPQPPPTETPPSDAQNPFLNPQAATENGNSTDACKKLAITKPLLSENGL  84

Query  1902  TNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtgtgtGRKRKSR  1723
             TNT+SG ++D SGGEEETTSRRRRRSR DP P   +  G G  G G+       RKRKSR
Sbjct  85    TNTNSGNERDGSGGEEETTSRRRRRSRGDPQPESENQSGGGETGCGT-------RKRKSR  137

Query  1722  WADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPS  1543
             WAD+EPK  IQLPDFM    GGIEFDPEIQALNSRLLEISR L SGLPLDDRPEGARSPS
Sbjct  138   WADEEPK-AIQLPDFM----GGIEFDPEIQALNSRLLEISRMLSSGLPLDDRPEGARSPS  192

Query  1542  PEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             PEPIYDNMGIRINTRE+RARE+LN+ERQEII+QIIK+NPAFKPPADYRPPKL KKLYI
Sbjct  193   PEPIYDNMGIRINTREFRARERLNKERQEIIAQIIKRNPAFKPPADYRPPKLHKKLYI  250


 Score = 51.2 bits (121),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  386   FKSDVLCKICGDGGHPTIDCPVK  408


 Score = 33.1 bits (74),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  372   PGHRQYACPSRTSTF  386



>ref|XP_006842180.1| hypothetical protein AMTR_s00078p00155240 [Amborella trichopoda]
 gb|ERN03855.1| hypothetical protein AMTR_s00078p00155240 [Amborella trichopoda]
Length=805

 Score =   240 bits (613),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 151/221 (68%), Gaps = 16/221 (7%)
 Frame = -2

Query  2028  NTHGSSEQQMDNNSAQNHEQTTPQDGAPKVELRKPLLSENG-LTNTHSGTDKDQsggeee  1852
             N   S   Q D N  +N  +   Q+  P     KPL+SENG LT T SGTD++       
Sbjct  89    NLSESPNDQPDPNHTENQPENPYQNPKPS---EKPLVSENGGLTTTRSGTDRE-------  138

Query  1851  ttsrrrrrsrwdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMK  1672
                        +                G       GR+RK+RWAD+EPKPLIQLPDFMK
Sbjct  139   -----FSGGEEETSSKRRRRSRWEQPESGESLPDSGGRRRKTRWADEEPKPLIQLPDFMK  193

Query  1671  DFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREY  1492
             + TGG+E DPE+QALN RLL+I+R LQSGLPLDDRPEGARSPSPEP+YDNMGIRINTREY
Sbjct  194   ELTGGMELDPEVQALNIRLLDITRLLQSGLPLDDRPEGARSPSPEPVYDNMGIRINTREY  253

Query  1491  RAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             RARE+LNRERQEIISQ+IKKNPAFKPPADYRPPKLQKKLYI
Sbjct  254   RARERLNRERQEIISQLIKKNPAFKPPADYRPPKLQKKLYI  294


 Score = 50.1 bits (118),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCP+K
Sbjct  430   FKSDVLCKICGDGGHPTIDCPMK  452


 Score = 32.0 bits (71),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RTSTF
Sbjct  416   PGHRQYACPARTSTF  430


 Score = 23.5 bits (49),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  356   LHVLVEAETQEALDAAAGMVEKLLQP  381



>emb|CDY32633.1| BnaC03g16010D [Brassica napus]
Length=771

 Score =   238 bits (608),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRKSRWADDEPKP IQLPDF+K+F GGIEFDPEIQ LNSRLL+ISR LQSG+ LDDRPE
Sbjct  100   RKRKSRWADDEPKPTIQLPDFVKEFGGGIEFDPEIQVLNSRLLDISRLLQSGMALDDRPE  159

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             G RSPSPEP+YDNMGIRINTREYRARE+LNRERQEIISQIIKKNPAFKPPADYRPPKLQK
Sbjct  160   GQRSPSPEPVYDNMGIRINTREYRARERLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  219

Query  1380  KLYI  1369
             KL+I
Sbjct  220   KLFI  223


 Score = 51.6 bits (122),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  358   FKSDVLCKICGDGGHPTIDCPVK  380


 Score = 28.5 bits (62),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 10/15 (67%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +Q+ACPSR +TF
Sbjct  344   PGHRQFACPSRLNTF  358



>ref|XP_009370447.1| PREDICTED: branchpoint-bridging protein-like [Pyrus x bretschneideri]
 ref|XP_009370449.1| PREDICTED: branchpoint-bridging protein-like [Pyrus x bretschneideri]
Length=781

 Score =   238 bits (608),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 176/238 (74%), Gaps = 20/238 (8%)
 Frame = -2

Query  2058  PGKTLDSDRHNTHGSSEQQMDNNSAQN--------HEQTTPQDGAPKVELRKPLLSENGL  1903
             P +TL SD +        +   + AQN         E     D   K+ + KPLLSENGL
Sbjct  25    PAETLASDSNGPPQPPPTETPPSDAQNPFPNPQAATENGNSTDACKKLAITKPLLSENGL  84

Query  1902  TNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtgtgtGRKRKSR  1723
             TNT+SG ++D SGGEEETTSRRRRRSRWDP P   +  G G  G G+       RKRKSR
Sbjct  85    TNTNSGNERDGSGGEEETTSRRRRRSRWDPQPESENQSGGGETGSGT-------RKRKSR  137

Query  1722  WADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPS  1543
             WAD+EPK  IQLPDFM    GGIEFDPEIQALNSRLLEISR L SGLPLDDRPEGARSPS
Sbjct  138   WADEEPK-AIQLPDFM----GGIEFDPEIQALNSRLLEISRMLSSGLPLDDRPEGARSPS  192

Query  1542  PEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             PEPIYDNMGIRINTRE+RARE+LN+ERQEII+QIIK+NPAFKPPADYRPPKL KKLYI
Sbjct  193   PEPIYDNMGIRINTREFRARERLNKERQEIIAQIIKRNPAFKPPADYRPPKLHKKLYI  250


 Score = 51.2 bits (121),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  386   FKSDVLCKICGDGGHPTIDCPVK  408


 Score = 33.1 bits (74),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  372   PGHRQYACPSRTSTF  386



>ref|XP_009374466.1| PREDICTED: branchpoint-bridging protein-like [Pyrus x bretschneideri]
Length=791

 Score =   238 bits (608),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 165/209 (79%), Gaps = 14/209 (7%)
 Frame = -2

Query  1995  NNSAQNHEQTTPQDGAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwd  1816
             N + +N   T   D    + + KPLLSENGLTNT SG ++D SGGEEETTSRRRRRSRWD
Sbjct  64    NTATENGNST---DACKVLAIMKPLLSENGLTNTTSGNERDGSGGEEETTSRRRRRSRWD  120

Query  1815  pppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEI  1636
             P     +  G G  G G+       RKRKSRWAD+EPK  IQLPDFM    GGIEFDPEI
Sbjct  121   PQAESDNQRGGGETGSGT-------RKRKSRWADEEPKQAIQLPDFM----GGIEFDPEI  169

Query  1635  QALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQE  1456
             QALNSRLLEISR L SGLPLDDRPEGARSPSPEPIYDNMGIRINTRE+RARE+LN+ERQE
Sbjct  170   QALNSRLLEISRMLSSGLPLDDRPEGARSPSPEPIYDNMGIRINTREFRARERLNKERQE  229

Query  1455  IISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             II+QIIK+NPAFKPPADYRPPKL KKLYI
Sbjct  230   IIAQIIKRNPAFKPPADYRPPKLHKKLYI  258


 Score = 51.6 bits (122),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  394   FKSDVLCKICGDGGHPTIDCPVK  416


 Score = 33.1 bits (74),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  380   PGHRQYACPSRTSTF  394



>ref|XP_009132612.1| PREDICTED: branchpoint-bridging protein [Brassica rapa]
 emb|CDY38859.1| BnaA03g13200D [Brassica napus]
Length=762

 Score =   238 bits (606),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRKSRWADDEPKP IQLPDF+K+F GGIEFDPEIQ LNSRLL+ISR LQSG+ LDDRPE
Sbjct  91    RKRKSRWADDEPKPTIQLPDFVKEFGGGIEFDPEIQVLNSRLLDISRLLQSGMALDDRPE  150

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             G RSPSPEP+YDNMGIRINTREYRARE+LNRERQEIISQIIKKNPAFKPPADYRPPKLQK
Sbjct  151   GQRSPSPEPVYDNMGIRINTREYRARERLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  210

Query  1380  KLYI  1369
             KL+I
Sbjct  211   KLFI  214


 Score = 51.2 bits (121),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  349   FKSDVLCKICGDGGHPTIDCPVK  371


 Score = 28.5 bits (62),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 10/15 (67%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +Q+ACPSR +TF
Sbjct  335   PGHRQFACPSRLNTF  349



>ref|XP_010680635.1| PREDICTED: branchpoint-bridging protein [Beta vulgaris subsp. 
vulgaris]
Length=778

 Score =   238 bits (606),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 118/124 (95%), Gaps = 4/124 (3%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRKSRWADDEPKP+ QLPDFM    GGIEFDPE+Q+LNSRLLEISRKLQSGLPLDDRPE
Sbjct  141   RKRKSRWADDEPKPVYQLPDFM----GGIEFDPEVQSLNSRLLEISRKLQSGLPLDDRPE  196

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             GARSPSPEP+YDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKL K
Sbjct  197   GARSPSPEPVYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLHK  256

Query  1380  KLYI  1369
             KLYI
Sbjct  257   KLYI  260


 Score = 51.6 bits (122),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  396   FKSDVLCKICGDGGHPTIDCPVK  418


 Score = 33.1 bits (74),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  382   PGHRQYACPSRTSTF  396



>ref|XP_008347216.1| PREDICTED: branchpoint-bridging protein-like [Malus domestica]
Length=794

 Score =   238 bits (607),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 176/238 (74%), Gaps = 20/238 (8%)
 Frame = -2

Query  2058  PGKTLDSDRHN--------THGSSEQQMDNNSAQNHEQTTPQDGAPKVELRKPLLSENGL  1903
             P +TL SD +         T  S  Q    N     E  T  D   K+ + KPLLSENGL
Sbjct  38    PAETLASDSNGPPQPPHTETLASDAQNPFPNPQIATENGTSTDACKKLAITKPLLSENGL  97

Query  1902  TNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtgtgtGRKRKSR  1723
             TNT+SG ++D SGGEEETTSRRRRRSRWDP P   S  G G  G G+       RKRKSR
Sbjct  98    TNTNSGNERDGSGGEEETTSRRRRRSRWDPQPESESQSGGGETGSGT-------RKRKSR  150

Query  1722  WADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPS  1543
             WAD+EPK  IQLPDFM    GGIEFDPEIQALNSRLLEISR L SGLPLDDRPEGARSPS
Sbjct  151   WADEEPK-AIQLPDFM----GGIEFDPEIQALNSRLLEISRMLSSGLPLDDRPEGARSPS  205

Query  1542  PEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             PEPIYDNMGIRINTRE+RARE+LN+ERQEII+QIIK+NPAFKPPADYRPPKL KKLYI
Sbjct  206   PEPIYDNMGIRINTREFRARERLNKERQEIIAQIIKRNPAFKPPADYRPPKLHKKLYI  263


 Score = 51.2 bits (121),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  399   FKSDVLCKICGDGGHPTIDCPVK  421


 Score = 32.7 bits (73),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  385   PGHRQYACPSRTSTF  399



>ref|XP_003539505.1| PREDICTED: branchpoint-bridging protein-like isoform 1 [Glycine 
max]
Length=780

 Score =   237 bits (604),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 159/252 (63%), Positives = 177/252 (70%), Gaps = 29/252 (12%)
 Frame = -2

Query  2124  PSQTLDQSQSHSVAAYPQEQNQPGKTLDSDRHNTHGSSEQQMDNNSAQNHEQTTPQDGAP  1945
             P  T D S+ H+   +  E  Q G   +  + + +GS +   DNN         PQ    
Sbjct  12    PLPTYDPSEYHNPPQHQSETGQNGNGTNLGKPSENGS-QVAADNNG------LNPQ----  60

Query  1944  KVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdg  1765
                + KPLLSE GLT   SGTD+DQSGGEEETTS+RRRRSRW        +    +    
Sbjct  61    ---ISKPLLSE-GLT--RSGTDRDQSGGEEETTSKRRRRSRW--------DPQPESNEQS  106

Query  1764  sgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG  1585
              G      +KRKSRWADD+PKP+IQLPDFM    GGIEFDPEIQALNSRLLEISR LQSG
Sbjct  107   GGDSGTGPKKRKSRWADDDPKPVIQLPDFM----GGIEFDPEIQALNSRLLEISRMLQSG  162

Query  1584  LPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPAD  1405
             LPLDDRPEGARSPSPEPIYDNMGIRINTREYRARE+L +ERQEIISQIIKKNPAFKPP D
Sbjct  163   LPLDDRPEGARSPSPEPIYDNMGIRINTREYRARERLQKERQEIISQIIKKNPAFKPPVD  222

Query  1404  YRPPKLQKKLYI  1369
             YRPPKLQKKLYI
Sbjct  223   YRPPKLQKKLYI  234


 Score = 44.7 bits (104),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V+C+ CGDGGHP+IDCPVK
Sbjct  370   FKSEVVCKHCGDGGHPSIDCPVK  392


 Score = 32.0 bits (71),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RTSTF
Sbjct  356   PGHRQYACPTRTSTF  370



>ref|XP_003534409.1| PREDICTED: branchpoint-bridging protein-like [Glycine max]
Length=780

 Score =   236 bits (603),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 169/220 (77%), Gaps = 19/220 (9%)
 Frame = -2

Query  2013  SEQQMDNNSAQNHE-----QTTPQDGAPKVELRKPLLSENGLTNTHSGTDKDQsggeeet  1849
             SE   + N  +N E     Q    +    +++ KPLLSE     T SGTD+DQSGGEEET
Sbjct  29    SETGENGNGTKNGEPSENGQVAADNNGLHLQISKPLLSEG---MTRSGTDRDQSGGEEET  85

Query  1848  tsrrrrrsrwdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKD  1669
             TS+RRRRSRWDP P  +   G G  G G        +KRKSRWADDEPKP+IQLPDFM  
Sbjct  86    TSKRRRRSRWDPQPESNDQSGGGDSGSGP-------KKRKSRWADDEPKPVIQLPDFM--  136

Query  1668  FTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYR  1489
               GGIEFDPEIQALNSRLLEISR LQSGLPLDDRPEGARSPSPEP+YDNMGIRINTREYR
Sbjct  137   --GGIEFDPEIQALNSRLLEISRMLQSGLPLDDRPEGARSPSPEPVYDNMGIRINTREYR  194

Query  1488  AREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             ARE+L +ERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI
Sbjct  195   ARERLQKERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  234


 Score = 44.7 bits (104),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V+C+ CGDGGHP+IDCPVK
Sbjct  370   FKSEVVCKHCGDGGHPSIDCPVK  392


 Score = 32.0 bits (71),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RTSTF
Sbjct  356   PGHRQYACPTRTSTF  370



>ref|XP_007131353.1| hypothetical protein PHAVU_011G006700g [Phaseolus vulgaris]
 gb|ESW03347.1| hypothetical protein PHAVU_011G006700g [Phaseolus vulgaris]
Length=803

 Score =   234 bits (596),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 161/190 (85%), Gaps = 12/190 (6%)
 Frame = -2

Query  1938  ELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsg  1759
             ++ KPLLSE GLT   SGTD+DQSGGEEETTS+RRRRSRWDP P  +   G   G  GSG
Sbjct  66    QISKPLLSE-GLT--RSGTDRDQSGGEEETTSKRRRRSRWDPQPESNDQSGQSGGELGSG  122

Query  1758  tgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLP  1579
                   +KRKSRWADDEPKP+IQLPDFM    GGIEFDPEIQALNSRLLEISR LQSGLP
Sbjct  123   P-----KKRKSRWADDEPKPVIQLPDFM----GGIEFDPEIQALNSRLLEISRMLQSGLP  173

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYR  1399
             LDDRPEGARSPSPEPIYDNMGIRINTRE RARE+L +ERQEIISQIIKKNPAFKPPADYR
Sbjct  174   LDDRPEGARSPSPEPIYDNMGIRINTRECRARERLQKERQEIISQIIKKNPAFKPPADYR  233

Query  1398  PPKLQKKLYI  1369
             PPKLQKKLYI
Sbjct  234   PPKLQKKLYI  243


 Score = 44.7 bits (104),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V+C+ CGDGGHP+IDCPVK
Sbjct  379   FKSEVVCKHCGDGGHPSIDCPVK  401


 Score = 32.0 bits (71),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RTSTF
Sbjct  365   PGHRQYACPTRTSTF  379



>ref|XP_004307795.1| PREDICTED: uncharacterized protein LOC101299998 isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004307796.1| PREDICTED: uncharacterized protein LOC101299998 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=756

 Score =   232 bits (592),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 166/255 (65%), Gaps = 22/255 (9%)
 Frame = -2

Query  2133  PQNPSQTLDQSQSHSVAAYPQEQNQPGKTLDSDRHNTHGSSEQQMDNNSAQNHEQTTPQD  1954
             P NP +TLD    H  A+     + P +++ SD  +      Q +  ++A   E  TP D
Sbjct  5     PPNPIETLD----HQPAS---NNHNPPESIVSDYKDPSPPPSQTLAFHAAA--ENGTPAD  55

Query  1953  GAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtg  1774
              +  V L   L+SENGLTNT SGT   +            RR R      +  ++  G  
Sbjct  56    ASKAVAL---LISENGLTNTQSGTTDREVSLSGGEEETTSRRRRRSRWDPQPESESQGDE  112

Query  1773  gdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKL  1594
                        RKRKSRWA +EPKP++QLPDFM    GGIEFDPEIQALNSRLLEISR L
Sbjct  113   SGSGK------RKRKSRWAAEEPKPVVQLPDFM----GGIEFDPEIQALNSRLLEISRML  162

Query  1593  QSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKP  1414
              SGLPLDDRPEGARSPSPEP+YDNMGIRINTRE+RARE+LNRERQEII+QI+K+NP +KP
Sbjct  163   SSGLPLDDRPEGARSPSPEPVYDNMGIRINTREFRARERLNRERQEIIAQILKRNPNYKP  222

Query  1413  PADYRPPKLQKKLYI  1369
             PADYRPPKL KKLYI
Sbjct  223   PADYRPPKLHKKLYI  237


 Score = 52.8 bits (125),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCP+K
Sbjct  373   FKSDVLCKICGDGGHPTIDCPMK  395


 Score = 33.1 bits (74),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  359   PGHRQYACPSRTSTF  373



>ref|XP_006393481.1| hypothetical protein EUTSA_v100114671mg, partial [Eutrema salsugineum]
 gb|ESQ30767.1| hypothetical protein EUTSA_v100114671mg, partial [Eutrema salsugineum]
Length=307

 Score =   213 bits (543),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             +KRKSRWADDE KP+IQL DFMKDF   IEFDPEIQ LNSRLLEISR LQSG+ LDD PE
Sbjct  66    KKRKSRWADDELKPVIQLSDFMKDFISTIEFDPEIQTLNSRLLEISRTLQSGMALDDIPE  125

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             G RS S EP+YDN+GIRINTREYR REKLNRERQEIISQIIKKNPAFKPPADY+ PKLQK
Sbjct  126   GHRSLSLEPVYDNIGIRINTREYRGREKLNRERQEIISQIIKKNPAFKPPADYKLPKLQK  185

Query  1380  KLYI  1369
             KL+I
Sbjct  186   KLFI  189



>ref|XP_008669507.1| PREDICTED: branchpoint-bridging protein-like [Zea mays]
 ref|XP_008669508.1| PREDICTED: branchpoint-bridging protein-like [Zea mays]
 tpg|DAA38179.1| TPA: hypothetical protein ZEAMMB73_126317 [Zea mays]
Length=750

 Score =   223 bits (567),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 115/124 (93%), Gaps = 2/124 (2%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRK+RWA++EP+P I LPDFMKDF    E DPE+ ALN+RLLEISR LQSGLPLDDRPE
Sbjct  71    RKRKTRWAEEEPRPAIALPDFMKDFAA--EMDPEVHALNARLLEISRLLQSGLPLDDRPE  128

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             GARSPSPEP+YDN+GIRINTREYRARE+LNRERQEIISQ+I++NPAFKPP+DYRPPKLQK
Sbjct  129   GARSPSPEPVYDNLGIRINTREYRARERLNRERQEIISQLIRRNPAFKPPSDYRPPKLQK  188

Query  1380  KLYI  1369
             KLYI
Sbjct  189   KLYI  192


 Score = 49.7 bits (117),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DV C+ICGDGGHPTIDCPVK
Sbjct  328   FKSDVQCKICGDGGHPTIDCPVK  350


 Score = 25.4 bits (54),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 8/14 (57%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -3

Query  1280  GQKQYACPSRTSTF  1239
             G +QYACP++ +TF
Sbjct  315   GHRQYACPNKMNTF  328



>ref|XP_002465427.1| hypothetical protein SORBIDRAFT_01g038690 [Sorghum bicolor]
 gb|EER92425.1| hypothetical protein SORBIDRAFT_01g038690 [Sorghum bicolor]
Length=727

 Score =   221 bits (564),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 115/124 (93%), Gaps = 2/124 (2%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRK+RWA++EP+P I LPDFMKDF    E DPE+ ALN+RLLEISR LQSGLPLDDRPE
Sbjct  72    RKRKTRWAEEEPRPAIALPDFMKDFAA--EMDPEVHALNARLLEISRLLQSGLPLDDRPE  129

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             GARSPSPEP+YDN+GIRINTREYRARE+LNRERQEIISQ+I++NPAFKPP+DYRPPKLQK
Sbjct  130   GARSPSPEPVYDNIGIRINTREYRARERLNRERQEIISQLIRRNPAFKPPSDYRPPKLQK  189

Query  1380  KLYI  1369
             KLYI
Sbjct  190   KLYI  193


 Score = 49.7 bits (117),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DV C+ICGDGGHPTIDCPVK
Sbjct  329   FKSDVQCKICGDGGHPTIDCPVK  351


 Score = 25.4 bits (54),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 8/14 (57%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -3

Query  1280  GQKQYACPSRTSTF  1239
             G +QYACP++ +TF
Sbjct  316   GHRQYACPNKMNTF  329



>ref|XP_006414750.1| hypothetical protein EUTSA_v10024523mg [Eutrema salsugineum]
 gb|ESQ56203.1| hypothetical protein EUTSA_v10024523mg [Eutrema salsugineum]
Length=730

 Score =   221 bits (563),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 156/234 (67%), Gaps = 38/234 (16%)
 Frame = -2

Query  2046  LDSDRHNTHGSSEQQMDN--------NSAQNHEQTTPQDGAPKVELRKPLLSENGLTNTH  1891
             +DS   N +  S   +DN        +S+   +Q  PQ   P  E  + L+SE G++ T 
Sbjct  1     MDSVELNQYNHSSHALDNPPPSSEALDSSTASDQLNPQ--IPTSEFTRDLVSEKGVSKTM  58

Query  1890  SGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdgsgtgtgtGRKRKSRWADD  1711
             SGT+KDQSGGEEE TSR R+R                              KRKSRWADD
Sbjct  59    SGTEKDQSGGEEENTSRSRKRRSRWDSSPP---------------------KRKSRWADD  97

Query  1710  EPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPI  1531
             EPKP+IQLPDFM       EFDPE+Q LN+RLLEISR LQSGLPLDDR EG RSPSPEPI
Sbjct  98    EPKPIIQLPDFM-------EFDPEVQVLNARLLEISRILQSGLPLDDRQEGQRSPSPEPI  150

Query  1530  YDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             YDN GIR+NTREYRA+E+LNRERQEIISQII KNPAFKPPADYRPPKLQKKL+I
Sbjct  151   YDNNGIRVNTREYRAKERLNRERQEIISQIISKNPAFKPPADYRPPKLQKKLFI  204


 Score = 51.2 bits (121),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  337   FKSDVLCKICGDGGHPTIDCPVK  359


 Score = 25.4 bits (54),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = -3

Query  1280  GQKQYACPSRTSTF  1239
             G +QYACPS  +TF
Sbjct  324   GHRQYACPSSATTF  337



>ref|XP_009402178.1| PREDICTED: branchpoint-bridging protein-like [Musa acuminata 
subsp. malaccensis]
Length=772

 Score =   221 bits (564),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 117/124 (94%), Gaps = 2/124 (2%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRKSRWA++EPKP +QLPDFMK+FT   + DPE+QALN RLLEISR+LQS LPLDDRPE
Sbjct  144   RKRKSRWAEEEPKPTVQLPDFMKEFTA--DLDPEVQALNFRLLEISRRLQSNLPLDDRPE  201

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             GARSPSPEPIYDNMGIRINTREYRARE+LN+ERQEIISQ+I++NPAF+PPADYRPPKLQK
Sbjct  202   GARSPSPEPIYDNMGIRINTREYRARERLNKERQEIISQLIQRNPAFRPPADYRPPKLQK  261

Query  1380  KLYI  1369
             KLYI
Sbjct  262   KLYI  265


 Score = 52.8 bits (125),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 39/77 (51%), Gaps = 11/77 (14%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVKR*IKWHAWHLTAGKRSKTTNPRSLENIHVAGDQKS-K  1064
             FK DVLC+ICGDGGHPTIDCP+K           AGK+        L  +  A  + S K
Sbjct  401   FKSDVLCKICGDGGHPTIDCPMK----------GAGKKMDDEYQNFLAELGGAAPESSTK  450

Query  1063  QKLNTQVAGRKTVAAAP  1013
             Q +   + G  T  + P
Sbjct  451   QNIALPLLGSSTSGSNP  467


 Score = 32.0 bits (71),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  1286  SPGQKQYACPSRTSTF  1239
              PG +QYACP+RTSTF
Sbjct  386   EPGHRQYACPARTSTF  401



>ref|XP_004975388.1| PREDICTED: branchpoint-bridging protein-like [Setaria italica]
Length=730

 Score =   221 bits (562),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 115/124 (93%), Gaps = 2/124 (2%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRK+RWA++EP+P I LPDFMKDF    E DPE+ ALN+RLLEISR LQSGLPLDDRPE
Sbjct  80    RKRKTRWAEEEPRPAIALPDFMKDFAA--EMDPEVHALNARLLEISRLLQSGLPLDDRPE  137

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             GARSPSPEP+YDN+GIRINTREYRARE+LNRERQEIISQ+I++NPAFKPP+DYRPPKLQK
Sbjct  138   GARSPSPEPVYDNLGIRINTREYRARERLNRERQEIISQLIRRNPAFKPPSDYRPPKLQK  197

Query  1380  KLYI  1369
             KLYI
Sbjct  198   KLYI  201


 Score = 49.3 bits (116),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DV C+ICGDGGHPTIDCPVK
Sbjct  337   FKSDVQCKICGDGGHPTIDCPVK  359


 Score = 27.7 bits (60),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 9/15 (60%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP++ +TF
Sbjct  323   PGHRQYACPNKMNTF  337



>ref|XP_008801638.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008801658.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008801666.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008801674.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
Length=789

 Score =   221 bits (562),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 154/198 (78%), Gaps = 16/198 (8%)
 Frame = -2

Query  1962  PQDGAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgt  1783
             P    P    R P +SENGL  THSGT+KD SGGEE+ +SRRRRRSRWDPP     N  +
Sbjct  98    PAASEPGGSERPPPISENGLAVTHSGTEKDCSGGEEDASSRRRRRSRWDPPAESDQNGDS  157

Query  1782  gtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEIS  1603
                           RKRKSRWA++EP+ +IQLPDFMKDFT   + DPE+QALN RLL+I+
Sbjct  158   --------------RKRKSRWAEEEPQAVIQLPDFMKDFTA--DLDPEVQALNVRLLDIN  201

Query  1602  RKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPA  1423
             R+LQS LPLDD PEGARSPSPEPIYDNMGIRINTREYRARE+LN+ERQEIISQ+I++NPA
Sbjct  202   RRLQSNLPLDDCPEGARSPSPEPIYDNMGIRINTREYRARERLNKERQEIISQLIQRNPA  261

Query  1422  FKPPADYRPPKLQKKLYI  1369
             F+PP DYRPPKLQ+KLYI
Sbjct  262   FRPPPDYRPPKLQRKLYI  279


 Score = 50.1 bits (118),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCP+K
Sbjct  415   FKSDVLCKICGDGGHPTIDCPMK  437


 Score = 32.0 bits (71),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  401   PGHRQYACPSRTTTF  415



>ref|XP_003579604.1| PREDICTED: branchpoint-bridging protein [Brachypodium distachyon]
 ref|XP_010239806.1| PREDICTED: branchpoint-bridging protein [Brachypodium distachyon]
Length=749

 Score =   220 bits (560),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 2/124 (2%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRKSRWA++EP+P I LPDFMKDF    E DPE+  LNSRLLEISR LQSGLPLDDRPE
Sbjct  75    RKRKSRWAEEEPRPTIALPDFMKDFAA--EMDPEVHNLNSRLLEISRLLQSGLPLDDRPE  132

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             GARSPSPEPIYDN+GIRINTREYRARE+LNRERQEIISQ+I++NPAFKPPADYRPPKL K
Sbjct  133   GARSPSPEPIYDNLGIRINTREYRARERLNRERQEIISQLIRRNPAFKPPADYRPPKLHK  192

Query  1380  KLYI  1369
             KLYI
Sbjct  193   KLYI  196


 Score = 47.8 bits (112),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V C+ICGDGGHPTIDCPVK
Sbjct  332   FKSEVQCKICGDGGHPTIDCPVK  354


 Score = 30.8 bits (68),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RT+TF
Sbjct  318   PGHRQYACPNRTTTF  332



>ref|XP_002448361.1| hypothetical protein SORBIDRAFT_06g025810 [Sorghum bicolor]
 gb|EES12689.1| hypothetical protein SORBIDRAFT_06g025810 [Sorghum bicolor]
Length=727

 Score =   219 bits (559),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 2/124 (2%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRK+RWA++EP+P I LPDFMKDF    E DPE+ ALN+RLLEISR LQSGLPLDDRPE
Sbjct  71    RKRKTRWAEEEPRPAIALPDFMKDFAA--EMDPEVHALNARLLEISRLLQSGLPLDDRPE  128

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             GARSPSPEP+YDN+GIRINTREYRARE+LNRERQEIISQ+I++NP FKPP+DYRPPKLQK
Sbjct  129   GARSPSPEPVYDNLGIRINTREYRARERLNRERQEIISQLIRRNPTFKPPSDYRPPKLQK  188

Query  1380  KLYI  1369
             KLYI
Sbjct  189   KLYI  192


 Score = 49.3 bits (116),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DV C+ICGDGGHPTIDCPVK
Sbjct  328   FKSDVQCKICGDGGHPTIDCPVK  350


 Score = 25.4 bits (54),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 8/14 (57%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -3

Query  1280  GQKQYACPSRTSTF  1239
             G +QYACP++ +TF
Sbjct  315   GHRQYACPNKMNTF  328



>ref|XP_010905186.1| PREDICTED: branchpoint-bridging protein-like [Elaeis guineensis]
 ref|XP_010905187.1| PREDICTED: branchpoint-bridging protein-like [Elaeis guineensis]
Length=724

 Score =   219 bits (559),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 114/124 (92%), Gaps = 2/124 (2%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRKSRWA++EP PL+QL DFMKD     + DPE+QALN RLLEISR LQSG+PLDDRPE
Sbjct  74    RKRKSRWAEEEPNPLVQLSDFMKDLAA--DLDPEVQALNLRLLEISRLLQSGMPLDDRPE  131

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             GARSPSPEPIYDNMGIRINTREYRARE+LN+ERQEIISQ+I++NPAFKPPADYRPPKLQK
Sbjct  132   GARSPSPEPIYDNMGIRINTREYRARERLNKERQEIISQLIRRNPAFKPPADYRPPKLQK  191

Query  1380  KLYI  1369
             KLYI
Sbjct  192   KLYI  195


 Score = 48.5 bits (114),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DV C+ICGDGGHPTIDCP+K
Sbjct  331   FKSDVQCKICGDGGHPTIDCPMK  353


 Score = 32.0 bits (71),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  317   PGHRQYACPSRTTTF  331



>emb|CBI20199.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   207 bits (527),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/103 (96%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = -2

Query  1677  MKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTR  1498
             MKDFTGGIEFDPEIQALNSRLLEISR LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTR
Sbjct  1     MKDFTGGIEFDPEIQALNSRLLEISRMLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTR  60

Query  1497  EYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             EYRARE+LNRERQEIISQI+K+NPAFKPPADYRPPKLQKKLYI
Sbjct  61    EYRARERLNRERQEIISQILKRNPAFKPPADYRPPKLQKKLYI  103



>ref|NP_001169335.1| hypothetical protein [Zea mays]
 gb|ACN33460.1| unknown [Zea mays]
 gb|AFW58047.1| hypothetical protein ZEAMMB73_457780 [Zea mays]
Length=714

 Score =   218 bits (555),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 114/124 (92%), Gaps = 2/124 (2%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRK+RWA++EP+P I LPDFMKDF    E DPE+ ALN+RLL+ISR LQSGLPLDDRPE
Sbjct  64    RKRKTRWAEEEPRPAIALPDFMKDFAA--EMDPEVHALNARLLDISRLLQSGLPLDDRPE  121

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             GARSPSPEP+YDN GIRINTREYRARE+LNRERQ+IISQ+I++NPAFKPP+DYRPPKLQK
Sbjct  122   GARSPSPEPVYDNFGIRINTREYRARERLNRERQDIISQLIRRNPAFKPPSDYRPPKLQK  181

Query  1380  KLYI  1369
             KLYI
Sbjct  182   KLYI  185


 Score = 49.3 bits (116),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DV C+ICGDGGHPTIDCPVK
Sbjct  321   FKSDVQCKICGDGGHPTIDCPVK  343


 Score = 25.4 bits (54),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 8/14 (57%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -3

Query  1280  GQKQYACPSRTSTF  1239
             G +QYACP++ +TF
Sbjct  308   GHRQYACPNKMNTF  321



>gb|EMT18286.1| Branchpoint-bridging protein [Aegilops tauschii]
Length=749

 Score =   218 bits (555),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 112/124 (90%), Gaps = 2/124 (2%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRKSRWA+ EP+P I LPDFMKDF    E DPE+  LNSRLLEISR L+SGLPLDDRPE
Sbjct  75    RKRKSRWAEAEPRPTIALPDFMKDFAA--EMDPEVHNLNSRLLEISRLLRSGLPLDDRPE  132

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             GARSPSPEPIYDN+GIRINTREYRARE+LNRERQEIISQ+I++NPAFKPPADYRPPKL K
Sbjct  133   GARSPSPEPIYDNLGIRINTREYRARERLNRERQEIISQLIRRNPAFKPPADYRPPKLHK  192

Query  1380  KLYI  1369
             KLYI
Sbjct  193   KLYI  196


 Score = 48.1 bits (113),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V C+ICGDGGHPTIDCPVK
Sbjct  332   FKSEVQCKICGDGGHPTIDCPVK  354


 Score = 31.2 bits (69),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RT+TF
Sbjct  318   PGHRQYACPNRTTTF  332



>ref|XP_008801838.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
Length=725

 Score =   217 bits (553),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 114/124 (92%), Gaps = 2/124 (2%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             +KRKSRWA++EP P++QLPDFMKDF    + DPE+QALN RLLEISR LQSG+PLDDRPE
Sbjct  75    QKRKSRWANEEPNPVVQLPDFMKDFAA--DLDPEVQALNLRLLEISRLLQSGMPLDDRPE  132

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             GARSPSPEPIYDNMGIRINTREYRARE+L +ERQ IISQ+I++NPAFKPPADYRPPKLQK
Sbjct  133   GARSPSPEPIYDNMGIRINTREYRARERLTKERQGIISQLIQRNPAFKPPADYRPPKLQK  192

Query  1380  KLYI  1369
             KLYI
Sbjct  193   KLYI  196


 Score = 49.7 bits (117),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK+DV C+ICGDGGHPTIDCP+K
Sbjct  332   FKIDVQCKICGDGGHPTIDCPMK  354


 Score = 30.8 bits (68),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RT+TF
Sbjct  318   PGHRQYACPARTTTF  332



>ref|XP_010917529.1| PREDICTED: branchpoint-bridging protein-like [Elaeis guineensis]
Length=761

 Score =   216 bits (549),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 2/124 (2%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRK+RWAD+EPKP+ QLPDFMKDF    + DPE+QALN RLLEI+R LQSG+P DDRPE
Sbjct  129   RKRKTRWADEEPKPVGQLPDFMKDFAA--DLDPEVQALNLRLLEINRLLQSGMPQDDRPE  186

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             GARSPSPEPIYDNMGIRINTREYRARE+L +ERQEIISQ+I +NPAFKPPADYRPPKLQK
Sbjct  187   GARSPSPEPIYDNMGIRINTREYRARERLTKERQEIISQLICRNPAFKPPADYRPPKLQK  246

Query  1380  KLYI  1369
             KLYI
Sbjct  247   KLYI  250


 Score = 48.1 bits (113),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DV C+ICGDGGHPTIDCP+K
Sbjct  386   FKSDVQCKICGDGGHPTIDCPMK  408


 Score = 30.8 bits (68),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RT+TF
Sbjct  372   PGHRQYACPARTTTF  386



>gb|AEW07878.1| hypothetical protein 0_13604_02, partial [Pinus radiata]
 gb|AFG52497.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52498.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52499.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52500.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52501.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52502.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52503.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52504.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52505.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52506.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52507.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52508.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52509.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52510.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52511.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52512.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52513.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
 gb|AFG52514.1| hypothetical protein 0_13604_02, partial [Pinus taeda]
Length=129

 Score =   196 bits (497),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 2/119 (2%)
 Frame = -2

Query  1713  DEPKPL--IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSP  1540
             DEPKPL  IQLP F+K+ TGG+E DPE+QALN+RL++I R LQSG+PLDDRPEGARSPSP
Sbjct  1     DEPKPLMGIQLPGFVKELTGGMELDPEVQALNARLMDIHRLLQSGMPLDDRPEGARSPSP  60

Query  1539  EPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYIHV  1363
             EPIYDN GIRINTRE+RAREKL RERQE+ISQ+IK+NPAFKPPADYRPPKL KKL+I V
Sbjct  61    EPIYDNDGIRINTREFRAREKLTRERQEVISQLIKRNPAFKPPADYRPPKLYKKLFIPV  119



>ref|XP_010926686.1| PREDICTED: branchpoint-bridging protein-like [Elaeis guineensis]
 ref|XP_010926687.1| PREDICTED: branchpoint-bridging protein-like [Elaeis guineensis]
Length=756

 Score =   212 bits (539),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 154/199 (77%), Gaps = 12/199 (6%)
 Frame = -2

Query  1965  TPQDGAPKVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdg  1786
              P    P    R P + ENGL  THSGTDKD SGGEE+ +SRRRRRSRWDPP     N  
Sbjct  59    VPAVSKPGGSERPPPIFENGLAFTHSGTDKDCSGGEEDASSRRRRRSRWDPPAESDQNSD  118

Query  1785  tgtggdgsgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEI  1606
               +            RKRKSRWA++EP+ LIQLPDFMKDFT   + DPE+QALN RLL++
Sbjct  119   ASSSS----------RKRKSRWAEEEPQALIQLPDFMKDFTA--DLDPEVQALNVRLLDV  166

Query  1605  SRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNP  1426
             +R+LQS LPLDDRPEGARSPSPEPIYDNMGIRINTREYRARE+LN+ERQEIISQ+I++NP
Sbjct  167   NRRLQSNLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARERLNKERQEIISQLIQRNP  226

Query  1425  AFKPPADYRPPKLQKKLYI  1369
             AF+PP DYRPPKLQKKLYI
Sbjct  227   AFRPPPDYRPPKLQKKLYI  245


 Score = 50.1 bits (118),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCP+K
Sbjct  381   FKSDVLCKICGDGGHPTIDCPMK  403


 Score = 32.0 bits (71),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  367   PGHRQYACPSRTTTF  381


 Score = 23.5 bits (49),  Expect(3) = 8e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  307   LHVLVEAETQESLDAACAMVEKLLQP  332



>ref|XP_010532355.1| PREDICTED: branchpoint-bridging protein [Tarenaya hassleriana]
Length=822

 Score =   211 bits (538),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 155/198 (78%), Gaps = 9/198 (5%)
 Frame = -2

Query  1944  KVELRKPLLSENGLTNTHSGTDKDQsggeeettsrrrrrsrwdpppsesSNdgtgtggdg  1765
             K E++ PLLSENG + T SG DKDQSGGEEETTSRRRRRSRW+PPPSE +N  +  G   
Sbjct  60    KPEIQPPLLSENGFSKTQSGADKDQSGGEEETTSRRRRRSRWEPPPSELNNTISDGGTGD  119

Query  1764  sgtgtgtGRKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG  1585
             S T T   +KRKSRWADDEPKP+IQLPDFMKDFTGGIEFDPEIQ LNSRLLEISR LQSG
Sbjct  120   SSTAT---KKRKSRWADDEPKPVIQLPDFMKDFTGGIEFDPEIQTLNSRLLEISRMLQSG  176

Query  1584  LPLDDRPEGARSPSPEPIYDNMGIRI-NTREYRAREKLN-----RERQEIISQIIKKNPA  1423
             +PLDDRPEG RSPSPEPIY  +       +++   +         ERQEIISQIIKKNPA
Sbjct  177   MPLDDRPEGQRSPSPEPIYSPVAFAAPVAKDFSGFQDCVSISALEERQEIISQIIKKNPA  236

Query  1422  FKPPADYRPPKLQKKLYI  1369
             FKPPADYRPPKLQKKLYI
Sbjct  237   FKPPADYRPPKLQKKLYI  254


 Score = 51.2 bits (121),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  390   FKSDVLCKICGDGGHPTIDCPVK  412


 Score = 32.0 bits (71),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRT+TF
Sbjct  376   PGHRQYACPSRTNTF  390


 Score = 23.5 bits (49),  Expect(3) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 15/26 (58%), Gaps = 8/26 (31%)
 Frame = -2

Query  1371  IHVLVGAETQSHL--------KLLQP  1318
             +HVLV AETQ  L        KLLQP
Sbjct  316   LHVLVEAETQESLDAAAAMVEKLLQP  341



>ref|XP_004305301.1| PREDICTED: uncharacterized protein LOC101296792 [Fragaria vesca 
subsp. vesca]
Length=731

 Score =   207 bits (526),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 108/124 (87%), Gaps = 7/124 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRKSRWAD+EPKP++Q       F GGIEFDPEIQALNSRL+EISR L SG  LDDRPE
Sbjct  97    RKRKSRWADEEPKPVVQ-------FMGGIEFDPEIQALNSRLVEISRILFSGSVLDDRPE  149

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQK  1381
             G RSPSPEP+YDN GIRINTREYRARE+LNRERQEII+QIIK+NP FKPPADYRPPK+ K
Sbjct  150   GERSPSPEPVYDNFGIRINTREYRARERLNRERQEIIAQIIKRNPTFKPPADYRPPKIHK  209

Query  1380  KLYI  1369
             KLYI
Sbjct  210   KLYI  213


 Score = 49.7 bits (117),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +VLC+ICGDGGHPTIDCPVK
Sbjct  349   FKSEVLCKICGDGGHPTIDCPVK  371


 Score = 32.7 bits (73),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  335   PGHRQYACPSRTSTF  349



>ref|XP_009340604.1| PREDICTED: branchpoint-bridging protein-like [Pyrus x bretschneideri]
Length=732

 Score =   198 bits (503),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = -2

Query  1677  MKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTR  1498
             + DF GGIEFDPEIQALNSRLLEISR L SGLPLDDRPEGARSPSPEPIYDNMGIRINTR
Sbjct  97    VPDFMGGIEFDPEIQALNSRLLEISRMLSSGLPLDDRPEGARSPSPEPIYDNMGIRINTR  156

Query  1497  EYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             E+RARE+LN+ERQEII+QIIK+NPAFKPPADYRPPKL KKLYI
Sbjct  157   EFRARERLNKERQEIIAQIIKRNPAFKPPADYRPPKLHKKLYI  199


 Score = 51.6 bits (122),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DVLC+ICGDGGHPTIDCPVK
Sbjct  335   FKSDVLCKICGDGGHPTIDCPVK  357


 Score = 33.1 bits (74),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACPSRTSTF
Sbjct  321   PGHRQYACPSRTSTF  335



>gb|KHN11669.1| Branchpoint-bridging protein [Glycine soja]
Length=645

 Score =   197 bits (500),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/98 (95%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = -2

Query  1662  GGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAR  1483
             GGIEFDPEIQALNSRLLEISR LQSGLPLDDRPEGARSPSPEP+YDNMGIRINTREYRAR
Sbjct  2     GGIEFDPEIQALNSRLLEISRMLQSGLPLDDRPEGARSPSPEPVYDNMGIRINTREYRAR  61

Query  1482  EKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             E+L +ERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI
Sbjct  62    ERLQKERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  99


 Score = 44.7 bits (104),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V+C+ CGDGGHP+IDCPVK
Sbjct  235   FKSEVVCKHCGDGGHPSIDCPVK  257


 Score = 32.0 bits (71),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RTSTF
Sbjct  221   PGHRQYACPTRTSTF  235



>gb|KHN32434.1| Branchpoint-bridging protein [Glycine soja]
Length=645

 Score =   196 bits (497),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/98 (95%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = -2

Query  1662  GGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAR  1483
             GGIEFDPEIQALNSRLLEISR LQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAR
Sbjct  2     GGIEFDPEIQALNSRLLEISRMLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAR  61

Query  1482  EKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             E+L +ERQEIISQIIKKNPAFKPP DYRPPKLQKKLYI
Sbjct  62    ERLQKERQEIISQIIKKNPAFKPPVDYRPPKLQKKLYI  99


 Score = 44.7 bits (104),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V+C+ CGDGGHP+IDCPVK
Sbjct  235   FKSEVVCKHCGDGGHPSIDCPVK  257


 Score = 32.0 bits (71),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RTSTF
Sbjct  221   PGHRQYACPTRTSTF  235



>ref|NP_001173909.1| Os04g0385700 [Oryza sativa Japonica Group]
 dbj|BAH92637.1| Os04g0385700 [Oryza sativa Japonica Group]
Length=231

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 95/103 (92%), Gaps = 2/103 (2%)
 Frame = -2

Query  1677  MKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTR  1498
             MKDF    + DPE+  LN+RLLEISR LQSGLPLDDRPEGARSPSPEP+YDN+GIRINTR
Sbjct  1     MKDFAA--DLDPEVHNLNARLLEISRMLQSGLPLDDRPEGARSPSPEPVYDNLGIRINTR  58

Query  1497  EYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             EYRARE+LNRERQEIISQ+I++NPAFKPPADYRPPKLQKKLYI
Sbjct  59    EYRARERLNRERQEIISQLIRRNPAFKPPADYRPPKLQKKLYI  101



>ref|XP_001766808.1| predicted protein [Physcomitrella patens]
 gb|EDQ68439.1| predicted protein [Physcomitrella patens]
Length=677

 Score =   192 bits (488),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 111/130 (85%), Gaps = 4/130 (3%)
 Frame = -2

Query  1740  RKRKSRWADDEPK-PL---IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             +KRKSRWA +EPK PL   IQLPDF+K+ TGG++ DPE+QALN +LL+I+RKLQ+G+ LD
Sbjct  103   KKRKSRWAAEEPKLPLLGQIQLPDFVKELTGGVDLDPELQALNIKLLDINRKLQTGMVLD  162

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
                +G RSPSPEPIYDNMGIRINTREYRAREKL RERQE+I+ +IKKNPAFKPPADY+P 
Sbjct  163   PVGDGNRSPSPEPIYDNMGIRINTREYRAREKLTRERQEVIAMLIKKNPAFKPPADYKPL  222

Query  1392  KLQKKLYIHV  1363
             K  KKLYI V
Sbjct  223   KHYKKLYIPV  232



>ref|XP_001771487.1| predicted protein [Physcomitrella patens]
 gb|EDQ63687.1| predicted protein [Physcomitrella patens]
Length=774

 Score =   190 bits (483),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 110/130 (85%), Gaps = 4/130 (3%)
 Frame = -2

Query  1740  RKRKSRWADDEPK-PL---IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             +KRKSRWA +EP  PL   IQLPDF+K+ TGG++ DPE+QALN +LL+I+RKLQ+G+ LD
Sbjct  102   KKRKSRWAAEEPNLPLLGQIQLPDFVKELTGGVDLDPELQALNIKLLDINRKLQTGMVLD  161

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
                +G RSPSPEPIYDNMGIRINTREYRAREKL RERQE+I+ +IKKNPAFKPPADY+P 
Sbjct  162   PVGDGNRSPSPEPIYDNMGIRINTREYRAREKLTRERQEVIAMLIKKNPAFKPPADYKPL  221

Query  1392  KLQKKLYIHV  1363
             K  KKLYI V
Sbjct  222   KHYKKLYIPV  231


 Score = 47.4 bits (111),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DV C ICGDGGHPTIDCP+K
Sbjct  365   FKSDVSCRICGDGGHPTIDCPLK  387


 Score = 30.0 bits (66),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+R STF
Sbjct  351   PGHRQYACPARHSTF  365



>dbj|BAK04277.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=657

 Score =   184 bits (466),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 94/103 (91%), Gaps = 2/103 (2%)
 Frame = -2

Query  1677  MKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTR  1498
             MKDF    E DPE+  LNSRLLEISR LQSGLPLDDRPEGARSPSPEPIYDN+GIRINTR
Sbjct  1     MKDFAA--EMDPEVHNLNSRLLEISRLLQSGLPLDDRPEGARSPSPEPIYDNLGIRINTR  58

Query  1497  EYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             EYRARE+LNRERQEIISQ+I++NPAFKPPADYRPPKL KKLYI
Sbjct  59    EYRARERLNRERQEIISQLIRRNPAFKPPADYRPPKLHKKLYI  101


 Score = 47.8 bits (112),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V C+ICGDGGHPTIDCPVK
Sbjct  237   FKSEVQCKICGDGGHPTIDCPVK  259


 Score = 31.2 bits (69),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RT+TF
Sbjct  223   PGHRQYACPNRTTTF  237



>emb|CAE05015.1| OSJNBa0044M19.2 [Oryza sativa Japonica Group]
Length=650

 Score =   183 bits (464),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 95/103 (92%), Gaps = 2/103 (2%)
 Frame = -2

Query  1677  MKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTR  1498
             MKDF    + DPE+  LN+RLLEISR LQSGLPLDDRPEGARSPSPEP+YDN+GIRINTR
Sbjct  1     MKDFAA--DLDPEVHNLNARLLEISRMLQSGLPLDDRPEGARSPSPEPVYDNLGIRINTR  58

Query  1497  EYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             EYRARE+LNRERQEIISQ+I++NPAFKPPADYRPPKLQKKLYI
Sbjct  59    EYRARERLNRERQEIISQLIRRNPAFKPPADYRPPKLQKKLYI  101



>gb|EAZ30506.1| hypothetical protein OsJ_14553 [Oryza sativa Japonica Group]
Length=684

 Score =   183 bits (464),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 95/103 (92%), Gaps = 2/103 (2%)
 Frame = -2

Query  1677  MKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTR  1498
             MKDF    + DPE+  LN+RLLEISR LQSGLPLDDRPEGARSPSPEP+YDN+GIRINTR
Sbjct  1     MKDFAA--DLDPEVHNLNARLLEISRMLQSGLPLDDRPEGARSPSPEPVYDNLGIRINTR  58

Query  1497  EYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             EYRARE+LNRERQEIISQ+I++NPAFKPPADYRPPKLQKKLYI
Sbjct  59    EYRARERLNRERQEIISQLIRRNPAFKPPADYRPPKLQKKLYI  101


 Score = 47.8 bits (112),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V C+ICGDGGHPTIDCPVK
Sbjct  237   FKSEVQCKICGDGGHPTIDCPVK  259


 Score = 32.0 bits (71),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RTSTF
Sbjct  223   PGHRQYACPNRTSTF  237



>gb|EAY93866.1| hypothetical protein OsI_15642 [Oryza sativa Indica Group]
Length=684

 Score =   183 bits (464),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 95/103 (92%), Gaps = 2/103 (2%)
 Frame = -2

Query  1677  MKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTR  1498
             MKDF    + DPE+  LN+RLLEISR LQSGLPLDDRPEGARSPSPEP+YDN+GIRINTR
Sbjct  1     MKDFAA--DLDPEVHNLNARLLEISRMLQSGLPLDDRPEGARSPSPEPVYDNLGIRINTR  58

Query  1497  EYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             EYRARE+LNRERQEIISQ+I++NPAFKPPADYRPPKLQKKLYI
Sbjct  59    EYRARERLNRERQEIISQLIRRNPAFKPPADYRPPKLQKKLYI  101


 Score = 47.8 bits (112),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V C+ICGDGGHPTIDCPVK
Sbjct  237   FKSEVQCKICGDGGHPTIDCPVK  259


 Score = 32.0 bits (71),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RTSTF
Sbjct  223   PGHRQYACPNRTSTF  237



>ref|XP_006644320.1| PREDICTED: branchpoint-bridging protein-like [Oryza brachyantha]
Length=681

 Score =   183 bits (464),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 95/103 (92%), Gaps = 2/103 (2%)
 Frame = -2

Query  1677  MKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTR  1498
             MKDF    + DPE+  LN+RLLEISR LQSGLPLDDRPEGARSPSPEPIYDN+GIRINTR
Sbjct  1     MKDFAA--DLDPEVHNLNARLLEISRLLQSGLPLDDRPEGARSPSPEPIYDNLGIRINTR  58

Query  1497  EYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             EYRARE+LNRERQEIISQ+I++NPAFKPPADYRPPKLQKKLYI
Sbjct  59    EYRARERLNRERQEIISQLIRRNPAFKPPADYRPPKLQKKLYI  101


 Score = 46.2 bits (108),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V C++CGDGGHPTIDCPV+
Sbjct  237   FKSEVQCKVCGDGGHPTIDCPVR  259


 Score = 30.8 bits (68),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  1286  SPGQKQYACPSRTSTF  1239
              PG +QYACP++TSTF
Sbjct  222   EPGHRQYACPNKTSTF  237



>ref|XP_008805310.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805311.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805312.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805313.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805314.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805315.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805316.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805317.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805318.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805319.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805320.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805321.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805322.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805323.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805324.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805326.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805327.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
 ref|XP_008805328.1| PREDICTED: branchpoint-bridging protein-like [Phoenix dactylifera]
Length=608

 Score =   180 bits (457),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 95/103 (92%), Gaps = 2/103 (2%)
 Frame = -2

Query  1677  MKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTR  1498
             MK+F    + DPE+QALN RLLEI+R LQSG+PLDDRPEGARSPSPEPIYDNMGIRINTR
Sbjct  1     MKEFAA--DLDPEVQALNLRLLEINRLLQSGMPLDDRPEGARSPSPEPIYDNMGIRINTR  58

Query  1497  EYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             EYRARE+L +ERQEIISQ+I++NPAFKPPADYRPPKLQKKLYI
Sbjct  59    EYRARERLTKERQEIISQLIRRNPAFKPPADYRPPKLQKKLYI  101


 Score = 48.1 bits (113),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK DV C+ICGDGGHPTIDCP+K
Sbjct  237   FKSDVQCKICGDGGHPTIDCPMK  259


 Score = 30.8 bits (68),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  1286  SPGQKQYACPSRTSTF  1239
              PG +QYACP+RT+TF
Sbjct  222   EPGHRQYACPARTTTF  237



>gb|EMS55585.1| Branchpoint-bridging protein [Triticum urartu]
Length=650

 Score =   178 bits (451),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -2

Query  1650  FDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLN  1471
              DPE+  LNSRLLEISR LQSGLPLDDRPEGARSPSPEPIYDN+GIRINTREYRARE+LN
Sbjct  1     MDPEVHNLNSRLLEISRLLQSGLPLDDRPEGARSPSPEPIYDNLGIRINTREYRARERLN  60

Query  1470  RERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             RERQEIISQ+I++NPAFKPPADYRPPKL KKLYI
Sbjct  61    RERQEIISQLIRRNPAFKPPADYRPPKLHKKLYI  94


 Score = 47.8 bits (112),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -1

Query  1240  FKVDVLCEICGDGGHPTIDCPVK  1172
             FK +V C+ICGDGGHPTIDCPVK
Sbjct  230   FKSEVQCKICGDGGHPTIDCPVK  252


 Score = 31.2 bits (69),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  1283  PGQKQYACPSRTSTF  1239
             PG +QYACP+RT+TF
Sbjct  216   PGHRQYACPNRTTTF  230



>ref|XP_006827746.1| hypothetical protein AMTR_s00009p00262590 [Amborella trichopoda]
 gb|ERM95162.1| hypothetical protein AMTR_s00009p00262590 [Amborella trichopoda]
Length=705

 Score =   159 bits (403),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 106/131 (81%), Gaps = 5/131 (4%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPL----IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPL-  1576
             ++RKS WA+D+ K      I+LPDF+++   G+E DPE+QALN++LLEI+RKL+SG+ L 
Sbjct  201   KRRKSGWAEDDTKIKMMGPIKLPDFVEELAVGLENDPEVQALNAQLLEINRKLRSGVVLY  260

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRP  1396
             +++P   +SPSPEPIYDN+GIRINTR+ RAREKL +ERQE+IS++++KNP+F PP DY+P
Sbjct  261   ENKPYEPKSPSPEPIYDNLGIRINTRDCRAREKLTKERQEVISRLVQKNPSFNPPVDYKP  320

Query  1395  PKLQKKLYIHV  1363
              KL  KLYI V
Sbjct  321   SKLYNKLYIPV  331



>ref|XP_010273178.1| PREDICTED: uncharacterized protein LOC104608792 [Nelumbo nucifera]
Length=799

 Score =   142 bits (357),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 93/128 (73%), Gaps = 4/128 (3%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPL----IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             +K+K+RW  D+ +      IQLPDF+K+       DPEI+ L  RL+EI+RKLQ     D
Sbjct  272   KKKKTRWDGDDSQIKMLGPIQLPDFVKESNSEAVNDPEIKKLKMRLIEINRKLQGSEIHD  331

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
             DRPE  RSPSP P+YDN GIRIN+R+ R+ +KL +ERQ I+S +I+KNP FKPP+DY+PP
Sbjct  332   DRPEEERSPSPPPLYDNFGIRINSRDIRSHQKLIQERQCIVSMLIQKNPTFKPPSDYKPP  391

Query  1392  KLQKKLYI  1369
             KL +KLYI
Sbjct  392   KLYRKLYI  399



>ref|XP_002263312.1| PREDICTED: uncharacterized protein LOC100261746 [Vitis vinifera]
Length=751

 Score =   127 bits (319),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 79/109 (72%), Gaps = 1/109 (1%)
 Frame = -2

Query  1695  IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMG  1516
             IQLP F+KDF    + DPEIQ L   L EI+ KLQ     DDRP+  RSPSPEP+YD +G
Sbjct  221   IQLPSFVKDFVTS-DLDPEIQELKVELFEINSKLQRPELHDDRPKEDRSPSPEPVYDYLG  279

Query  1515  IRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
              R NTRE R REKL ++RQ IIS++I+KN  FKP ADY+PPKL KKLYI
Sbjct  280   NRKNTREVRLREKLIKKRQCIISRLIEKNSTFKPAADYKPPKLIKKLYI  328



>gb|KDD72497.1| hypothetical protein H632_c3271p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=346

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 87/143 (61%), Gaps = 22/143 (15%)
 Frame = -2

Query  1740  RKRKSRWAD------DEPKPLIQLPDFMKDFTGGIEF-------------DPEIQALNSR  1618
             RKRKSRW D      +E K L+ +PD +   + GI+              DPE+ +L+  
Sbjct  26    RKRKSRWGDRDDAAPNEEKALMLMPDSIV-LSNGIKVVLPPVLTGRSPTGDPEVLSLHQT  84

Query  1617  LLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQII  1438
             LL+++RKL    PL+  PEG RSPSP PIYD MGIR NTRE R +EKL RER  +I Q++
Sbjct  85    LLDVTRKLAG--PLELPPEGERSPSPPPIYDTMGIRQNTREVRLKEKLTRERGRLIEQLL  142

Query  1437  KKNPAFKPPADYRPPKLQKKLYI  1369
              ++P +K P DYRP K  KKL I
Sbjct  143   MRDPTYKAPTDYRPEKKSKKLII  165



>emb|CDP05215.1| unnamed protein product [Coffea canephora]
Length=598

 Score =   116 bits (291),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 86/130 (66%), Gaps = 5/130 (4%)
 Frame = -2

Query  1740  RKRKSRW--ADDEPKPL--IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             ++RK+RW   D + K L  + L +F   F    E DPEI  L  +L+EI+ KLQS    D
Sbjct  212   KRRKTRWDVGDAQIKLLGPMHLSEFYNQFKES-ELDPEINDLKMQLVEINSKLQSSDVQD  270

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
             DRPE  RSPSPEP+Y+N+GIRINTRE R R +L+ ER  IIS++++KNP FK P   +  
Sbjct  271   DRPEEERSPSPEPMYNNLGIRINTREVRLRRRLSDERTLIISKLVEKNPTFKTPLKPKLT  330

Query  1392  KLQKKLYIHV  1363
             KL KKLY+ V
Sbjct  331   KLFKKLYVPV  340



>gb|ABR18258.1| unknown [Picea sitchensis]
Length=970

 Score =   114 bits (285),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 90/159 (57%), Gaps = 39/159 (25%)
 Frame = -2

Query  1737  KRKSRWADDEPK----PLIQLPDF------------------------------MKDFTG  1660
             K++SRWA ++PK      I+LPDF                              MKD   
Sbjct  130   KKRSRWATEDPKISMLGQIKLPDFVKGLSGKKKKSRLARKKSRTKYKASRLGISMKDLA-  188

Query  1659  GIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRARE  1480
               + DPE   L   L  I+ +L++G  +    +G RSPSPEP Y+N+G+RINTRE RAR+
Sbjct  189   --DTDPEAWQLKLMLFNINNRLKTGNVIGASGDGQRSPSPEPQYNNLGMRINTREIRARQ  246

Query  1479  KLNRERQEIISQIIKKNPAFKPPADYRPPKLQ--KKLYI  1369
             KL  ERQ II+++IKK PAF+PPADY+ P L+  KKLYI
Sbjct  247   KLMDERQMIIARLIKKTPAFRPPADYKSPSLKHHKKLYI  285



>gb|KDD73228.1| hypothetical protein H632_c2405p0 [Helicosporidium sp. ATCC 50920]
Length=126

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 66/93 (71%), Gaps = 2/93 (2%)
 Frame = -2

Query  1647  DPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNR  1468
             DPE+ +L+  LL+++RKL    PL+  PEG RSPSP PIYD MGIR NTRE R +EKL R
Sbjct  27    DPEVLSLHQTLLDVTRKLAG--PLELPPEGERSPSPPPIYDTMGIRQNTREVRLKEKLTR  84

Query  1467  ERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             ER  +I Q++ ++P +K P DYRP K  KKL I
Sbjct  85    ERGRLIEQLLMRDPTYKAPTDYRPEKKSKKLII  117



>ref|XP_008812234.1| PREDICTED: uncharacterized protein LOC103723178 [Phoenix dactylifera]
Length=211

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 2/60 (3%)
 Frame = -2

Query  1677  MKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTR  1498
             MK+F    + DPE+QALN RLLEI+R LQSG+PLDDRPEGARSPSPEPIYD +GIRINTR
Sbjct  1     MKEFVA--DLDPEVQALNLRLLEINRLLQSGMPLDDRPEGARSPSPEPIYDTIGIRINTR  58



>gb|ESA14251.1| hypothetical protein GLOINDRAFT_172480 [Rhizophagus irregularis 
DAOM 181602]
Length=387

 Score =   100 bits (248),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 77/121 (64%), Gaps = 9/121 (7%)
 Frame = -2

Query  1722  WADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPLDDRPEGARS  1549
             W  +E K  I +P  +       + D  +  L+ RL EI RKL+ G  +P    PE  RS
Sbjct  69    WGGEETKVDIGVPTAITYNMSKEQLDTYL--LHMRLEEIGRKLRLGDYVP----PEKERS  122

Query  1548  PSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPPKLQKKLY  1372
             PSPEPIYD+ G R+NTREYR R+KL  ER ++I + +++NP FKPPADY +P K+Q K+Y
Sbjct  123   PSPEPIYDSQGKRVNTREYRYRKKLEDERHKLIEEAVRRNPDFKPPADYKKPTKVQDKVY  182

Query  1371  I  1369
             I
Sbjct  183   I  183



>gb|KFH65616.1| hypothetical protein MVEG_09092 [Mortierella verticillata NRRL 
6337]
Length=621

 Score =   101 bits (251),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 82/130 (63%), Gaps = 10/130 (8%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFD-PEIQALNSRLLEISRKLQSG--LPLDD  1570
             RKRKSRWA ++ K  + +P         +  +  E+  L++RL EI+RKL+SG  LPLD 
Sbjct  94    RKRKSRWAAEDEK--VTIPGMPTALPTNMSAEQEEMFLLHTRLEEIARKLKSGDVLPLDR  151

Query  1569  RPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPP  1393
                  RS SPEP Y+  G R+NTREYR R+KL  ER ++I   +KK P F+PPADY RP 
Sbjct  152   E----RSRSPEPEYNAEGKRVNTREYRYRKKLENERHQLIDGALKKYPDFRPPADYKRPT  207

Query  1392  KLQKKLYIHV  1363
             K Q K+YI V
Sbjct  208   KTQDKVYIPV  217



>ref|XP_010041144.1| PREDICTED: branchpoint-bridging protein-like [Eucalyptus grandis]
Length=607

 Score = 99.8 bits (247),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 85/130 (65%), Gaps = 4/130 (3%)
 Frame = -2

Query  1740  RKRKSRWA--DDEPKPL--IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             ++RK+RW+  D   K L  +QLPDF+K+     + +PEI  L + L E++ +LQ  +  D
Sbjct  115   KRRKTRWSSFDTRIKLLGPLQLPDFIKESVLESDSNPEIVKLKAELAELNSELQKPVLHD  174

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
              +P   RSPSPE +++++GI +NT E R RE+L R+RQ II ++I+K+P F  P   +P 
Sbjct  175   VQPAEKRSPSPETVHNDLGIIVNTHEVRLREELVRKRQGIILKLIRKHPTFNTPPSRKPS  234

Query  1392  KLQKKLYIHV  1363
             KL KKLY+ V
Sbjct  235   KLFKKLYVPV  244



>gb|EXX61176.1| Msl5p [Rhizophagus irregularis DAOM 197198w]
Length=563

 Score = 99.4 bits (246),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 77/121 (64%), Gaps = 9/121 (7%)
 Frame = -2

Query  1722  WADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPLDDRPEGARS  1549
             W  +E K  I +P  +       + D  +  L+ RL EI RKL+ G  +P    PE  RS
Sbjct  69    WGGEETKVDIGVPTAITYNMSKEQLDTYL--LHMRLEEIGRKLRLGDYVP----PEKERS  122

Query  1548  PSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPPKLQKKLY  1372
             PSPEPIYD+ G R+NTREYR R+KL  ER ++I + +++NP FKPPADY +P K+Q K+Y
Sbjct  123   PSPEPIYDSQGKRVNTREYRYRKKLEDERHKLIEEAVRRNPDFKPPADYKKPTKVQDKVY  182

Query  1371  I  1369
             I
Sbjct  183   I  183



>gb|KFM25385.1| Branchpoint-bridging protein [Auxenochlorella protothecoides]
Length=1200

 Score = 99.8 bits (247),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 84/141 (60%), Gaps = 19/141 (13%)
 Frame = -2

Query  1740  RKRKSRWADDEP----KPLIQLPDFMKDFTGGIEF-------------DPEIQALNSRLL  1612
             RKR+SRW + E     K ++ +P+ +   + G++              DPE+   + +L 
Sbjct  59    RKRRSRWGEKEETNDEKAIMLMPNEIV-LSNGMKVYLPPSVTGRSPTGDPEVLVFHQQLN  117

Query  1611  EISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKK  1432
              +++K+  G  +D  PEG RSPSP P YD MGIR+NTRE R REK+ R+R E+I  +I +
Sbjct  118   ALNKKISEG-EIDIPPEGERSPSPPPTYDAMGIRLNTREVRYREKMQRKRNELIETLIAR  176

Query  1431  NPAFKPPADYRPPKLQKKLYI  1369
             +P ++PP+DYRP K   KL I
Sbjct  177   DPTYRPPSDYRPEKKWCKLSI  197



>gb|KCW46415.1| hypothetical protein EUGRSUZ_K00247 [Eucalyptus grandis]
Length=555

 Score = 98.2 bits (243),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 84/130 (65%), Gaps = 4/130 (3%)
 Frame = -2

Query  1740  RKRKSRWA--DDEPKPL--IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             ++RK+RW+  D   K L  +QLPDF+K+     + +PEI  L + L E++ +LQ  +  D
Sbjct  115   KRRKTRWSSFDTRIKLLGPLQLPDFIKESVLESDSNPEIVKLKAELAELNSELQKPVLHD  174

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
              +P   R PSPE +++++GI +NT E R RE+L R+RQ II ++I+K+P F  P   +P 
Sbjct  175   VQPAEKRPPSPETVHNDLGIIVNTHEVRLREELVRKRQGIILKLIRKHPTFNTPPSRKPS  234

Query  1392  KLQKKLYIHV  1363
             KL KKLY+ V
Sbjct  235   KLFKKLYVPV  244



>ref|XP_010038431.1| PREDICTED: branchpoint-bridging protein-like [Eucalyptus grandis]
Length=637

 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 84/130 (65%), Gaps = 4/130 (3%)
 Frame = -2

Query  1740  RKRKSRWA--DDEPKPL--IQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             ++RK+RW+  D   K L  +QLPDF+K+     + +PEI  L + L E++ +LQ  +  D
Sbjct  115   KRRKTRWSSFDTRIKLLGPLQLPDFIKESVLESDSNPEIVKLKAELAELNSELQKPVLHD  174

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
              +P   R PSPE +++++GI +NT E R RE+L R+RQ II ++I+K+P F  P   +P 
Sbjct  175   VQPAEKRPPSPETVHNDLGIIVNTHEVRLREELVRKRQGIILKLIRKHPTFNTPPSRKPS  234

Query  1392  KLQKKLYIHV  1363
             KL KKLY+ V
Sbjct  235   KLFKKLYVPV  244



>gb|EXX61177.1| Msl5p [Rhizophagus irregularis DAOM 197198w]
Length=476

 Score = 95.5 bits (236),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 7/90 (8%)
 Frame = -2

Query  1629  LNSRLLEISRKLQSG--LPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQE  1456
             L+ RL EI RKL+ G  +P    PE  RSPSPEPIYD+ G R+NTREYR R+KL  ER +
Sbjct  11    LHMRLEEIGRKLRLGDYVP----PEKERSPSPEPIYDSQGKRVNTREYRYRKKLEDERHK  66

Query  1455  IISQIIKKNPAFKPPADY-RPPKLQKKLYI  1369
             +I + +++NP FKPPADY +P K+Q K+YI
Sbjct  67    LIEEAVRRNPDFKPPADYKKPTKVQDKVYI  96



>gb|EIE86835.1| hypothetical protein RO3G_11546 [Rhizopus delemar RA 99-880]
Length=518

 Score = 95.9 bits (237),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 79/127 (62%), Gaps = 10/127 (8%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPLDDR  1567
             RKRKSRW D++   +  LP  +       +   E   L  RL EI+RKL++G  LP ++R
Sbjct  57    RKRKSRWGDEQKIIIPGLPTAVNKLD---KQQSEKYLLQIRLEEINRKLRTGDYLPSENR  113

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPPK  1390
                 RSPSPEP+YD  G R+NTRE R ++KL  ER ++I   +K  P F+PP DY RP K
Sbjct  114   ----RSPSPEPVYDANGKRVNTREARYKKKLEDERHKLIEIALKTIPNFRPPIDYKRPTK  169

Query  1389  LQKKLYI  1369
             LQ+K+YI
Sbjct  170   LQEKVYI  176



>gb|EKC39213.1| Splicing factor 1 [Crassostrea gigas]
Length=481

 Score = 95.1 bits (235),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 79/128 (62%), Gaps = 5/128 (4%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQ-ALNSRLLEISRKLQSG-LPLDDR  1567
             +KRKSRWA D       +P        G+  D E Q  L+ ++ E+SR+L++G L +   
Sbjct  33    KKRKSRWAQDNDTDKTIIPGMPTVIPNGLSDDQEKQYLLHLQIEEVSRRLRTGDLGIPPN  92

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY+N G R+NTREYR R+ L  ER +++ Q I  N  +KPPADY+PP  
Sbjct  93    PE-ERSPSPEPIYNNEGKRLNTREYRTRKNLEEERHQLVQQAISLNCDYKPPADYKPPIV  151

Query  1392  KLQKKLYI  1369
             ++  K+ I
Sbjct  152   RVNDKVMI  159



>ref|XP_005102930.1| PREDICTED: splicing factor 1-like isoform X1 [Aplysia californica]
 ref|XP_005102931.1| PREDICTED: splicing factor 1-like isoform X2 [Aplysia californica]
Length=824

 Score = 95.5 bits (236),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 85/130 (65%), Gaps = 10/130 (8%)
 Frame = -2

Query  1740  RKRKSRW-ADDEPKPLI-QLPDFM-KDFTGGIEFDPEIQALNSRLLEISRKLQSG-LPLD  1573
             +KRKSRW  D++ K +I  +P  +  + T   E       ++ ++ EISRKL++G L + 
Sbjct  36    KKRKSRWNTDNDEKTVIPGMPTVIPSNLT---ESQQRQYVVHLQIEEISRKLRTGDLGIP  92

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
               PE  RSPSPEPIY+N G R+NTREYR R+KL  ER ++I + IK NP FKPP+DY+PP
Sbjct  93    ANPE-QRSPSPEPIYNNEGKRLNTREYRTRKKLEEERHKLIQEAIKLNPEFKPPSDYKPP  151

Query  1392  --KLQKKLYI  1369
               ++  K+ I
Sbjct  152   VVRVSDKVMI  161



>ref|XP_001637547.1| predicted protein [Nematostella vectensis]
 gb|EDO45484.1| predicted protein [Nematostella vectensis]
Length=261

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 81/128 (63%), Gaps = 7/128 (5%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNS-RLLEISRKLQSG-LPLDDR  1567
             +KRKSRW  ++ K +I  P         ++ D +   L   R+ EISR L++G L + D 
Sbjct  62    KKRKSRWGGEDKKMII--PGMPTTLPPNLKPDQQKAYLMQLRIEEISRMLRTGDLGIPDN  119

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY+  G R+NTR++R R++L  ER + I  ++K NP FKPPADY+PP  
Sbjct  120   PE-DRSPSPEPIYNTDGKRLNTRDFRVRKRLEDERHKFIQDMMKINPDFKPPADYKPPLI  178

Query  1392  KLQKKLYI  1369
             K+Q K+ I
Sbjct  179   KIQDKVMI  186



>emb|CEI94815.1| hypothetical protein RMCBS344292_09020 [Rhizopus microsporus]
Length=505

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 77/127 (61%), Gaps = 9/127 (7%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPLDDR  1567
             RKR+SRW D++   +  LP  +       +   E   L  RL EI+RKL++G  LP + R
Sbjct  56    RKRRSRWGDEQKIIIPGLPTAINKID---KEQSEKYLLQIRLEEINRKLRTGDYLPSETR  112

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPPK  1390
                 RSPSPEP+YD  G R+NTRE R ++KL  ER  +I   ++  P F+PP DY RP K
Sbjct  113   ---GRSPSPEPVYDANGKRVNTREARYKKKLEDERHRLIEIALRTIPNFRPPIDYKRPTK  169

Query  1389  LQKKLYI  1369
             LQ+K+YI
Sbjct  170   LQEKVYI  176



>emb|CEG63079.1| Putative Zinc knuckle transcription factor splicing factor msl5 
[Rhizopus microsporus]
Length=515

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 77/127 (61%), Gaps = 9/127 (7%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPLDDR  1567
             RKR+SRW D++   +  LP  +       +   E   L  RL EI+RKL++G  LP + R
Sbjct  56    RKRRSRWGDEQKIIIPGLPTAINKID---KEQSEKYLLQIRLEEINRKLRTGDYLPSETR  112

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPPK  1390
                 RSPSPEP+YD  G R+NTRE R ++KL  ER  +I   ++  P F+PP DY RP K
Sbjct  113   ---GRSPSPEPVYDANGKRVNTREARYKKKLEDERHRLIEIALRTIPNFRPPIDYKRPTK  169

Query  1389  LQKKLYI  1369
             LQ+K+YI
Sbjct  170   LQEKVYI  176



>emb|CEJ03890.1| hypothetical protein RMCBS344292_17865 [Rhizopus microsporus]
Length=467

 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 77/127 (61%), Gaps = 9/127 (7%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPLDDR  1567
             RKR+SRW D++   +  LP  +       +   E   L  RL EI+RKL++G  LP + R
Sbjct  56    RKRRSRWGDEQKIIIPGLPTAINKID---KEQSEKYLLQIRLEEINRKLRTGDYLPSETR  112

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPPK  1390
                 RSPSPEP+YD  G R+NTRE R ++KL  ER  +I   ++  P F+PP DY RP K
Sbjct  113   ---GRSPSPEPVYDANGKRVNTREARYKKKLEDERHRLIEIALRTIPNFRPPIDYKRPTK  169

Query  1389  LQKKLYI  1369
             LQ+K+YI
Sbjct  170   LQEKVYI  176



>ref|XP_005102932.1| PREDICTED: splicing factor 1-like isoform X3 [Aplysia californica]
Length=680

 Score = 93.6 bits (231),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 85/130 (65%), Gaps = 10/130 (8%)
 Frame = -2

Query  1740  RKRKSRW-ADDEPKPLI-QLPDFM-KDFTGGIEFDPEIQALNSRLLEISRKLQSG-LPLD  1573
             +KRKSRW  D++ K +I  +P  +  + T   E       ++ ++ EISRKL++G L + 
Sbjct  36    KKRKSRWNTDNDEKTVIPGMPTVIPSNLT---ESQQRQYVVHLQIEEISRKLRTGDLGIP  92

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
               PE  RSPSPEPIY+N G R+NTREYR R+KL  ER ++I + IK NP FKPP+DY+PP
Sbjct  93    ANPE-QRSPSPEPIYNNEGKRLNTREYRTRKKLEEERHKLIQEAIKLNPEFKPPSDYKPP  151

Query  1392  --KLQKKLYI  1369
               ++  K+ I
Sbjct  152   VVRVSDKVMI  161



>ref|XP_008326232.1| PREDICTED: splicing factor 1, partial [Cynoglossus semilaevis]
Length=670

 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 97/166 (58%), Gaps = 20/166 (12%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             +++KSRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   
Sbjct  91    QRKKSRWSSETPDQKTVIPGMPTVIPAGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVN  150

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY++ G R+NTREYR R+K+  ER  +I++++  NP FKPPADY+PP  
Sbjct  151   PE-DRSPSPEPIYNSEGKRLNTREYRTRKKIEEERHSLITEMVGLNPEFKPPADYKPPAT  209

Query  1392  KLQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             ++  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  210   RVNDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  251



>ref|XP_008433150.1| PREDICTED: splicing factor 1 [Poecilia reticulata]
Length=676

 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 97/166 (58%), Gaps = 20/166 (12%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             +++KSRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   
Sbjct  93    KRKKSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVN  152

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY++ G R+NTREYR R+K+  ER  +I+++I  NP FKPPADY+PP  
Sbjct  153   PE-DRSPSPEPIYNSEGKRLNTREYRTRKKIEEERHSLITEMIALNPDFKPPADYKPPAT  211

Query  1392  KLQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             ++  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  212   RVSDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  253



>ref|XP_005807962.1| PREDICTED: LOW QUALITY PROTEIN: splicing factor 1-like [Xiphophorus 
maculatus]
Length=697

 Score = 93.2 bits (230),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 97/166 (58%), Gaps = 20/166 (12%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             +++KSRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   
Sbjct  93    KRKKSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVN  152

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY++ G R+NTREYR R+K+  ER  +I+++I  NP FKPPADY+PP  
Sbjct  153   PE-DRSPSPEPIYNSEGKRLNTREYRTRKKIEEERHSLITEMIALNPDFKPPADYKPPAT  211

Query  1392  KLQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             ++  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  212   RVSDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  253



>ref|XP_007567934.1| PREDICTED: splicing factor 1 [Poecilia formosa]
Length=676

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 97/166 (58%), Gaps = 20/166 (12%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             +++KSRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   
Sbjct  93    KRKKSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVN  152

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY++ G R+NTREYR R+K+  ER  +I+++I  NP FKPPADY+PP  
Sbjct  153   PE-DRSPSPEPIYNSEGKRLNTREYRTRKKIEEERHSLITEMIALNPDFKPPADYKPPAT  211

Query  1392  KLQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             ++  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  212   RVSDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  253



>ref|XP_005754765.1| PREDICTED: LOW QUALITY PROTEIN: splicing factor 1-like [Pundamilia 
nyererei]
Length=697

 Score = 92.8 bits (229),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 96/165 (58%), Gaps = 20/165 (12%)
 Frame = -2

Query  1737  KRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDRP  1564
             ++KSRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   P
Sbjct  95    RKKSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNP  154

Query  1563  EGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--K  1390
             E  RSPSPEPIY++ G R+NTREYR R+KL  ER  +I++++  NP FKPPADY+PP  +
Sbjct  155   E-DRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHALITEMVGLNPDFKPPADYKPPATR  213

Query  1389  LQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             +  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  214   VNDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  254



>ref|XP_004576135.1| PREDICTED: splicing factor 1-like [Maylandia zebra]
Length=680

 Score = 92.8 bits (229),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 96/165 (58%), Gaps = 20/165 (12%)
 Frame = -2

Query  1737  KRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDRP  1564
             ++KSRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   P
Sbjct  95    RKKSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNP  154

Query  1563  EGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--K  1390
             E  RSPSPEPIY++ G R+NTREYR R+KL  ER  +I++++  NP FKPPADY+PP  +
Sbjct  155   E-DRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHALITEMVGLNPDFKPPADYKPPATR  213

Query  1389  LQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             +  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  214   VNDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  254



>ref|XP_006809913.1| PREDICTED: splicing factor 1-like [Neolamprologus brichardi]
Length=680

 Score = 92.8 bits (229),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 96/165 (58%), Gaps = 20/165 (12%)
 Frame = -2

Query  1737  KRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDRP  1564
             ++KSRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   P
Sbjct  95    RKKSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNP  154

Query  1563  EGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--K  1390
             E  RSPSPEPIY++ G R+NTREYR R+KL  ER  +I++++  NP FKPPADY+PP  +
Sbjct  155   E-DRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHALITEMVGLNPDFKPPADYKPPATR  213

Query  1389  LQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             +  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  214   VNDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  254



>ref|XP_005951329.1| PREDICTED: LOW QUALITY PROTEIN: splicing factor 1-like [Haplochromis 
burtoni]
Length=706

 Score = 92.8 bits (229),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 96/165 (58%), Gaps = 20/165 (12%)
 Frame = -2

Query  1737  KRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDRP  1564
             ++KSRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   P
Sbjct  95    RKKSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNP  154

Query  1563  EGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--K  1390
             E  RSPSPEPIY++ G R+NTREYR R+KL  ER  +I++++  NP FKPPADY+PP  +
Sbjct  155   E-DRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHALITEMVGLNPDFKPPADYKPPATR  213

Query  1389  LQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             +  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  214   VNDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  254



>ref|XP_005465438.1| PREDICTED: LOW QUALITY PROTEIN: splicing factor 1-like [Oreochromis 
niloticus]
Length=697

 Score = 92.8 bits (229),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 96/165 (58%), Gaps = 20/165 (12%)
 Frame = -2

Query  1737  KRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDRP  1564
             ++KSRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   P
Sbjct  95    RKKSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNP  154

Query  1563  EGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--K  1390
             E  RSPSPEPIY++ G R+NTREYR R+KL  ER  +I++++  NP FKPPADY+PP  +
Sbjct  155   E-DRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHALITEMVGLNPDFKPPADYKPPATR  213

Query  1389  LQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             +  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  214   VNDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  254



>ref|XP_009301351.1| PREDICTED: splicing factor 1 isoform X2 [Danio rerio]
Length=637

 Score = 92.4 bits (228),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 97/166 (58%), Gaps = 20/166 (12%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             ++++SRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   
Sbjct  88    KRKRSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVN  147

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY++ G R+NTREYR R+KL  ER  +I++++  NP FKPPADY+PP  
Sbjct  148   PE-DRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPADYKPPAT  206

Query  1392  KLQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             ++  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  207   RVSDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  248



>gb|AAI63938.1| Sf1 protein [Danio rerio]
Length=663

 Score = 92.4 bits (228),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 97/166 (58%), Gaps = 20/166 (12%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             ++++SRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   
Sbjct  88    KRKRSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVN  147

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY++ G R+NTREYR R+KL  ER  +I++++  NP FKPPADY+PP  
Sbjct  148   PE-DRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPADYKPPAT  206

Query  1392  KLQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             ++  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  207   RVSDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  248



>ref|XP_009301350.1| PREDICTED: splicing factor 1 isoform X1 [Danio rerio]
Length=663

 Score = 92.4 bits (228),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 97/166 (58%), Gaps = 20/166 (12%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             ++++SRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   
Sbjct  88    KRKRSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVN  147

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY++ G R+NTREYR R+KL  ER  +I++++  NP FKPPADY+PP  
Sbjct  148   PE-DRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPADYKPPAT  206

Query  1392  KLQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             ++  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  207   RVSDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  248



>ref|NP_001080780.1| splicing factor 1 [Xenopus laevis]
 gb|AAH46717.1| Sf1 protein [Xenopus laevis]
 gb|AAI10719.1| Sf1 protein [Xenopus laevis]
Length=571

 Score = 92.0 bits (227),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 81/129 (63%), Gaps = 6/129 (5%)
 Frame = -2

Query  1740  RKRK-SRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDD  1570
             RKRK SRW D+ P     +P        G+  D E    +  ++ +++RKL++G L +  
Sbjct  5     RKRKRSRWNDETPDQKTIIPGMPTVIPPGLSRDQERAYIVQLQIEDLTRKLRTGDLGIPP  64

Query  1569  RPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP-  1393
              PE  RSPSPEPIY++ G R+NTRE+R R+KL  ER  +I++++  NP FKPPADY+PP 
Sbjct  65    NPE-DRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVGLNPDFKPPADYKPPA  123

Query  1392  -KLQKKLYI  1369
              ++  K+ I
Sbjct  124   TRVSDKVMI  132



>ref|XP_010749843.1| PREDICTED: LOW QUALITY PROTEIN: splicing factor 1-like [Larimichthys 
crocea]
Length=681

 Score = 92.0 bits (227),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 97/166 (58%), Gaps = 20/166 (12%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             +++KSRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   
Sbjct  92    QRKKSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVN  151

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY++ G R+NTREYR R+K+  ER  +I++++  NP FKPPADY+PP  
Sbjct  152   PE-DRSPSPEPIYNSEGKRLNTREYRTRKKIEEERHSLITEMVGLNPDFKPPADYKPPAT  210

Query  1392  KLQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             ++  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  211   RVNDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  252



>ref|XP_008283418.1| PREDICTED: splicing factor 1 [Stegastes partitus]
 ref|XP_008283419.1| PREDICTED: splicing factor 1 [Stegastes partitus]
Length=677

 Score = 91.7 bits (226),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 97/166 (58%), Gaps = 20/166 (12%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             +++KSRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   
Sbjct  93    QRKKSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVN  152

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY++ G R+NTREYR R+K+  ER  +I++++  NP FKPPADY+PP  
Sbjct  153   PE-DRSPSPEPIYNSEGKRLNTREYRTRKKIEEERHSLITEMVGLNPDFKPPADYKPPAT  211

Query  1392  KLQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             ++  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  212   RVNDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  253



>emb|CCX34375.1| Similar to Branchpoint-bridging protein; acc. no. Q8NIW7 [Pyronema 
omphalodes CBS 100304]
Length=590

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 81/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RKRK+RW D   ++   L+ LP  +  F        E  AL+ R+ EIS+KL+    ++D
Sbjct  72    RKRKNRWGDQTDNKAAGLMGLPTAI--FATMTSEQLEAYALHLRIEEISQKLR----IND  125

Query  1569  R--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
                 EG RSPSP P YDN G R+NTREYR R++L  ER ++I + +K  P + PP+DY R
Sbjct  126   CVPAEGDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLIDKAMKTIPNYHPPSDYRR  185

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  186   PTKTQEKIYVPV  197



>ref|XP_007250246.1| PREDICTED: splicing factor 1 [Astyanax mexicanus]
Length=557

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 97/166 (58%), Gaps = 20/166 (12%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             +++KSRW+ + P     +P        G+  + E    +  ++ +++RKL++G L +   
Sbjct  84    KRKKSRWSSETPDQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPVN  143

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY++ G R+NTREYR R+KL  ER  +I++++  NP FKPPADY+PP  
Sbjct  144   PE-DRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPADYKPPAT  202

Query  1392  KLQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             ++  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  203   RVSDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  244



>ref|XP_382256.1| hypothetical protein FG02080.1 [Fusarium graminearum PH-1]
 gb|ESU07470.1| hypothetical protein FGSG_02080 [Fusarium graminearum PH-1]
Length=1693

 Score = 92.0 bits (227),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 55/132 (42%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RK+++RW D   ++   L+ LP  +   +       E   L+ R+ EIS+KL+    +DD
Sbjct  1196  RKKRNRWGDASENKAAGLMGLPTAI--LSNMTSEQLEAYTLHLRIEEISQKLR----IDD  1249

Query  1569  --RPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
                 +G RSPSP P YDN G RINTREYR R++L  ER ++I + +K  P + PP DY R
Sbjct  1250  VVPADGDRSPSPAPQYDNHGRRINTREYRYRKRLEDERHKLIEKAMKTIPNYHPPQDYRR  1309

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  1310  PTKTQEKVYVPV  1321



>ref|XP_007703846.1| hypothetical protein COCSADRAFT_243802 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD60517.1| hypothetical protein COCSADRAFT_243802 [Bipolaris sorokiniana 
ND90Pr]
Length=231

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 99/190 (52%), Gaps = 25/190 (13%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             RK+++RW D   ++   L+ LP  +       + D     L+ R+ EI++KL+    +P 
Sbjct  59    RKKRNRWGDASENKAAGLMGLPTAIYSAMTTEQLD--AYTLHLRIEEITQKLKINDVVPA  116

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDN G R+NTRE+R R++L  ER +++ + +K  P + PPADY R
Sbjct  117   D----GDRSPSPPPQYDNFGRRVNTREFRYRKRLEDERHKLVEKAMKTLPNYHPPADYRR  172

Query  1398  PPKLQKKLYIHVLVGAETQSHLKL--LQPWLRSSCSRLMKSWPKTICVSFPYFHLLRLMF  1225
             P K Q+K+Y+ V    E     KL  L P L SSCS            +F    LLRL+ 
Sbjct  173   PTKTQEKVYVPVNDYPEINFSTKLTPLTP-LFSSCS----------TPAFVLTSLLRLLD  221

Query  1224  CVKFVVMVGI  1195
                 +V   +
Sbjct  222   VYAHLVAPAV  231



>ref|XP_002837836.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ82027.1| unnamed protein product [Tuber melanosporum]
Length=623

 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 80/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             RK+K+RW D   ++   L+ LP  +  F        E  AL+ R+ EIS+KL+    +P 
Sbjct  74    RKKKNRWGDQTDNKAAGLMGLPTAI--FATMTSEQLEAYALHLRIEEISQKLRINDVVPA  131

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDN G R+NTREYR R++L  ER ++I + +K  P + PP+DY R
Sbjct  132   D----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLIDKAMKAIPNYHPPSDYRR  187

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  188   PTKTQEKIYVPV  199



>ref|XP_002167761.2| PREDICTED: splicing factor 1-like [Hydra vulgaris]
Length=392

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 18/133 (14%)
 Frame = -2

Query  1740  RKRKSRWADDEPKP----LIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG---L  1582
             RKR SRW   E K     L+ LP    D T        +Q    ++ EIS+KL++G   +
Sbjct  127   RKRSSRWGAKEEKANMTGLVTLP---ADLTEEQRVHYLVQF---KIEEISQKLRTGDLGI  180

Query  1581  PLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY  1402
             P D    GARSPSPEPIY++ G R+NTREYR R++L  ER  +I + I++ P +KPP DY
Sbjct  181   PADP---GARSPSPEPIYNSEGKRLNTREYRVRKQLEEERHTLIKKAIEEIPNYKPPLDY  237

Query  1401  RPP--KLQKKLYI  1369
             + P  K+Q K++I
Sbjct  238   KAPTSKIQDKVFI  250



>ref|NP_997818.1| splicing factor 1 [Danio rerio]
 gb|AAQ91271.1| splicing factor 1 [Danio rerio]
Length=565

 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 96/166 (58%), Gaps = 20/166 (12%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             ++++SRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   
Sbjct  16    KRKRSRWSSETPDQKTVIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVN  75

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY++ G R+NTREYR R+KL  ER  +I++++  NP FKPP DY+PP  
Sbjct  76    PE-DRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPTDYKPPAT  134

Query  1392  KLQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             ++  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  135   RVSDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  176



>ref|XP_570209.1| splicing factor SF1 [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_775941.1| hypothetical protein CNBD3480 [Cryptococcus neoformans var. neoformans 
B-3501A]
 sp|P0CO45.1|BBP_CRYNB RecName: Full=Branchpoint-bridging protein [Cryptococcus neoformans 
var. neoformans B-3501A]
 sp|P0CO44.1|BBP_CRYNJ RecName: Full=Branchpoint-bridging protein [Cryptococcus neoformans 
var. neoformans JEC21]
 gb|EAL21294.1| hypothetical protein CNBD3480 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW42902.1| splicing factor SF1, putative [Cryptococcus neoformans var. neoformans 
JEC21]
Length=546

 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 77/130 (59%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGI-EFDPEIQALNSRLLEISRKLQSGLPLDDRP  1564
             RKR+SRW D   K  + +P       G + + + +  A++ RL EI+RKL++G  +   P
Sbjct  129   RKRRSRWGDASAK--VNVPGMPVAVMGNVSQTELDNYAIHVRLEEINRKLRTGDVVP--P  184

Query  1563  EGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY---RPP  1393
             EG RSPSP P YD  G R NTRE R R+KL  ER  +I + +K +P F+PP D+   R  
Sbjct  185   EGQRSPSPTPQYDAYGRRTNTRELRYRKKLEDERTRLIDRAVKSDPNFRPPVDFQHKRGS  244

Query  1392  KLQKKLYIHV  1363
             + Q K+YI V
Sbjct  245   RPQDKVYIPV  254



>gb|EKV07295.1| Branchpoint-bridging protein [Penicillium digitatum Pd1]
 gb|EKV08675.1| Branchpoint-bridging protein [Penicillium digitatum PHI26]
Length=599

 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  71    RKKRNRWGDQQENKAAGLMGLPTMIMANFT---SEQLEAYTLHLRIEEISQKLRINDVVP  127

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + IK  P + PP+DY 
Sbjct  128   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAIKTIPNYNPPSDYR  183

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  184   RPTKTQEKVYVPV  196



>ref|NP_001011340.1| splicing factor 1 [Xenopus (Silurana) tropicalis]
 gb|AAH88491.1| splicing factor 1 [Xenopus (Silurana) tropicalis]
Length=571

 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 81/129 (63%), Gaps = 6/129 (5%)
 Frame = -2

Query  1740  RKRK-SRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDD  1570
             RKRK SRW D+ P     +P        G+  + E    +  ++ +++RKL++G L +  
Sbjct  5     RKRKRSRWNDETPDQKTIIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPP  64

Query  1569  RPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP-  1393
              PE  RSPSPEPIY++ G R+NTRE+R R+KL  ER  +I++++  NP FKPPADY+PP 
Sbjct  65    NPE-DRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVGLNPDFKPPADYKPPA  123

Query  1392  -KLQKKLYI  1369
              ++  K+ I
Sbjct  124   TRVSDKVMI  132



>gb|AFR94987.1| branchpoint-bridging protein [Cryptococcus neoformans var. grubii 
H99]
Length=546

 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 77/130 (59%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGI-EFDPEIQALNSRLLEISRKLQSGLPLDDRP  1564
             RKR+SRW D   K  + +P       G + + + +  A++ RL EI+RKL++G  +   P
Sbjct  129   RKRRSRWGDASAK--VNVPGMPVAVMGNVSQTELDNYAIHVRLEEINRKLRTGDVVP--P  184

Query  1563  EGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY---RPP  1393
             EG RSPSP P YD  G R NTRE R R+KL  ER  +I + +K +P F+PP D+   R  
Sbjct  185   EGQRSPSPTPQYDAYGRRTNTRELRYRKKLEDERTRLIDRAVKSDPNFRPPVDFQHKRGS  244

Query  1392  KLQKKLYIHV  1363
             + Q K+YI V
Sbjct  245   RPQDKVYIPV  254



>ref|XP_002561926.1| Pc18g00800 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP94304.1| Pc18g00800 [Penicillium rubens Wisconsin 54-1255]
Length=585

 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  66    RKKRNRWGDQQENKAAGLMGLPTMIMANFT---SEQLEAYTLHLRIEEISQKLRINDVVP  122

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + IK  P + PP+DY 
Sbjct  123   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAIKTIPNYNPPSDYR  178

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  179   RPTKTQEKVYVPV  191



>gb|KGB74893.1| splicing factor SF1 [Cryptococcus gattii R265]
Length=547

 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 77/130 (59%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGI-EFDPEIQALNSRLLEISRKLQSGLPLDDRP  1564
             RKR+SRW D   K  + +P       G + + + +  A++ RL EI+RKL++G  +   P
Sbjct  129   RKRRSRWGDASAK--VNVPGMPVAVMGNVSQTELDNYAIHVRLEEINRKLRTGDVVP--P  184

Query  1563  EGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY---RPP  1393
             EG RSPSP P YD  G R NTRE R R+KL  ER  +I + +K +P F+PP D+   R  
Sbjct  185   EGQRSPSPTPQYDAYGRRTNTRELRYRKKLEDERTRLIDRAVKSDPNFRPPVDFQHKRGS  244

Query  1392  KLQKKLYIHV  1363
             + Q K+YI V
Sbjct  245   RPQDKVYIPV  254



>ref|XP_010886232.1| PREDICTED: splicing factor 1, partial [Esox lucius]
Length=542

 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 96/165 (58%), Gaps = 20/165 (12%)
 Frame = -2

Query  1737  KRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDRP  1564
             +++SRW+ + P     +P        G+  D E    +  ++ +++RKL++G L +   P
Sbjct  93    RKRSRWSSETPDQKTIIPGMPTVIPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNP  152

Query  1563  EGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--K  1390
             E  RSPSPEPIY++ G R+NTREYR R+K+  ER  +I++++  NP FKPPADY+PP  +
Sbjct  153   E-DRSPSPEPIYNSEGKRLNTREYRTRKKIEEERHSLITEMVGLNPEFKPPADYKPPATR  211

Query  1389  LQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             +  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  212   VNDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  252



>ref|XP_002796190.1| branchpoint-bridging protein [Paracoccidioides sp. 'lutzii' Pb01]
Length=222

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 78/132 (59%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWADDE---PKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             RK+++RW D E      L+ LP  +       +   E   L+ R+ EIS+KL+    +P 
Sbjct  63    RKKRNRWGDAEENKAAGLMGLPTLIMANMTNEQL--EAYTLHLRIEEISQKLRINDVVPA  120

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDN G R+NTREYR R++L  ER ++I + IK  P + PP+DY R
Sbjct  121   D----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLIEKAIKAIPNYHPPSDYRR  176

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  177   PTKTQEKVYVPV  188



>gb|EMS24331.1| splicing factor 1 SF1 [Rhodosporidium toruloides NP11]
 emb|CDR41924.1| RHTO0S06e07866g1_1 [Rhodosporidium toruloides]
Length=574

 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 78/135 (58%), Gaps = 19/135 (14%)
 Frame = -2

Query  1740  RKRKSRWAD--DEPKPLIQLPDFMKDFTGGI-EFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RKRKSRW D  D   P+          TGG+ E D E  A+  RL EI R L++G  +  
Sbjct  144   RKRKSRWGDKSDAAVPVA--------ITGGVQEKDLETYAVQLRLDEIQRALRTGQVVP-  194

Query  1569  RPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPK  1390
              P+GARSPSP P YD+ G R NTRE R R++L  ER  +I + IK +P F+PPA+Y   K
Sbjct  195   -PDGARSPSPPPTYDSHGRRTNTREVRYRKRLEDERMRLIDRQIKLDPNFRPPAEYLVAK  253

Query  1389  L------QKKLYIHV  1363
                    Q+K+YI V
Sbjct  254   RQNMGRPQEKIYIPV  268



>ref|XP_011125723.1| hypothetical protein AOL_s00169g64 [Arthrobotrys oligospora ATCC 
24927]
 gb|EGX45458.1| hypothetical protein AOL_s00169g64 [Arthrobotrys oligospora ATCC 
24927]
Length=628

 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 81/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             RK+K+RW D   ++   L+ LP  ++      +   E   L+ R+ EI++KL+    +P 
Sbjct  80    RKKKNRWGDAVDNKAAGLVGLPTKIEAAMTSEQL--EAYTLHLRIEEITQKLRINDVVPA  137

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDNMG RINTREYR R++L  ER +++ + +K  P + PP+DY R
Sbjct  138   D----GDRSPSPPPQYDNMGRRINTREYRYRKRLEDERHKLVEKAMKAIPNYHPPSDYRR  193

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  194   PTKTQEKIYVPV  205



>ref|XP_011112405.1| hypothetical protein H072_6622 [Dactylellina haptotyla CBS 200.50]
 gb|EPS39599.1| hypothetical protein H072_6622 [Dactylellina haptotyla CBS 200.50]
Length=621

 Score = 89.7 bits (221),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 81/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             RK+K+RW D   ++   L+ LP  ++      +   E   L+ R+ EI++KL+    +P 
Sbjct  79    RKKKNRWGDAVDNKAAGLVGLPTKIEAAMTSEQL--EAYTLHLRIEEITQKLRINDVVPA  136

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDNMG RINTREYR R++L  ER +++ + +K  P + PP+DY R
Sbjct  137   D----GDRSPSPPPQYDNMGRRINTREYRYRKRLEDERHKLVEKAMKAIPNYHPPSDYRR  192

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  193   PTKTQEKIYVPV  204



>ref|XP_007286952.1| zinc knuckle transcription factor splicing factor msl5 [Colletotrichum 
gloeosporioides Nara gc5]
 gb|ELA24004.1| zinc knuckle transcription factor splicing factor msl5 [Colletotrichum 
gloeosporioides Nara gc5]
Length=375

 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDP-EIQALNSRLLEISRKLQSGLPLDDR-  1567
             RK+++RW D        L       T  +  +  E   L+ R+ EIS+KL+    +DD  
Sbjct  58    RKKRNRWGDASENKAAGLMGLTTAITANMTGEQLEAYTLHLRITEISQKLR----IDDVV  113

Query  1566  -PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPP  1393
               +G RSPSP P YDN G RINTREYR R++L  ER ++I + +K  P + PP DY RP 
Sbjct  114   PADGDRSPSPPPQYDNHGRRINTREYRYRKRLEDERHKLIEKAMKTIPNYHPPQDYRRPT  173

Query  1392  KLQKKLYIHV  1363
             K Q+K+Y+ V
Sbjct  174   KTQEKVYVPV  183



>ref|XP_003193642.1| splicing factor SF1 [Cryptococcus gattii WM276]
 gb|ADV21855.1| Splicing factor SF1, putative [Cryptococcus gattii WM276]
Length=547

 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 77/130 (59%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGI-EFDPEIQALNSRLLEISRKLQSGLPLDDRP  1564
             RKR+SRW D   K  + +P       G + + + +  A++ RL EI+RKL++G  +   P
Sbjct  129   RKRRSRWGDASAK--VNVPGMPVAVMGNVSQTELDNYAIHVRLEEINRKLRTGDVVP--P  184

Query  1563  EGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY---RPP  1393
             EG RSPSP P YD  G R NTRE R R+KL  ER  +I + +K +P F+PP D+   R  
Sbjct  185   EGQRSPSPTPQYDAYGRRTNTRELRYRKKLEDERTRLIDRAVKSDPNFRPPVDFQHKRGS  244

Query  1392  KLQKKLYIHV  1363
             + Q K+YI V
Sbjct  245   RPQDKVYIPV  254



>gb|EFA83129.1| hypothetical protein PPL_03919 [Polysphondylium pallidum PN500]
Length=475

 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 83/131 (63%), Gaps = 8/131 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEP-KPLIQLPDFMKDFTGGIEFDPEIQAL--NSRLLEISRKLQSGLPLDD  1570
             R RK++W   EP K  + LP   K    G+  D ++ +L    R+ EI++KL +G P+D 
Sbjct  47    RTRKNKW---EPEKTQLGLPGVPKSLPPGL-TDDQLASLIIRIRIDEITKKLTTG-PIDI  101

Query  1569  RPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPK  1390
               +  RS SP P+YDN G R NTRE RA++K+++ER  +I+Q  + NP F+PPADY+PP 
Sbjct  102   DTKDDRSRSPTPVYDNTGKRTNTREQRAKDKISKERHNLITQAQQINPQFRPPADYQPPN  161

Query  1389  LQKKLYIHVLV  1357
              +K + I++ V
Sbjct  162   EKKTMKIYIPV  172



>gb|KGO64052.1| K Homology domain, type 1 [Penicillium italicum]
Length=596

 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  69    RKKRNRWGDQQENKAAGLMGLPTMIMANFT---SEQLEAYTLHLRIEEISQKLRINDVVP  125

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + IK  P + PP+DY 
Sbjct  126   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAIKTIPNYNPPSDYR  181

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  182   RPTKTQEKVYVPV  194



>gb|EFX80726.1| hypothetical protein DAPPUDRAFT_303941 [Daphnia pulex]
Length=418

 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 70/118 (59%), Gaps = 4/118 (3%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQAL-NSRLLEISRKLQSG-LPLDDR  1567
             +KR+SRW  DE +    +P         +  D E   L   ++ EI+RKL++G L +   
Sbjct  112   KKRRSRWGGDEKEKTF-IPGMPTVLPANLTKDQEEAYLVQFKIEEITRKLRTGDLGIAPN  170

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
             PE  RSPSPEPIY   G R+NTREYR R KL  ER  +I+++I  N  FKPP DY+PP
Sbjct  171   PE-ERSPSPEPIYGTDGKRLNTREYRMRRKLEEERHSMITKMISLNADFKPPVDYKPP  227



>emb|CDM33928.1| Branchpoint-bridging protein [Penicillium roqueforti FM164]
Length=596

 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  71    RKKRNRWGDQQENKAAGLMGLPTMIMANFT---SEQLEAYTLHLRIEEISQKLRINDVVP  127

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + IK  P + PP+DY 
Sbjct  128   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAIKTIPNYNPPSDYR  183

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  184   RPTKTQEKVYVPV  196



>tpe|CBF76509.1| TPA: zinc knuckle transcription factor/splicing factor MSL5/ZFM1, 
putative (AFU_orthologue; AFUA_3G10840) [Aspergillus nidulans 
FGSC A4]
Length=554

 Score = 89.4 bits (220),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  59    RKKRNRWGDAQENKAAGLMGLPTMIMANFT---TEQLEAYTLHLRIEEISQKLRINDVVP  115

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + IK  P + PP+DY 
Sbjct  116   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAIKTIPNYHPPSDYR  171

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  172   RPTKTQEKVYVPV  184



>gb|KFY30798.1| hypothetical protein V493_01663 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=611

 Score = 89.4 bits (220),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 80/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RK+++RW D   ++   L+ LP  +K      +   E   L+ R+ EIS+KL+    +DD
Sbjct  67    RKKRNRWGDATDNKAAGLMGLPTAIKANMTSEQL--EAYTLHLRIEEISQKLR----IDD  120

Query  1569  R--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
                 +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP DY R
Sbjct  121   VVPADGDRSPSPAPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPQDYRR  180

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  181   PTKTQEKVYVPV  192



>ref|XP_003016147.1| hypothetical protein ARB_05544 [Arthroderma benhamiae CBS 112371]
 gb|EFE35502.1| hypothetical protein ARB_05544 [Arthroderma benhamiae CBS 112371]
Length=272

 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 80/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             RK+++RW D   ++   L+ LP  +       +   E   L+ R+ EIS+KL+    +P 
Sbjct  61    RKKRNRWGDAQENKAAGLMGLPTLIMANMTNEQL--EAYTLHLRIEEISQKLRINDVVPA  118

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDN+G R+NTREYR R++L  ER ++I + +K  P + PP+DY R
Sbjct  119   D----GDRSPSPAPQYDNLGKRVNTREYRYRKRLEDERHKLIEKAMKVIPNYHPPSDYRR  174

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  175   PTKTQEKVYVPV  186



>ref|XP_003661986.1| hypothetical protein MYCTH_2314770 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO56741.1| hypothetical protein MYCTH_2314770 [Myceliophthora thermophila 
ATCC 42464]
Length=239

 Score = 85.9 bits (211),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW +   ++   L+ LP   + D T       E   L+ R+ EI++KL+    +D
Sbjct  64    RKKRNRWGEATENKAAGLMGLPTAIVADMT---SEQLEAYTLHLRIEEITQKLK----ID  116

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G RINTREYR R++L  ER ++I + IK  P + PPADY 
Sbjct  117   DVVPADGDRSPSPPPQYDNHGRRINTREYRYRKRLEDERHKLIEKAIKTIPNYHPPADYR  176

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  177   RPTKTQEKVYVPV  189



>emb|CCJ30428.1| unnamed protein product [Pneumocystis jirovecii]
Length=537

 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 75/134 (56%), Gaps = 14/134 (10%)
 Frame = -2

Query  1740  RKRKSRWADDEPKP-----LIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--L  1582
             RKRK+RW    P+      LI LP  +       +   E  AL+ RL EI +KL+ G  +
Sbjct  65    RKRKNRWGTSGPEGNKALGLIGLPTAITSNMTNEQL--EAYALHMRLEEIGQKLRIGDVV  122

Query  1581  PLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY  1402
             P D    G RSPSP P YDN G R NTRE R R++L  ER  +I + ++  P FKPP DY
Sbjct  123   PRD----GERSPSPPPQYDNFGRRTNTREIRYRKRLEDERHCLIDKAMRTIPDFKPPVDY  178

Query  1401  -RPPKLQKKLYIHV  1363
              RP K Q K+Y+ V
Sbjct  179   RRPTKTQDKIYVPV  192



>gb|EPB83741.1| hypothetical protein HMPREF1544_09482 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=543

 Score = 88.6 bits (218),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 74/126 (59%), Gaps = 7/126 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRP-  1564
             RKRKSRW D++ K +I  P      +       E   L  RL E++RK+++    D  P 
Sbjct  62    RKRKSRWGDEQQKVII--PGLPTTISKANRDQSEKYLLQIRLEEVNRKIRTN---DFTPG  116

Query  1563  EGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPPKL  1387
             E  RSPSPEPIY+  G R+NTRE R ++KL  ER  +I   IK  P F+PP DY RP K 
Sbjct  117   ERERSPSPEPIYNADGKRVNTREARYKKKLEDERHRLIETAIKTIPNFRPPLDYKRPTKT  176

Query  1386  QKKLYI  1369
             Q+K+YI
Sbjct  177   QEKVYI  182



>dbj|GAD96713.1| zinc knuckle transcription factor/splicing factor MSL5/ZFM1, 
putative [Byssochlamys spectabilis No. 5]
Length=566

 Score = 88.6 bits (218),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  59    RKKRNRWGDAQENKAAGLMGLPTMIMANFT---NEQLEAYTLHLRIEEISQKLRINDVVP  115

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + +K  P + PP+DY 
Sbjct  116   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAMKMIPNYHPPSDYR  171

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  172   RPTKTQEKVYVPV  184



>gb|ELQ38565.1| branchpoint-bridging protein [Magnaporthe oryzae Y34]
 gb|ELQ69270.1| branchpoint-bridging protein [Magnaporthe oryzae P131]
Length=638

 Score = 89.0 bits (219),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EI++KL+    +D
Sbjct  77    RKKRNRWGDATDNKAAGLMGLPTAVMANMTA---EQLEAYTLHLRIEEITQKLK----ID  129

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + IK  P + PP+DY 
Sbjct  130   DVVPADGDRSPSPAPQYDNQGRRVNTREYRYRKKLEDERHKLIEKAIKTIPNYHPPSDYR  189

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  190   RPTKTQEKVYVPV  202



>dbj|GAM39257.1| zinc finger protein [Talaromyces cellulolyticus]
Length=567

 Score = 88.6 bits (218),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  63    RKKRNRWGDAQENKAAGLMGLPTMIMANFT---NEQLEAYTLHLRIEEISQKLRINDVVP  119

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + +K  P + PP+DY 
Sbjct  120   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVERAMKVIPNYHPPSDYR  175

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  176   RPTKTQEKVYVPV  188



>gb|EPS30080.1| hypothetical protein PDE_05030 [Penicillium oxalicum 114-2]
Length=564

 Score = 88.6 bits (218),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  60    RKKRNRWGDQQENKAAGLMGLPTMIMANFT---SEQLEAYTLHLRIEEISQKLRINDVVP  116

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER ++I + +K  P + PP+DY 
Sbjct  117   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLIEKAMKTIPNYHPPSDYR  172

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  173   RPTKTQEKVYVPV  185



>ref|XP_003709462.1| branchpoint-bridging protein [Magnaporthe oryzae 70-15]
 gb|EHA56850.1| branchpoint-bridging protein [Magnaporthe oryzae 70-15]
Length=638

 Score = 88.6 bits (218),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EI++KL+    +D
Sbjct  77    RKKRNRWGDATDNKAAGLMGLPTAVMANMTA---EQLEAYTLHLRIEEITQKLK----ID  129

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + IK  P + PP+DY 
Sbjct  130   DVVPADGDRSPSPAPQYDNQGRRVNTREYRYRKKLEDERHKLIEKAIKTIPNYHPPSDYR  189

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  190   RPTKTQEKVYVPV  202



>gb|KHN97274.1| Zinc knuckle domain containing protein [Metarhizium album ARSEF 
1941]
Length=583

 Score = 88.6 bits (218),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  51    RKKRNRWGDASENKAAGLMGLPTAIMSNMT---SEQLEAYTLHLRIEEISQKLR----ID  103

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  104   DVVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIEKAMKTIPNYHPPQDYR  163

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  164   RPTKTQEKVYVPV  176



>emb|CDQ77395.1| unnamed protein product [Oncorhynchus mykiss]
Length=651

 Score = 89.0 bits (219),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 94/165 (57%), Gaps = 20/165 (12%)
 Frame = -2

Query  1737  KRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDRP  1564
             +++SRW  + P     +P        G+  D E    +  ++ +++RKL++G L +   P
Sbjct  93    RKRSRWNSETPDQKTVIPGMPTVIPPGLTRDQEKAYIVQLQIEDLTRKLRTGDLGIPVNP  152

Query  1563  EGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--K  1390
             E  RSPSPEPIY++ G R+NTREYR R+K+  ER  +I+ ++  NP FKPPADY+PP  +
Sbjct  153   ED-RSPSPEPIYNSEGKRLNTREYRTRKKIEEERHSLITDMVALNPEFKPPADYKPPATR  211

Query  1389  LQKKL-----------YIHVLVGAETQSHLKLLQPWLRSSCSRLM  1288
             +  K+           ++ +L+G    + LK ++   +  C+++M
Sbjct  212   VNDKVMIPQDEYPEINFVGLLIGPRGNT-LKNIE---KECCAKIM  252



>gb|EYE94603.1| hypothetical protein EURHEDRAFT_80013 [Aspergillus ruber CBS 
135680]
Length=572

 Score = 88.6 bits (218),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  63    RKKRNRWGDAQENKAAGLMGLPTMIMANFT---NEQLEAYTLHLRIEEISQKLRINDVVP  119

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + +K  P + PP+DY 
Sbjct  120   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVDKAMKSIPNYHPPSDYR  175

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  176   RPTKTQEKVYVPV  188



>ref|XP_007583360.1| putative branchpoint-bridging protein [Neofusicoccum parvum UCRNP2]
 gb|EOD49138.1| putative branchpoint-bridging protein [Neofusicoccum parvum UCRNP2]
Length=443

 Score = 87.8 bits (216),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDP-EIQALNSRLLEISRKLQSG--LPLDD  1570
             RK+++RW D        L       T  +  +  E   L+ R+ EIS+KL+    +P D 
Sbjct  67    RKKRNRWGDASDNKAAGLMGLTTAITAHMTAEQLEAYTLHLRIEEISQKLRINDVVPAD-  125

Query  1569  RPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPP  1393
                G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP+DY RP 
Sbjct  126   ---GDRSPSPPPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPSDYRRPT  182

Query  1392  KLQKKLYIHV  1363
             K Q+K+Y+ V
Sbjct  183   KTQEKVYVPV  192



>ref|XP_008179372.1| PREDICTED: splicing factor 1 [Acyrthosiphon pisum]
Length=543

 Score = 88.2 bits (217),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 72/129 (56%), Gaps = 20/129 (16%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGI---------EFDPEIQALNSRLLEISRKLQS  1588
             RK+KSRW            D  K F  G+         +   E   L  ++ EI RKL++
Sbjct  39    RKKKSRWGGS---------DLEKTFIPGMPTVLPHNLTKEQEEAYILQLQIEEIGRKLRT  89

Query  1587  G-LPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPP  1411
             G L +   PE  RSPSPEPIY + G R+NTREYR R+KL  ER  +I ++   NP FKPP
Sbjct  90    GELGIPSNPE-ERSPSPEPIYSSDGKRMNTREYRTRKKLEEERHRLIQRMAIINPTFKPP  148

Query  1410  ADYRPPKLQ  1384
             ADY+PP ++
Sbjct  149   ADYKPPVIR  157



>gb|KFY33042.1| hypothetical protein V495_08485, partial [Pseudogymnoascus pannorum 
VKM F-4514 (FW-929)]
Length=504

 Score = 88.2 bits (217),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  68    RKKRNRWGDATDNKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  120

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  121   DVVPADGDRSPSPAPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPQDYR  180

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  181   RPTKTQEKVYVPV  193



>dbj|GAA82104.1| zinc knuckle transcription factor/splicing factor MSL5/ZFM1 [Aspergillus 
kawachii IFO 4308]
Length=560

 Score = 88.2 bits (217),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  66    RKKRNRWGDAQENKAAGLMGLPTMIMANFT---NEQLEAYTLHLRIEEISQKLRINDVVP  122

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + +K  P + PP+DY 
Sbjct  123   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAMKTIPNYHPPSDYR  178

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  179   RPTKTQEKVYVPV  191



>ref|XP_006642895.1| PREDICTED: splicing factor 1-like [Lepisosteus oculatus]
Length=635

 Score = 88.6 bits (218),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 82/130 (63%), Gaps = 9/130 (7%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG---LPLD  1573
             ++++SRW+ + P     +P        G+  + E    +  ++ +++RKL++G   +PL+
Sbjct  104   KRKRSRWSSETPDQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPLN  163

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
               PE  RSPSPEPIY++ G R+NTREYR R+KL  ER  +I +++  NP FKPPADY+PP
Sbjct  164   --PE-DRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHLLIQEMVGLNPEFKPPADYKPP  220

Query  1392  --KLQKKLYI  1369
               ++  K+ I
Sbjct  221   ATRVSDKVMI  230



>ref|XP_002509405.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70663.1| predicted protein [Micromonas sp. RCC299]
Length=823

 Score = 89.0 bits (219),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -2

Query  1647  DPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNR  1468
             DPE+    ++ ++I+ +++SG   D+RPE ARSPSP P YD  G+R NTRE R + KL  
Sbjct  220   DPEVVKQYAKYVDITDRVRSGYFADERPEHARSPSPPPQYDKYGVRTNTRELRIKAKLED  279

Query  1467  ERQEIISQIIKKNP-AFKPPADYRPPKLQKKLYI  1369
             ER E+I  ++ + P  F+PP D++P K  +KLY+
Sbjct  280   ERSELIGWLVARCPHMFRPPQDWKPKKRTRKLYV  313



>gb|KFY09295.1| hypothetical protein V491_08267, partial [Pseudogymnoascus pannorum 
VKM F-3775]
Length=480

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  69    RKKRNRWGDATDNKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  121

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  122   DVVPADGDRSPSPAPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPQDYR  181

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  182   RPTKTQEKVYVPV  194



>ref|XP_001271088.1| zinc knuckle transcription factor/splicing factor  MSL5/ZFM1, 
putative [Aspergillus clavatus NRRL 1]
 gb|EAW09662.1| zinc knuckle transcription factor/splicing factor MSL5/ZFM1, 
putative [Aspergillus clavatus NRRL 1]
Length=568

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  62    RKKRNRWGDAQENKAAGLMGLPTMIMANFT---NEQLEAYTLHLRIEEISQKLRINDVVP  118

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + +K  P + PP+DY 
Sbjct  119   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAMKTIPNYHPPSDYR  174

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  175   RPTKTQEKVYVPV  187



>ref|XP_007592088.1| zinc knuckle [Colletotrichum fioriniae PJ7]
 gb|EXF84264.1| zinc knuckle [Colletotrichum fioriniae PJ7]
Length=593

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDP-EIQALNSRLLEISRKLQSGLPLDDR-  1567
             RK+++RW D        L       T  +  +  E   L+ R+ EIS+KL+    +DD  
Sbjct  61    RKKRNRWGDASENKAAGLMGLTTAITANMTGEQLEAYTLHLRITEISQKLR----IDDVV  116

Query  1566  -PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPP  1393
               +G RSPSP P YDN G RINTREYR R++L  ER ++I + +K  P + PP DY RP 
Sbjct  117   PADGDRSPSPAPQYDNHGRRINTREYRYRKRLEDERHKLIEKAMKTIPNYHPPQDYRRPT  176

Query  1392  KLQKKLYIHV  1363
             K Q+K+Y+ V
Sbjct  177   KTQEKVYVPV  186



>ref|XP_002480389.1| zinc knuckle transcription factor/splicing factor  MSL5/ZFM1, 
putative [Talaromyces stipitatus ATCC 10500]
 gb|EED19955.1| zinc knuckle transcription factor/splicing factor MSL5/ZFM1, 
putative [Talaromyces stipitatus ATCC 10500]
Length=554

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  62    RKKRNRWGDAQENKAAGLMGLPTMIMANFT---NEQLEAYTLHLRIEEISQKLRINDVVP  118

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + +K  P + PP+DY 
Sbjct  119   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVERAMKVIPNYHPPSDYR  174

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  175   RPTKTQEKVYVPV  187



>ref|XP_007811916.1| Zinc knuckle domain containing protein [Metarhizium acridum CQMa 
102]
 gb|EFY88367.1| Zinc knuckle domain containing protein [Metarhizium acridum CQMa 
102]
Length=567

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  50    RKKRNRWGDASENKAAGLMGLPTAIMSNMT---SEQLEAYTLHLRIEEISQKLR----ID  102

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  103   DVVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIEKAMKTIPNYHPPQDYR  162

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  163   RPTKTQEKVYVPV  175



>ref|XP_003000220.1| branchpoint-bridging protein [Verticillium alfalfae VaMs.102]
 gb|EEY23305.1| branchpoint-bridging protein [Verticillium alfalfae VaMs.102]
Length=592

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  63    RKKRNRWGDASENKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  115

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  116   DVVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIEKAMKTIPNYHPPQDYR  175

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  176   RPTKTQEKVYVPV  188



>gb|KEY82589.1| transcription factor zinc knuckle MSL5/ZFM1 [Aspergillus fumigatus 
var. RP-2014]
Length=565

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  64    RKKRNRWGDAQENKAAGLMGLPTMIMANFT---NEQLEAYTLHLRIEEISQKLRINDVVP  120

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + +K  P + PP+DY 
Sbjct  121   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAMKTIPNYHPPSDYR  176

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  177   RPTKTQEKVYVPV  189



>ref|XP_001399793.1| branchpoint-bridging protein [Aspergillus niger CBS 513.88]
 emb|CAL00655.1| unnamed protein product [Aspergillus niger]
Length=566

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  66    RKKRNRWGDAQENKAAGLMGLPTMIMANFT---NEQLEAYTLHLRIEEISQKLRINDVVP  122

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + +K  P + PP+DY 
Sbjct  123   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAMKTIPNYHPPSDYR  178

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  179   RPTKTQEKVYVPV  191



>ref|XP_001263374.1| zinc knuckle transcription factor/splicing factor MSL5/ZFM1, 
putative [Neosartorya fischeri NRRL 181]
 gb|EAW21477.1| zinc knuckle transcription factor/splicing factor MSL5/ZFM1, 
putative [Neosartorya fischeri NRRL 181]
Length=566

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  64    RKKRNRWGDAQENKAAGLMGLPTMIMANFT---NEQLEAYTLHLRIEEISQKLRINDVVP  120

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + +K  P + PP+DY 
Sbjct  121   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAMKTIPNYHPPSDYR  176

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  177   RPTKTQEKVYVPV  189



>ref|XP_002144012.1| zinc knuckle transcription factor/splicing factor  MSL5/ZFM1, 
putative [Talaromyces marneffei ATCC 18224]
 gb|EEA27497.1| zinc knuckle transcription factor/splicing factor MSL5/ZFM1, 
putative [Talaromyces marneffei ATCC 18224]
Length=565

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  63    RKKRNRWGDAQENKAAGLMGLPTMIMANFT---NEQLEAYTLHLRIEEISQKLRINDVVP  119

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + +K  P + PP+DY 
Sbjct  120   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVERAMKVIPNYHPPSDYR  175

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  176   RPTKTQEKVYVPV  188



>gb|ENH80879.1| branchpoint-bridging protein [Colletotrichum orbiculare MAFF 
240422]
Length=576

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDP-EIQALNSRLLEISRKLQSGLPLDDR-  1567
             RK+++RW D        L       T  +  +  E   L+ R+ EIS+KL+    +DD  
Sbjct  60    RKKRNRWGDASENKAAGLMGLTTAITANMTGEQLEAYTLHLRITEISQKLR----IDDVV  115

Query  1566  -PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPP  1393
               +G RSPSP P YDN G RINTREYR R++L  ER ++I + +K  P + PP DY RP 
Sbjct  116   PADGDRSPSPPPQYDNHGRRINTREYRYRKRLEDERHKLIEKAMKTIPNYHPPQDYRRPT  175

Query  1392  KLQKKLYIHV  1363
             K Q+K+Y+ V
Sbjct  176   KTQEKVYVPV  185



>ref|XP_009652551.1| branchpoint-bridging protein [Verticillium dahliae VdLs.17]
 gb|EGY23214.1| branchpoint-bridging protein [Verticillium dahliae VdLs.17]
Length=590

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  62    RKKRNRWGDASENKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  114

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  115   DVVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIEKAMKTIPNYHPPQDYR  174

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  175   RPTKTQEKVYVPV  187



>gb|ELR06706.1| hypothetical protein GMDG_00323 [Pseudogymnoascus destructans 
20631-21]
Length=611

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  68    RKKRNRWGDATDNKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  120

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  121   DVVPADGDRSPSPAPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPQDYR  180

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  181   RPTKTQEKVYVPV  193



>emb|CCF44509.1| zinc knuckle [Colletotrichum higginsianum]
Length=564

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDP-EIQALNSRLLEISRKLQSGLPLDDR-  1567
             RK+++RW D        L       T  +  +  E   L+ R+ EIS+KL+    +DD  
Sbjct  28    RKKRNRWGDASENKAAGLMGLTTAITANMTGEQLEAYTLHLRITEISQKLR----IDDVV  83

Query  1566  -PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPP  1393
               +G RSPSP P YDN G RINTREYR R++L  ER ++I + +K  P + PP DY RP 
Sbjct  84    PADGDRSPSPPPQYDNHGRRINTREYRYRKRLEDERHKLIEKAMKTIPNYHPPQDYRRPT  143

Query  1392  KLQKKLYIHV  1363
             K Q+K+Y+ V
Sbjct  144   KTQEKVYVPV  153



>gb|EEH08472.1| branchpoint-bridging protein [Histoplasma capsulatum G186AR]
Length=597

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 79/133 (59%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWADDE---PKPLIQLPDF-MKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D E      L+ LP   M + T       E   L+ R+ EIS+KL+    +P
Sbjct  62    RKKRNRWGDAEENKAAGLMGLPTLIMANMT---NEQLEAYTLHLRIEEISQKLRINDVVP  118

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER ++I + +K  P + PP+DY 
Sbjct  119   AD----GDRSPSPAPQYDNFGRRVNTREYRYRKRLEDERHKLIEKAVKVIPNYHPPSDYR  174

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  175   RPTKTQEKVYVPV  187



>ref|XP_754535.1| zinc knuckle transcription factor/splicing factor  MSL5/ZFM1, 
putative [Aspergillus fumigatus Af293]
 sp|Q4WXV6.1|BBP_ASPFU RecName: Full=Branchpoint-bridging protein [Aspergillus fumigatus 
Af293]
 gb|EAL92497.1| zinc knuckle transcription factor/splicing factor MSL5/ZFM1, 
putative [Aspergillus fumigatus Af293]
 gb|EDP52663.1| zinc knuckle transcription factor/splicing factor MSL5/ZFM1, 
putative [Aspergillus fumigatus A1163]
Length=566

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  64    RKKRNRWGDAQENKAAGLMGLPTMIMANFT---NEQLEAYTLHLRIEEISQKLRINDVVP  120

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + +K  P + PP+DY 
Sbjct  121   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAMKTIPNYHPPSDYR  176

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  177   RPTKTQEKVYVPV  189



>gb|KFY51470.1| hypothetical protein V497_09111 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=610

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  68    RKKRNRWGDATDNKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  120

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  121   DVVPADGDRSPSPAPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPQDYR  180

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  181   RPTKTQEKVYVPV  193



>gb|KFX86791.1| hypothetical protein V490_08846 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=611

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  68    RKKRNRWGDATDNKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  120

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  121   DVVPADGDRSPSPAPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPQDYR  180

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  181   RPTKTQEKVYVPV  193



>gb|KFY81872.1| hypothetical protein V500_11017 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=612

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  68    RKKRNRWGDATDNKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  120

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  121   DVVPADGDRSPSPAPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPQDYR  180

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  181   RPTKTQEKVYVPV  193



>ref|XP_002374691.1| zinc knuckle splicing factor Zfm1 [Aspergillus flavus NRRL3357]
 ref|XP_001819793.2| branchpoint-bridging protein [Aspergillus oryzae RIB40]
 gb|EED55909.1| zinc knuckle splicing factor Zfm1 [Aspergillus flavus NRRL3357]
Length=564

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  62    RKKRNRWGDAQENKAAGLMGLPTMIMANFT---NEQLEAYTLHLRIEEISQKLRINDVVP  118

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + +K  P + PP+DY 
Sbjct  119   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAMKTIPNYHPPSDYR  174

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  175   RPTKTQEKVYVPV  187



>gb|KID75768.1| Zinc knuckle domain containing protein, partial [Metarhizium 
brunneum ARSEF 3297]
Length=565

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  50    RKKRNRWGDASENKAAGLMGLPTAIMSNMT---SEQLEAYTLHLRIEEISQKLR----ID  102

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  103   DVVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIERAMKTIPNYHPPQDYR  162

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  163   RPTKTQEKVYVPV  175



>gb|KFZ15578.1| hypothetical protein V502_05533 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=612

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  68    RKKRNRWGDATDNKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  120

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  121   DVVPADGDRSPSPAPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPQDYR  180

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  181   RPTKTQEKVYVPV  193



>gb|EGD94942.1| zinc knuckle transcription factor/splicing factor MSL5/ZFM1 [Trichophyton 
tonsurans CBS 112818]
 gb|EGE02506.1| branchpoint-bridging protein [Trichophyton equinum CBS 127.97]
Length=578

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDF-MKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +P
Sbjct  61    RKKRNRWGDAQENKAAGLMGLPTLIMANMT---NEQLEAYTLHLRIEEISQKLRINDVVP  117

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN+G R+NTREYR R++L  ER ++I + +K  P + PP+DY 
Sbjct  118   AD----GDRSPSPAPQYDNLGKRVNTREYRYRKRLEDERHKLIEKAMKVIPNYHPPSDYR  173

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  174   RPTKTQEKVYVPV  186



>gb|EQB56438.1| zinc knuckle [Colletotrichum gloeosporioides Cg-14]
Length=576

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDP-EIQALNSRLLEISRKLQSGLPLDDR-  1567
             RK+++RW D        L       T  +  +  E   L+ R+ EIS+KL+    +DD  
Sbjct  58    RKKRNRWGDASENKAAGLMGLTTAITANMTGEQLEAYTLHLRITEISQKLR----IDDVV  113

Query  1566  -PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPP  1393
               +G RSPSP P YDN G RINTREYR R++L  ER ++I + +K  P + PP DY RP 
Sbjct  114   PADGDRSPSPPPQYDNHGRRINTREYRYRKRLEDERHKLIEKAMKTIPNYHPPQDYRRPT  173

Query  1392  KLQKKLYIHV  1363
             K Q+K+Y+ V
Sbjct  174   KTQEKVYVPV  183



>gb|KFY60323.1| hypothetical protein V496_05365 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY96515.1| hypothetical protein V498_02636 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=613

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  69    RKKRNRWGDATDNKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  121

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  122   DVVPADGDRSPSPAPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPQDYR  181

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  182   RPTKTQEKVYVPV  194



>gb|KFY73533.1| hypothetical protein V499_06394 [Pseudogymnoascus pannorum VKM 
F-103]
 gb|KFZ12458.1| hypothetical protein V501_04224 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=613

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  69    RKKRNRWGDATDNKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  121

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  122   DVVPADGDRSPSPAPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPQDYR  181

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  182   RPTKTQEKVYVPV  194



>gb|KFY08302.1| hypothetical protein V492_06347 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=614

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  69    RKKRNRWGDATDNKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  121

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  122   DVVPADGDRSPSPAPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPQDYR  181

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  182   RPTKTQEKVYVPV  194



>ref|XP_003177063.1| branchpoint-bridging protein [Microsporum gypseum CBS 118893]
 gb|EFQ98111.1| branchpoint-bridging protein [Microsporum gypseum CBS 118893]
Length=569

 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDF-MKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +P
Sbjct  62    RKKRNRWGDAQENKAAGLMGLPTLIMANMT---NEQLEAYTLHLRIEEISQKLRINDVVP  118

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN+G R+NTREYR R++L  ER ++I + +K  P + PP+DY 
Sbjct  119   AD----GDRSPSPAPQYDNLGKRVNTREYRYRKRLEDERHKLIEKAMKVIPNYHPPSDYR  174

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  175   RPTKTQEKVYVPV  187



>ref|XP_003728254.1| PREDICTED: uncharacterized protein LOC754661 isoform 2 [Strongylocentrotus 
purpuratus]
Length=853

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 74/118 (63%), Gaps = 6/118 (5%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQAL-NSRLLEISRKLQSG-LPLDDR  1567
             R+++SRW  ++ K     P        G+  + E Q L + ++ E+SRKL++G L +   
Sbjct  109   RRKRSRWGGEDAK---AAPGVATVIPSGLSKEQETQVLLHLQIEELSRKLRTGELGVPPN  165

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
              E  RSPSPEPIY++ G R+NTREYR R+KL  +R ++I   I  NP +KPPADY+PP
Sbjct  166   VED-RSPSPEPIYNHEGKRLNTREYRMRKKLEEDRHKMIQDAITMNPEYKPPADYKPP  222



>ref|XP_001186560.2| PREDICTED: uncharacterized protein LOC754661 isoform 1 [Strongylocentrotus 
purpuratus]
Length=819

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 74/118 (63%), Gaps = 6/118 (5%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQAL-NSRLLEISRKLQSG-LPLDDR  1567
             R+++SRW  ++ K     P        G+  + E Q L + ++ E+SRKL++G L +   
Sbjct  109   RRKRSRWGGEDAK---AAPGVATVIPSGLSKEQETQVLLHLQIEELSRKLRTGELGVPPN  165

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
              E  RSPSPEPIY++ G R+NTREYR R+KL  +R ++I   I  NP +KPPADY+PP
Sbjct  166   VED-RSPSPEPIYNHEGKRLNTREYRMRKKLEEDRHKMIQDAITMNPEYKPPADYKPP  222



>ref|XP_003852129.1| hypothetical protein MYCGRDRAFT_71918 [Zymoseptoria tritici IPO323]
 gb|EGP87105.1| hypothetical protein MYCGRDRAFT_71918 [Zymoseptoria tritici IPO323]
Length=535

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             R++++RW D   ++   L+ LP  +       + D  +  L  R+ EIS+KL+    +P 
Sbjct  58    RRKRNRWGDASDNKAAGLMNLPTAITAPMTAEQLDAYVTHL--RIEEISQKLRINDVVPA  115

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDN G R+NTREYR R+KL  ER + I + +K  P++ PPADY R
Sbjct  116   D----GDRSPSPAPQYDNFGKRVNTREYRYRKKLEDERHKQIEKAMKIIPSYHPPADYRR  171

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  172   PTKTQEKVYVPV  183



>gb|EZF32451.1| branchpoint-bridging protein [Trichophyton interdigitale H6]
 gb|KDB22613.1| branchpoint-bridging protein [Trichophyton interdigitale MR816]
Length=567

 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDF-MKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +P
Sbjct  61    RKKRNRWGDAQENKAAGLMGLPTLIMANMT---NEQLEAYTLHLRIEEISQKLRINDVVP  117

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN+G R+NTREYR R++L  ER ++I + +K  P + PP+DY 
Sbjct  118   AD----GDRSPSPAPQYDNLGKRVNTREYRYRKRLEDERHKLIEKAMKVIPNYHPPSDYR  173

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  174   RPTKTQEKVYVPV  186



>gb|KFX50717.1| Branchpoint-bridging protein [Talaromyces marneffei PM1]
Length=841

 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M +FT       E   L+ R+ EIS+KL+    +P
Sbjct  332   RKKRNRWGDAQENKAAGLMGLPTMIMANFT---NEQLEAYTLHLRIEEISQKLRINDVVP  388

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER +++ + +K  P + PP+DY 
Sbjct  389   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVERAMKVIPNYHPPSDYR  444

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  445   RPTKTQEKVYVPV  457



>gb|KFY39287.1| hypothetical protein V494_04039 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=614

 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  69    RKKRNRWGDATDNKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  121

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  122   DVVPADGDRSPSPAPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPQDYR  181

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  182   RPTKTQEKVYVPV  194



>ref|XP_006674210.1| peptidase family M28 family [Cordyceps militaris CM01]
 gb|EGX88965.1| peptidase family M28 family [Cordyceps militaris CM01]
Length=1596

 Score = 88.6 bits (218),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RK+++RW D   ++   LI LP  +       +   E   L+ R+ EIS+KL+    +DD
Sbjct  57    RKKRNRWGDASENKAAGLINLPTAITAAMTSEQL--EAYTLHLRIEEISQKLR----IDD  110

Query  1569  R--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
                 +G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP DY R
Sbjct  111   VVPADGDRSPSPAPQYDNHGRRVNTREYRYRKKLEDERHKLIEKAMKTIPNYHPPQDYRR  170

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  171   PTKTQEKVYVPV  182



>gb|KID91681.1| Zinc knuckle domain containing protein [Metarhizium guizhouense 
ARSEF 977]
 gb|KID97145.1| Zinc knuckle domain containing protein, partial [Metarhizium 
majus ARSEF 297]
Length=567

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  50    RKKRNRWGDASENKAAGLMGLPTAIMSNMT---SEQLEAYTLHLRIEEISQKLR----ID  102

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  103   DVVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIERAMKTIPNYHPPQDYR  162

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  163   RPTKTQEKVYVPV  175



>ref|XP_007820715.1| Zinc knuckle domain containing protein [Metarhizium robertsii 
ARSEF 23]
 gb|EFZ00085.1| branchpoint-bridging protein [Metarhizium robertsii ARSEF 23]
 gb|EXV06794.1| zinc knuckle and KH domain protein [Metarhizium robertsii]
Length=567

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  50    RKKRNRWGDASENKAAGLMGLPTAIMSNMT---SEQLEAYTLHLRIEEISQKLR----ID  102

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  103   DVVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIERAMKTIPNYHPPQDYR  162

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  163   RPTKTQEKVYVPV  175



>gb|KFG78945.1| Zinc knuckle domain containing protein [Metarhizium anisopliae]
 gb|KID63213.1| Zinc knuckle domain containing protein, partial [Metarhizium 
anisopliae ARSEF 549]
Length=569

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  50    RKKRNRWGDASENKAAGLMGLPTAIMSNMT---SEQLEAYTLHLRIEEISQKLR----ID  102

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  103   DVVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIERAMKTIPNYHPPQDYR  162

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  163   RPTKTQEKVYVPV  175



>gb|EEH39889.2| branchpoint-bridging protein [Paracoccidioides sp. 'lutzii' Pb01]
Length=603

 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 79/133 (59%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWADDE---PKPLIQLPDF-MKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D E      L+ LP   M + T       E   L+ R+ EIS+KL+    +P
Sbjct  63    RKKRNRWGDAEENKAAGLMGLPTLIMANMT---NEQLEAYTLHLRIEEISQKLRINDVVP  119

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER ++I + IK  P + PP+DY 
Sbjct  120   AD----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLIEKAIKAIPNYHPPSDYR  175

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  176   RPTKTQEKVYVPV  188



>ref|XP_003238380.1| zinc knuckle transcription factor/splicing factor MSL5/ZFM1 [Trichophyton 
rubrum CBS 118892]
 gb|EGD84089.1| branchpoint-bridging protein [Trichophyton rubrum CBS 118892]
 gb|EZF11059.1| branchpoint-bridging protein [Trichophyton rubrum MR850]
 gb|EZF37932.1| branchpoint-bridging protein [Trichophyton rubrum CBS 100081]
 gb|EZF48568.1| branchpoint-bridging protein [Trichophyton rubrum CBS 288.86]
 gb|EZF59209.1| branchpoint-bridging protein [Trichophyton rubrum CBS 289.86]
 gb|EZF69797.1| branchpoint-bridging protein [Trichophyton soudanense CBS 452.61]
 gb|EZF80597.1| branchpoint-bridging protein [Trichophyton rubrum MR1448]
 gb|EZF91128.1| branchpoint-bridging protein [Trichophyton rubrum MR1459]
 gb|EZG02029.1| branchpoint-bridging protein [Trichophyton rubrum CBS 735.88]
 gb|EZG12737.1| branchpoint-bridging protein [Trichophyton rubrum CBS 202.88]
 gb|KDB29774.1| branchpoint-bridging protein [Trichophyton rubrum D6]
Length=567

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDF-MKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +P
Sbjct  61    RKKRNRWGDAQENKAAGLMGLPTLIMANMT---NEQLEAYTLHLRIEEISQKLRINDVVP  117

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN+G R+NTREYR R++L  ER ++I + +K  P + PP+DY 
Sbjct  118   AD----GDRSPSPAPQYDNLGKRVNTREYRYRKRLEDERHKLIEKAMKVIPNYHPPSDYR  173

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  174   RPTKTQEKVYVPV  186



>ref|XP_009170462.1| hypothetical protein T265_06824 [Opisthorchis viverrini]
 gb|KER25793.1| hypothetical protein T265_06824 [Opisthorchis viverrini]
Length=597

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 78/134 (58%), Gaps = 19/134 (14%)
 Frame = -2

Query  1740  RKRKSRW--ADDEPKPLI-----QLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG-  1585
             RKRKSRW  A D  +  I     QLP  M      I          S + +ISR+L+SG 
Sbjct  47    RKRKSRWSSAADSDRTYIPGMPTQLPPNMTPLQEKIYI--------SSIEDISRRLKSGD  98

Query  1584  LPLDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPAD  1405
             L +   PE  RSPSPEPIY + G R+NTREYR R+K+  ER  ++ Q+ + NP +KPP D
Sbjct  99    LGIPKNPE-DRSPSPEPIYSSEGKRLNTREYRTRKKMEDERHTLVQQLTELNPDYKPPTD  157

Query  1404  YRPP--KLQKKLYI  1369
             Y+PP  ++  K++I
Sbjct  158   YKPPQNRVTDKVFI  171



>ref|XP_010756504.1| branchpoint-bridging protein [Paracoccidioides brasiliensis Pb18]
 gb|EEH44525.1| branchpoint-bridging protein [Paracoccidioides brasiliensis Pb18]
 gb|EEH20069.2| branchpoint-bridging protein [Paracoccidioides brasiliensis Pb03]
Length=604

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 78/132 (59%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWADDE---PKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             RK+++RW D E      L+ LP  +       +   E   L+ R+ EIS+KL+    +P 
Sbjct  65    RKKRNRWGDAEENKAAGLMGLPTLIMANMTNEQL--EAYTLHLRIEEISQKLRINDVVPA  122

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDN G R+NTREYR R++L  ER ++I + IK  P + PP+DY R
Sbjct  123   D----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLIEKAIKAIPNYHPPSDYRR  178

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  179   PTKTQEKVYVPV  190



>gb|EFQ26078.1| zinc knuckle [Colletotrichum graminicola M1.001]
Length=588

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDP-EIQALNSRLLEISRKLQSGLPLDDR-  1567
             RK+++RW D        L       T  +  +  E   L+ R+ EIS+KL+    +DD  
Sbjct  60    RKKRNRWGDASENKAAGLMGLTTAITANMTGEQLEAYTLHLRITEISQKLR----IDDVV  115

Query  1566  -PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPP  1393
               +G RSPSP P YDN G RINTREYR R++L  ER ++I + +K  P + PP DY RP 
Sbjct  116   PADGDRSPSPPPQYDNHGRRINTREYRYRKRLEDERHKLIEKAMKTIPNYHPPQDYRRPT  175

Query  1392  KLQKKLYIHV  1363
             K Q+K+Y+ V
Sbjct  176   KTQEKVYVPV  185



>gb|EER42445.1| branchpoint-bridging protein [Histoplasma capsulatum H143]
 gb|EGC43509.1| branchpoint-bridging protein [Histoplasma capsulatum H88]
Length=597

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 78/132 (59%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWADDE---PKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             RK+++RW D E      L+ LP  +       +   E   L+ R+ EIS+KL+    +P 
Sbjct  62    RKKRNRWGDAEENKAAGLMGLPTLIMANMTNEQL--EAYTLHLRIEEISQKLRINDVVPA  119

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDN G R+NTREYR R++L  ER ++I + +K  P + PP+DY R
Sbjct  120   D----GDRSPSPAPQYDNFGRRVNTREYRYRKRLEDERHKLIEKAVKVIPNYHPPSDYRR  175

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  176   PTKTQEKVYVPV  187



>pdb|2M0G|A Chain A, Structure, Phosphorylation And U2af65 Binding Of The 
Nterminal Domain Of Splicing Factor 1 During 3 Splice Site 
Recognition
Length=145

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 75/118 (64%), Gaps = 3/118 (3%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             ++++SRW  D  +    +P        G+  + E    +  ++ +++RKL++G L +   
Sbjct  16    KRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPN  75

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
             PE  RSPSPEPIY++ G R+NTRE+R R+KL  ER  +I++++  NP FKPPADY+PP
Sbjct  76    PED-RSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPP  132



>gb|EKG17291.1| Zinc finger CCHC-type protein [Macrophomina phaseolina MS6]
Length=570

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDP-EIQALNSRLLEISRKLQSG--LPLDD  1570
             RK+++RW D        L       T  +  +  E   L+ R+ EIS+KL+    +P D 
Sbjct  66    RKKRNRWGDASDNKAAGLMGLTTAITAHMTAEQLEAYTLHLRIEEISQKLRINDVVPAD-  124

Query  1569  RPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPP  1393
                G RSPSP P YDN G R+NTREYR R+KL  ER ++I + +K  P + PP+DY RP 
Sbjct  125   ---GDRSPSPPPQYDNFGRRVNTREYRYRKKLEDERHKLIEKAMKVIPNYHPPSDYRRPT  181

Query  1392  KLQKKLYIHV  1363
             K Q+K+Y+ V
Sbjct  182   KTQEKVYVPV  191



>gb|KDN69795.1| putative zinc knuckle [Colletotrichum sublineola]
Length=585

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDP-EIQALNSRLLEISRKLQSGLPLDDR-  1567
             RK+++RW D        L       T  +  +  E   L+ R+ EIS+KL+    +DD  
Sbjct  61    RKKRNRWGDASENKAAGLMGLTTAITANMTGEQLEAYTLHLRITEISQKLR----IDDVV  116

Query  1566  -PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-RPP  1393
               +G RSPSP P YDN G RINTREYR R++L  ER ++I + +K  P + PP DY RP 
Sbjct  117   PADGDRSPSPPPQYDNHGRRINTREYRYRKRLEDERHKLIEKAMKTIPNYHPPQDYRRPT  176

Query  1392  KLQKKLYIHV  1363
             K Q+K+Y+ V
Sbjct  177   KTQEKVYVPV  186



>ref|XP_007920793.1| hypothetical protein MYCFIDRAFT_97070, partial [Pseudocercospora 
fijiensis CIRAD86]
 gb|EME87300.1| hypothetical protein MYCFIDRAFT_97070, partial [Pseudocercospora 
fijiensis CIRAD86]
Length=524

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 81/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRW---ADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             R++++RW   AD++   L+ LP  +       + D  +  L  R+ EIS+KL+    +P 
Sbjct  60    RRKRNRWGDAADNKAAGLMNLPTAITAPMTAEQLDAYVTHL--RIEEISQKLRINDVVPA  117

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDN G R+NTREYR R++L  ER ++I + +K  P++ PP+DY R
Sbjct  118   D----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLIEKAMKIIPSYHPPSDYRR  173

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  174   PTKTQEKVYVPV  185



>gb|KDB13964.1| Zinc knuckle domain containing protein [Ustilaginoidea virens]
Length=665

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  143   RKKRNRWGDASENKAAGLMGLPTAIMSNMT---SEQLEAYTLHLRIEEISQKLR----ID  195

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY 
Sbjct  196   DVVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIEKAMKTIPNYHPPQDYR  255

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  256   RPTKTQEKVYVPV  268



>ref|NP_524654.2| splicing factor 1, isoform A [Drosophila melanogaster]
 gb|AAF55430.3| splicing factor 1, isoform A [Drosophila melanogaster]
 gb|ABY20506.1| LD36095p [Drosophila melanogaster]
Length=787

 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 79/132 (60%), Gaps = 14/132 (11%)
 Frame = -2

Query  1740  RKRKSRWADDE-PKPLI-QLPDFMKDFTGGIEFDP---EIQALNSRLLEISRKLQSG-LP  1579
             RKRKSRW   E  K  I  +P  +         DP   E   +  ++ EISRKL++G L 
Sbjct  272   RKRKSRWGGSENDKTFIPGMPTILPS-----TLDPAQQEAYLVQFQIEEISRKLRTGDLG  326

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYR  1399
             +   PE  RSPSPEPIY + G R+NTRE+R R++L  +R ++I ++   NP FKPPADY+
Sbjct  327   ITQNPE-ERSPSPEPIYSSDGKRLNTREFRYRKRLEEQRHQLIVKMQTVNPEFKPPADYK  385

Query  1398  PP--KLQKKLYI  1369
             PP  ++  K+ I
Sbjct  386   PPVTRVSDKVLI  397



>ref|XP_001544877.1| hypothetical protein HCAG_01924 [Histoplasma capsulatum NAm1]
 gb|EDN04059.1| hypothetical protein HCAG_01924 [Histoplasma capsulatum NAm1]
Length=580

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 78/132 (59%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWADDE---PKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             RK+++RW D E      L+ LP  +       +   E   L+ R+ EIS+KL+    +P 
Sbjct  62    RKKRNRWGDAEENKAAGLMGLPTLIMANMTNEQL--EAYTLHLRIEEISQKLRINDVVPA  119

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDN G R+NTREYR R++L  ER ++I + +K  P + PP+DY R
Sbjct  120   D----GDRSPSPAPQYDNFGRRVNTREYRYRKRLEDERHKLIEKAVKVIPNYHPPSDYRR  175

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  176   PTKTQEKVYVPV  187



>gb|EMF16645.1| hypothetical protein SEPMUDRAFT_152816 [Sphaerulina musiva SO2202]
Length=538

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 80/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             R++++RW D   ++   L+ LP  +       + D  +  L  R+ EIS+KL+    +P 
Sbjct  61    RRKRNRWGDASDNKAAGLMNLPTAITAAMTAEQLDAYVTHL--RIEEISQKLRINDVVPA  118

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDN G R+NTREYR R++L  ER ++I + +K  P++ PP+DY R
Sbjct  119   D----GDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLIEKAMKIIPSYHPPSDYRR  174

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  175   PTKTQEKVYVPV  186



>gb|EXM33352.1| branchpoint-bridging protein [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=553

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RK+++RW D   ++   L+ LP  +   +       E   L+ R+ EIS+KL+    +DD
Sbjct  56    RKKRNRWGDASENKAAGLMGLPTAI--LSNMTSEQLEAYTLHLRIEEISQKLR----IDD  109

Query  1569  R--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
                 +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY R
Sbjct  110   VVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIEKAMKTIPNYHPPQDYRR  169

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  170   PTKTQEKVYVPV  181



>gb|EGU85930.1| hypothetical protein FOXB_03597 [Fusarium oxysporum Fo5176]
 gb|EMT66180.1| Branchpoint-bridging protein [Fusarium oxysporum f. sp. cubense 
race 4]
 gb|EWZ46516.1| branchpoint-bridging protein [Fusarium oxysporum Fo47]
 gb|EWZ84524.1| branchpoint-bridging protein [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA43911.1| branchpoint-bridging protein [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK87354.1| branchpoint-bridging protein [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL47376.1| branchpoint-bridging protein [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL81240.1| branchpoint-bridging protein [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM02150.1| branchpoint-bridging protein [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
Length=553

 Score = 87.0 bits (214),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RK+++RW D   ++   L+ LP  +   +       E   L+ R+ EIS+KL+    +DD
Sbjct  56    RKKRNRWGDASENKAAGLMGLPTAI--LSNMTSEQLEAYTLHLRIEEISQKLR----IDD  109

Query  1569  R--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
                 +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY R
Sbjct  110   VVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIEKAMKTIPNYHPPQDYRR  169

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  170   PTKTQEKVYVPV  181



>gb|EWZ00481.1| branchpoint-bridging protein [Fusarium oxysporum FOSC 3-a]
Length=553

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RK+++RW D   ++   L+ LP  +   +       E   L+ R+ EIS+KL+    +DD
Sbjct  56    RKKRNRWGDASENKAAGLMGLPTAI--LSNMTSEQLEAYTLHLRIEEISQKLR----IDD  109

Query  1569  R--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
                 +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY R
Sbjct  110   VVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIEKAMKTIPNYHPPQDYRR  169

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  170   PTKTQEKVYVPV  181



>emb|CAB64937.1| SF1 protein [Drosophila melanogaster]
Length=773

 Score = 87.4 bits (215),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 79/132 (60%), Gaps = 14/132 (11%)
 Frame = -2

Query  1740  RKRKSRWADDE-PKPLI-QLPDFMKDFTGGIEFDP---EIQALNSRLLEISRKLQSG-LP  1579
             RKRKSRW   E  K  I  +P  +         DP   E   +  ++ EISRKL++G L 
Sbjct  272   RKRKSRWGGSENDKTFIPGMPTILPS-----TLDPAQQEAYLVQFQIEEISRKLRTGDLG  326

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYR  1399
             +   PE  RSPSPEPIY + G R+NTRE+R R++L  +R ++I ++   NP FKPPADY+
Sbjct  327   ITQNPE-ERSPSPEPIYSSDGKRLNTREFRYRKRLEEQRHQLIVKMQTVNPEFKPPADYK  385

Query  1398  PP--KLQKKLYI  1369
             PP  ++  K+ I
Sbjct  386   PPVTRVSDKVLI  397



>gb|ENH65357.1| Branchpoint-bridging protein [Fusarium oxysporum f. sp. cubense 
race 1]
Length=575

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RK+++RW D   ++   L+ LP  +   +       E   L+ R+ EIS+KL+    +DD
Sbjct  56    RKKRNRWGDASENKAAGLMGLPTAI--LSNMTSEQLEAYTLHLRIEEISQKLR----IDD  109

Query  1569  R--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
                 +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY R
Sbjct  110   VVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIEKAMKTIPNYHPPQDYRR  169

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  170   PTKTQEKVYVPV  181



>emb|CCT72179.1| related to branch point bridging protein (MSL5) [Fusarium fujikuroi 
IMI 58289]
Length=553

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RK+++RW D   ++   L+ LP  +   +       E   L+ R+ EIS+KL+    +DD
Sbjct  56    RKKRNRWGDASENKAAGLMGLPTAI--LSNMTSEQLEAYTLHLRIEEISQKLR----IDD  109

Query  1569  R--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
                 +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY R
Sbjct  110   VVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIEKAMKTIPNYHPPQDYRR  169

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  170   PTKTQEKVYVPV  181



>gb|EXK43815.1| branchpoint-bridging protein [Fusarium oxysporum f. sp. melonis 
26406]
Length=553

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RK+++RW D   ++   L+ LP  +   +       E   L+ R+ EIS+KL+    +DD
Sbjct  56    RKKRNRWGDASENKAAGLMGLPTAI--LSNMTSEQLEAYTLHLRIEEISQKLR----IDD  109

Query  1569  R--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
                 +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY R
Sbjct  110   VVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIEKAMKTIPNYHPPQDYRR  169

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  170   PTKTQEKVYVPV  181



>gb|KIH88470.1| splicing factor 1 [Sporothrix brasiliensis 5110]
Length=654

 Score = 87.0 bits (214),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 78/132 (59%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWA---DDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RK+++RW    D++   L+ LP  +           E   L+ R+ EI++KL+    +DD
Sbjct  96    RKKRNRWGEASDNKAAGLMGLPTAI--LANMTSEQLEAYTLHLRIEEITQKLK----IDD  149

Query  1569  R--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
                 +G RSPSP P YDN G RINTREYR R+KL  ER +++ + IK  P + PP DY R
Sbjct  150   VVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEEERHKLVEKAIKTFPNYHPPQDYRR  209

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  210   PTKTQEKVYVPV  221



>gb|ELU40740.1| splicing factor SF1 [Rhizoctonia solani AG-1 IA]
Length=942

 Score = 87.4 bits (215),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 79/130 (61%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRKSRW D + +P + LP  +   +G  + + +  A+  RL EI+RKLQ+   +   PE
Sbjct  509   RKRKSRWGDAKSEP-VGLPTAISS-SGVSQRELDNYAVKIRLDEINRKLQTNTFIP--PE  564

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY----RPP  1393
               RSPSP P YD+ G R NTRE R R+KL  ER  ++ + +K +P F+PPA+Y    R  
Sbjct  565   SERSPSPPPTYDSHGRRTNTREVRYRKKLEEERVRLVDRAMKSDPNFRPPAEYHQQKRSL  624

Query  1392  KLQKKLYIHV  1363
             + Q K+YI V
Sbjct  625   RPQDKVYIPV  634



>gb|EWG47432.1| branchpoint-bridging protein [Fusarium verticillioides 7600]
Length=552

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RK+++RW D   ++   L+ LP  +   +       E   L+ R+ EIS+KL+    +DD
Sbjct  56    RKKRNRWGDASENKAAGLMGLPTAI--LSNMTSEQLEAYTLHLRIEEISQKLR----IDD  109

Query  1569  R--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
                 +G RSPSP P YDN G RINTREYR R+KL  ER ++I + +K  P + PP DY R
Sbjct  110   VVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEDERHKLIEKAMKTIPNYHPPQDYRR  169

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  170   PTKTQEKVYVPV  181



>emb|CCO28600.1| Branchpoint-bridging protein [Rhizoctonia solani AG-1 IB]
Length=504

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 78/130 (60%), Gaps = 8/130 (6%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPE  1561
             RKRKSRW D + +P + LP  +   +G  + + +  A+  RL EI+RKLQ+   +    E
Sbjct  70    RKRKSRWGDAKSEP-VGLPTAISS-SGVSQRELDNYAIKIRLDEINRKLQTNTFIPAESE  127

Query  1560  GARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY----RPP  1393
               RSPSP PIYD  G R NTRE R R+KL  ER  ++ + +K +P F+PPA+Y    R  
Sbjct  128   --RSPSPPPIYDAHGRRTNTREVRYRKKLEEERVRLVDRAMKSDPNFRPPAEYHQQKRSL  185

Query  1392  KLQKKLYIHV  1363
             + Q K+YI V
Sbjct  186   RPQDKVYIPV  195



>ref|XP_002626957.1| branchpoint-bridging protein [Blastomyces dermatitidis SLH14081]
 gb|EEQ76610.1| branchpoint-bridging protein [Blastomyces dermatitidis SLH14081]
 gb|EEQ84084.1| branchpoint-bridging protein [Blastomyces dermatitidis ER-3]
 gb|EGE79906.1| branchpoint-bridging protein [Blastomyces dermatitidis ATCC 18188]
 gb|EQL31292.1| branchpoint-bridging protein [Blastomyces dermatitidis ATCC 26199]
Length=605

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 79/133 (59%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWADDE---PKPLIQLPDF-MKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LP  1579
             RK+++RW D E      L+ LP   M + T       E   L+ R+ EIS+KL+    +P
Sbjct  62    RKKRNRWGDAEENKAAGLMGLPTLIMANMT---NEQLEAYTLHLRIEEISQKLRINDVVP  118

Query  1578  LDDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
              D    G RSPSP P YDN G R+NTREYR R++L  ER ++I + +K  P + PP+DY 
Sbjct  119   AD----GDRSPSPAPQYDNFGRRVNTREYRYRKRLEDERHKLIEKAMKVIPNYHPPSDYR  174

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  175   RPTKTQEKVYVPV  187



>gb|KEQ73680.1| hypothetical protein M436DRAFT_9822, partial [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=553

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             RK+++RW D   ++   L+ LP  +       + D     L+ R+ EIS+KL+    +P 
Sbjct  63    RKKRNRWGDATDNKAAGLMNLPTAVLGNMTSEQLD--AYTLHLRIEEISQKLRINDVVPA  120

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDN G R+NTREYR +++L  ER +++ + +K  P + PP+DY R
Sbjct  121   D----GDRSPSPPPQYDNFGRRVNTREYRYKKRLEEERHKLVEKAMKTIPGYHPPSDYRR  176

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  177   PTKTQEKVYVPV  188



>ref|XP_007288066.1| branchpoint-bridging protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD21064.1| branchpoint-bridging protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=595

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 80/133 (60%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RW D   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  69    RKKRNRWGDSTENKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  121

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTREYR R++L  ER ++I + +K  P + PP DY 
Sbjct  122   DVVPADGDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLIEKAMKVIPNYHPPQDYR  181

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  182   RPTKTQEKVYVPV  194



>emb|CCU80215.1| Zinc knuckle domain containing protein [Blumeria graminis f. 
sp. hordei DH14]
Length=581

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RWAD   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  70    RKKRNRWADATENKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  122

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTRE+R R++L  ER ++I + +K  P + PP DY 
Sbjct  123   DVVPADGDRSPSPPPQYDNFGRRVNTREFRYRKRLEDERHKLIEKAMKVIPNYHPPQDYR  182

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  183   RPTKTQEKVYVPV  195



>gb|KDE03660.1| hypothetical protein MVLG_05850 [Microbotryum violaceum p1A1 
Lamole]
Length=621

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 81/149 (54%), Gaps = 16/149 (11%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPEIQ--ALNSRLLEISRKLQSGLPLDDR  1567
             RKRKSRW  D+    ++ P  M     G   + E++  A   RL EI+RKL+SG  +   
Sbjct  148   RKRKSRWGSDK----VEGP--MPTAIAGAVNEKELERYAAQLRLDEIARKLRSGDVVP--  199

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKL  1387
             P+GARSPSP P YD  G R NTRE R R KL  ER  ++ + +K +PAFKPP +Y   K 
Sbjct  200   PDGARSPSPPPTYDGHGRRTNTREVRYRRKLEDERMRLVDRQMKLDPAFKPPTEYLVAKR  259

Query  1386  ------QKKLYIHVLVGAETQSHLKLLQP  1318
                   Q+K+YI V    E      L+ P
Sbjct  260   QNAGRPQEKVYIPVKTFPEINFFGLLVGP  288



>ref|XP_007518639.1| PREDICTED: splicing factor 1 isoform X1 [Erinaceus europaeus]
Length=637

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 80/128 (63%), Gaps = 5/128 (4%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             ++++SRW  D  +    +P        G+  + E    +  ++ +++RKL++G L +   
Sbjct  16    KRKRSRWNQDTTEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPN  75

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP--  1393
             PE  RSPSPEPIY++ G R+NTRE+R R+KL  ER  +I++++  NP FKPPADY+PP  
Sbjct  76    PE-DRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPAT  134

Query  1392  KLQKKLYI  1369
             ++  K+ I
Sbjct  135   RVSDKVMI  142



>gb|AAR88778.1| splicing factor I [Musa acuminata AAA Group]
Length=126

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = -2

Query  1500  REYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYI  1369
             REYRARE+LN+ERQEIISQ+I++NPAF+PPADYRP KLQKKLYI
Sbjct  1     REYRARERLNKERQEIISQLIQRNPAFRPPADYRPLKLQKKLYI  44



>gb|EPQ67366.1| Component of the commitment complex [Blumeria graminis f. sp. 
tritici 96224]
Length=581

 Score = 86.7 bits (213),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPD-FMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             RK+++RWAD   ++   L+ LP   M + T       E   L+ R+ EIS+KL+    +D
Sbjct  70    RKKRNRWADATENKAAGLMGLPTAIMANMT---SEQLEAYTLHLRIEEISQKLR----ID  122

Query  1572  DR--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-  1402
             D    +G RSPSP P YDN G R+NTRE+R R++L  ER ++I + +K  P + PP DY 
Sbjct  123   DVVPADGDRSPSPPPQYDNFGRRVNTREFRYRKRLEDERHKLIEKAMKVIPNYHPPQDYR  182

Query  1401  RPPKLQKKLYIHV  1363
             RP K Q+K+Y+ V
Sbjct  183   RPTKTQEKVYVPV  195



>gb|EPY78881.1| hypothetical protein CB1_000996012, partial [Camelus ferus]
Length=160

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 75/118 (64%), Gaps = 3/118 (3%)
 Frame = -2

Query  1740  RKRKSRWADDEPKPLIQLPDFMKDFTGGIEFDPE-IQALNSRLLEISRKLQSG-LPLDDR  1567
             ++++SRW  D  +    +P        G+  + E    +  ++ +++RKL++G L +   
Sbjct  12    KRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPN  71

Query  1566  PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
             PE  RSPSPEPIY++ G R+NTRE+R R+KL  ER  +I++++  NP FKPPADY+PP
Sbjct  72    PED-RSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPP  128



>gb|ERT02177.1| branchpoint-bridging protein [Sporothrix schenckii ATCC 58251]
Length=644

 Score = 86.7 bits (213),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 78/132 (59%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDD  1570
             RK+++RW D   ++   L+ LP  +           E   L+ R+ EI++KL+    +DD
Sbjct  96    RKKRNRWGDASDNKAAGLMGLPTAI--LANMTSEQLEAYTLHLRIEEITQKLK----IDD  149

Query  1569  R--PEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
                 +G RSPSP P YDN G RINTREYR R+KL  ER +++ + IK  P + PP DY R
Sbjct  150   VVPADGDRSPSPAPQYDNHGRRINTREYRYRKKLEEERHKLVEKAIKTFPNYHPPQDYRR  209

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  210   PTKTQEKVYVPV  221



>emb|CEF63043.1| Splicing factor 1 [Strongyloides ratti]
Length=452

 Score = 85.9 bits (211),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 77/130 (59%), Gaps = 14/130 (11%)
 Frame = -2

Query  1740  RKRKSRWADDE----PKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLD  1573
             R+RKSRW+ ++      P +  PD  K+         EI+       +I++ L+SG  L 
Sbjct  16    RRRKSRWSTNKHFLPNLPTVLPPDLTKEQIKAYLLKLEIE-------DITKSLRSGDYLL  68

Query  1572  DRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPP  1393
              R +  RSPSPEP+YD  G R NTRE R R++L  +R + I Q++K +P++KPP DYR P
Sbjct  69    VRADN-RSPSPEPVYDAQGKRTNTRELRKRQELEHQRHDKIQQLLKLDPSYKPPTDYRSP  127

Query  1392  --KLQKKLYI  1369
               +L +K+YI
Sbjct  128   QVRLNEKVYI  137



>gb|KEQ63982.1| hypothetical protein M437DRAFT_65273 [Aureobasidium melanogenum 
CBS 110374]
Length=576

 Score = 86.3 bits (212),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             RK+++RW D   ++   L+ LP  +       + D     L+ R+ EIS+KL+    +P 
Sbjct  63    RKKRNRWGDATDNKAAGLMNLPTAVLGNMTSEQLD--AYTLHLRIEEISQKLRINDVVPA  120

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDN G R+NTREYR +++L  ER +++ + +K  P + PP+DY R
Sbjct  121   D----GDRSPSPPPQYDNFGRRVNTREYRYKKRLEEERHKLVEKAMKTIPGYHPPSDYRR  176

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  177   PTKTQEKVYVPV  188



>gb|KEQ94558.1| hypothetical protein AUEXF2481DRAFT_30521 [Aureobasidium subglaciale 
EXF-2481]
Length=627

 Score = 86.3 bits (212),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  1740  RKRKSRWAD---DEPKPLIQLPDFMKDFTGGIEFDPEIQALNSRLLEISRKLQSG--LPL  1576
             RK+++RW D   ++   L+ LP  +       + D     L+ R+ EIS+KL+    +P 
Sbjct  63    RKKRNRWGDATDNKAAGLMNLPTAVLGNMTSEQLD--AYTLHLRIEEISQKLRINDVVPA  120

Query  1575  DDRPEGARSPSPEPIYDNMGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADY-R  1399
             D    G RSPSP P YDN G R+NTREYR +++L  ER +++ + +K  P + PP+DY R
Sbjct  121   D----GDRSPSPPPQYDNFGRRVNTREYRYKKRLEEERHKLVEKAMKTIPGYHPPSDYRR  176

Query  1398  PPKLQKKLYIHV  1363
             P K Q+K+Y+ V
Sbjct  177   PTKTQEKVYVPV  188



>ref|XP_003082157.1| RNA-binding protein ELAV/HU (RRM superfamily) (ISS) [Ostreococcus 
tauri]
Length=679

 Score = 86.7 bits (213),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 63/113 (56%), Gaps = 1/113 (1%)
 Frame = -2

Query  1698  LIQLP-DFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDN  1522
              +QLP   + + +   E   E+  L + L  ++R+L +G   DDRP  +R P P PIYD 
Sbjct  96    FVQLPTSVLTEHSAPSEATAEVHFLFAELGRLNRRLLAGGTFDDRPADSREPEPAPIYDA  155

Query  1521  MGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYIHV  1363
              G+R+NT +   REK    R  I+ +I +K P F+PP DYRP K   KL I V
Sbjct  156   NGVRVNTPDVVEREKFQYRRMAILEEICQKCPTFRPPPDYRPNKRTAKLLIPV  208



>emb|CEF99753.1| Nucleotide-binding, alpha-beta plait [Ostreococcus tauri]
Length=691

 Score = 86.7 bits (213),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 63/113 (56%), Gaps = 1/113 (1%)
 Frame = -2

Query  1698  LIQLP-DFMKDFTGGIEFDPEIQALNSRLLEISRKLQSGLPLDDRPEGARSPSPEPIYDN  1522
              +QLP   + + +   E   E+  L + L  ++R+L +G   DDRP  +R P P PIYD 
Sbjct  96    FVQLPTSVLTEHSAPSEATAEVHFLFAELGRLNRRLLAGGTFDDRPADSREPEPAPIYDA  155

Query  1521  MGIRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYRPPKLQKKLYIHV  1363
              G+R+NT +   REK    R  I+ +I +K P F+PP DYRP K   KL I V
Sbjct  156   NGVRVNTPDVVEREKFQYRRMAILEEICQKCPTFRPPPDYRPNKRTAKLLIPV  208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7713695153360