BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21264_g3_i1 len=2412 path=[9173:0-2411]

Length=2412
                                                                      Score     E

ref|XP_009605896.1|  PREDICTED: uncharacterized protein LOC104100...   1040   0.0      
emb|CDP00801.1|  unnamed protein product                               1034   0.0      
ref|XP_002280911.1|  PREDICTED: uncharacterized protein LOC100243950   1018   0.0      Vitis vinifera
ref|XP_002527800.1|  phosphoglucomutase, putative                      1016   0.0      Ricinus communis
ref|XP_011023675.1|  PREDICTED: uncharacterized protein LOC105125072   1010   0.0      
ref|XP_006338178.1|  PREDICTED: uncharacterized protein LOC102599849   1009   0.0      
ref|XP_002312448.2|  hypothetical protein POPTR_0008s13060g            1008   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003556140.1|  PREDICTED: uncharacterized protein LOC100810397   1008   0.0      
ref|XP_007045189.1|  Phosphoglucomutase / glucose phosphomutase, ...   1005   0.0      
ref|XP_004298476.1|  PREDICTED: phosphomannomutase/phosphoglucomu...   1005   0.0      
ref|XP_009605895.1|  PREDICTED: uncharacterized protein LOC104100...   1004   0.0      
ref|XP_011070724.1|  PREDICTED: uncharacterized protein LOC105156326   1003   0.0      
ref|XP_008221457.1|  PREDICTED: uncharacterized protein LOC103321435   1002   0.0      
ref|XP_009351503.1|  PREDICTED: uncharacterized protein LOC103943037   1001   0.0      
ref|XP_007222016.1|  hypothetical protein PRUPE_ppa002940mg            1001   0.0      
ref|XP_010044201.1|  PREDICTED: uncharacterized protein LOC104433216   1000   0.0      
ref|XP_009349513.1|  PREDICTED: uncharacterized protein LOC103941057    998   0.0      
ref|XP_004239330.1|  PREDICTED: uncharacterized protein LOC101267404    998   0.0      
ref|XP_010095721.1|  hypothetical protein L484_002693                   996   0.0      
ref|XP_006448230.1|  hypothetical protein CICLE_v10014623mg             993   0.0      
ref|XP_007157756.1|  hypothetical protein PHAVU_002G096000g             993   0.0      
ref|XP_004505287.1|  PREDICTED: phosphomannomutase/phosphoglucomu...    973   0.0      
ref|XP_003607905.1|  Phosphoglucosamine mutase                          969   0.0      
gb|KFK41509.1|  hypothetical protein AALP_AA2G138900                    946   0.0      
ref|XP_006301021.1|  hypothetical protein CARUB_v10021412mg             945   0.0      
ref|NP_177239.1|  phosphoglucomutase-like protein                       939   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009105749.1|  PREDICTED: uncharacterized protein LOC103831616    938   0.0      
emb|CDY11542.1|  BnaC06g31970D                                          937   0.0      
ref|XP_008464699.1|  PREDICTED: uncharacterized protein LOC103502...    934   0.0      
ref|XP_010427875.1|  PREDICTED: uncharacterized protein LOC104712639    934   0.0      
ref|XP_010415771.1|  PREDICTED: uncharacterized protein LOC104701728    933   0.0      
emb|CDX96280.1|  BnaA07g28910D                                          931   0.0      
ref|XP_002887331.1|  hypothetical protein ARALYDRAFT_476213             931   0.0      
ref|XP_010533353.1|  PREDICTED: uncharacterized protein LOC104809154    929   0.0      
ref|XP_004151147.1|  PREDICTED: phosphomannomutase/phosphoglucomu...    928   0.0      
ref|XP_010471085.1|  PREDICTED: uncharacterized protein LOC104750921    922   0.0      
ref|XP_004168100.1|  PREDICTED: phosphomannomutase/phosphoglucomu...    921   0.0      
ref|XP_010274724.1|  PREDICTED: uncharacterized protein LOC104609970    912   0.0      
emb|CAA53507.1|  phosphoglucomutase                                     910   0.0      Spinacia oleracea
ref|XP_010681886.1|  PREDICTED: uncharacterized protein LOC104896793    908   0.0      
ref|XP_010916818.1|  PREDICTED: uncharacterized protein LOC105041573    884   0.0      
ref|XP_009421114.1|  PREDICTED: uncharacterized protein LOC104000728    880   0.0      
ref|XP_008809830.1|  PREDICTED: uncharacterized protein LOC103721410    854   0.0      
ref|XP_008464700.1|  PREDICTED: uncharacterized protein LOC103502...    842   0.0      
ref|XP_008464701.1|  PREDICTED: uncharacterized protein LOC103502...    841   0.0      
ref|XP_006448229.1|  hypothetical protein CICLE_v10014623mg             822   0.0      
ref|NP_001057639.1|  Os06g0476200                                       822   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004965413.1|  PREDICTED: uncharacterized protein LOC101782278    818   0.0      
dbj|BAK05013.1|  predicted protein                                      818   0.0      
gb|EEC80611.1|  hypothetical protein OsI_22972                          817   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_008651739.1|  PREDICTED: uncharacterized protein LOC100383...    815   0.0      
ref|XP_006838103.1|  hypothetical protein AMTR_s00106p00039260          811   0.0      
ref|XP_008651738.1|  PREDICTED: uncharacterized protein LOC100383...    809   0.0      
ref|XP_003560751.2|  PREDICTED: uncharacterized protein LOC100828...    808   0.0      
ref|XP_002459972.1|  hypothetical protein SORBIDRAFT_02g019490          804   0.0      Sorghum bicolor [broomcorn]
ref|XP_006656933.1|  PREDICTED: uncharacterized protein LOC102704346    763   0.0      
ref|XP_010227685.1|  PREDICTED: uncharacterized protein LOC100828...    650   0.0      
ref|NP_001169666.1|  hypothetical protein                               649   0.0      Zea mays [maize]
ref|XP_009802461.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    637   0.0      
ref|XP_006390835.1|  hypothetical protein EUTSA_v100183050mg            638   0.0      
ref|XP_010427876.1|  PREDICTED: uncharacterized protein LOC104712640    610   0.0      
gb|EPS61324.1|  hypothetical protein M569_13472                         603   0.0      
dbj|BAD35746.1|  putative phosphomannomutase                            592   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KDO64611.1|  hypothetical protein CISIN_1g021442mg                   551   0.0      
gb|KDO64612.1|  hypothetical protein CISIN_1g021442mg                   525   7e-178   
gb|EYU30079.1|  hypothetical protein MIMGU_mgv1a0042811mg               470   1e-155   
ref|XP_005535333.1|  phosphoglucomutase                                 464   1e-149   
ref|XP_002500529.1|  phosphoglucomutase/phosphomannomutase family...    451   2e-145   Micromonas commoda
emb|CEF96535.1|  Alpha-D-phosphohexomutase, alpha/beta/alpha I/II...    441   5e-142   
ref|WP_015167380.1|  phosphomannomutase                                 439   3e-141   
ref|WP_035289417.1|  phosphoglucomutase                                 435   7e-140   
ref|XP_003056559.1|  phosphoglucomutase/phosphomannomutase family...    437   2e-139   
ref|WP_008275431.1|  phosphoglucomutase                                 433   6e-139   
ref|WP_015222525.1|  phosphoglucomutase/phosphomannomutase alpha/...    432   9e-139   
ref|WP_017306046.1|  hypothetical protein                               432   2e-138   
ref|WP_035991226.1|  phosphoglucomutase                                 431   2e-138   
ref|WP_039725781.1|  phosphoglucomutase                                 431   4e-138   
ref|WP_006507573.1|  phosphomannomutase                                 430   8e-138   
ref|XP_001415757.1|  predicted protein                                  430   1e-137   Ostreococcus lucimarinus CCE9901
ref|WP_026100882.1|  phosphoglucomutase                                 427   6e-137   
ref|WP_017710813.1|  hypothetical protein                               428   1e-136   
ref|WP_006453438.1|  phosphoglucomutase                                 427   2e-136   
ref|WP_009169793.1|  phosphoglucomutase                                 426   2e-136   
ref|WP_019504044.1|  hypothetical protein                               425   5e-136   
ref|WP_015219098.1|  phosphoglucomutase/phosphomannomutase alpha/...    425   6e-136   
ref|WP_015163936.1|  phosphoglucomutase/phosphomannomutase alpha/...    425   8e-136   
ref|WP_017293907.1|  hypothetical protein                               424   1e-135   
ref|WP_021670356.1|  phosphoglucomutase/phosphomannomutase, alpha...    424   1e-135   
ref|WP_004356366.1|  phosphoglucomutase                                 423   1e-135   
ref|WP_013334283.1|  phosphoglucomutase                                 424   2e-135   
ref|WP_036884469.1|  phosphoglucomutase                                 423   2e-135   
ref|WP_015183935.1|  phosphomannomutase                                 423   3e-135   
ref|WP_024750168.1|  phosphoglucomutase                                 423   3e-135   
ref|WP_009543274.1|  phosphoglucomutase                                 423   3e-135   
ref|WP_006631399.1|  phosphoglucomutase                                 422   7e-135   
ref|WP_022157192.1|  phosphoglucomutase/phosphomannomutase alpha/...    421   8e-135   
ref|WP_013239544.1|  MULTISPECIES: phosphoglucomutase                   421   1e-134   
ref|WP_036480361.1|  phosphoglucomutase                                 421   2e-134   
ref|WP_015175946.1|  phosphoglucomutase/phosphomannomutase alpha/...    419   7e-134   
ref|WP_009627585.1|  Phosphoglucomutase                                 419   8e-134   
ref|WP_015133190.1|  phosphoglucomutase/phosphomannomutase alpha/...    419   9e-134   
ref|WP_027428091.1|  phosphoglucomutase                                 419   9e-134   
ref|WP_008313443.1|  phosphomannomutase                                 419   1e-133   
ref|WP_026504093.1|  phosphoglucomutase                                 418   2e-133   
ref|WP_006514706.1|  phosphomannomutase                                 418   2e-133   
ref|WP_008050108.1|  phosphoglucomutase                                 418   3e-133   
ref|WP_026072936.1|  phosphoglucomutase                                 418   3e-133   
ref|WP_006619315.1|  phosphoglucomutase                                 418   4e-133   
ref|WP_006626204.1|  MULTISPECIES: phosphoglucomutase                   417   5e-133   
ref|WP_034934697.1|  phosphoglucomutase                                 417   5e-133   
ref|WP_010479183.1|  phosphoglucomutase                                 417   6e-133   
gb|ELS00180.1|  phosphomannomutase                                      417   8e-133   
ref|WP_024998090.1|  phosphoglucomutase                                 416   1e-132   
ref|WP_007789892.1|  phosphoglucomutase                                 415   2e-132   
ref|WP_023925923.1|  hypothetical protein                               415   2e-132   
ref|WP_007353594.1|  MULTISPECIES: phosphoglucomutase                   416   2e-132   
ref|XP_005714195.1|  unnamed protein product                            422   3e-132   
ref|WP_004366380.1|  phosphoglucomutase                                 416   4e-132   
ref|WP_016566379.1|  phosphoglucomutase/phosphomannomutase family...    414   6e-132   
ref|XP_010520182.1|  PREDICTED: uncharacterized protein LOC104799...    415   1e-131   
ref|WP_031292711.1|  phosphoglucomutase                                 414   1e-131   
ref|WP_015162277.1|  phosphomannomutase                                 414   1e-131   
ref|WP_027400250.1|  phosphoglucomutase                                 414   1e-131   
ref|WP_028901659.1|  phosphoglucomutase                                 412   2e-131   
gb|ESA36405.1|  phosphoglucomutase phosphomannomutase alpha beta ...    414   3e-131   
ref|WP_012160792.1|  phosphoglucomutase                                 413   4e-131   
ref|WP_028898083.1|  phosphoglucomutase                                 411   8e-131   
ref|WP_007310475.1|  phosphoglucomutase                                 412   9e-131   
ref|XP_005644325.1|  Phosphoglucomutase, first 3 domain-containin...    411   1e-130   
ref|WP_012862673.1|  phosphoglucomutase                                 411   1e-130   
ref|WP_035309912.1|  phosphoglucomutase                                 410   2e-130   
ref|WP_012860912.1|  phosphoglucomutase                                 411   2e-130   
ref|WP_021836330.1|  Phosphoglucomutase                                 411   2e-130   
ref|WP_006045284.1|  phosphoglucomutase                                 410   2e-130   
gb|AHF01499.1|  phosphoglucomutase                                      410   2e-130   
ref|XP_009788112.1|  PREDICTED: uncharacterized protein LOC104235970    402   2e-130   
ref|WP_007305164.1|  phosphoglucomutase                                 410   3e-130   
ref|XP_010520181.1|  PREDICTED: uncharacterized protein LOC104799...    414   3e-130   
gb|KDP38076.1|  hypothetical protein JCGZ_04719                         400   3e-130   
ref|WP_025000937.1|  phosphoglucomutase                                 410   3e-130   
ref|WP_004362062.1|  hypothetical protein                               409   4e-130   
ref|WP_028905091.1|  phosphoglucomutase                                 409   4e-130   
ref|XP_009603702.1|  PREDICTED: phosphoglucomutase-2 isoform X2         410   5e-130   
ref|WP_021803549.1|  phosphomannomutase                                 409   7e-130   
ref|XP_009781930.1|  PREDICTED: phosphoglucomutase-2 isoform X2         410   7e-130   
ref|WP_038457131.1|  phosphoglucomutase                                 409   9e-130   
ref|WP_035632295.1|  phosphoglucomutase                                 409   1e-129   
ref|WP_022316367.1|  phosphoglucomutase/phosphomannomutase alpha/...    407   2e-129   
ref|WP_031583197.1|  hypothetical protein                               408   2e-129   
ref|WP_023153616.1|  phosphoglucomutase/phosphomannomutase, alpha...    408   2e-129   
ref|WP_021660283.1|  phosphoglucomutase/phosphomannomutase, alpha...    408   3e-129   
ref|WP_011967580.1|  phosphoglucomutase                                 408   3e-129   
ref|WP_006439097.1|  phosphoglucomutase [                               407   3e-129   
ref|WP_011967899.1|  phosphoglucomutase                                 408   4e-129   
ref|WP_035293255.1|  phosphoglucomutase                                 407   4e-129   
ref|WP_009167922.1|  phosphoglucomutase                                 407   4e-129   
ref|WP_038350910.1|  phosphoglucomutase                                 406   5e-129   
ref|WP_007937388.1|  MULTISPECIES: phosphoglucomutase                   407   5e-129   
ref|XP_009603701.1|  PREDICTED: phosphoglucomutase-2 isoform X1         410   6e-129   
ref|WP_014355257.1|  phosphoglucomutase                                 406   9e-129   
ref|XP_009781929.1|  PREDICTED: phosphoglucomutase-2 isoform X1         409   2e-128   
ref|WP_013378931.1|  phosphoglucomutase                                 405   2e-128   
ref|XP_002871771.1|  phosphoglucosamine mutase family protein           408   3e-128   
ref|XP_009126193.1|  PREDICTED: phosphoglucomutase-2 isoform X2         406   3e-128   
ref|XP_004237080.1|  PREDICTED: uncharacterized protein LOC101259...    406   4e-128   
gb|ERK28959.1|  phosphomannomutase                                      404   5e-128   
ref|XP_010319499.1|  PREDICTED: uncharacterized protein LOC101259...    406   6e-128   
ref|WP_014709779.1|  phosphoglucomutase                                 403   9e-128   
ref|XP_006363536.1|  PREDICTED: uncharacterized protein LOC102592...    405   1e-127   
ref|XP_007515616.1|  phosphoglucomutase/phosphomannomutase family...    406   1e-127   
ref|WP_023973691.1|  phosphoglucomutase                                 404   1e-127   
ref|WP_039312073.1|  phosphoglucomutase                                 403   1e-127   
ref|WP_027471315.1|  phosphoglucomutase                                 402   3e-127   
ref|WP_026475441.1|  phosphoglucomutase                                 402   3e-127   
ref|XP_010658403.1|  PREDICTED: uncharacterized protein LOC100244...    403   4e-127   
ref|XP_009126192.1|  PREDICTED: uncharacterized protein LOC103851...    405   4e-127   
ref|XP_004237078.1|  PREDICTED: uncharacterized protein LOC101259...    405   5e-127   
emb|CDY55933.1|  BnaC02g44120D                                          405   5e-127   
emb|CAC01897.1|  phosphoglucomutase-like protein                        404   6e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287303.1|  hypothetical protein CARUB_v10000496mg             405   7e-127   
ref|WP_026506459.1|  phosphoglucomutase                                 401   7e-127   
ref|NP_568350.1|  phosphoglucosamine mutase family protein              404   9e-127   Arabidopsis thaliana [mouse-ear cress]
ref|WP_027203240.1|  phosphoglucomutase                                 401   1e-126   
gb|AHE97205.1|  phosphoglucomutase                                      401   1e-126   
ref|WP_013710970.1|  phosphoglucomutase                                 400   1e-126   
ref|WP_027207286.1|  phosphoglucomutase                                 401   1e-126   
ref|XP_005844743.1|  hypothetical protein CHLNCDRAFT_58837              399   1e-126   
ref|XP_009344764.1|  PREDICTED: uncharacterized protein LOC103936...    402   2e-126   
ref|XP_006363535.1|  PREDICTED: uncharacterized protein LOC102592...    404   2e-126   
ref|WP_036764547.1|  phosphoglucomutase                                 400   2e-126   
ref|WP_034857094.1|  phosphoglucomutase                                 399   2e-126   
ref|WP_027215134.1|  phosphoglucomutase                                 400   3e-126   
ref|NP_001190326.1|  phosphoglucosamine mutase family protein           403   3e-126   
emb|CDX85448.1|  BnaA02g03650D                                          404   4e-126   
ref|XP_002274127.2|  PREDICTED: uncharacterized protein LOC100244...    403   5e-126   Vitis vinifera
ref|XP_009344763.1|  PREDICTED: uncharacterized protein LOC103936...    402   5e-126   
ref|XP_010420479.1|  PREDICTED: uncharacterized protein LOC104706...    402   5e-126   
ref|XP_010658400.1|  PREDICTED: uncharacterized protein LOC100244...    403   6e-126   
ref|WP_038299109.1|  phosphoglucomutase [                               399   6e-126   
ref|XP_010453951.1|  PREDICTED: uncharacterized protein LOC104735...    402   7e-126   
ref|WP_027208029.1|  phosphoglucomutase                                 399   7e-126   
ref|WP_016778576.1|  phosphoglucomutase                                 399   9e-126   
ref|XP_010492710.1|  PREDICTED: probable phosphoglucomutase-2 iso...    399   1e-125   
ref|WP_034548816.1|  phosphoglucomutase                                 398   1e-125   
ref|XP_011031738.1|  PREDICTED: uncharacterized protein LOC105130...    399   1e-125   
ref|NP_001059541.1|  Os07g0447800                                       399   1e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011031737.1|  PREDICTED: uncharacterized protein LOC105130...    399   2e-125   
ref|XP_010492709.1|  PREDICTED: uncharacterized protein LOC104770...    401   2e-125   
gb|EEE67095.1|  hypothetical protein OsJ_24083                          400   2e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010453952.1|  PREDICTED: probable phosphoglucomutase-2 iso...    399   2e-125   
ref|XP_009344762.1|  PREDICTED: uncharacterized protein LOC103936...    401   2e-125   
gb|KFK25970.1|  hypothetical protein AALP_AA8G186700                    399   2e-125   
ref|WP_015260295.1|  Phosphomannomutase                                 398   2e-125   
ref|WP_007050789.1|  phosphoglucomutase                                 397   2e-125   
ref|XP_006400293.1|  hypothetical protein EUTSA_v10012819mg             404   3e-125   
ref|XP_008368102.1|  PREDICTED: uncharacterized protein LOC103431...    398   4e-125   
ref|XP_010420480.1|  PREDICTED: probable phosphoglucomutase-2 iso...    398   5e-125   
ref|XP_003591896.1|  Phosphoglucosamine mutase                          397   7e-125   
ref|XP_008368039.1|  PREDICTED: uncharacterized protein LOC103431...    398   9e-125   
ref|WP_007960599.1|  phosphoglucomutase                                 395   1e-124   
ref|WP_026395081.1|  phosphoglucomutase                                 395   1e-124   
ref|XP_008233321.1|  PREDICTED: uncharacterized protein LOC103332...    397   2e-124   
ref|XP_011031735.1|  PREDICTED: uncharacterized protein LOC105130...    398   2e-124   
ref|WP_007724190.1|  phosphoglucomutase                                 395   3e-124   
ref|XP_008367977.1|  PREDICTED: uncharacterized protein LOC103431...    399   3e-124   
ref|WP_036100422.1|  phosphoglucomutase                                 394   3e-124   
ref|WP_036073068.1|  phosphoglucomutase                                 394   3e-124   
ref|WP_035052524.1|  phosphoglucomutase                                 394   4e-124   
ref|XP_011031736.1|  PREDICTED: uncharacterized protein LOC105130...    398   4e-124   
ref|XP_003591897.1|  Phosphoglucosamine mutase                          398   4e-124   
ref|XP_002311090.1|  phosphoglucosamine mutase family protein           397   5e-124   Populus trichocarpa [western balsam poplar]
ref|WP_011989366.1|  phosphoglucomutase                                 394   5e-124   
ref|WP_036067048.1|  phosphoglucomutase                                 394   5e-124   
ref|WP_029276447.1|  phosphoglucomutase                                 394   5e-124   
ref|XP_007220543.1|  hypothetical protein PRUPE_ppa002945mg             398   5e-124   
ref|WP_036084964.1|  phosphoglucomutase                                 394   6e-124   
ref|XP_002974017.1|  hypothetical protein SELMODRAFT_100482             395   6e-124   
ref|WP_010425044.1|  phosphoglucomutase                                 394   6e-124   
ref|XP_008233320.1|  PREDICTED: uncharacterized protein LOC103332...    396   8e-124   
ref|WP_034550417.1|  phosphoglucomutase                                 393   9e-124   
ref|XP_008233319.1|  PREDICTED: uncharacterized protein LOC103332...    397   1e-123   
ref|WP_035023284.1|  phosphoglucomutase                                 393   1e-123   
ref|WP_013405673.1|  phosphoglucomutase                                 393   1e-123   
ref|WP_021408503.1|  phosphoglucomutase/phosphomannomutase, alpha...    392   1e-123   
ref|WP_003423133.1|  phosphoglucomutase                                 392   1e-123   
ref|XP_002532751.1|  phosphoglucomutase, putative                       396   2e-123   Ricinus communis
ref|XP_002316369.2|  hypothetical protein POPTR_0010s22980g             396   2e-123   Populus trichocarpa [western balsam poplar]
ref|WP_021362754.1|  phosphoglucomutase/phosphomannomutase, alpha...    392   2e-123   
ref|XP_010658401.1|  PREDICTED: uncharacterized protein LOC100244...    394   3e-123   
ref|WP_035027734.1|  phosphoglucomutase                                 392   3e-123   
ref|WP_003430697.1|  phosphoglucomutase                                 392   3e-123   
ref|WP_032122891.1|  phosphoglucomutase                                 391   3e-123   
ref|XP_007143707.1|  hypothetical protein PHAVU_007G094900g             393   3e-123   
ref|WP_021412029.1|  phosphoglucomutase/phosphomannomutase, alpha...    392   3e-123   
ref|WP_009897501.1|  phosphoglucomutase                                 392   3e-123   
ref|WP_015075920.1|  phosphoglucomutase/phosphomannomutase, alpha...    392   4e-123   
ref|WP_010051815.1|  phosphoglucomutase                                 392   4e-123   
ref|WP_035064170.1|  phosphoglucomutase                                 392   5e-123   
ref|WP_031586578.1|  phosphoglucomutase                                 391   5e-123   
ref|WP_004454621.1|  phosphoglucomutase                                 391   6e-123   
ref|XP_010238878.1|  PREDICTED: probable phosphoglucomutase-2 iso...    392   6e-123   
ref|WP_021370496.1|  phosphoglucomutase/phosphomannomutase, alpha...    391   7e-123   
ref|XP_011047416.1|  PREDICTED: uncharacterized protein LOC105141...    392   7e-123   
ref|WP_034536811.1|  phosphoglucomutase                                 391   7e-123   
ref|WP_022355508.1|  phosphomannomutase                                 390   7e-123   
ref|XP_005644327.1|  Phosphoglucomutase, first 3 domain-containin...    387   7e-123   
ref|XP_008456482.1|  PREDICTED: probable phosphoglucomutase-2 iso...    392   8e-123   
ref|XP_010104268.1|  hypothetical protein L484_001565                   394   9e-123   
ref|XP_003563180.1|  PREDICTED: probable phosphoglucomutase-2 iso...    394   9e-123   
ref|WP_031583442.1|  phosphoglucomutase                                 390   1e-122   
ref|WP_025871873.1|  phosphoglucomutase                                 390   1e-122   
ref|WP_021375888.1|  phosphoglucomutase/phosphomannomutase, alpha...    390   1e-122   
ref|WP_022504807.1|  phosphomannomutase                                 390   1e-122   
ref|XP_011047415.1|  PREDICTED: uncharacterized protein LOC105141...    392   1e-122   
ref|WP_021366865.1|  phosphoglucomutase/phosphomannomutase, alpha...    390   1e-122   
ref|WP_039658009.1|  phosphoglucomutase                                 390   2e-122   
ref|WP_017750984.1|  hypothetical protein                               390   2e-122   
ref|WP_034559019.1|  phosphoglucomutase                                 390   2e-122   
ref|WP_021406470.1|  phosphoglucomutase/phosphomannomutase, alpha...    389   2e-122   
ref|XP_011041009.1|  PREDICTED: uncharacterized protein LOC105137...    391   2e-122   
ref|XP_011041008.1|  PREDICTED: uncharacterized protein LOC105137...    391   2e-122   
gb|KDO64614.1|  hypothetical protein CISIN_1g021442mg                   379   3e-122   
ref|WP_021417643.1|  phosphoglucomutase/phosphomannomutase, alpha...    389   3e-122   
ref|WP_010762379.1|  phosphoglucomutase/phosphomannomutase              389   3e-122   
ref|WP_023178178.1|  phosphoglucomutase                                 389   4e-122   
ref|WP_036092217.1|  phosphoglucomutase                                 389   4e-122   
gb|KDO64607.1|  hypothetical protein CISIN_1g023423mg                   381   4e-122   
ref|WP_017895490.1|  hypothetical protein                               389   4e-122   
ref|XP_007143706.1|  hypothetical protein PHAVU_007G094900g             393   4e-122   
ref|WP_013835119.1|  phosphoglucomutase                                 389   4e-122   
ref|WP_019543523.1|  phosphoglucomutase                                 389   4e-122   
ref|WP_022235989.1|  phosphoglucomutase/phosphomannomutase alpha/...    389   5e-122   
emb|CDL91142.1|  Phosphomannomutase                                     389   5e-122   
ref|XP_011047413.1|  PREDICTED: uncharacterized protein LOC105141...    392   8e-122   
ref|WP_021423469.1|  phosphoglucomutase/phosphomannomutase, alpha...    388   1e-121   
ref|XP_004158593.1|  PREDICTED: phosphomannomutase/phosphoglucomu...    392   1e-121   
ref|WP_021771949.1|  phosphoglucomutase/phosphomannomutase, alpha...    388   1e-121   
ref|WP_009890519.1|  phosphoglucomutase                                 388   1e-121   
ref|XP_008456481.1|  PREDICTED: uncharacterized protein LOC103496...    392   1e-121   
ref|WP_036132652.1|  phosphoglucomutase                                 387   1e-121   
ref|XP_002983474.1|  hypothetical protein SELMODRAFT_118454             389   1e-121   
ref|WP_008539462.1|  phosphoglucomutase                                 387   1e-121   
ref|WP_003531465.1|  phosphoglucomutase [                               387   1e-121   
ref|WP_035400161.1|  phosphoglucomutase                                 387   2e-121   
ref|XP_006657661.1|  PREDICTED: uncharacterized protein LOC102721461    391   2e-121   
gb|ERK43106.1|  phosphoglucomutase/phosphomannomutase, alpha/beta...    387   2e-121   
gb|KDP44367.1|  hypothetical protein JCGZ_20047                         390   2e-121   
ref|XP_011041007.1|  PREDICTED: uncharacterized protein LOC105137...    390   3e-121   
ref|XP_010032194.1|  PREDICTED: uncharacterized protein LOC104421...    388   3e-121   
ref|XP_004496273.1|  PREDICTED: phosphomannomutase/phosphoglucomu...    390   4e-121   
ref|WP_027889974.1|  phosphoglucomutase                                 386   6e-121   
ref|XP_006589428.1|  PREDICTED: uncharacterized protein LOC100816...    387   7e-121   
ref|WP_005487870.1|  Phosphomannomutase                                 386   7e-121   
ref|WP_022228581.1|  putative uncharacterized protein                   385   8e-121   
ref|WP_029510617.1|  phosphoglucomutase                                 385   8e-121   
ref|WP_021385156.1|  phosphoglucomutase/phosphomannomutase, alpha...    385   9e-121   
ref|XP_006485696.1|  PREDICTED: uncharacterized protein LOC102623...    387   1e-120   
ref|XP_006485694.1|  PREDICTED: uncharacterized protein LOC102623...    389   1e-120   
ref|XP_006436431.1|  hypothetical protein CICLE_v10031045mg             387   2e-120   
ref|XP_006485693.1|  PREDICTED: uncharacterized protein LOC102623...    388   2e-120   
ref|WP_014093213.1|  phosphoglucomutase                                 384   2e-120   
ref|XP_010683505.1|  PREDICTED: uncharacterized protein LOC104898...    385   2e-120   
ref|WP_018998848.1|  phosphoglucomutase                                 384   2e-120   
ref|WP_023548663.1|  phosphoglucomutase                                 384   3e-120   
ref|WP_006597872.1|  phosphoglucomutase                                 384   3e-120   
ref|WP_012581096.1|  phosphoglucomutase                                 384   3e-120   
ref|XP_010032191.1|  PREDICTED: uncharacterized protein LOC104421...    387   3e-120   
ref|XP_010032188.1|  PREDICTED: uncharacterized protein LOC104421...    388   3e-120   
ref|XP_006485695.1|  PREDICTED: uncharacterized protein LOC102623...    387   3e-120   
ref|XP_010032193.1|  PREDICTED: uncharacterized protein LOC104421...    386   3e-120   
ref|XP_004956118.1|  PREDICTED: uncharacterized protein LOC101756...    388   3e-120   
ref|WP_012951800.1|  phosphoglucomutase                                 384   4e-120   
ref|WP_014600954.1|  phosphoglucomutase                                 384   4e-120   
ref|XP_010032189.1|  PREDICTED: uncharacterized protein LOC104421...    387   4e-120   
ref|XP_004149905.1|  PREDICTED: phosphomannomutase/phosphoglucomu...    387   5e-120   
gb|EFR84141.1|  phosphoglucomutase/phosphomannomutase family protein    383   5e-120   
ref|XP_006589427.1|  PREDICTED: uncharacterized protein LOC100816...    387   7e-120   
ref|WP_019595519.1|  phosphoglucomutase                                 382   9e-120   
ref|WP_039120463.1|  phosphoglucomutase                                 383   1e-119   
gb|EFR96473.1|  phosphoglucomutase/phosphomannomutase family protein    383   1e-119   
ref|WP_027112867.1|  phosphoglucomutase                                 382   1e-119   
ref|WP_031671909.1|  phosphoglucomutase                                 382   1e-119   
gb|EFR87308.1|  phosphoglucomutase/phosphomannomutase family protein    382   1e-119   
ref|WP_016318365.1|  hypothetical protein                               382   2e-119   
ref|WP_023550560.1|  phosphoglucomutase                                 382   2e-119   
ref|WP_002844098.1|  phosphoglucomutase                                 382   2e-119   
ref|WP_024621126.1|  phosphoglucomutase [                               382   2e-119   
ref|WP_009925768.1|  phosphoglucomutase                                 382   2e-119   
ref|XP_004956117.1|  PREDICTED: uncharacterized protein LOC101756...    388   3e-119   
ref|WP_022264122.1|  phosphoglucomutase/phosphomannomutase alpha/...    382   3e-119   
ref|WP_031665099.1|  phosphoglucomutase                                 382   3e-119   
ref|XP_010683504.1|  PREDICTED: uncharacterized protein LOC104898...    385   3e-119   
ref|WP_031674718.1|  phosphoglucomutase                                 381   3e-119   
gb|EFS02766.1|  phosphoglucomutase/phosphomannomutase family protein    381   3e-119   
ref|WP_009918617.1|  phosphoglucomutase                                 381   3e-119   
ref|WP_026747265.1|  phosphoglucomutase                                 381   3e-119   
emb|CDO99746.1|  unnamed protein product                                385   3e-119   
ref|WP_003734429.1|  phosphoglucomutase                                 381   4e-119   
ref|WP_031644334.1|  phosphoglucomutase                                 381   4e-119   
ref|WP_012681356.1|  phosphoglucomutase                                 381   4e-119   
ref|WP_010989833.1|  phosphoglucomutase                                 381   4e-119   
ref|WP_003732070.1|  phosphoglucomutase                                 381   4e-119   
ref|WP_003725826.1|  phosphoglucomutase                                 381   5e-119   
ref|WP_010763620.1|  phosphoglucomutase/phosphomannomutase              381   6e-119   
ref|WP_031644827.1|  phosphoglucomutase                                 380   6e-119   
ref|WP_024635466.1|  phosphoglucomutase                                 380   6e-119   
ref|WP_003728277.1|  phosphoglucomutase                                 380   7e-119   
ref|WP_003729488.1|  phosphoglucomutase                                 380   7e-119   
ref|WP_003723425.1|  phosphoglucomutase                                 380   7e-119   
ref|XP_003536351.1|  PREDICTED: uncharacterized protein LOC100816...    384   1e-118   
ref|WP_014553377.1|  phosphoglucomutase                                 380   1e-118   
ref|WP_003739275.1|  phosphoglucomutase                                 380   1e-118   
ref|WP_024636086.1|  phosphoglucomutase                                 379   1e-118   
ref|WP_038407574.1|  phosphoglucomutase                                 379   2e-118   
ref|WP_003730830.1|  phosphoglucomutase                                 379   2e-118   
ref|WP_003767498.1|  phosphoglucomutase                                 379   2e-118   
ref|WP_021496770.1|  phosphoglucomutase                                 379   2e-118   
ref|XP_008652327.1|  PREDICTED: uncharacterized protein LOC103632...    381   2e-118   
ref|WP_036378228.1|  phosphoglucomutase                                 379   3e-118   
ref|WP_002314522.1|  phosphoglucomutase                                 379   3e-118   
ref|XP_006606247.1|  PREDICTED: uncharacterized protein LOC100817...    380   3e-118   
ref|WP_025654965.1|  phosphoglucomutase                                 379   3e-118   
ref|WP_027109029.1|  phosphoglucomutase                                 379   3e-118   
ref|WP_002845115.1|  phosphoglucomutase/phosphomannomutase, alpha...    379   3e-118   
ref|WP_033532918.1|  phosphoglucomutase                                 379   3e-118   
ref|WP_007207518.1|  phosphoglucomutase                                 379   4e-118   
ref|WP_002341995.1|  phosphoglucomutase                                 378   4e-118   
ref|WP_033837736.1|  phosphoglucomutase                                 378   4e-118   
gb|KHN17139.1|  Phosphomannomutase/phosphoglucomutase                   380   5e-118   
ref|WP_036078077.1|  phosphoglucomutase                                 378   5e-118   
ref|XP_010920439.1|  PREDICTED: uncharacterized protein LOC105044...    382   6e-118   
ref|WP_022518498.1|  phosphoglucomutase/phosphomannomutase alpha/...    378   7e-118   
ref|XP_008652325.1|  PREDICTED: uncharacterized protein LOC103632...    382   7e-118   
gb|EEC81957.1|  hypothetical protein OsI_25842                          382   8e-118   
ref|WP_036201137.1|  MULTISPECIES: phosphoglucomutase                   377   8e-118   
ref|WP_012620235.1|  phosphoglucomutase                                 376   1e-117   
gb|EHN62368.1|  phosphoglucomutase/phosphomannomutase, alpha/beta...    378   1e-117   
ref|WP_021495888.1|  phosphoglucomutase                                 377   1e-117   
ref|WP_005840782.1|  phosphoglucomutase                                 377   1e-117   
ref|WP_009002141.1|  phosphoglucomutase                                 377   2e-117   
ref|WP_014125511.1|  phosphoglucomutase                                 377   2e-117   
dbj|BAK03508.1|  predicted protein                                      378   2e-117   
ref|WP_002336042.1|  phosphoglucomutase/phosphomannomutase              377   2e-117   
ref|WP_007390412.1|  phosphoglucomutase                                 377   2e-117   
ref|XP_010943481.1|  PREDICTED: uncharacterized protein LOC105061204    379   2e-117   
ref|WP_002329582.1|  phosphoglucomutase/phosphomannomutase              376   2e-117   
gb|EPP15360.1|  phosphoglucomutase/phosphomannomutase family protein    376   2e-117   
ref|WP_010991692.1|  phosphoglucomutase                                 376   2e-117   
ref|XP_006606246.1|  PREDICTED: uncharacterized protein LOC100817...    380   3e-117   
gb|EPP16356.1|  phosphoglucomutase/phosphomannomutase family protein    376   3e-117   
ref|WP_002374919.1|  phosphoglucomutase                                 376   3e-117   
gb|ERM45603.1|  phosphoglucomutase/phosphomannomutase, alpha/beta...    372   3e-117   
ref|XP_010920441.1|  PREDICTED: probable phosphoglucomutase-2 iso...    377   3e-117   
ref|WP_010749045.1|  phosphoglucomutase/phosphomannomutase              376   4e-117   
ref|XP_010920440.1|  PREDICTED: uncharacterized protein LOC105044...    378   6e-117   
gb|EFR90302.1|  phosphoglucomutase/phosphomannomutase family protein    375   6e-117   
ref|WP_002313348.1|  phosphoglucomutase                                 375   7e-117   
ref|XP_008785063.1|  PREDICTED: uncharacterized protein LOC103703...    376   8e-117   
ref|WP_022299874.1|  phosphoglucomutase/phosphomannomutase alpha/...    375   9e-117   
ref|WP_002308155.1|  phosphoglucomutase                                 375   9e-117   
ref|WP_011702658.1|  phosphoglucomutase                                 375   1e-116   
ref|WP_015510465.1|  phosphoglucomutase                                 375   1e-116   
gb|EOH57489.1|  phosphoglucomutase/phosphomannomutase                   375   1e-116   
ref|WP_028273705.1|  phosphoglucomutase                                 375   1e-116   
ref|XP_007009849.1|  Phosphoglucosamine mutase family protein           389   1e-116   
ref|WP_009063249.1|  phosphoglucomutase                                 374   2e-116   
ref|WP_022174731.1|  phosphoglucomutase/phosphomannomutase alpha/...    374   2e-116   
ref|WP_022335616.1|  phosphoglucomutase/phosphomannomutase alpha/...    374   2e-116   
ref|WP_009369442.1|  phosphoglucomutase                                 374   2e-116   
dbj|BAJ87888.1|  predicted protein                                      377   2e-116   
gb|KCW51587.1|  hypothetical protein EUGRSUZ_J01084                     376   2e-116   
ref|WP_005233485.1|  MULTISPECIES: phosphoglucomutase                   374   3e-116   
ref|WP_016612972.1|  phosphoglucomutase/phosphomannomutase, alpha...    374   3e-116   
ref|WP_028790362.1|  phosphoglucomutase                                 374   3e-116   
ref|WP_003748517.1|  phosphoglucomutase                                 374   3e-116   
ref|WP_019553578.1|  hypothetical protein                               374   4e-116   
ref|XP_004307387.1|  PREDICTED: phosphomannomutase/phosphoglucomu...    377   4e-116   
ref|WP_022447000.1|  phosphoglucomutase/phosphomannomutase alpha/...    373   4e-116   
ref|WP_020072591.1|  phosphoglucomutase [                               373   4e-116   
ref|WP_005227788.1|  phosphoglucomutase                                 373   4e-116   
ref|WP_012986006.1|  phosphoglucomutase                                 373   5e-116   
ref|WP_038322000.1|  phosphoglucomutase                                 373   5e-116   
gb|KHN00841.1|  Phosphomannomutase/phosphoglucomutase                   375   6e-116   
ref|WP_006282341.1|  phosphoglucomutase                                 372   6e-116   
ref|WP_008379286.1|  phosphoglucomutase                                 372   7e-116   
ref|WP_034570602.1|  phosphoglucomutase                                 373   7e-116   
ref|WP_005879370.1|  phosphoglucomutase/phosphomannomutase family...    372   7e-116   
gb|EEV33865.1|  phosphomannomutase                                      372   7e-116   
ref|WP_027453698.1|  phosphoglucomutase                                 372   8e-116   
ref|WP_022143153.1|  phosphoglucomutase/phosphomannomutase alpha/...    372   8e-116   
ref|XP_008785062.1|  PREDICTED: uncharacterized protein LOC103703...    376   8e-116   
ref|WP_002347729.1|  phosphoglucomutase                                 372   1e-115   
ref|WP_010718320.1|  phosphoglucomutase/phosphomannomutase              372   1e-115   
ref|WP_002325133.1|  phosphoglucomutase/phosphomannomutase              372   1e-115   
ref|WP_027405867.1|  phosphoglucomutase                                 372   2e-115   
ref|WP_010728894.1|  phosphoglucomutase/phosphomannomutase              371   2e-115   
ref|WP_037376254.1|  phosphoglucomutase                                 371   2e-115   
ref|WP_016299524.1|  hypothetical protein                               371   2e-115   
gb|EOS58418.1|  hypothetical protein C814_02377                         371   2e-115   
ref|WP_010737120.1|  MULTISPECIES: phosphoglucomutase                   371   3e-115   
ref|WP_036204280.1|  phosphoglucomutase                                 371   3e-115   
ref|WP_016520847.1|  hypothetical protein                               371   3e-115   
ref|XP_010920442.1|  PREDICTED: probable phosphoglucomutase-2 iso...    372   5e-115   
ref|WP_002327435.1|  phosphoglucomutase/phosphomannomutase              370   5e-115   
ref|XP_008791549.1|  PREDICTED: uncharacterized protein LOC103708...    374   6e-115   
ref|WP_016404184.1|  phosphoglucomutase/phosphomannomutase alpha/...    370   6e-115   
ref|XP_008791548.1|  PREDICTED: uncharacterized protein LOC103708...    374   8e-115   
ref|WP_034553803.1|  phosphoglucomutase                                 370   9e-115   
ref|WP_029487310.1|  phosphoglucomutase                                 369   9e-115   
ref|WP_010772143.1|  phosphoglucomutase/phosphomannomutase              370   1e-114   
ref|XP_001772541.1|  predicted protein                                  371   1e-114   
ref|WP_002305997.1|  phosphoglucomutase                                 369   1e-114   
ref|WP_010724443.1|  phosphoglucomutase/phosphomannomutase              369   1e-114   
ref|WP_016251920.1|  phosphoglucomutase/phosphomannomutase              369   2e-114   
ref|WP_007476137.1|  phosphoglucomutase/phosphomannomutase              369   2e-114   
ref|WP_005472834.1|  MULTISPECIES: phosphoglucomutase                   369   2e-114   
ref|WP_010720842.1|  phosphoglucomutase/phosphomannomutase              369   2e-114   
ref|WP_002300335.1|  phosphoglucomutase                                 369   2e-114   
ref|WP_016628464.1|  phosphoglucomutase/phosphomannomutase, alpha...    369   2e-114   
ref|WP_002346496.1|  phosphoglucomutase/phosphomannomutase              369   2e-114   
ref|WP_002286827.1|  MULTISPECIES: phosphoglucomutase                   368   3e-114   
ref|WP_010725504.1|  phosphoglucomutase/phosphomannomutase              368   3e-114   
ref|WP_002377714.1|  phosphoglucomutase                                 368   3e-114   
ref|WP_013977751.1|  phosphoglucomutase                                 368   4e-114   
ref|WP_016174147.1|  phosphoglucomutase/phosphomannomutase              368   4e-114   
ref|WP_002293678.1|  phosphoglucomutase                                 368   4e-114   
ref|WP_016609980.1|  phosphoglucomutase/phosphomannomutase, alpha...    367   6e-114   
ref|WP_034699900.1|  phosphoglucomutase                                 368   6e-114   
ref|WP_022156460.1|  phosphoglucomutase/phosphomannomutase alpha/...    367   7e-114   
ref|WP_002337888.1|  phosphoglucomutase/phosphomannomutase              367   7e-114   
ref|WP_029546344.1|  phosphoglucomutase                                 367   8e-114   
ref|WP_029485592.1|  phosphoglucomutase                                 367   1e-113   
ref|WP_002340238.1|  phosphoglucomutase/phosphomannomutase              366   1e-113   
ref|WP_006875577.1|  phosphoglucomutase                                 367   2e-113   
ref|WP_010738908.1|  phosphoglucomutase/phosphomannomutase              365   4e-113   
ref|WP_016182432.1|  phosphoglucomutase/phosphomannomutase              367   4e-113   
ref|XP_008791550.1|  PREDICTED: uncharacterized protein LOC103708...    367   5e-113   
gb|KGN47825.1|  hypothetical protein Csa_6G405870                       368   5e-113   
ref|WP_005999228.1|  phosphoglucomutase [                               365   5e-113   
ref|WP_002318341.1|  phosphoglucomutase                                 365   5e-113   



>ref|XP_009605896.1| PREDICTED: uncharacterized protein LOC104100389 isoform X2 [Nicotiana 
tomentosiformis]
Length=607

 Score =  1040 bits (2688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/621 (81%), Positives = 557/621 (90%), Gaps = 15/621 (2%)
 Frame = -1

Query  2091  MASTSTTPQSLQTI-ASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNE  1915
             MAST     S+QTI AS+ NFPS P++KP+H+ L I+ +    K SLRVES  TA K+N+
Sbjct  1     MASTPNPSHSIQTINASRTNFPSLPMNKPIHKKLHISLN----KSSLRVESCSTA-KYND  55

Query  1914  VAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGG  1735
             V   EEM+KI+RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVI+GLE E+G 
Sbjct  56    V---EEMDKIKRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVINGLEKEKG-  111

Query  1734  AVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDA  1555
                  VRVSLG DPRISG  LS AVFAGL +AGC+VFDMGLATTPACFMST+LPPFQYDA
Sbjct  112   -----VRVSLGKDPRISGNMLSVAVFAGLSRAGCMVFDMGLATTPACFMSTILPPFQYDA  166

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVD  1375
             SIMMTASHLPYTRNGLKFFTKKGGLTS EVE ICDKAARKYANR+AKVST L   P+ VD
Sbjct  167   SIMMTASHLPYTRNGLKFFTKKGGLTSPEVEEICDKAARKYANRLAKVSTRLPITPTMVD  226

Query  1374  FMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  1195
             FMSAYAKHLR+IIKERVNHP+HYDTPL+GFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL
Sbjct  227   FMSAYAKHLREIIKERVNHPSHYDTPLKGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  286

Query  1194  HLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDR  1015
             HLNPDGMFPNHIPNPEDKTAMA+TRA VL+N ADLG+VFDTDVDRSGVVD  GN INGDR
Sbjct  287   HLNPDGMFPNHIPNPEDKTAMALTRAGVLKNKADLGIVFDTDVDRSGVVDSEGNTINGDR  346

Query  1014  LIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDG  835
             LIALMSAIVLKEHP TT+VTDARTSM LT+FI  +GGQHCLYRVGYRNVIDKGV+LN+DG
Sbjct  347   LIALMSAIVLKEHPSTTIVTDARTSMALTKFIRNKGGQHCLYRVGYRNVIDKGVNLNKDG  406

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLET  655
             +ETHLMMETSGHGALKEN+FLDDGAYMVVKIIIEMV+MKLEGSE  IGSLI+DLEEPLE+
Sbjct  407   IETHLMMETSGHGALKENHFLDDGAYMVVKIIIEMVRMKLEGSEGDIGSLIEDLEEPLES  466

Query  654   AELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPA  475
             AE+RM VLSEPR+AKAKAVEAIE+FR +IE+G+LPGWELD+CGDCWVS+GCLVDTND PA
Sbjct  467   AEVRMIVLSEPRNAKAKAVEAIEAFRTHIEQGSLPGWELDACGDCWVSDGCLVDTNDDPA  526

Query  474   AIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAG  295
             AIDAFMYRAKVS+E+NGEHGWVHLRQSIHNPNIAVNLQS IPGGCQSMA+ L D+FLL  
Sbjct  527   AIDAFMYRAKVSDEQNGEHGWVHLRQSIHNPNIAVNLQSTIPGGCQSMAKVLIDRFLLPS  586

Query  294   EMAKFLDISQIDEFARNGNLN  232
              M K LD+SQID++AR GNL+
Sbjct  587   GMDKILDVSQIDKYARTGNLS  607



>emb|CDP00801.1| unnamed protein product [Coffea canephora]
Length=621

 Score =  1034 bits (2673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/611 (81%), Positives = 551/611 (90%), Gaps = 3/611 (0%)
 Frame = -1

Query  2061  LQTIASKPNFPSFPIHKP-LHRS-LGIAQSFPKIKLSLRVESSLTANKHNEVAVDEEMEK  1888
             LQ + SK +FPS PI+KP LH +   I+  FP  +  LRVESS T  K NEV VDEEM+K
Sbjct  12    LQGLISKTSFPSLPINKPILHNTNFKISFPFPSRQSLLRVESSSTV-KSNEVVVDEEMDK  70

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             IRRLQNGSDVRGVAL+GEKGR+VDLTPPAVEAIAESFGEWV+  LE  +    VE+VRVS
Sbjct  71    IRRLQNGSDVRGVALEGEKGRTVDLTPPAVEAIAESFGEWVVERLEEGKTNGSVENVRVS  130

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHL  1528
             LG DPRISG SLSAAVFAGL +AGCL FDMGLATTPACFMST+LPPF YDASIMMTASHL
Sbjct  131   LGRDPRISGASLSAAVFAGLARAGCLAFDMGLATTPACFMSTLLPPFMYDASIMMTASHL  190

Query  1527  PYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
             PYTRNGLKFFTK GGLTS +VE IC +AARKYANR+AKVSTALR PP +VDFMS YAKHL
Sbjct  191   PYTRNGLKFFTKNGGLTSPDVEEICYRAARKYANRLAKVSTALRNPPKRVDFMSTYAKHL  250

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
             RDIIKERVNHP HYDTPLQGFQIIVNAGNGSGGFFT+DVLD+LGA+TFGSLHLNPDGMFP
Sbjct  251   RDIIKERVNHPLHYDTPLQGFQIIVNAGNGSGGFFTYDVLDRLGAETFGSLHLNPDGMFP  310

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NHIPNPEDKTAMA+TRAAVL+N ADLG+VFDTDVDRSGVVD SGNPINGD+LIALMSAIV
Sbjct  311   NHIPNPEDKTAMALTRAAVLENKADLGIVFDTDVDRSGVVDSSGNPINGDKLIALMSAIV  370

Query  987   LKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             LKEHPGTT+VTDARTSM LTRFIT RGGQHCLYRVGYRNVIDKGV LN+DG+ETHLMME 
Sbjct  371   LKEHPGTTIVTDARTSMALTRFITDRGGQHCLYRVGYRNVIDKGVQLNKDGMETHLMMEI  430

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             +GHGALKEN+FLDDGAYMVVK+IIEMV+MKLEGS +GIGSLIKDLE PLE+AELRM+V+S
Sbjct  431   TGHGALKENHFLDDGAYMVVKVIIEMVRMKLEGSGDGIGSLIKDLEGPLESAELRMNVIS  490

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             EPR AKAKA+EAIE+FR+Y+E+G LPGW+LDSCG+CWVS+GCLVDTND PAA+DA MYRA
Sbjct  491   EPRFAKAKAIEAIETFRNYVEEGQLPGWDLDSCGECWVSDGCLVDTNDTPAAVDAHMYRA  550

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDIS  268
             KVS+++N E GWVHLRQSIHNPNIAVNLQSN+PGGCQ M+RDLRDKFLLA  M + LDIS
Sbjct  551   KVSDKDNAELGWVHLRQSIHNPNIAVNLQSNVPGGCQLMSRDLRDKFLLASGMDRILDIS  610

Query  267   QIDEFARNGNL  235
             QID++AR+G++
Sbjct  611   QIDKYARSGSV  621



>ref|XP_002280911.1| PREDICTED: uncharacterized protein LOC100243950 [Vitis vinifera]
 emb|CBI26878.3| unnamed protein product [Vitis vinifera]
Length=617

 Score =  1018 bits (2633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/619 (78%), Positives = 551/619 (89%), Gaps = 3/619 (0%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNEV  1912
             M+STST    LQ  A K  FPS P+ KP   +L  + S  ++  ++ V+SS TA K NEV
Sbjct  1     MSSTSTLSLPLQRNARKKGFPSSPVTKPFTANLTFSFSL-RLTKAIHVKSSSTA-KFNEV  58

Query  1911  AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGA  1732
              VDEE++KIRRLQNGSDVRGVA++GEKGR+VDLTPPAVEAIAESFGEWV++ LESE GG 
Sbjct  59    VVDEEIDKIRRLQNGSDVRGVAVEGEKGRTVDLTPPAVEAIAESFGEWVMNRLESE-GGV  117

Query  1731  VVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDAS  1552
              VE VRVSLG DPRISG SLSAAVF+GL +AGCL FDMGLATTPACFMST+LPPF YDAS
Sbjct  118   PVEGVRVSLGRDPRISGASLSAAVFSGLARAGCLAFDMGLATTPACFMSTLLPPFAYDAS  177

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDF  1372
             IMMTASHLPYTRNGLKFFT+KGGLTS EVEAICDKAARKYANR+ KVST L  PP+KVDF
Sbjct  178   IMMTASHLPYTRNGLKFFTRKGGLTSPEVEAICDKAARKYANRLTKVSTTLSIPPTKVDF  237

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             MS YAKHLRDIIKERVNHP HYDTPL+GFQIIVN+GNGSGGFFTWDVLDKLGADTFGSL+
Sbjct  238   MSTYAKHLRDIIKERVNHPLHYDTPLKGFQIIVNSGNGSGGFFTWDVLDKLGADTFGSLN  297

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             L+PDGMFPNHIPNPEDKTAMA+T+AAVL+N ADLG+VFDTDVDRSGVVD SGNPINGD+L
Sbjct  298   LSPDGMFPNHIPNPEDKTAMALTKAAVLENNADLGIVFDTDVDRSGVVDSSGNPINGDKL  357

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGV  832
             IALM+AIVL+EHPG+T+VTDARTSM LT+FI  RGG HCLYRVGYRNVIDKGV LN+DG+
Sbjct  358   IALMAAIVLREHPGSTIVTDARTSMALTQFIANRGGHHCLYRVGYRNVIDKGVQLNKDGI  417

Query  831   ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETA  652
             E HLMMETSGHGALKEN+FLDDGAYMVVKIIIEMV+MKL GS EGIGSLI+DL+EP E+ 
Sbjct  418   EAHLMMETSGHGALKENHFLDDGAYMVVKIIIEMVRMKLAGSYEGIGSLIEDLQEPFESV  477

Query  651   ELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAA  472
             ELRM+V+SEP+HAKAK  EAIE+FR+YIE+G L GWELDSCGDCWVSEGCLVD ND PAA
Sbjct  478   ELRMNVISEPKHAKAKGAEAIEAFRNYIEEGKLEGWELDSCGDCWVSEGCLVDLNDTPAA  537

Query  471   IDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGE  292
             IDA+MYRAKVS++E+G+HGW+HLRQSIHNPNIAVN+QS++P GCQSMAR LR+KFL+A  
Sbjct  538   IDAYMYRAKVSDKEHGQHGWIHLRQSIHNPNIAVNIQSSVPSGCQSMARVLREKFLIASG  597

Query  291   MAKFLDISQIDEFARNGNL  235
             M K LDI+QID++A++G +
Sbjct  598   MEKSLDITQIDKYAKSGQV  616



>ref|XP_002527800.1| phosphoglucomutase, putative [Ricinus communis]
 gb|EEF34610.1| phosphoglucomutase, putative [Ricinus communis]
Length=620

 Score =  1016 bits (2627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/622 (79%), Positives = 545/622 (88%), Gaps = 10/622 (2%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNF---PSFPIHKPLHRSLGIAQSFPKIKLS--LRVESSLTAN  1927
             MA T+T+  SLQ      +F   PS P  KP   +  I  SFP + L+   R++SS T  
Sbjct  1     MAHTATSSISLQNNVPNTSFKSPPSLPT-KPFQNN--IKFSFPPLTLTKVTRIKSSRTT-  56

Query  1926  KHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES  1747
             K+NEV VDEEM+K+RRLQNGSDVRGVAL+GEKGR+VDLTPPAVEAIAESFGEWVI+GLE 
Sbjct  57    KYNEVIVDEEMDKVRRLQNGSDVRGVALEGEKGRTVDLTPPAVEAIAESFGEWVINGLEK  116

Query  1746  ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF  1567
             E+G  VVE VRVSLG DPR++G SLS AVFAGL +AGC+VFDMGLATTPACFMST+L PF
Sbjct  117   EKG-RVVEDVRVSLGKDPRVTGASLSVAVFAGLSRAGCMVFDMGLATTPACFMSTLLHPF  175

Query  1566  QYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPP  1387
              YDASIMMTASHLPYTRNGLKFFTKKGGLTS EVE IC+KAARKYANR+ KVST L  PP
Sbjct  176   AYDASIMMTASHLPYTRNGLKFFTKKGGLTSPEVEEICEKAARKYANRLMKVSTLLNTPP  235

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
             ++VDFMS YAKHLRDIIKERV+HP HYDTPL+GFQIIVNAGNGSGGFF WDVLDKLGADT
Sbjct  236   TRVDFMSTYAKHLRDIIKERVSHPLHYDTPLKGFQIIVNAGNGSGGFFKWDVLDKLGADT  295

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
             FGSLHLNPDGMFPNHIPNPEDKTAMA+TRAAVL N+ADLG+VFDTDVDRSGVVD  GNPI
Sbjct  296   FGSLHLNPDGMFPNHIPNPEDKTAMALTRAAVLDNSADLGIVFDTDVDRSGVVDNKGNPI  355

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHL  847
             NGD+LIALMSAIVL+EHPGTT+VTDARTSM L+RFIT RGGQHCLYRVGYRNVIDKGVHL
Sbjct  356   NGDKLIALMSAIVLREHPGTTIVTDARTSMALSRFITDRGGQHCLYRVGYRNVIDKGVHL  415

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEE  667
             NEDG+E HLMMETSGHGALKENYFLDDGAYMVVKIIIEMV+MKL GS+EGIGSLIKDLEE
Sbjct  416   NEDGIEAHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVRMKLAGSDEGIGSLIKDLEE  475

Query  666   PLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTN  487
             P E  ELRM+V+SEPRHAKAKAVE IE FR++IE+G L GWELD CGDCWVS+GCLVD+N
Sbjct  476   PREVIELRMNVISEPRHAKAKAVEVIEKFRNFIEEGKLEGWELDYCGDCWVSDGCLVDSN  535

Query  486   DHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
             D PAA+DA+MYR KVS+EE+G+HGWVHLRQSIHNPNIAVN+QS +PG CQSM   LRDKF
Sbjct  536   DTPAAVDAYMYRTKVSDEEHGQHGWVHLRQSIHNPNIAVNMQSMVPGACQSMTEVLRDKF  595

Query  306   LLAGEMAKFLDISQIDEFARNG  241
             L+A  + KFLDI+QID++A  G
Sbjct  596   LVASGIDKFLDITQIDKYANTG  617



>ref|XP_011023675.1| PREDICTED: uncharacterized protein LOC105125072 [Populus euphratica]
Length=617

 Score =  1010 bits (2611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/617 (77%), Positives = 544/617 (88%), Gaps = 3/617 (0%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNEV  1912
             MASTST+  SL+  A    FPS    K L  +L      P  K +  ++SS +A ++NE 
Sbjct  1     MASTSTSSISLRNNAPGTRFPSSTTSKLLQSNLKFPLLMPATKAT-GIKSS-SATRYNEA  58

Query  1911  AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGA  1732
              +DEEM+KIRRLQNGSDVRGVALQGEKGR+VDL+PPAVEAIAESFGEWVI+GLE E+G  
Sbjct  59    VIDEEMDKIRRLQNGSDVRGVALQGEKGRTVDLSPPAVEAIAESFGEWVINGLEKEKG-R  117

Query  1731  VVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDAS  1552
             VVE+VRVSLG DPR+SG SLS AVF+GL +AGCL FDMGLATTPACFMST+L PF YDAS
Sbjct  118   VVENVRVSLGRDPRLSGASLSVAVFSGLVRAGCLAFDMGLATTPACFMSTLLTPFAYDAS  177

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDF  1372
             IMMTASHLPYTRNGLKFFT++GGLTS EVE IC KAARKYANR+AKVST L+ PP +VDF
Sbjct  178   IMMTASHLPYTRNGLKFFTRRGGLTSPEVEEICGKAARKYANRLAKVSTMLKTPPERVDF  237

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             MS YAKHLR+IIKERVNHP HYDTPL+GFQIIVNAGNGSGGFFTWDVLDKLGA+TFGSLH
Sbjct  238   MSTYAKHLRNIIKERVNHPLHYDTPLKGFQIIVNAGNGSGGFFTWDVLDKLGAETFGSLH  297

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             LNPDGMFPNHIPNPEDK AMA+TRAAVL+N+ADLG+VFDTDVDRSGVVD+ GNPINGDRL
Sbjct  298   LNPDGMFPNHIPNPEDKIAMALTRAAVLENSADLGIVFDTDVDRSGVVDKEGNPINGDRL  357

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGV  832
             IALMSAIVL+EHPGTT+VTDARTSM LTRFI  RGGQHCLYRVGYRNVIDKGV LN++G+
Sbjct  358   IALMSAIVLREHPGTTIVTDARTSMALTRFIIDRGGQHCLYRVGYRNVIDKGVQLNKNGI  417

Query  831   ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETA  652
             ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMV+MKL GS+EGIGSLIKDLEEP E+ 
Sbjct  418   ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVRMKLAGSDEGIGSLIKDLEEPFESV  477

Query  651   ELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAA  472
             ELRM+++SEPRHAKA+ ++AIE+FR Y+E+G + GWELDSCGDCWV++GCLVD+ND PAA
Sbjct  478   ELRMNIISEPRHAKARGIDAIETFRSYVEEGRIEGWELDSCGDCWVADGCLVDSNDDPAA  537

Query  471   IDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGE  292
             +DA MYRAKVS+E+ G+HGW+HLRQSIHNPNIAVN+QS +PGGC SM + LRDKFL+A  
Sbjct  538   VDAHMYRAKVSDEKLGQHGWIHLRQSIHNPNIAVNMQSMVPGGCLSMTKTLRDKFLVASG  597

Query  291   MAKFLDISQIDEFARNG  241
             M K LDI+QID++AR G
Sbjct  598   MDKILDITQIDKYARTG  614



>ref|XP_006338178.1| PREDICTED: uncharacterized protein LOC102599849 [Solanum tuberosum]
Length=608

 Score =  1009 bits (2608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/620 (80%), Positives = 545/620 (88%), Gaps = 17/620 (3%)
 Frame = -1

Query  2079  STTPQSLQTI-ASKPNFPSFPI-HKP-LHRSLGIAQSFPKIKLSLRVES-SLTANKHNEV  1912
             ++T  SLQTI +S  NFP  PI  KP LH SL     F     SLRVE  S +A  +NE 
Sbjct  2     ASTFSSLQTINSSITNFPCVPIIKKPKLHISLSKTSIF-----SLRVECCSSSAKTYNE-  55

Query  1911  AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGA  1732
               DEEM+KIRRLQNGSDVRGVALQGEKGRS+DLTPPAVEAIAESFGEWVI GL ++    
Sbjct  56    --DEEMDKIRRLQNGSDVRGVALQGEKGRSIDLTPPAVEAIAESFGEWVIKGLNNKE---  110

Query  1731  VVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDAS  1552
               + V VSLG DPRISG +LS AVF+GL +AGC+VFDMGLATTPACFMST+LPP QYDAS
Sbjct  111   --KVVMVSLGKDPRISGNTLSVAVFSGLSRAGCMVFDMGLATTPACFMSTILPPCQYDAS  168

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDF  1372
             IMMTASHLPYTRNGLKFFTKKGGLTS EVE IC++AARKYANR  KVST L   P+KVDF
Sbjct  169   IMMTASHLPYTRNGLKFFTKKGGLTSVEVEEICEEAARKYANRFTKVSTTLPTRPTKVDF  228

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             MS+YAKHLRDIIKERVNHP HYDTPL+GFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH
Sbjct  229   MSSYAKHLRDIIKERVNHPNHYDTPLKGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  288

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             LNPDGMFPNHIPNPEDK AM++TRAAVL+N ADLG+VFDTDVDRSGVVD  GNPINGDRL
Sbjct  289   LNPDGMFPNHIPNPEDKIAMSLTRAAVLENNADLGIVFDTDVDRSGVVDSEGNPINGDRL  348

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGV  832
             IALMSAIVLKEHPGTT+VTDARTSM LT+FIT +GGQHCLYRVGYRNVIDKGV+LN+DGV
Sbjct  349   IALMSAIVLKEHPGTTIVTDARTSMALTKFITNKGGQHCLYRVGYRNVIDKGVNLNKDGV  408

Query  831   ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETA  652
             ETHLMMETSGHGALKEN+FLDDGAYMVVKIIIEMV+MKLEGSE+GIGSLIKDLEEPLE+A
Sbjct  409   ETHLMMETSGHGALKENHFLDDGAYMVVKIIIEMVRMKLEGSEKGIGSLIKDLEEPLESA  468

Query  651   ELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAA  472
             ELRM VLSEPR+AKAKA EAIE+FR YIE+G+LPGWELD+CGDCWVS+GCLVDTND P A
Sbjct  469   ELRMVVLSEPRYAKAKAFEAIEAFRTYIEQGSLPGWELDACGDCWVSDGCLVDTNDDPTA  528

Query  471   IDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGE  292
             IDA+MYRAKVS+E N EHGWVHLRQSIHNPNIAVN+QS +PGGCQ MA+ LRD+FLL   
Sbjct  529   IDAYMYRAKVSSEGNEEHGWVHLRQSIHNPNIAVNMQSTVPGGCQYMAKVLRDRFLLPSG  588

Query  291   MAKFLDISQIDEFARNGNLN  232
             M K LD++QID++A +GNL+
Sbjct  589   MDKILDVTQIDKYATSGNLS  608



>ref|XP_002312448.2| hypothetical protein POPTR_0008s13060g [Populus trichocarpa]
 gb|EEE89815.2| hypothetical protein POPTR_0008s13060g [Populus trichocarpa]
Length=617

 Score =  1008 bits (2607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/617 (78%), Positives = 543/617 (88%), Gaps = 3/617 (0%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNEV  1912
             MASTST+  SL+  A    FPS    K LH +L      P  K +  ++SS +A ++NE 
Sbjct  1     MASTSTSSISLRNNAPGTRFPSSTTSKLLHSNLKFPLLMPATKAT-GIKSS-SATRYNEA  58

Query  1911  AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGA  1732
              +DEEM+KIRRLQNGSDVRGVALQGEKGR+VDL+PPAVEAIAESFGEWVI+GLE E+G  
Sbjct  59    VIDEEMDKIRRLQNGSDVRGVALQGEKGRTVDLSPPAVEAIAESFGEWVINGLEKEKG-R  117

Query  1731  VVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDAS  1552
             VVE+VRVSLG DPR+SG SLS AVF+GL +AGCL FDMGLATTPACFMST+L PF YDAS
Sbjct  118   VVENVRVSLGRDPRLSGASLSVAVFSGLVRAGCLAFDMGLATTPACFMSTLLTPFAYDAS  177

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDF  1372
             IMMTASHLPYTRNGLKFFT++GGLTS EVE IC KAARKYANR+AKVST L+ PP +VDF
Sbjct  178   IMMTASHLPYTRNGLKFFTRRGGLTSPEVEEICGKAARKYANRLAKVSTMLKTPPERVDF  237

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             MS YAKHLR+IIKERVNHP HYDTPL+ FQIIVNAGNGSGGFFTWDVLDKLGA+TFGSLH
Sbjct  238   MSTYAKHLRNIIKERVNHPFHYDTPLKEFQIIVNAGNGSGGFFTWDVLDKLGAETFGSLH  297

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             LNPDGMFPNHIPNPEDK AMA+TRAAVL+N+ADLG+VFDTDVDRSGVVD+ GNPINGDRL
Sbjct  298   LNPDGMFPNHIPNPEDKIAMALTRAAVLENSADLGIVFDTDVDRSGVVDKEGNPINGDRL  357

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGV  832
             IALMSAIVL EHPGTT+VTDARTSM LTRFI  RGGQHCLYRVGYRNVIDKGV LN++G+
Sbjct  358   IALMSAIVLTEHPGTTIVTDARTSMALTRFIIDRGGQHCLYRVGYRNVIDKGVQLNKNGI  417

Query  831   ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETA  652
             ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMV+MKL GS+EGIGSLIKDLEEPLE+ 
Sbjct  418   ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVRMKLAGSDEGIGSLIKDLEEPLESV  477

Query  651   ELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAA  472
             ELRM+++SEPRHAKA+ ++AIE+FR Y+E+G + GWELDSCGDCWV++GCLVD+ND PAA
Sbjct  478   ELRMNIISEPRHAKARGIDAIETFRSYVEEGRIEGWELDSCGDCWVADGCLVDSNDDPAA  537

Query  471   IDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGE  292
             +DA MYRAKVS+E+ G+HGW+HLRQSIHNPNIAVN+QS  PGGC SM + LRDKFL+A  
Sbjct  538   VDAHMYRAKVSDEKLGQHGWIHLRQSIHNPNIAVNMQSMAPGGCLSMTKTLRDKFLVASG  597

Query  291   MAKFLDISQIDEFARNG  241
             M K LDI+QID++AR G
Sbjct  598   MDKILDITQIDKYARTG  614



>ref|XP_003556140.1| PREDICTED: uncharacterized protein LOC100810397 [Glycine max]
 gb|KHN08065.1| Phosphomannomutase/phosphoglucomutase [Glycine soja]
Length=619

 Score =  1008 bits (2606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/619 (78%), Positives = 544/619 (88%), Gaps = 6/619 (1%)
 Frame = -1

Query  2085  STSTTPQ---SLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNE  1915
             + ST+P    SL   + K  FPS P  K LH  L  + SFP  K S+RV+S  TA K++E
Sbjct  2     AASTSPNFTTSLHKNSHKTKFPSLPGKKTLHTKLSFSFSFPFNK-SIRVKSIGTA-KYDE  59

Query  1914  VAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGG  1735
             V VDEE++KIRRLQNGSDVRGVAL+GEKGR+VDLTPPAVEAI+ESFGEW+I GL+ E+G 
Sbjct  60    VVVDEELDKIRRLQNGSDVRGVALEGEKGRTVDLTPPAVEAISESFGEWIIKGLKKEKGY  119

Query  1734  AVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDA  1555
              V E+VRVSLG DPR++G  LS AVFAGL +AGC+V+DMGLATTPACFMST+LPPF YDA
Sbjct  120   PV-ENVRVSLGRDPRVTGSKLSVAVFAGLARAGCMVYDMGLATTPACFMSTLLPPFAYDA  178

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVD  1375
             S+MMTASHLPYTRNGLKFFTK+GGLTSTEVE IC+KAARKYANRMAKVST L   P+KVD
Sbjct  179   SMMMTASHLPYTRNGLKFFTKRGGLTSTEVEEICEKAARKYANRMAKVSTLLNVLPTKVD  238

Query  1374  FMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  1195
             FMS Y+ HLR+IIKER+NHP HYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL
Sbjct  239   FMSTYSMHLREIIKERINHPLHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  298

Query  1194  HLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDR  1015
             HLNPDGMFPNHIPNPEDKTAMA+TRAAVLQN+ADLG+VFDTDVDRSGVVD  GNPINGD+
Sbjct  299   HLNPDGMFPNHIPNPEDKTAMALTRAAVLQNSADLGIVFDTDVDRSGVVDSKGNPINGDK  358

Query  1014  LIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDG  835
             LIALMSAIVL+EHPG+T+VTDARTSM LTRFIT RGG HCLYRVGYRNVIDKGVHLN DG
Sbjct  359   LIALMSAIVLREHPGSTIVTDARTSMALTRFITDRGGHHCLYRVGYRNVIDKGVHLNNDG  418

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLET  655
             +ETHLMMETSGHGALKEN+FLDDGAYMVVKIIIEMV+MKL GS EGIGSLI+DLEEP E+
Sbjct  419   IETHLMMETSGHGALKENHFLDDGAYMVVKIIIEMVRMKLAGSNEGIGSLIEDLEEPYES  478

Query  654   AELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPA  475
              ELR++++SEPR AKAK +EAIE FR+YIE+G L GWELDSCGDCWVSEGCLVDTND PA
Sbjct  479   VELRINIISEPRLAKAKGIEAIEIFRNYIEEGRLKGWELDSCGDCWVSEGCLVDTNDTPA  538

Query  474   AIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAG  295
              IDA MYRAKVSN+E+ +HGWVH+RQSIHNPNIAVNLQS++ GGC SMAR  RD+FL A 
Sbjct  539   PIDAQMYRAKVSNDEHAQHGWVHMRQSIHNPNIAVNLQSSVRGGCLSMARAFRDEFLKAS  598

Query  294   EMAKFLDISQIDEFARNGN  238
              +  FLDI+Q+D+FA NG+
Sbjct  599   GVHTFLDITQVDKFAENGS  617



>ref|XP_007045189.1| Phosphoglucomutase / glucose phosphomutase, putative [Theobroma 
cacao]
 gb|EOY01021.1| Phosphoglucomutase / glucose phosphomutase, putative [Theobroma 
cacao]
Length=617

 Score =  1005 bits (2598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/618 (79%), Positives = 538/618 (87%), Gaps = 3/618 (0%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNEV  1912
             MASTST+P  L+  A KP+F   P      ++L  + S    K+ + V+SS T  K+NEV
Sbjct  1     MASTSTSPIPLRGNARKPSFSPLPAKDASQKTLSFSFSSRSSKV-ICVKSSSTV-KYNEV  58

Query  1911  AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGA  1732
              VDEE+ KIRRLQNGSDVRGVAL+GEKGR+VDLTPPAVEAIAESFGEWVI  LE ER   
Sbjct  59    VVDEEINKIRRLQNGSDVRGVALEGEKGRTVDLTPPAVEAIAESFGEWVIKALE-ERERR  117

Query  1731  VVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDAS  1552
               E VRVSLG DPRISG SLS AVFAGL +AGCLVFDMGLATTPACFMST+LPPF YDAS
Sbjct  118   PAEDVRVSLGKDPRISGASLSVAVFAGLARAGCLVFDMGLATTPACFMSTLLPPFCYDAS  177

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDF  1372
             IMMTASHLPYTRNGLKFFTKKGGLTS EVE ICDKAARKYANR+ KVST L  P  KVDF
Sbjct  178   IMMTASHLPYTRNGLKFFTKKGGLTSPEVEQICDKAARKYANRLTKVSTMLNFPSKKVDF  237

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             MSAYAKHLRDIIK+RVNHP HYDTPL+GFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH
Sbjct  238   MSAYAKHLRDIIKKRVNHPLHYDTPLKGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  297

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             LNPDGMFPNHIPNPEDKTAMA+TRAAVL N+ADLG+VFDTDVDRSGVVD  GNPINGD+L
Sbjct  298   LNPDGMFPNHIPNPEDKTAMALTRAAVLHNSADLGIVFDTDVDRSGVVDNKGNPINGDKL  357

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGV  832
             I LMSAIVLKEHPGTT+VTDARTSM LT+FI  RGG HCLYRVGYRNVIDKGV LN+DG+
Sbjct  358   IGLMSAIVLKEHPGTTIVTDARTSMALTKFIIERGGHHCLYRVGYRNVIDKGVQLNKDGI  417

Query  831   ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETA  652
             ETHLMMETSGHGALKENYFLDDGA+MVVKIIIEMV MKL GS+EGIGSLIKDLEEPLE+ 
Sbjct  418   ETHLMMETSGHGALKENYFLDDGAFMVVKIIIEMVHMKLSGSDEGIGSLIKDLEEPLESI  477

Query  651   ELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAA  472
             ELRM+++SEP++AKA+  EAIE+FR Y+E+G L GWELDSCGDCWVSEGCLVD+ND PAA
Sbjct  478   ELRMNIISEPKYAKARGTEAIEAFRSYVEEGQLEGWELDSCGDCWVSEGCLVDSNDSPAA  537

Query  471   IDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGE  292
             IDA MYRAKVSNE+N E GWVH+RQSIHNPNIAVN+QS++PGGCQ M R LRDKFLLA  
Sbjct  538   IDAHMYRAKVSNEKNEEVGWVHIRQSIHNPNIAVNVQSSVPGGCQWMTRVLRDKFLLASG  597

Query  291   MAKFLDISQIDEFARNGN  238
             M + LDISQI+++AR G+
Sbjct  598   MDEILDISQIEKYARIGD  615



>ref|XP_004298476.1| PREDICTED: phosphomannomutase/phosphoglucomutase-like [Fragaria 
vesca subsp. vesca]
Length=619

 Score =  1005 bits (2598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/624 (76%), Positives = 547/624 (88%), Gaps = 10/624 (2%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLR----VESSLTANK  1924
             MASTST+  SLQT A K +FPS       H +L    SFP   L       V SS T+  
Sbjct  1     MASTSTSSISLQTSAQKQSFPSNSAATTFHTNL----SFPYNPLPFTKFVCVRSSSTSKY  56

Query  1923  HNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESE  1744
             +NEV VDEEM++IRRLQNGSDVRGVAL+GEKGRSVDLTPPAVEAIAESFGEWVI+GLE +
Sbjct  57    YNEVVVDEEMDRIRRLQNGSDVRGVALEGEKGRSVDLTPPAVEAIAESFGEWVINGLEKQ  116

Query  1743  RGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQ  1564
             RG  V E+V+VSLG DPRISG SLS AVF+GL +AGCLVFDMGLATTPACFMST+LPPF 
Sbjct  117   RGQPV-ENVKVSLGRDPRISGPSLSVAVFSGLARAGCLVFDMGLATTPACFMSTILPPFS  175

Query  1563  YDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPS  1384
             YDASIMMTASHLPYTRNGLKFFTK+GGLTS EVE ICDKAARKYANR+ KVS+ LR PPS
Sbjct  176   YDASIMMTASHLPYTRNGLKFFTKRGGLTSPEVEEICDKAARKYANRLTKVSSVLRIPPS  235

Query  1383  KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  1204
             +VDFMS+Y++HLR+IIKERVNHP HYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF
Sbjct  236   RVDFMSSYSEHLRNIIKERVNHPLHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  295

Query  1203  GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPIN  1024
             GSLHL PDGMFPNHIPNPEDK AM +TRAAVL+N+ADLG+VFDTDVDRSGVVD  GNPIN
Sbjct  296   GSLHLKPDGMFPNHIPNPEDKVAMTLTRAAVLENSADLGIVFDTDVDRSGVVDNKGNPIN  355

Query  1023  GDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLN  844
             GD+LIAL+SAIVLKEHPGTT+VTDARTSM LTRFIT RGG HCLYRVGYRNVI+KG+ LN
Sbjct  356   GDKLIALISAIVLKEHPGTTIVTDARTSMALTRFITNRGGHHCLYRVGYRNVIEKGIQLN  415

Query  843   EDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEP  664
             +DG+ETHLMMETSGHGAL+EN+FLDDGAYMVVKIIIEMV+MKL GS+EGIGS+I DLEEP
Sbjct  416   KDGIETHLMMETSGHGALRENFFLDDGAYMVVKIIIEMVQMKLAGSDEGIGSIINDLEEP  475

Query  663   LETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTND  484
              E+ ELRM+V+SEPR+AK KA+EAIE+FR Y+E+G + GWELD+CGDCWVSEGCLVD+N+
Sbjct  476   EESVELRMNVVSEPRYAKEKAIEAIETFRQYVEEGRIEGWELDTCGDCWVSEGCLVDSNE  535

Query  483   -HPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                AA+DA MYR KVS+E +G+HGWVH+RQSIHNPNIAVN+QS++PG CQ+M R LRD+F
Sbjct  536   TSAAAVDAHMYRVKVSDEVHGQHGWVHIRQSIHNPNIAVNMQSSVPGSCQTMTRVLRDRF  595

Query  306   LLAGEMAKFLDISQIDEFARNGNL  235
             L+A EM + LD+++ID++A++G L
Sbjct  596   LIASEMDRVLDMTEIDKYAKSGFL  619



>ref|XP_009605895.1| PREDICTED: uncharacterized protein LOC104100389 isoform X1 [Nicotiana 
tomentosiformis]
Length=628

 Score =  1004 bits (2596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/595 (82%), Positives = 537/595 (90%), Gaps = 15/595 (3%)
 Frame = -1

Query  2091  MASTSTTPQSLQTI-ASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNE  1915
             MAST     S+QTI AS+ NFPS P++KP+H+ L I+ +    K SLRVES  TA K+N+
Sbjct  1     MASTPNPSHSIQTINASRTNFPSLPMNKPIHKKLHISLN----KSSLRVESCSTA-KYND  55

Query  1914  VAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGG  1735
             V   EEM+KI+RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVI+GLE E+G 
Sbjct  56    V---EEMDKIKRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVINGLEKEKG-  111

Query  1734  AVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDA  1555
                  VRVSLG DPRISG  LS AVFAGL +AGC+VFDMGLATTPACFMST+LPPFQYDA
Sbjct  112   -----VRVSLGKDPRISGNMLSVAVFAGLSRAGCMVFDMGLATTPACFMSTILPPFQYDA  166

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVD  1375
             SIMMTASHLPYTRNGLKFFTKKGGLTS EVE ICDKAARKYANR+AKVST L   P+ VD
Sbjct  167   SIMMTASHLPYTRNGLKFFTKKGGLTSPEVEEICDKAARKYANRLAKVSTRLPITPTMVD  226

Query  1374  FMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  1195
             FMSAYAKHLR+IIKERVNHP+HYDTPL+GFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL
Sbjct  227   FMSAYAKHLREIIKERVNHPSHYDTPLKGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  286

Query  1194  HLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDR  1015
             HLNPDGMFPNHIPNPEDKTAMA+TRA VL+N ADLG+VFDTDVDRSGVVD  GN INGDR
Sbjct  287   HLNPDGMFPNHIPNPEDKTAMALTRAGVLKNKADLGIVFDTDVDRSGVVDSEGNTINGDR  346

Query  1014  LIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDG  835
             LIALMSAIVLKEHP TT+VTDARTSM LT+FI  +GGQHCLYRVGYRNVIDKGV+LN+DG
Sbjct  347   LIALMSAIVLKEHPSTTIVTDARTSMALTKFIRNKGGQHCLYRVGYRNVIDKGVNLNKDG  406

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLET  655
             +ETHLMMETSGHGALKEN+FLDDGAYMVVKIIIEMV+MKLEGSE  IGSLI+DLEEPLE+
Sbjct  407   IETHLMMETSGHGALKENHFLDDGAYMVVKIIIEMVRMKLEGSEGDIGSLIEDLEEPLES  466

Query  654   AELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPA  475
             AE+RM VLSEPR+AKAKAVEAIE+FR +IE+G+LPGWELD+CGDCWVS+GCLVDTND PA
Sbjct  467   AEVRMIVLSEPRNAKAKAVEAIEAFRTHIEQGSLPGWELDACGDCWVSDGCLVDTNDDPA  526

Query  474   AIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDK  310
             AIDAFMYRAKVS+E+NGEHGWVHLRQSIHNPNIAVNLQS IPGGCQSMA+ L D+
Sbjct  527   AIDAFMYRAKVSDEQNGEHGWVHLRQSIHNPNIAVNLQSTIPGGCQSMAKVLIDR  581



>ref|XP_011070724.1| PREDICTED: uncharacterized protein LOC105156326 [Sesamum indicum]
Length=624

 Score =  1003 bits (2592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/631 (78%), Positives = 544/631 (86%), Gaps = 19/631 (3%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFPIHKPL--HRSLGIAQSFPKIKLS-LRVES----SLT  1933
             MAS S T      I +K NFPSF   +P   + +L    SF   KL  +RV S    S T
Sbjct  1     MASQSLT----HHIPTKTNFPSFQKTRPFRSNNNLITFPSFSTAKLHPVRVASYNSTSTT  56

Query  1932  ANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGL  1753
             A  +++V VDEEM++IRRLQNGSDVRGVAL+GEKGRSVDLTPPAVEAIAESFGEWV+SGL
Sbjct  57    AGYNDQVVVDEEMDRIRRLQNGSDVRGVALKGEKGRSVDLTPPAVEAIAESFGEWVVSGL  116

Query  1752  ESER----GGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMS  1585
             E ER    GGA     RVSLG DPRISG  LS AVFAGL +AGC+VFDMGLATTPACFMS
Sbjct  117   EIERERGGGGA---PARVSLGRDPRISGGVLSVAVFAGLARAGCVVFDMGLATTPACFMS  173

Query  1584  TVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVST  1405
             T+LPPF YDASIMMTASHLPYTRNGLKFFTKKGGLTS +VE ICD AARKYANR AK+ST
Sbjct  174   TLLPPFTYDASIMMTASHLPYTRNGLKFFTKKGGLTSPQVEEICDNAARKYANRFAKLST  233

Query  1404  ALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLD  1225
             ALR PP++VDFMSAYA HLRDIIK+RV+HP HYD+PLQGFQIIVNAGNGSGGFFTWDVLD
Sbjct  234   ALRVPPTRVDFMSAYAHHLRDIIKQRVDHPLHYDSPLQGFQIIVNAGNGSGGFFTWDVLD  293

Query  1224  KLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVD  1045
             KLGADTFGSLHLNPDGMFPNHIPNPEDKTAMA+TRAAVL+N ADLG+VFDTDVDRSGVVD
Sbjct  294   KLGADTFGSLHLNPDGMFPNHIPNPEDKTAMALTRAAVLENKADLGIVFDTDVDRSGVVD  353

Query  1044  RSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVI  865
             + GNPINGD+LIALMSAIVLKEHP TT+VTDARTSM LTRFIT RGG HCLYRVGYRNVI
Sbjct  354   KHGNPINGDKLIALMSAIVLKEHPNTTIVTDARTSMALTRFITDRGGHHCLYRVGYRNVI  413

Query  864   DKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSL  685
             DKGV LN+DG+ETHLMMETSGHGALKEN+FLDDGAYMVVKIIIEMV+MKLEGSEEGIGSL
Sbjct  414   DKGVQLNKDGIETHLMMETSGHGALKENHFLDDGAYMVVKIIIEMVRMKLEGSEEGIGSL  473

Query  684   IKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEG  505
             I+DL+EPLE+ ELRM++LSEPR AK K V+AIE FR++IE+G L GWELDSCGDCWVSEG
Sbjct  474   IQDLDEPLESVELRMNILSEPRFAKTKGVQAIEEFRNFIEQGRLEGWELDSCGDCWVSEG  533

Query  504   CLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMAR  325
             CLVD+ND PA +DA MYRA+VS  E+GEHGWVHLRQSIHNPNIAVNLQS +PGGCQSMAR
Sbjct  534   CLVDSNDTPAPVDAHMYRAEVSEAEHGEHGWVHLRQSIHNPNIAVNLQSTVPGGCQSMAR  593

Query  324   DLRDKFLLAGEMAKFLDISQIDEFAR-NGNL  235
              LRDKFL+A  + K LDISQID +A  NG L
Sbjct  594   ALRDKFLVASGLDKILDISQIDNYASGNGKL  624



>ref|XP_008221457.1| PREDICTED: uncharacterized protein LOC103321435 [Prunus mume]
Length=620

 Score =  1002 bits (2591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/618 (78%), Positives = 542/618 (88%), Gaps = 2/618 (0%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNEV  1912
             MASTST+  SLQT A KP FPS    +  H +L    S P     + V+SS TA  +NEV
Sbjct  1     MASTSTSSISLQTNAQKPCFPSKSAPRISHTNLSFPCSLPLSTKFVCVKSSSTAKYYNEV  60

Query  1911  AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGA  1732
              VDEEM++IRRLQNGSDVRGVAL+GEKGR+VDLTPPAVEA+AESFGEWVI GLE ERG  
Sbjct  61    VVDEEMDRIRRLQNGSDVRGVALEGEKGRTVDLTPPAVEAVAESFGEWVIKGLEKERGHP  120

Query  1731  VVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDAS  1552
             V E+V VSLG DPRISG SLS AVF+GL +AGCL FDMGLATTPACFMST+LPPF YDAS
Sbjct  121   V-ENVGVSLGRDPRISGASLSVAVFSGLARAGCLAFDMGLATTPACFMSTILPPFAYDAS  179

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDF  1372
             IMMTASHLPYTRNGLKFFTKKGGL+S +VE ICDKAARKYANR+ KVS  L  P S+VDF
Sbjct  180   IMMTASHLPYTRNGLKFFTKKGGLSSPDVEDICDKAARKYANRLTKVSILLNIPLSRVDF  239

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             MS YAKHLRDIIKERVNHP HY+TPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH
Sbjct  240   MSTYAKHLRDIIKERVNHPLHYETPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  299

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             L PDGMFPNHIPNPEDKTAMA+TRAAVL+N+ADLG+VFDTDVDRSGVVD  GNPINGD+L
Sbjct  300   LKPDGMFPNHIPNPEDKTAMAVTRAAVLENSADLGIVFDTDVDRSGVVDNKGNPINGDKL  359

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGV  832
             IAL+SAIVL+EHPGTT+VTDARTSM LTRFI  RGGQHCLYRVGYRNVIDKGV LN++G+
Sbjct  360   IALISAIVLREHPGTTIVTDARTSMALTRFIANRGGQHCLYRVGYRNVIDKGVQLNKEGI  419

Query  831   ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETA  652
             ETHLMMETSGHGALKEN+FLDDGAYMVVKIIIEMV+MKL GS+EG G++IKDLEEP E+ 
Sbjct  420   ETHLMMETSGHGALKENHFLDDGAYMVVKIIIEMVRMKLAGSDEGFGNIIKDLEEPAESL  479

Query  651   ELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTND-HPA  475
             ELR++V+SEPR+AK KA+EAIE+FR Y+E+G L GWELDSCGDCWVSEGCLVD+ND   A
Sbjct  480   ELRINVVSEPRYAKEKAIEAIETFREYVEEGRLEGWELDSCGDCWVSEGCLVDSNDTSAA  539

Query  474   AIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAG  295
             A+DA MYRAKVS+EE+G+HGWVH+RQSIHNPNIAVN+QS++PG CQ+M R L DKF++A 
Sbjct  540   AVDAHMYRAKVSDEEHGQHGWVHIRQSIHNPNIAVNMQSSVPGCCQTMTRVLLDKFIIAN  599

Query  294   EMAKFLDISQIDEFARNG  241
              M K LDISQI+++A++G
Sbjct  600   GMDKSLDISQIEKYAKSG  617



>ref|XP_009351503.1| PREDICTED: uncharacterized protein LOC103943037 [Pyrus x bretschneideri]
Length=619

 Score =  1001 bits (2588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/619 (78%), Positives = 546/619 (88%), Gaps = 5/619 (1%)
 Frame = -1

Query  2091  MASTSTTPQ-SLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNE  1915
             MASTST+    LQT A K +FPS P  K  H +L    S       +RV+SS TA  +NE
Sbjct  1     MASTSTSSTIYLQTNAQKLSFPSKPATKTSHTNLSFPYSLRFATKFVRVKSSSTA--YNE  58

Query  1914  VAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGG  1735
             V VDEEM++IRRLQNGSDVRGVAL+GEKGR VDLTPPAVEAIAESFGEWVI GLE E+G 
Sbjct  59    VVVDEEMDRIRRLQNGSDVRGVALEGEKGRIVDLTPPAVEAIAESFGEWVIDGLEKEQG-  117

Query  1734  AVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDA  1555
              +VE VRVSLG DPRISG +LS AVF+GLG+AGCLVFDMGLATTPACFMST+LPPF YDA
Sbjct  118   QLVEKVRVSLGKDPRISGPNLSVAVFSGLGRAGCLVFDMGLATTPACFMSTILPPFSYDA  177

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVD  1375
             SIMMTASHLPYTRNGLKFFTKKGGL+S EVE IC++AARKYANR+AKVST L   PS+VD
Sbjct  178   SIMMTASHLPYTRNGLKFFTKKGGLSSPEVEDICNRAARKYANRLAKVSTLLNVAPSRVD  237

Query  1374  FMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  1195
             FMS+YAKHLRDIIKERVNHP HY+TPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL
Sbjct  238   FMSSYAKHLRDIIKERVNHPLHYETPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  297

Query  1194  HLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDR  1015
             +LNPDGMFPNHIPNPEDKTAMA+TRAAVL+N+ADLG+VFDTDVDRSGVVD  GNPINGD+
Sbjct  298   YLNPDGMFPNHIPNPEDKTAMAVTRAAVLENSADLGIVFDTDVDRSGVVDNKGNPINGDK  357

Query  1014  LIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDG  835
             LIAL+SAIVL+EHPGTT+VTDARTSM LTRFIT RGG HCLYRVGYRNVIDKGV LN++G
Sbjct  358   LIALISAIVLREHPGTTIVTDARTSMALTRFITNRGGHHCLYRVGYRNVIDKGVQLNKEG  417

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLET  655
             +ETHLMMETSGHGALKEN+FLDDGAYMVVKIII+MV+MKL GS+EG+G++IKDLEEP E+
Sbjct  418   IETHLMMETSGHGALKENHFLDDGAYMVVKIIIDMVRMKLAGSDEGVGNIIKDLEEPSES  477

Query  654   AELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTND-HP  478
              ELRM+V+SEPR+AK KAVEAIE+FR Y+E+G L GWELDSCGDCWVSEGCLVD+ND   
Sbjct  478   IELRMNVISEPRYAKEKAVEAIETFREYVEEGRLEGWELDSCGDCWVSEGCLVDSNDASA  537

Query  477   AAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLA  298
             AA+DA MYRAKVS+EE+G+HGWVH+RQSIHNPNIAVN+QS  PG C++M R L DKFL+A
Sbjct  538   AAVDARMYRAKVSDEEHGQHGWVHIRQSIHNPNIAVNMQSTAPGCCRTMTRVLLDKFLIA  597

Query  297   GEMAKFLDISQIDEFARNG  241
               M + LD +QID++A++G
Sbjct  598   SGMDRILDTNQIDKYAKSG  616



>ref|XP_007222016.1| hypothetical protein PRUPE_ppa002940mg [Prunus persica]
 gb|EMJ23215.1| hypothetical protein PRUPE_ppa002940mg [Prunus persica]
Length=620

 Score =  1001 bits (2587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/618 (78%), Positives = 543/618 (88%), Gaps = 2/618 (0%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNEV  1912
             MASTST+  SLQT A KP FPS    +  H +L    S P     + V+SS TA  +NEV
Sbjct  1     MASTSTSSISLQTNAQKPCFPSKSAPRISHTNLSFPCSLPLSTKFVCVKSSSTAKYYNEV  60

Query  1911  AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGA  1732
              VDEEM++IRRLQNGSDVRGVAL+GEKGR+VDLTPPAVEAIAESFGEWVI+GLE ERG  
Sbjct  61    VVDEEMDRIRRLQNGSDVRGVALEGEKGRTVDLTPPAVEAIAESFGEWVINGLEKERGHP  120

Query  1731  VVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDAS  1552
             V E+V VSLG DPRISG SLS AVF+GL +AGCLVFDMGLATTPACFMST+ P F YDAS
Sbjct  121   V-ENVGVSLGRDPRISGASLSVAVFSGLARAGCLVFDMGLATTPACFMSTIFPSFAYDAS  179

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDF  1372
             IMMTASHLPYTRNGLKFFTKKGGL+S +VE ICDKAARKYANR+ KVS  L  P S+VDF
Sbjct  180   IMMTASHLPYTRNGLKFFTKKGGLSSPDVEDICDKAARKYANRLTKVSILLNIPLSRVDF  239

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             MS YAKHLRDIIKERVNHP HY+TPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH
Sbjct  240   MSTYAKHLRDIIKERVNHPLHYETPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  299

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             L PDGMFPNHIPNPEDKTAMA+TRAAVL+N+ADLG+VFDTDVDRSGVVD  GNPINGD+L
Sbjct  300   LKPDGMFPNHIPNPEDKTAMAVTRAAVLENSADLGIVFDTDVDRSGVVDNKGNPINGDKL  359

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGV  832
             IAL+SAIVL+EHPGTT+VTDARTSM LTRFIT RGG HCLYRVGYRNVIDKGV LN++G+
Sbjct  360   IALISAIVLREHPGTTIVTDARTSMALTRFITNRGGNHCLYRVGYRNVIDKGVQLNKEGI  419

Query  831   ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETA  652
             ETHLMMETSGHGALKEN+FLDDGAYMVVKIIIEMV+MKL GS+EG+G++IKDLEEP E+ 
Sbjct  420   ETHLMMETSGHGALKENHFLDDGAYMVVKIIIEMVRMKLAGSDEGVGNIIKDLEEPAESI  479

Query  651   ELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTND-HPA  475
             ELR++V+SEPR+AK KA+EAIE+FR Y+E+G L GWELDSCGDCWVSEGCLVD+ND   A
Sbjct  480   ELRINVVSEPRYAKEKAIEAIETFREYVEEGRLEGWELDSCGDCWVSEGCLVDSNDTSAA  539

Query  474   AIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAG  295
             A+DA MYRAKVS+EE+G+HGWVH+RQSIHNPNIAVN+QS++PG CQ+M R L DKF++A 
Sbjct  540   AVDAHMYRAKVSDEEHGQHGWVHIRQSIHNPNIAVNMQSSVPGCCQTMTRVLLDKFIIAN  599

Query  294   EMAKFLDISQIDEFARNG  241
              M K LDISQI+++A++G
Sbjct  600   GMDKSLDISQIEKYAKSG  617



>ref|XP_010044201.1| PREDICTED: uncharacterized protein LOC104433216 [Eucalyptus grandis]
 gb|KCW86243.1| hypothetical protein EUGRSUZ_B02929 [Eucalyptus grandis]
Length=614

 Score =  1000 bits (2586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/615 (79%), Positives = 542/615 (88%), Gaps = 6/615 (1%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPN--FPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHN  1918
             MAS S +  +LQ ++++ +   PSFP  KPL  +L +    P I+ S  V S L   K++
Sbjct  1     MASASPSSMTLQNMSAQKSTIIPSFPT-KPLATNLRVIFMCPSIR-STGVRS-LRVAKYD  57

Query  1917  EVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERG  1738
             EV VD+E++KIRRLQNGSDVRGVAL+GE+GR+VDLTPPAV+AIAESFGEWVI GLESE+G
Sbjct  58    EVVVDDEIDKIRRLQNGSDVRGVALEGEQGRTVDLTPPAVDAIAESFGEWVIKGLESEKG  117

Query  1737  GAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYD  1558
               V E +RVSLG DPRISG +LS AVFAGL +AGC+VFDMGLATTPACFMSTVL  F YD
Sbjct  118   RPV-EDIRVSLGRDPRISGAALSVAVFAGLSRAGCMVFDMGLATTPACFMSTVLDHFSYD  176

Query  1557  ASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKV  1378
             ASIMMTASHLPYTRNGLKFFTKKGGLTS EVE ICD+AARKYANR+AKVST L  PP++V
Sbjct  177   ASIMMTASHLPYTRNGLKFFTKKGGLTSPEVEEICDRAARKYANRLAKVSTMLATPPTQV  236

Query  1377  DFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGS  1198
             DFMSAYA HLR+IIKERVNHPTHYDTPL+GFQIIVNAGNGSGGFFTW+VLDKLGADTFGS
Sbjct  237   DFMSAYAAHLRNIIKERVNHPTHYDTPLEGFQIIVNAGNGSGGFFTWNVLDKLGADTFGS  296

Query  1197  LHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGD  1018
             LHLNPDGMFPNHIPNPEDKTAMA+TRAAVL N+ADLG+VFDTDVDRSGVVD  GNPINGD
Sbjct  297   LHLNPDGMFPNHIPNPEDKTAMALTRAAVLDNSADLGIVFDTDVDRSGVVDAKGNPINGD  356

Query  1017  RLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNED  838
             +LIALMSAIVL+EHPGTTVVTDARTS+ LTRFI  RGG HCLYRVGYRNVIDKGV LN+D
Sbjct  357   KLIALMSAIVLREHPGTTVVTDARTSVALTRFIKERGGHHCLYRVGYRNVIDKGVQLNQD  416

Query  837   GVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLE  658
             G+ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMV+MKL G  +GIGSLI+DLEEPLE
Sbjct  417   GIETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVRMKLAGFNDGIGSLIEDLEEPLE  476

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
             + E+RM+V++EPRHAK KAVEAIE+FR Y+E+G L GWELDSCGDCWVSEGCLVD+N+ P
Sbjct  477   STEIRMNVIAEPRHAKVKAVEAIEAFRQYVEEGKLQGWELDSCGDCWVSEGCLVDSNEMP  536

Query  477   AAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLA  298
             AAIDA MYRAKVS+EENG++GWVHLRQSIHNPNIAVN+QS +PGGC+SM   LRDKFLLA
Sbjct  537   AAIDARMYRAKVSDEENGQYGWVHLRQSIHNPNIAVNMQSTVPGGCRSMTAVLRDKFLLA  596

Query  297   GEMAKFLDISQIDEF  253
               M K LDISQID +
Sbjct  597   SGMNKTLDISQIDNY  611



>ref|XP_009349513.1| PREDICTED: uncharacterized protein LOC103941057 [Pyrus x bretschneideri]
Length=619

 Score =   998 bits (2581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/619 (78%), Positives = 546/619 (88%), Gaps = 5/619 (1%)
 Frame = -1

Query  2091  MASTSTTPQ-SLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNE  1915
             MASTST+    LQT A K +FPS P  K  H +L    S       +RV+SS TA  +NE
Sbjct  1     MASTSTSSTIYLQTNAQKLSFPSKPATKTSHTNLSFPYSLRFATKFVRVKSSSTA--YNE  58

Query  1914  VAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGG  1735
             V VDEEM++IRRLQNGSDVRGVAL+GEKGR VDLTPPAVEAIAESFGEWVI GLE E+G 
Sbjct  59    VVVDEEMDRIRRLQNGSDVRGVALEGEKGRIVDLTPPAVEAIAESFGEWVIDGLEKEQG-  117

Query  1734  AVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDA  1555
              +VE VRVSLG DPRISG +LS AVF+GLG+AGCLVFDMGLATTPACFMST+LPPF YDA
Sbjct  118   QLVEKVRVSLGKDPRISGPNLSVAVFSGLGRAGCLVFDMGLATTPACFMSTILPPFSYDA  177

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVD  1375
             SIMMTASHLPYTRNGLKFFTKKGGL+S EVE IC++AARKYANR+AKVST L   PS+VD
Sbjct  178   SIMMTASHLPYTRNGLKFFTKKGGLSSPEVEDICNRAARKYANRLAKVSTLLNVAPSRVD  237

Query  1374  FMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  1195
             FMS+YAKHLRDIIKERVNHP HY+TPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL
Sbjct  238   FMSSYAKHLRDIIKERVNHPLHYETPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  297

Query  1194  HLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDR  1015
             +LNPDGMFPNHIPNPEDKTAMA+TRAAVL+N+ADLG+VFDTDVDRSG+VD  GNPINGD+
Sbjct  298   YLNPDGMFPNHIPNPEDKTAMAVTRAAVLENSADLGIVFDTDVDRSGIVDNKGNPINGDK  357

Query  1014  LIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDG  835
             LIAL+SAIVL+EHPGTT+VTDARTSM LTRFIT RGG HCLYRVGYRNVIDKGV LN++G
Sbjct  358   LIALISAIVLREHPGTTIVTDARTSMALTRFITNRGGHHCLYRVGYRNVIDKGVQLNKEG  417

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLET  655
             +ETHLMMETSGHGALKEN+FLDDGAYMVVKIII+MV+MKL GS+EG+G++IKDLEEP E+
Sbjct  418   IETHLMMETSGHGALKENHFLDDGAYMVVKIIIDMVRMKLAGSDEGVGNIIKDLEEPSES  477

Query  654   AELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTND-HP  478
              ELRM+V+SEPR+AK KAVEAIE+FR Y+E+G L GWELDSCGDCWVSEGCLVD+ND   
Sbjct  478   IELRMNVISEPRYAKEKAVEAIETFREYVEEGRLEGWELDSCGDCWVSEGCLVDSNDASA  537

Query  477   AAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLA  298
             AA+DA MYRAKVS+EE+G+HGWVH+RQSIHNPNIAVN+QS  PG C++M R L DKFL+A
Sbjct  538   AAVDARMYRAKVSDEEHGQHGWVHIRQSIHNPNIAVNMQSTAPGCCRTMTRVLLDKFLIA  597

Query  297   GEMAKFLDISQIDEFARNG  241
               M + L+ +QID++A++G
Sbjct  598   SGMDRILETNQIDKYAKSG  616



>ref|XP_004239330.1| PREDICTED: uncharacterized protein LOC101267404 [Solanum lycopersicum]
Length=614

 Score =   998 bits (2580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/621 (79%), Positives = 545/621 (88%), Gaps = 12/621 (2%)
 Frame = -1

Query  2079  STTPQSLQTI-ASKPNFPSFPI-HKP-LHRSLGIAQSFPKIKLSLRVESSLTANKHNEVA  1909
             ++T  SLQTI +S  NFP  PI  KP LH SL    S   +++     SS +A  +NE  
Sbjct  2     ASTLSSLQTINSSITNFPCVPIIKKPKLHISL-TKTSISSVRVVCCSSSSSSATTYNE--  58

Query  1908  VDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAV  1729
              DEEM+KIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVI  L ++     
Sbjct  59    -DEEMDKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVIKRLNNKE----  113

Query  1728  VESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASI  1549
              + V VSLG DPRISG +LS AVF+GL +AGC+VFDMGLATTPACFMST+LPP QYDASI
Sbjct  114   -KVVMVSLGKDPRISGNTLSVAVFSGLSRAGCMVFDMGLATTPACFMSTILPPCQYDASI  172

Query  1548  MMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFM  1369
             MMTASHLPYTRNGLKFFTKKGGLTS EVE IC  AARKYANR AKVST L   P+KVDFM
Sbjct  173   MMTASHLPYTRNGLKFFTKKGGLTSVEVEEICSDAARKYANRFAKVSTTLSTRPTKVDFM  232

Query  1368  SAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHL  1189
             S YAKHLRDIIKERVNHP HY+TPL+GFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHL
Sbjct  233   SNYAKHLRDIIKERVNHPNHYETPLKGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHL  292

Query  1188  NPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLI  1009
             NPDGMFPNHIPNPEDK AM++TRAAVL+N ADLG+VFDTDVDRSGVVD  GNPINGDRLI
Sbjct  293   NPDGMFPNHIPNPEDKIAMSLTRAAVLENNADLGIVFDTDVDRSGVVDSEGNPINGDRLI  352

Query  1008  ALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             ALMSAIVLKEHPGTT+VTDARTSM LT+FIT + GQHCLYRVGYRNVIDKGV+LN+DGVE
Sbjct  353   ALMSAIVLKEHPGTTIVTDARTSMALTKFITNKRGQHCLYRVGYRNVIDKGVNLNKDGVE  412

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAE  649
             THLMMETSGHGALKEN+FLDDGAYMVVKIIIEMV+MKLEGS+EGIGSLIKDLEEPLE+AE
Sbjct  413   THLMMETSGHGALKENHFLDDGAYMVVKIIIEMVRMKLEGSKEGIGSLIKDLEEPLESAE  472

Query  648   LRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAI  469
             LRM VLSEPR+AKAKA EAIE+FR YIE+G+LPGW+LD+CGDCWVS+GCLVDTND P AI
Sbjct  473   LRMVVLSEPRYAKAKAFEAIEAFRTYIEQGSLPGWDLDACGDCWVSDGCLVDTNDDPTAI  532

Query  468   DAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEM  289
             DA+MYRAKVS++ENGEHGW+HLRQSIHNPNIAVN+QS +PGGCQ+MA+ LRD+FLL   M
Sbjct  533   DAYMYRAKVSSQENGEHGWIHLRQSIHNPNIAVNMQSTVPGGCQNMAKVLRDRFLLPSGM  592

Query  288   AKFLDISQIDEFARNGNLN*D  226
              K LD++QID++A++G+L+ D
Sbjct  593   DKILDVTQIDKYAKSGDLSQD  613



>ref|XP_010095721.1| hypothetical protein L484_002693 [Morus notabilis]
 gb|EXB62021.1| hypothetical protein L484_002693 [Morus notabilis]
Length=622

 Score =   996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/624 (76%), Positives = 543/624 (87%), Gaps = 12/624 (2%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPS---FPIHKPLHRSLGIAQSFPKIKLS----LRVESSLT  1933
             MA + ++PQ+ Q+I   P+F S     I   L +S  I   F    LS    + ++SS  
Sbjct  1     MACSISSPQNNQSIYLNPSFLSNRRTSIKPILFKSTNINFPFSSPPLSKPVIISLKSSSI  60

Query  1932  ANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGL  1753
             A   + V VDEEM+KIRRLQNGSDVRGVAL+GEK R+VDLTPPAVEAIAESFGEWVI GL
Sbjct  61    AKYDDVVVVDEEMDKIRRLQNGSDVRGVALEGEKNRTVDLTPPAVEAIAESFGEWVIEGL  120

Query  1752  ESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLP  1573
             E+      VE+VRVSLG DPRISG SLS AVF+GL +AGC+VFDMGLATTPACFMSTVLP
Sbjct  121   ETP-----VENVRVSLGKDPRISGPSLSVAVFSGLSRAGCVVFDMGLATTPACFMSTVLP  175

Query  1572  PFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRA  1393
             PF +DASIMMTASHLPYTRNGLKFFTKKGGLTS +VE IC KAARKYANR+ KVST L  
Sbjct  176   PFAFDASIMMTASHLPYTRNGLKFFTKKGGLTSPDVEEICGKAARKYANRLTKVSTLLNV  235

Query  1392  PPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGA  1213
             PP++VDFMSAYA+HLR+IIK RVNHP HYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGA
Sbjct  236   PPTRVDFMSAYAQHLREIIKARVNHPIHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGA  295

Query  1212  DTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGN  1033
             DTFGSLHLNPDGMFPNHIPNPEDKTAMA+TRAAVL+N+ADLG+VFDTDVDRSGVVD  GN
Sbjct  296   DTFGSLHLNPDGMFPNHIPNPEDKTAMALTRAAVLENSADLGIVFDTDVDRSGVVDNKGN  355

Query  1032  PINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGV  853
             PINGD+LIALMSAIVL+EHPGTT+VTDARTSM LTRF+T +GG+HCLYRVGYRNVIDKGV
Sbjct  356   PINGDKLIALMSAIVLREHPGTTIVTDARTSMALTRFVTSKGGRHCLYRVGYRNVIDKGV  415

Query  852   HLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDL  673
              LN+DGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMV+MKLEGS+EG+GSLIKDL
Sbjct  416   QLNKDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVRMKLEGSDEGVGSLIKDL  475

Query  672   EEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVD  493
             EEPLE+ ELRM+++SEP++AKA+ +EAIE+FR Y+E+G L GWELD+CGDCWVSEGCLVD
Sbjct  476   EEPLESVELRMNIISEPKYAKARGIEAIETFRDYVEEGKLEGWELDACGDCWVSEGCLVD  535

Query  492   TNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRD  313
              ND PAAIDA MYRAKVS++E+G+ GW+HLRQSIHNPNIAVN+QS++PGGCQ+M R L D
Sbjct  536   LNDTPAAIDAHMYRAKVSDKEHGQFGWIHLRQSIHNPNIAVNMQSSVPGGCQTMTRVLID  595

Query  312   KFLLAGEMAKFLDISQIDEFARNG  241
             KFLLAGE+   LDISQI+ + ++G
Sbjct  596   KFLLAGELDSILDISQIENYVKSG  619



>ref|XP_006448230.1| hypothetical protein CICLE_v10014623mg [Citrus clementina]
 ref|XP_006469192.1| PREDICTED: uncharacterized protein LOC102613324 [Citrus sinensis]
 gb|ESR61470.1| hypothetical protein CICLE_v10014623mg [Citrus clementina]
Length=618

 Score =   993 bits (2568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/622 (78%), Positives = 545/622 (88%), Gaps = 11/622 (2%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFP---IHKPLHRSLGIAQSFPKIKLSLR---VESSLTA  1930
             MAST+T   SLQ+ +S+ +F S P     KP   +       P +  S++   V+SS+T 
Sbjct  1     MASTTTPSISLQSNSSRTSFLSSPGPKCPKPFQIT---GLKLPFLSHSIKFTHVKSSVT-  56

Query  1929  NKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLE  1750
             +K+NEV VDEEM++IRRLQNGSDVRGVAL+GEKGR+VDLTP AVEAIAESFGEWVI  LE
Sbjct  57    DKYNEVVVDEEMDRIRRLQNGSDVRGVALEGEKGRTVDLTPSAVEAIAESFGEWVIRSLE  116

Query  1749  SERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPP  1570
             +ERG  V E V+VSLG DPR+SG SLS AVFAGL +AGCLVFDMGLATTPACFMST+LPP
Sbjct  117   NERGRPV-EDVKVSLGKDPRVSGPSLSVAVFAGLARAGCLVFDMGLATTPACFMSTLLPP  175

Query  1569  FQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAP  1390
             F YDASIMMTASHLPYTRNGLKFFTKKGGLTS  VE IC +AARK+ANR+ KVST  R P
Sbjct  176   FAYDASIMMTASHLPYTRNGLKFFTKKGGLTSPVVEEICGEAARKFANRLTKVSTVPRNP  235

Query  1389  PSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGAD  1210
             P++VDFMSAYAKHLRDIIKERVNHP HY+TP++GFQIIVNAGNGSGGFFTWDVLDKLGAD
Sbjct  236   PTRVDFMSAYAKHLRDIIKERVNHPLHYETPIKGFQIIVNAGNGSGGFFTWDVLDKLGAD  295

Query  1209  TFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNP  1030
             TFGSLHLNPDGMFPNHIPNP DKTAMA+TRAAVL+N ADLGVVFDTDVDRSGVVD  GNP
Sbjct  296   TFGSLHLNPDGMFPNHIPNPGDKTAMALTRAAVLENNADLGVVFDTDVDRSGVVDNKGNP  355

Query  1029  INGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVH  850
             INGD+LIALMSAIVLKEHPGTT+VTDARTSM LT+FIT RGG HCLYRVGYRNVIDKGVH
Sbjct  356   INGDKLIALMSAIVLKEHPGTTIVTDARTSMPLTKFITDRGGNHCLYRVGYRNVIDKGVH  415

Query  849   LNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLE  670
             LNEDG+ETHLMMETSGHGALKENYFLDDGAY+VVKIII+MV+MKLEGS+EGIGSLIKDLE
Sbjct  416   LNEDGIETHLMMETSGHGALKENYFLDDGAYLVVKIIIQMVRMKLEGSDEGIGSLIKDLE  475

Query  669   EPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDT  490
             EPLE+ ELRM+++SEPR+AKAK  EAIE FR YIE G L GWELDSCGDCWVSEGCLVD+
Sbjct  476   EPLESIELRMNIISEPRYAKAKGSEAIEEFRKYIEGGRLQGWELDSCGDCWVSEGCLVDS  535

Query  489   NDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDK  310
             ++ PAAIDA MYRAKV++EE G++GW+HLRQSIHNPNIAVN+QS +PGGC+S+ + LRDK
Sbjct  536   DESPAAIDARMYRAKVTDEERGQYGWIHLRQSIHNPNIAVNVQSMVPGGCRSITKSLRDK  595

Query  309   FLLAGEMAKFLDISQIDEFARN  244
             FLLA  M K LDISQI+++A +
Sbjct  596   FLLASGMDKVLDISQIEKYAES  617



>ref|XP_007157756.1| hypothetical protein PHAVU_002G096000g [Phaseolus vulgaris]
 gb|ESW29750.1| hypothetical protein PHAVU_002G096000g [Phaseolus vulgaris]
Length=619

 Score =   993 bits (2566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/620 (78%), Positives = 538/620 (87%), Gaps = 6/620 (1%)
 Frame = -1

Query  2085  STSTTPQ---SLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNE  1915
             + ST+P    SL     K  FPS    K LH  +G + S P  K S+ V+S  TA K++E
Sbjct  2     AASTSPNFSTSLDKNTHKTKFPSSAGKKILHNKVGFSFSVPFNK-SVGVKSFGTA-KYDE  59

Query  1914  VAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGG  1735
             V VD+E+EKIRRLQNGSDVRGVAL+GEKGR VDLTPPAVEAI+ESFGEWVI+GLE+ERG 
Sbjct  60    VVVDDELEKIRRLQNGSDVRGVALEGEKGRKVDLTPPAVEAISESFGEWVINGLEAERGY  119

Query  1734  AVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDA  1555
              + E+VRVSLG DPRI+G  LS AVFAGL +AGC+VFDMGLATTPACFMST+L PF YDA
Sbjct  120   PL-ENVRVSLGRDPRITGSKLSVAVFAGLSRAGCMVFDMGLATTPACFMSTILSPFAYDA  178

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVD  1375
             SIMMTASHLPYTRNGLKFFTK+GGLTSTEVE ICDKAARKYANRM KVST L   P+KVD
Sbjct  179   SIMMTASHLPYTRNGLKFFTKRGGLTSTEVEEICDKAARKYANRMTKVSTLLSVLPTKVD  238

Query  1374  FMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  1195
             FMS YA HLR+II ER+NHP +YDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL
Sbjct  239   FMSTYAMHLREIITERINHPLYYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  298

Query  1194  HLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDR  1015
             HL PDGMFPNHIPNPEDKTAMA+TRAAVL+N+ADLGVVFDTDVDRSGVVD  GNPINGD+
Sbjct  299   HLTPDGMFPNHIPNPEDKTAMALTRAAVLENSADLGVVFDTDVDRSGVVDNKGNPINGDK  358

Query  1014  LIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDG  835
             LIALMSAIVL+EHPG+T+VTDARTSM LTRFIT RGG HCLYRVGYRNVIDKGV L+  G
Sbjct  359   LIALMSAIVLREHPGSTIVTDARTSMALTRFITDRGGNHCLYRVGYRNVIDKGVQLDSGG  418

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLET  655
             VETHLMMETSGHGALKEN+FLDDGAYMVVKIIIEMV+MKL GS EGIGSLIKDLEEP E+
Sbjct  419   VETHLMMETSGHGALKENHFLDDGAYMVVKIIIEMVRMKLAGSNEGIGSLIKDLEEPYES  478

Query  654   AELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPA  475
              ELR++++SEPRHAKAK  EAI++FR+YIE+G L GWELDSCGDCWVSEGCLVDTND PA
Sbjct  479   VELRINIVSEPRHAKAKGSEAIQTFRNYIEEGRLRGWELDSCGDCWVSEGCLVDTNDDPA  538

Query  474   AIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAG  295
              IDA MYRAKVSN+ +G+HGWVH+RQSIHNPNIAVNLQS++PGGC SMAR  RD+FL A 
Sbjct  539   PIDAQMYRAKVSNDRHGQHGWVHMRQSIHNPNIAVNLQSSVPGGCLSMARAFRDEFLKAS  598

Query  294   EMAKFLDISQIDEFARNGNL  235
              +  FLDI+Q+D+FA  G++
Sbjct  599   GVHTFLDITQVDKFAEKGSM  618



>ref|XP_004505287.1| PREDICTED: phosphomannomutase/phosphoglucomutase-like [Cicer 
arietinum]
Length=620

 Score =   973 bits (2515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/623 (76%), Positives = 537/623 (86%), Gaps = 8/623 (1%)
 Frame = -1

Query  2091  MASTSTTPQ---SLQTIASKPNFPSF-PIHKPLHRSLGIAQSFPKIKLSLRVESSLTANK  1924
             MA+++++P    SL+    K N+PS    +  LH  LG + S P  K SL V+S   A K
Sbjct  1     MAASTSSPNISTSLRRKTRKTNYPSLLGKNISLHTKLGFSSSVPFNK-SLNVKS-YGAAK  58

Query  1923  HNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESE  1744
             ++EV VDEE++KIRRLQNGSDVRGVAL+GEKGR+VDLTPPAVEAI+ESFGEWVI+GLE E
Sbjct  59    YDEV-VDEELDKIRRLQNGSDVRGVALEGEKGRTVDLTPPAVEAISESFGEWVINGLEKE  117

Query  1743  RGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQ  1564
             +G  V E+V VSLG DPRIS   LS AVFAGL +AGC+ FD+GLATTPACFMST+LPPF 
Sbjct  118   KGYPV-ENVSVSLGRDPRISASKLSVAVFAGLARAGCMTFDVGLATTPACFMSTLLPPFV  176

Query  1563  YDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPS  1384
             YDASIMMTASHLPYTRNGLKFFTK+GGLTS EVE +CDKAARKYANRMAKVST L   P+
Sbjct  177   YDASIMMTASHLPYTRNGLKFFTKRGGLTSLEVEEVCDKAARKYANRMAKVSTLLNVLPT  236

Query  1383  KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  1204
             KVDFMSAY+KHLR+IIKER+ HP HY+TPL+GFQIIVNAGNGSGGFFTW+VLDKLGADTF
Sbjct  237   KVDFMSAYSKHLREIIKERIGHPLHYETPLKGFQIIVNAGNGSGGFFTWNVLDKLGADTF  296

Query  1203  GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPIN  1024
             GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVL+N+ADLG+VFDTDVDRSGVVD  GN IN
Sbjct  297   GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLENSADLGIVFDTDVDRSGVVDNKGNSIN  356

Query  1023  GDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLN  844
             GD+LIALMSAIVLKE+PG+T+VTDARTSM LT+FIT RGG HCLYR GYRNVIDKGV LN
Sbjct  357   GDKLIALMSAIVLKENPGSTIVTDARTSMSLTKFITDRGGHHCLYRAGYRNVIDKGVQLN  416

Query  843   EDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEP  664
              DG+ETHLMMETSGHGALKEN+FLDDGAY VVKIIIEMV+MKL GS+EGIGSLIKDLEEP
Sbjct  417   MDGIETHLMMETSGHGALKENHFLDDGAYTVVKIIIEMVRMKLGGSDEGIGSLIKDLEEP  476

Query  663   LETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTND  484
              E+ ELR++++SEPR+AKAK  EAIE+FR+YIE+G L GWELDSCGDCWVSEGCLVDTND
Sbjct  477   YESIELRINIISEPRNAKAKGSEAIETFRNYIEEGRLKGWELDSCGDCWVSEGCLVDTND  536

Query  483   HPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFL  304
              P  IDA MYR KVSN E+G+HGW+H+RQSIHNPNIAVNLQS++ GGC SMAR  RD FL
Sbjct  537   TPTHIDAQMYRVKVSNNEHGQHGWIHMRQSIHNPNIAVNLQSSVHGGCLSMARAFRDDFL  596

Query  303   LAGEMAKFLDISQIDEFARNGNL  235
              A  +  FLDI+QID+F  NG L
Sbjct  597   KASGVDTFLDIAQIDKFVENGPL  619



>ref|XP_003607905.1| Phosphoglucosamine mutase [Medicago truncatula]
 gb|AES90102.1| phosphoglucomutase/phosphomannomutase family protein [Medicago 
truncatula]
Length=621

 Score =   969 bits (2506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/591 (78%), Positives = 522/591 (88%), Gaps = 2/591 (0%)
 Frame = -1

Query  2007  LHRSLGIAQSFPKIKLSLRVESSLTANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKG  1828
             L   LG A S P  K  + V+   TA K++EV VDEE++KIRRLQNGSDVRGVAL+GEKG
Sbjct  32    LQTKLGFASSVPFNKSVISVKCYGTA-KYDEVVVDEELDKIRRLQNGSDVRGVALEGEKG  90

Query  1827  RSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGL  1648
             R+VDLTPPAVEAI+ESFGEWVI+GLE E+G  V E+V VSLG DPR++G  LS AVFAGL
Sbjct  91    RTVDLTPPAVEAISESFGEWVINGLEKEKGYPV-ENVSVSLGRDPRVTGSKLSVAVFAGL  149

Query  1647  GQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTE  1468
              +AGC+VFDMGLATTPACFMST+LPPF YDASIMMTASHLPYTRNGLKFFTK+GGLTS E
Sbjct  150   ARAGCMVFDMGLATTPACFMSTLLPPFVYDASIMMTASHLPYTRNGLKFFTKRGGLTSLE  209

Query  1467  VEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQG  1288
             VE +CDKAARKYANR+A+VST L+  P+KVDFMSAY+KHLR+IIKER++HP HY+TPL+G
Sbjct  210   VEEVCDKAARKYANRLARVSTLLKVLPTKVDFMSAYSKHLREIIKERISHPLHYETPLKG  269

Query  1287  FQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVL  1108
             FQIIVNAGNGSGGFFT+DVLDKLGADTFGSLHL PDGMFPNHIPNPEDK AMAMTR AVL
Sbjct  270   FQIIVNAGNGSGGFFTYDVLDKLGADTFGSLHLKPDGMFPNHIPNPEDKIAMAMTREAVL  329

Query  1107  QNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLT  928
             +N+ADLG+VFDTDVDRSGVVD  GNPINGD+LIALMSAIVLKE+P +T+VTDARTSM LT
Sbjct  330   ENSADLGIVFDTDVDRSGVVDNKGNPINGDKLIALMSAIVLKENPESTIVTDARTSMSLT  389

Query  927   RFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVV  748
             +FIT RGG HCLYRVGYRNVIDKGV LN+DG+ETHLMMETSGHGALKEN+FLDDGAYMVV
Sbjct  390   KFITDRGGHHCLYRVGYRNVIDKGVQLNKDGIETHLMMETSGHGALKENHFLDDGAYMVV  449

Query  747   KIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYI  568
             KIIIEMV+MKL GS+EGIGSLIKDLEEP E+ ELR++++SEPR+AKAK  EA+E+FR+YI
Sbjct  450   KIIIEMVRMKLGGSDEGIGSLIKDLEEPYESVELRINIISEPRNAKAKGSEALETFRNYI  509

Query  567   EKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIH  388
             E+G L GWELDSCGDCWVSEGCLVDTND P  IDA MYRAKVSN E+G+HGWVH+RQSIH
Sbjct  510   EEGRLKGWELDSCGDCWVSEGCLVDTNDTPTHIDAQMYRAKVSNNEHGQHGWVHMRQSIH  569

Query  387   NPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQIDEFARNGNL  235
             NPNIAVNLQS+  GGC SMAR  RD FL A  +  FLDI+QID+F  NG L
Sbjct  570   NPNIAVNLQSSAQGGCLSMARAFRDDFLKASGVDAFLDITQIDKFVENGPL  620



>gb|KFK41509.1| hypothetical protein AALP_AA2G138900 [Arabis alpina]
Length=614

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/619 (75%), Positives = 523/619 (84%), Gaps = 15/619 (2%)
 Frame = -1

Query  2091  MASTSTTP--QSLQTIASKPNFPSFPIHKPLHRS-LGIAQSFPKIKLSLRVESSLTANKH  1921
             MASTST+    S   I+    F S P      RS L   Q+ P +K  LR    L A K 
Sbjct  1     MASTSTSSLMASKTVISETALFFSSP--GLFKRSFLSFTQASPSVK-PLRTRF-LNATKF  56

Query  1920  NEV--AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES  1747
              +V  ++DE+M++IRRLQNGSDVRGVAL+GEKGR+VDLTP AVEAIAESFGEWV   +  
Sbjct  57    EQVTNSLDEDMDQIRRLQNGSDVRGVALEGEKGRTVDLTPAAVEAIAESFGEWV--AVTE  114

Query  1746  ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF  1567
               G  V+   RVSLG DPR+SG  LS AVFAGL +AGCL FDMGLATTPACFMST+LPPF
Sbjct  115   SNGNGVI---RVSLGRDPRVSGGKLSTAVFAGLARAGCLAFDMGLATTPACFMSTLLPPF  171

Query  1566  QYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPP  1387
             +YDASIMMTASHLPYTRNGLKFFTK+GGLTS EVE ICD AARKYANR +KVST +R  P
Sbjct  172   EYDASIMMTASHLPYTRNGLKFFTKRGGLTSPEVEKICDLAARKYANRQSKVSTLIRTQP  231

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VDFMSAY+KHLR+IIK R+NHP HYDTPL+GFQIIVNAGNGSGGFFTWDVLDKLGADT
Sbjct  232   KQVDFMSAYSKHLREIIKARINHPEHYDTPLKGFQIIVNAGNGSGGFFTWDVLDKLGADT  291

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
             FGSL+LNPDGMFPNHIPNPEDKTAM+ TRAAVL+N+ADLGVVFDTDVDRSGVVD  GNPI
Sbjct  292   FGSLYLNPDGMFPNHIPNPEDKTAMSHTRAAVLENSADLGVVFDTDVDRSGVVDNRGNPI  351

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHL  847
             NGD+LIALMSAIVLKEHPG+T+VTDARTSMGLTRFIT RGG+HCLYRVGYRNVIDKGV L
Sbjct  352   NGDKLIALMSAIVLKEHPGSTIVTDARTSMGLTRFITERGGRHCLYRVGYRNVIDKGVEL  411

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEE  667
             N DG+E HLMMETSGHGA+KEN+FLDDGAYMVVKIIIEMV+M+L GS+EGIGSLI+DLEE
Sbjct  412   NRDGIEAHLMMETSGHGAVKENHFLDDGAYMVVKIIIEMVRMRLAGSKEGIGSLIEDLEE  471

Query  666   PLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTN  487
             PLE  ELRM+++S PR AKAK +EAIE+FR YIE+G L GWELDSCG+CWVSEGCLVD+N
Sbjct  472   PLEAVELRMNIVSAPRDAKAKGIEAIETFRQYIEEGKLKGWELDSCGECWVSEGCLVDSN  531

Query  486   DHPAAIDAFMYRAKVSNEENG-EHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDK  310
             DHP+AIDA MYRAKV +EE+G E+GWVH+RQSIHNPNIA+N+QS IPGGC SM R  RDK
Sbjct  532   DHPSAIDAHMYRAKVRDEESGEEYGWVHMRQSIHNPNIALNMQSMIPGGCLSMTRIFRDK  591

Query  309   FLLAGEMAKFLDISQIDEF  253
             FL A  MA+FLDIS  D +
Sbjct  592   FLEASGMARFLDISDFDRY  610



>ref|XP_006301021.1| hypothetical protein CARUB_v10021412mg [Capsella rubella]
 gb|EOA33919.1| hypothetical protein CARUB_v10021412mg [Capsella rubella]
Length=615

 Score =   945 bits (2442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/619 (75%), Positives = 530/619 (86%), Gaps = 15/619 (2%)
 Frame = -1

Query  2091  MASTSTTP--QSLQTIASKPNFPSFPIHKPLHRS-LGIAQSFPKIKLSLRVESSLTANKH  1921
             MASTST+    S   I+    F S P    ++RS L    + P +K  LR  SS  A K 
Sbjct  1     MASTSTSSLMASRTVISRTALFFSSP--GIVNRSFLSFTPASPSVK-PLRTRSS-NATKL  56

Query  1920  NEV--AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES  1747
             +EV  ++DE+M++IRRLQNGSDVRGVAL+GEKGR+VDLTP AVEAIAESFGEWV +   +
Sbjct  57    DEVTSSLDEDMDQIRRLQNGSDVRGVALEGEKGRTVDLTPAAVEAIAESFGEWVAA---N  113

Query  1746  ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF  1567
             E  G  V  ++VSLG DPR+SG  LS A+FAGLG+AGCL FDMGLATTPACFMST+L PF
Sbjct  114   EGNGNGV--IKVSLGRDPRVSGGKLSTAIFAGLGRAGCLAFDMGLATTPACFMSTLLSPF  171

Query  1566  QYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPP  1387
             +YDASIMMTASHLPYTRNGLKFFTK+GGLTS EVE ICD AARKYA R  KVST +R  P
Sbjct  172   EYDASIMMTASHLPYTRNGLKFFTKRGGLTSPEVEKICDLAARKYATRQTKVSTLIRTRP  231

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VDFMSAY+KHLR+IIKER+NHP HYDTPL+GFQI+VNAGNGSGGFFTWDVLDKLGADT
Sbjct  232   KQVDFMSAYSKHLREIIKERINHPEHYDTPLKGFQIVVNAGNGSGGFFTWDVLDKLGADT  291

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
             FGSL+LNPDGMFPNHIPNPE+K AM+ TRAAVL+N+ADLGVVFDTDVDRSGVVD  GNPI
Sbjct  292   FGSLYLNPDGMFPNHIPNPENKVAMSHTRAAVLENSADLGVVFDTDVDRSGVVDNKGNPI  351

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHL  847
             NGD+LIALMS+IVLKEHPG+TVVTDARTSMGLT+FIT RGG+HCLYRVGYRNVIDKGV L
Sbjct  352   NGDKLIALMSSIVLKEHPGSTVVTDARTSMGLTKFITERGGRHCLYRVGYRNVIDKGVEL  411

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEE  667
             N DG+ETHLMMETSGHGA+KEN+FLDDGAYMVVKIIIEMV+M+L GS EGIGSLI+DLEE
Sbjct  412   NRDGIETHLMMETSGHGAVKENHFLDDGAYMVVKIIIEMVRMRLAGSNEGIGSLIEDLEE  471

Query  666   PLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTN  487
             PLE AELR+++LSEPR AKAK +EAIE+FR YIE+G L GWELDSCGDCWVSEGCLVD+N
Sbjct  472   PLEAAELRLNILSEPRDAKAKGIEAIETFRQYIEEGKLKGWELDSCGDCWVSEGCLVDSN  531

Query  486   DHPAAIDAFMYRAKVSNEENG-EHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDK  310
             DHP+AIDA MYRA+VS+E+NG E+GWVH+RQSIHNPNIAVN+QS +PGGC SM R  RD+
Sbjct  532   DHPSAIDAHMYRARVSDEDNGEEYGWVHMRQSIHNPNIAVNMQSMLPGGCLSMTRVFRDQ  591

Query  309   FLLAGEMAKFLDISQIDEF  253
             FL A  MA+FLD+S  D++
Sbjct  592   FLEASGMARFLDVSDFDDY  610



>ref|NP_177239.1| phosphoglucomutase-like protein [Arabidopsis thaliana]
 gb|AAD55496.1|AC008148_6 Putative phosphoglucomutase [Arabidopsis thaliana]
 gb|AAM13162.1| putative phosphoglucomutase [Arabidopsis thaliana]
 gb|AAP37735.1| At1g70820 [Arabidopsis thaliana]
 gb|AEE35120.1| phosphoglucomutase-like protein [Arabidopsis thaliana]
Length=615

 Score =   939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/619 (74%), Positives = 528/619 (85%), Gaps = 15/619 (2%)
 Frame = -1

Query  2091  MASTSTTP-QSLQTIASKPN-FPSFPIHKPLHRS-LGIAQSFPKIKLSLRVESSLTANKH  1921
             MASTST+   + +T+ SK   F S P    + RS L  A + P +K  LR+ SS    K 
Sbjct  1     MASTSTSSLMASKTVISKTALFSSLP--GIVSRSFLTFAPASPSVK-PLRIRSS-NVTKF  56

Query  1920  NEV--AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES  1747
             +EV  ++DE+M++IRRLQNGSDVRGVAL+GEKGR+VDLTP AVEAIAESFGEWV +  ES
Sbjct  57    DEVTNSLDEDMDQIRRLQNGSDVRGVALEGEKGRTVDLTPAAVEAIAESFGEWV-AATES  115

Query  1746  ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF  1567
                G +    ++SLG DPR+SG  LS AVFAGL +AGCL FDMGLATTPACFMST+L PF
Sbjct  116   NGNGVI----KISLGRDPRVSGGKLSTAVFAGLARAGCLAFDMGLATTPACFMSTLLSPF  171

Query  1566  QYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPP  1387
             +YDASIMMTASHLPYTRNGLKFFTK+GGLTS EVE ICD AARKYA R  KVST +R  P
Sbjct  172   EYDASIMMTASHLPYTRNGLKFFTKRGGLTSPEVEKICDLAARKYATRQTKVSTLIRTRP  231

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VDFMSAY+KHLR+IIKER+NHP HYDTPL+GFQI+VNAGNGSGGFFTWDVLDKLGADT
Sbjct  232   QQVDFMSAYSKHLREIIKERINHPEHYDTPLKGFQIVVNAGNGSGGFFTWDVLDKLGADT  291

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
             FGSL+LNPDGMFPNHIPNPE+K AM  TRAAVL+N+ADLGVVFDTDVDRSGVVD  GNPI
Sbjct  292   FGSLYLNPDGMFPNHIPNPENKIAMQHTRAAVLENSADLGVVFDTDVDRSGVVDNKGNPI  351

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHL  847
             NGD+LIALMSAIVLKEHPG+TVVTDARTSMGLTRFIT RGG+HCLYRVGYRNVIDKGV L
Sbjct  352   NGDKLIALMSAIVLKEHPGSTVVTDARTSMGLTRFITERGGRHCLYRVGYRNVIDKGVEL  411

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEE  667
             N+DG+ETHLMMETSGHGA+KEN+FLDDGAYMVVKIIIEMV+M+L GS EGIGSLI+DLEE
Sbjct  412   NKDGIETHLMMETSGHGAVKENHFLDDGAYMVVKIIIEMVRMRLAGSNEGIGSLIEDLEE  471

Query  666   PLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTN  487
             PLE  ELR+++LSEPR AKAK +EAIE+FR YIE+G L GWEL +CGDCWV+EGCLVD+N
Sbjct  472   PLEAVELRLNILSEPRDAKAKGIEAIETFRQYIEEGKLKGWELGTCGDCWVTEGCLVDSN  531

Query  486   DHPAAIDAFMYRAKVSNEENG-EHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDK  310
             DHP+AIDA MYRA+VS+EE+G E+GWVH+RQSIHNPNIA+N+QS +PGGC SM R  RD+
Sbjct  532   DHPSAIDAHMYRARVSDEESGEEYGWVHMRQSIHNPNIALNMQSMLPGGCLSMTRIFRDQ  591

Query  309   FLLAGEMAKFLDISQIDEF  253
             FL A  +A+FLDIS  D +
Sbjct  592   FLEASGVARFLDISDFDNY  610



>ref|XP_009105749.1| PREDICTED: uncharacterized protein LOC103831616 [Brassica rapa]
Length=613

 Score =   938 bits (2424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/583 (77%), Positives = 513/583 (88%), Gaps = 13/583 (2%)
 Frame = -1

Query  1980  SFPKIKLS---LRVESSLTANKHNEVA---VDEEMEKIRRLQNGSDVRGVALQGEKGRSV  1819
             SF    LS   LR  SS  A K +EV    +DE+M++IRRLQNGSDVRGVAL+GEKGR+V
Sbjct  32    SFTPASLSFKPLRTRSS-NATKIDEVTSNILDEDMDQIRRLQNGSDVRGVALEGEKGRTV  90

Query  1818  DLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQA  1639
              LTP AVEAIAESFGEWV + +ES   G +    RVSLG DPR+SG  LS AVFAGL +A
Sbjct  91    TLTPAAVEAIAESFGEWV-AAMESNGNGVI----RVSLGRDPRVSGGKLSTAVFAGLARA  145

Query  1638  GCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEA  1459
             GCL FDMGLATTPACFMST+LPPF+YDASIMMTASHLPYTRNGLKFFTK+GGLTS EVE 
Sbjct  146   GCLAFDMGLATTPACFMSTLLPPFEYDASIMMTASHLPYTRNGLKFFTKRGGLTSPEVEK  205

Query  1458  ICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQI  1279
             ICD AARKYANR  KVST +R  P +VDFMSAY+KHLR+IIKER+NHP HYDTPL+GFQI
Sbjct  206   ICDLAARKYANRQTKVSTLIRTRPEQVDFMSAYSKHLREIIKERINHPEHYDTPLKGFQI  265

Query  1278  IVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNA  1099
             +VNAGNGSGGFFTWDVLDKLGADTFGSL+LNPDGMFPNHIPNPEDKTAM+ TRA+VL+N+
Sbjct  266   VVNAGNGSGGFFTWDVLDKLGADTFGSLYLNPDGMFPNHIPNPEDKTAMSRTRASVLENS  325

Query  1098  ADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFI  919
             ADLGVVFDTDVDRSGVVD  GNPINGD+LIALMSAIVLKEHPG+T+VTDARTSMGLTRFI
Sbjct  326   ADLGVVFDTDVDRSGVVDNKGNPINGDKLIALMSAIVLKEHPGSTIVTDARTSMGLTRFI  385

Query  918   TGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKII  739
             T RGG+HCLYRVGYRNVIDKGV LN+DG+E+HLMMETSGHGA+KEN+FLDDGAYMVVKII
Sbjct  386   TERGGRHCLYRVGYRNVIDKGVELNKDGIESHLMMETSGHGAVKENHFLDDGAYMVVKII  445

Query  738   IEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKG  559
             IEMV+M+L GS+EGIGSLI+DLEEPLE+AELRM++LSEPR AKAK +EAIE+FR YIE+G
Sbjct  446   IEMVRMRLAGSKEGIGSLIEDLEEPLESAELRMNILSEPRDAKAKGIEAIETFRQYIEEG  505

Query  558   NLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENG-EHGWVHLRQSIHNP  382
              L GWELDSCG+CWVSEGCLVD+NDHP+AIDA MYRAKV ++++G E+GWVH+RQSIHNP
Sbjct  506   KLEGWELDSCGECWVSEGCLVDSNDHPSAIDAHMYRAKVMDKKSGEEYGWVHMRQSIHNP  565

Query  381   NIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQIDEF  253
             NIA+N+QS +PGGC SM    RD+FL A  +A+FLDIS ID +
Sbjct  566   NIALNMQSVLPGGCFSMTSLFRDRFLEASGVARFLDISDIDNY  608



>emb|CDY11542.1| BnaC06g31970D [Brassica napus]
Length=615

 Score =   937 bits (2421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/574 (78%), Positives = 509/574 (89%), Gaps = 12/574 (2%)
 Frame = -1

Query  1956  LRVESSLTANKHNEVA---VDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIA  1786
             LR  SS  A K +EV    +DE+M++IRRLQNGSDVRGVAL+GEKGR+V LTP AVEAIA
Sbjct  43    LRTRSS-NATKIDEVTNNILDEDMDQIRRLQNGSDVRGVALEGEKGRTVTLTPAAVEAIA  101

Query  1785  ESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLAT  1606
             ESFGEWV +  ES   G +    RVSLG DPR+SG  LS AVFAGL +AGCL FDMGLAT
Sbjct  102   ESFGEWV-AATESNVNGVI----RVSLGRDPRVSGGKLSTAVFAGLARAGCLAFDMGLAT  156

Query  1605  TPACFMSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN  1426
             TPACFMST+LPPF+YDASIMMTASHLPYTRNGLKFFTKKGGLTS EVE ICD AARKYAN
Sbjct  157   TPACFMSTLLPPFEYDASIMMTASHLPYTRNGLKFFTKKGGLTSPEVEKICDLAARKYAN  216

Query  1425  RMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQ--IIVNAGNGSG  1252
             R  KVST +R  P +VDFMSAY+KHLR+IIKER+NHP HYDTPL+GFQ  I+VNAGNGSG
Sbjct  217   RQTKVSTLIRTRPQQVDFMSAYSKHLREIIKERINHPEHYDTPLKGFQARIVVNAGNGSG  276

Query  1251  GFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDT  1072
             GFFTWDVLDKLGADTFGSL+LNPDGMFPNHIPNPEDKTAM+ TRAAVL+N+ADLGVVFDT
Sbjct  277   GFFTWDVLDKLGADTFGSLYLNPDGMFPNHIPNPEDKTAMSRTRAAVLENSADLGVVFDT  336

Query  1071  DVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCL  892
             DVDRSGVVD  GNPINGD+LIALMSAIVLKEHPG+T+VTDARTSMGLTRFIT RGG+HCL
Sbjct  337   DVDRSGVVDNKGNPINGDKLIALMSAIVLKEHPGSTIVTDARTSMGLTRFITERGGRHCL  396

Query  891   YRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLE  712
             YRVGYRNVIDKGV LN+DG+E+HLMMETSGHGA+KEN+FLDDGAYMVVKIIIEMV+M+L 
Sbjct  397   YRVGYRNVIDKGVELNKDGIESHLMMETSGHGAVKENHFLDDGAYMVVKIIIEMVRMRLA  456

Query  711   GSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDS  532
             GS+EGIGSLI+DLEEPLE+AELRM++LSEPR AKAK +EAIE+FR YIE+G L GWELDS
Sbjct  457   GSKEGIGSLIEDLEEPLESAELRMNILSEPRDAKAKGIEAIETFRQYIEEGKLEGWELDS  516

Query  531   CGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENG-EHGWVHLRQSIHNPNIAVNLQSN  355
             CG+CWVSEGCLVD+NDHP+AIDA MYRAKV ++++G E+GWVH+RQSIHNPNIA+N+QS 
Sbjct  517   CGECWVSEGCLVDSNDHPSAIDAHMYRAKVMDKKSGEEYGWVHMRQSIHNPNIALNMQSV  576

Query  354   IPGGCQSMARDLRDKFLLAGEMAKFLDISQIDEF  253
             +PGGC SMA   RD+FL A  +A+FLDIS ID +
Sbjct  577   LPGGCLSMASLFRDRFLEASGVARFLDISDIDNY  610



>ref|XP_008464699.1| PREDICTED: uncharacterized protein LOC103502521 isoform X1 [Cucumis 
melo]
Length=614

 Score =   934 bits (2415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/622 (73%), Positives = 522/622 (84%), Gaps = 14/622 (2%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIA-SKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNE  1915
             MAST T   S++T   S PNF  FP +KPL   +  + +F K      V ++    +H  
Sbjct  1     MAST-TLGTSIKTRGDSFPNFILFP-NKPLSPKVS-SFAFLKRAAPRGVAATWRTAEHGG  57

Query  1914  V----AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES  1747
                   VDEEM +IRRLQNGSDVRGVA++GEKGR+VDLT  AVEAIAESF EWVI+G+E+
Sbjct  58    ALAAEEVDEEMGRIRRLQNGSDVRGVAIEGEKGRTVDLTAAAVEAIAESFSEWVINGMET  117

Query  1746  ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF  1567
              R      SV VS+G DPRISG +LSAAVFAG+ +AGCLVFDMGLATTPACFMSTVL PF
Sbjct  118   GR------SVSVSVGRDPRISGSALSAAVFAGVSRAGCLVFDMGLATTPACFMSTVLSPF  171

Query  1566  QYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPP  1387
              YDASIM+TASHLPYTRNG+KFFTK+GGL+S EVE ICD+AA KYANR+ KVST LR PP
Sbjct  172   SYDASIMLTASHLPYTRNGMKFFTKRGGLSSPEVEEICDRAAAKYANRVVKVSTLLRTPP  231

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
             SKVDFM AY+KHLRDIIK+R+NHP HYDTPLQGF+IIVNAGNGSGGFFTWDVLDKLGADT
Sbjct  232   SKVDFMGAYSKHLRDIIKQRINHPLHYDTPLQGFKIIVNAGNGSGGFFTWDVLDKLGADT  291

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
             FGSLHLNPDGMFPNHIPNPEDKTAM++TRA++L + ADLGVVFDTDVDRSGVVD  GNPI
Sbjct  292   FGSLHLNPDGMFPNHIPNPEDKTAMSLTRASLLDHNADLGVVFDTDVDRSGVVDHEGNPI  351

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHL  847
             NGD+LIALMSAIVL+EHP TT+VTDARTS+ LT+FIT RGG+HCLYRVGYRNVIDKG+ L
Sbjct  352   NGDKLIALMSAIVLREHPATTIVTDARTSVALTKFITNRGGRHCLYRVGYRNVIDKGIQL  411

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEE  667
             N DG+ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMV+MKLEGS EGIGSLIKDLEE
Sbjct  412   NMDGIETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVRMKLEGSNEGIGSLIKDLEE  471

Query  666   PLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTN  487
             PLE+AELR++V+SEP  AK KAVE IE+FR ++++G L GWELDSCGDCWV EGCLVD N
Sbjct  472   PLESAELRLNVISEPSFAKEKAVEVIETFRDFVQEGKLEGWELDSCGDCWVHEGCLVDLN  531

Query  486   DHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
             DHP  IDA MYR KV +EENGE GWVHLRQSIHNPN+A+N+QS++ GGC  + +D RDKF
Sbjct  532   DHPKPIDAQMYRVKVFDEENGEIGWVHLRQSIHNPNLALNMQSSLLGGCLQITKDFRDKF  591

Query  306   LLAGEMAKFLDISQIDEFARNG  241
             LLA    +FLD+ Q+++F   G
Sbjct  592   LLASGCDRFLDVDQVEKFINTG  613



>ref|XP_010427875.1| PREDICTED: uncharacterized protein LOC104712639 [Camelina sativa]
Length=615

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/584 (77%), Positives = 511/584 (88%), Gaps = 10/584 (2%)
 Frame = -1

Query  1995  LGIAQSFPKIKLSLRVESSLTANKHNEV--AVDEEMEKIRRLQNGSDVRGVALQGEKGRS  1822
             L  + + P +K  LR  SS  A K NEV  +VDE+M++IRRLQNGSDVRGVAL+GEKGR+
Sbjct  34    LSFSPASPSVK-PLRTRSS-NATKFNEVTSSVDEDMDQIRRLQNGSDVRGVALEGEKGRT  91

Query  1821  VDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQ  1642
             VDLTP AVEAIAESFGEWV +  E    G +    +VSLG DPR+SG  LS A+FAGLG+
Sbjct  92    VDLTPAAVEAIAESFGEWV-AATEGNPNGVI----KVSLGRDPRVSGGKLSTAIFAGLGR  146

Query  1641  AGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVE  1462
             AGCL FDMGLATTPACFMST+L PF+YDASIMMTASHLPYTRNGLKFFTK+GGLTS EVE
Sbjct  147   AGCLAFDMGLATTPACFMSTLLSPFEYDASIMMTASHLPYTRNGLKFFTKRGGLTSPEVE  206

Query  1461  AICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQ  1282
              ICD AARKYA R +KVST ++  P +VDFMSAY+KHLR+IIKER+NHP HYDTPL+GFQ
Sbjct  207   KICDLAARKYATRQSKVSTLIKTRPKQVDFMSAYSKHLREIIKERINHPEHYDTPLKGFQ  266

Query  1281  IIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQN  1102
             I+VNAGNGSGGFFTWDVLDKLGADTFGSL+LNPDGMFPNHIPNPE+K AM+ TRAAVL+N
Sbjct  267   IVVNAGNGSGGFFTWDVLDKLGADTFGSLYLNPDGMFPNHIPNPENKIAMSHTRAAVLEN  326

Query  1101  AADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRF  922
             +ADLGVVFDTDVDRSGVVD  GNPINGD+LIALMSAIVLKEHPG+TVVTDARTSMGLT+F
Sbjct  327   SADLGVVFDTDVDRSGVVDNRGNPINGDKLIALMSAIVLKEHPGSTVVTDARTSMGLTKF  386

Query  921   ITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKI  742
             IT RGG+HCLYRVGYRNVIDKGV LN+DG+ETHLMMETSGHGA+KEN+FLDDGAYMVVKI
Sbjct  387   ITERGGRHCLYRVGYRNVIDKGVELNKDGIETHLMMETSGHGAVKENHFLDDGAYMVVKI  446

Query  741   IIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEK  562
             IIEMV+M+L GS EGIGSLI+DLEEPLE  ELR+++LSEPR AKAK +EAIE+FR YIE+
Sbjct  447   IIEMVRMRLAGSNEGIGSLIEDLEEPLEAVELRLNILSEPRDAKAKGIEAIETFREYIEE  506

Query  561   GNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENG-EHGWVHLRQSIHN  385
             G L GWELDSCGDCWV+EGCLVD+NDHP+AIDA MYRA+VS+EE+G E+GWVH+RQSIHN
Sbjct  507   GKLKGWELDSCGDCWVNEGCLVDSNDHPSAIDAHMYRARVSDEESGDEYGWVHMRQSIHN  566

Query  384   PNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQIDEF  253
             PNIAVN+QS + GGC SM R  RD+FL A  +A+FLDIS  D +
Sbjct  567   PNIAVNMQSMLSGGCLSMTRVFRDQFLEASGIARFLDISDFDNY  610



>ref|XP_010415771.1| PREDICTED: uncharacterized protein LOC104701728 [Camelina sativa]
Length=615

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/619 (74%), Positives = 530/619 (86%), Gaps = 15/619 (2%)
 Frame = -1

Query  2091  MASTSTTP-QSLQTIASKPN-FPSFPIHKPLHRS-LGIAQSFPKIKLSLRVESSLTANKH  1921
             MASTST+   + +T+ SK   F S P    + RS L    + P +K  LR  SS  A K 
Sbjct  1     MASTSTSSLMASKTVISKTALFFSSP--GIVKRSFLSFPPASPSVK-PLRTRSS-NATKF  56

Query  1920  NEV--AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES  1747
             +EV  ++DE+M++IRRLQNGSDVRGVAL+GEKGR+VDLTP AVEAIAESFGEWV +   +
Sbjct  57    DEVTSSLDEDMDQIRRLQNGSDVRGVALEGEKGRTVDLTPAAVEAIAESFGEWVAA---T  113

Query  1746  ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF  1567
             E  G  V  ++VSLG DPR+SG  LS A+FAGLG+AGCL FDMGLATTPACFMST+L PF
Sbjct  114   EGNGNGV--IKVSLGRDPRVSGGKLSTAIFAGLGRAGCLAFDMGLATTPACFMSTLLSPF  171

Query  1566  QYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPP  1387
             +YDASIMMTASHLPYTRNGLKFFTK+GGLTS EVE ICD AARKYA R +KVST ++  P
Sbjct  172   EYDASIMMTASHLPYTRNGLKFFTKRGGLTSPEVEKICDLAARKYATRQSKVSTLIKTRP  231

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VDFM+AY+KHLR+IIKER+NHP HYDTPL+GFQI+VNAGNGSGGFFTWDVLDKLGADT
Sbjct  232   KQVDFMNAYSKHLREIIKERINHPEHYDTPLKGFQIVVNAGNGSGGFFTWDVLDKLGADT  291

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
             FGSL+LNPDGMFPNHIPNPE+K AM+ TRAAVL+N+ADLGVVFDTDVDRSGVVD  GNP+
Sbjct  292   FGSLYLNPDGMFPNHIPNPENKIAMSHTRAAVLENSADLGVVFDTDVDRSGVVDNKGNPV  351

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHL  847
             NGD+LIALMSAIVLKEHPG+TVVTDARTSMGLT+FIT RGG+HCLYRVGYRNVIDKGV L
Sbjct  352   NGDKLIALMSAIVLKEHPGSTVVTDARTSMGLTKFITERGGRHCLYRVGYRNVIDKGVEL  411

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEE  667
             N+DG+ETHLMMETSGHGA+KEN+FLDDGAYMVVKIIIEMV+M+L GS EGIGSLI+DLEE
Sbjct  412   NKDGIETHLMMETSGHGAVKENHFLDDGAYMVVKIIIEMVRMRLAGSNEGIGSLIEDLEE  471

Query  666   PLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTN  487
             PLE  ELR+++LSEPR AKAK +EAIE+FR YIE+G L GWELDSCGDCWVSEGCLVD+N
Sbjct  472   PLEAVELRLNILSEPRDAKAKGIEAIETFREYIEEGKLKGWELDSCGDCWVSEGCLVDSN  531

Query  486   DHPAAIDAFMYRAKVSNEENG-EHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDK  310
             DHP+AIDA MYR++VS+EE+G E+GWVH+RQSIHNPNIAVN+QS + GGC SM R  RD 
Sbjct  532   DHPSAIDAHMYRSRVSDEESGEEYGWVHMRQSIHNPNIAVNMQSMLSGGCLSMTRVFRDH  591

Query  309   FLLAGEMAKFLDISQIDEF  253
             FL A  +A+FLDIS  D +
Sbjct  592   FLEASGIARFLDISDFDNY  610



>emb|CDX96280.1| BnaA07g28910D [Brassica napus]
Length=615

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/574 (78%), Positives = 508/574 (89%), Gaps = 12/574 (2%)
 Frame = -1

Query  1956  LRVESSLTANKHNEVA---VDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIA  1786
             LR  SS  A K +EV    +DE+M++IRRLQNGSDVRGVAL+GEKGR+V LTP AVEAIA
Sbjct  43    LRTRSS-NATKIDEVTSNILDEDMDQIRRLQNGSDVRGVALEGEKGRTVTLTPAAVEAIA  101

Query  1785  ESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLAT  1606
             ESFGEWV +  ES   G +    RVSLG DPR+SG  LS AVFAGL +AGCL FDMGLAT
Sbjct  102   ESFGEWV-AATESNGNGVI----RVSLGRDPRVSGGKLSTAVFAGLARAGCLAFDMGLAT  156

Query  1605  TPACFMSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN  1426
             TPACFMST+LPPF+YDASIMMTASHLPYTRNGLKFFTK+GGLTS EVE ICD AARKYAN
Sbjct  157   TPACFMSTLLPPFEYDASIMMTASHLPYTRNGLKFFTKRGGLTSPEVEKICDLAARKYAN  216

Query  1425  RMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQ--IIVNAGNGSG  1252
             R  KVST +R  P +VDFMSAY++HLR+IIKER+NHP HYDTPL+GFQ  I+VNAGNGSG
Sbjct  217   RQTKVSTLIRTRPEQVDFMSAYSQHLREIIKERINHPEHYDTPLKGFQASIVVNAGNGSG  276

Query  1251  GFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDT  1072
             GFFTWDVLDKLGADTFGSL+LNPDGMFPNHIPNPEDKTAM+ TRA+VL+N+ADLGVVFDT
Sbjct  277   GFFTWDVLDKLGADTFGSLYLNPDGMFPNHIPNPEDKTAMSRTRASVLENSADLGVVFDT  336

Query  1071  DVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCL  892
             DVDRSGVVD  GNPINGD+LIALMSAIVLKEHPG+T+VTDARTSMGLTRFIT RGG+HCL
Sbjct  337   DVDRSGVVDNKGNPINGDKLIALMSAIVLKEHPGSTIVTDARTSMGLTRFITERGGRHCL  396

Query  891   YRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLE  712
             YRVGYRNVIDKGV LN+DG+E+HLMMETSGHGA+KEN+FLDDGAYMVVKIIIEMV+M+L 
Sbjct  397   YRVGYRNVIDKGVELNKDGIESHLMMETSGHGAVKENHFLDDGAYMVVKIIIEMVRMRLA  456

Query  711   GSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDS  532
             GS+EGIGSLI+DLEEPLE+AELRM++LSEPR AKAK +EAIE+FR YIE+G L GWELDS
Sbjct  457   GSKEGIGSLIEDLEEPLESAELRMNILSEPRDAKAKGIEAIETFRQYIEEGKLEGWELDS  516

Query  531   CGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENG-EHGWVHLRQSIHNPNIAVNLQSN  355
             CG+CWVSEGCLVD+NDHP+AIDA MYRAKV ++++G E+GWVH+RQSIHNPNIA+N+QS 
Sbjct  517   CGECWVSEGCLVDSNDHPSAIDAHMYRAKVMDKKSGEEYGWVHMRQSIHNPNIALNMQSV  576

Query  354   IPGGCQSMARDLRDKFLLAGEMAKFLDISQIDEF  253
             +PGGC SM    RD+FL A  +A+FLDIS ID +
Sbjct  577   LPGGCFSMTSLFRDRFLEASGVARFLDISDIDNY  610



>ref|XP_002887331.1| hypothetical protein ARALYDRAFT_476213 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63590.1| hypothetical protein ARALYDRAFT_476213 [Arabidopsis lyrata subsp. 
lyrata]
Length=615

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/619 (74%), Positives = 528/619 (85%), Gaps = 15/619 (2%)
 Frame = -1

Query  2091  MASTSTTP-QSLQTIASKPN-FPSFPIHKPLHRS-LGIAQSFPKIKLSLRVESSLTANKH  1921
             MASTST+   + +T+ SK   F S P     +R+ +  A + P +K  LR +SS    K 
Sbjct  1     MASTSTSSLMASKTVISKTTLFSSLP--GIFYRNFITFAPASPSVK-PLRTKSS-NGTKF  56

Query  1920  NEV--AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES  1747
             +EV  ++DE+M++IRRLQNGSDVRGVAL+GEKGR+VDLTP AVEAIAESFGEWV +  ES
Sbjct  57    DEVTNSLDEDMDQIRRLQNGSDVRGVALEGEKGRTVDLTPAAVEAIAESFGEWV-TATES  115

Query  1746  ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF  1567
                G +    +VSLG DPR+SG  LS AVFAGL +AGCL FDMGLATTPACFMST+L PF
Sbjct  116   NGNGVI----KVSLGRDPRVSGGKLSTAVFAGLARAGCLAFDMGLATTPACFMSTLLSPF  171

Query  1566  QYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPP  1387
             +YDASIMMTASHLPYTRNGLKFFTK+GGLTS EVE ICD AARKYA R  KVST +R  P
Sbjct  172   EYDASIMMTASHLPYTRNGLKFFTKRGGLTSPEVEKICDLAARKYATRQTKVSTLIRRRP  231

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VDFMSAY+KHLR+IIKER+NHP HYDTPL+GFQI+VNAGNGSGGFFTWDVLDKLGA+T
Sbjct  232   KQVDFMSAYSKHLREIIKERINHPEHYDTPLKGFQIVVNAGNGSGGFFTWDVLDKLGANT  291

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
             FGSL+LNPDGMFPNHIPNPE+K AM+ TRAAVL+N+ADLGVVFDTDVDRSGVVD  GNPI
Sbjct  292   FGSLYLNPDGMFPNHIPNPENKIAMSHTRAAVLENSADLGVVFDTDVDRSGVVDNRGNPI  351

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHL  847
             NGD+LIALMSAIVLKEHPG+T+VTDARTSMGLTRFIT RGG+HCLYRVGYRNVIDKGV L
Sbjct  352   NGDKLIALMSAIVLKEHPGSTIVTDARTSMGLTRFITERGGRHCLYRVGYRNVIDKGVEL  411

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEE  667
             N+DG+ETHLMMETSGHGA+KEN+FLDDGAYMVVKIIIEMV+M+L GS EGIGSLI+DLEE
Sbjct  412   NKDGIETHLMMETSGHGAVKENHFLDDGAYMVVKIIIEMVRMRLAGSNEGIGSLIEDLEE  471

Query  666   PLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTN  487
             PLE  ELR+++LS+PR AKA  +EAIE+FR YIE+G L GWEL +CGDCWVSEGCLVD+N
Sbjct  472   PLEAVELRLNILSKPRDAKANGIEAIETFRQYIEEGKLRGWELGTCGDCWVSEGCLVDSN  531

Query  486   DHPAAIDAFMYRAKVSNEENG-EHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDK  310
             DHP+AIDA MYRA+VS+EE+G E+GWVH+RQSIHNPNIA+N+QS +PGGC SM R  RD+
Sbjct  532   DHPSAIDAHMYRARVSDEESGEEYGWVHMRQSIHNPNIALNMQSMLPGGCLSMTRVFRDQ  591

Query  309   FLLAGEMAKFLDISQIDEF  253
             FL A  +A+FLD+S  D +
Sbjct  592   FLEASGIARFLDLSDFDNY  610



>ref|XP_010533353.1| PREDICTED: uncharacterized protein LOC104809154 [Tarenaya hassleriana]
Length=617

 Score =   929 bits (2402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/598 (74%), Positives = 510/598 (85%), Gaps = 6/598 (1%)
 Frame = -1

Query  2031  PSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNEV--AVDEEMEKIRRLQNGSDV  1858
             PS  I+  L R+          K  LR  S+  A K++E+   +DE+M+ IRRLQNGSDV
Sbjct  22    PSPVINPSLKRNFITFSQASSFKKPLRTLSA-GATKYDELTSGLDEDMDMIRRLQNGSDV  80

Query  1857  RGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGK  1678
             RGVAL+GEKGR+VDLTP AVEAIAESFGEWV +  ESE  G V+   RVS+G DPR+SG 
Sbjct  81    RGVALEGEKGRTVDLTPAAVEAIAESFGEWVAAEEESESKGRVL---RVSVGRDPRVSGA  137

Query  1677  SLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYTRNGLKFF  1498
             +L+ AVFAGL +AGCLV+D+GLATTPACFMST+L PF YDASIMMTASHLPYTRNGLKFF
Sbjct  138   TLATAVFAGLSRAGCLVYDIGLATTPACFMSTLLSPFDYDASIMMTASHLPYTRNGLKFF  197

Query  1497  TKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNH  1318
             TK GGLTS+EVE ICD AARKYANR+ KVST +R PP K+DFMSAY+KHLRDIIK+R++H
Sbjct  198   TKSGGLTSSEVEKICDVAARKYANRVTKVSTLVRTPPEKIDFMSAYSKHLRDIIKDRIHH  257

Query  1317  PTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKT  1138
             P  YDTPL GF+IIVNAGNGSGGFFTW+VLDKLGADTFGSLHLNPDGMFPNHIPNPEDKT
Sbjct  258   PDRYDTPLDGFKIIVNAGNGSGGFFTWEVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKT  317

Query  1137  AMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVV  958
             AM++TRAAVL+ +ADLG+VFDTDVDRSGVVD  GNPINGDRLIALMSAIVLKEHPGTT+V
Sbjct  318   AMSLTRAAVLEYSADLGIVFDTDVDRSGVVDSRGNPINGDRLIALMSAIVLKEHPGTTIV  377

Query  957   TDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENY  778
             TDARTS+GLT+FIT RGG+HC+YRVGYRNVIDKGV LN DG+ETHLMMETSGHGAL+EN+
Sbjct  378   TDARTSIGLTKFITERGGEHCMYRVGYRNVIDKGVQLNRDGIETHLMMETSGHGALQENH  437

Query  777   FLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAV  598
             FLDDGAYMVVKIIIEMV+MKLEGS EGIGSLI DLEEPLE+ ELRM+++SEPR AKAK  
Sbjct  438   FLDDGAYMVVKIIIEMVRMKLEGSNEGIGSLIDDLEEPLESIELRMNIVSEPREAKAKGT  497

Query  597   EAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEH  418
             +AIE+FR ++E+G L GWELDSCG+CWVSEGCLVD+NDHPA +DA MYRA+V + E GE+
Sbjct  498   QAIETFRQFVEEGKLEGWELDSCGECWVSEGCLVDSNDHPAPVDAHMYRARVGDGERGEY  557

Query  417   GWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQIDEFARN  244
             GWVH+RQSIHNPNIAVN QS +PGGC SMAR    +FL+A  +  FLD SQ  ++  N
Sbjct  558   GWVHMRQSIHNPNIAVNFQSTLPGGCLSMARLFTHQFLVASGIGDFLDFSQFRKYIAN  615



>ref|XP_004151147.1| PREDICTED: phosphomannomutase/phosphoglucomutase-like [Cucumis 
sativus]
 gb|KGN49625.1| hypothetical protein Csa_5G031450 [Cucumis sativus]
Length=616

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/608 (73%), Positives = 514/608 (85%), Gaps = 12/608 (2%)
 Frame = -1

Query  2046  SKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNEV----AVDEEMEKIRR  1879
             S PNF S P +KPL+  + I+ SF K      V ++ +  +H        VDEEM +IRR
Sbjct  16    SFPNFISIP-NKPLNPKV-ISFSFLKRAAPRGVAATWSTAEHGGALAAEEVDEEMGRIRR  73

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNGSDVRGVA+ GEKGR VDLT   VEAIAESF EWVI G+E+       +SV VS+G 
Sbjct  74    LQNGSDVRGVAIAGEKGRVVDLTAATVEAIAESFAEWVIEGMETG------QSVSVSVGR  127

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYT  1519
             DPRISG +LS AVFAG+ +AGCLVFDMGLATTPACFMSTVL PF YDASIM+TASHLPYT
Sbjct  128   DPRISGGALSVAVFAGVSRAGCLVFDMGLATTPACFMSTVLSPFSYDASIMLTASHLPYT  187

Query  1518  RNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDI  1339
             RNG+KFFTK+GGL+S EVE IC++AA KYANR+ KVST LR PPSKVDFM+AY++HLRDI
Sbjct  188   RNGMKFFTKRGGLSSPEVEEICNRAAMKYANRVVKVSTLLRTPPSKVDFMAAYSQHLRDI  247

Query  1338  IKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHI  1159
             IK+R+NHP HYDTPL+GFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHI
Sbjct  248   IKQRINHPLHYDTPLKGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHI  307

Query  1158  PNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKE  979
             PNPEDKTAM++TRA VL+N ADLGVVFDTDVDRSGVVD  GNPINGD+LIALMS+IVL++
Sbjct  308   PNPEDKTAMSLTRAKVLENKADLGVVFDTDVDRSGVVDHQGNPINGDKLIALMSSIVLRD  367

Query  978   HPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGH  799
             HP TT+VTDARTS+ LT+FIT RGG+HCLYRVGYRNVIDKG+ LN DG+ETHLMMETSGH
Sbjct  368   HPATTIVTDARTSVALTKFITSRGGRHCLYRVGYRNVIDKGIQLNMDGIETHLMMETSGH  427

Query  798   GALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEPR  619
             GALKENYFLDDGAYMVVKIIIEMV+MKLEGS+EGIGSLIKDLEEPLE+AELR++V+S+P 
Sbjct  428   GALKENYFLDDGAYMVVKIIIEMVRMKLEGSDEGIGSLIKDLEEPLESAELRLNVISDPS  487

Query  618   HAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVS  439
              AK KAVE IE+FR ++++G L GWELDSCGDCWV EGCLVD NDHP  IDA MYR KV 
Sbjct  488   FAKEKAVEVIETFRDFVQEGKLEGWELDSCGDCWVHEGCLVDLNDHPKPIDAQMYRVKVF  547

Query  438   NEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQID  259
             ++ENGE GWVHLRQSIHNPN+A+N+QS++ GGC  + +D RDKFL+A    +FLD+ Q++
Sbjct  548   DKENGEVGWVHLRQSIHNPNLALNMQSSLQGGCLQITKDFRDKFLMASGCDRFLDVDQVE  607

Query  258   EFARNGNL  235
             +F   G L
Sbjct  608   KFVNTGLL  615



>ref|XP_010471085.1| PREDICTED: uncharacterized protein LOC104750921 [Camelina sativa]
Length=625

 Score =   922 bits (2384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/619 (73%), Positives = 525/619 (85%), Gaps = 15/619 (2%)
 Frame = -1

Query  2091  MASTSTT-PQSLQTIASKPN-FPSFPIHKPLHRS-LGIAQSFPKIKLSLRVESSLTANKH  1921
             MAS+ST+   + +T+ SK   F S P    + RS L    + P  K  LR  SS  A K 
Sbjct  1     MASSSTSFLMASKTVISKTALFFSSP--GIVKRSFLSFTPASPSFK-PLRTRSS-NATKF  56

Query  1920  NEV--AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES  1747
             +EV  ++ E+M++IRRLQNGSDVRGVAL+GEKGR+VDLTP AVEAIAESFGEWV +   +
Sbjct  57    DEVTSSLGEDMDQIRRLQNGSDVRGVALEGEKGRTVDLTPAAVEAIAESFGEWVAA---T  113

Query  1746  ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF  1567
             E  G  V  ++VSLG DPR+SG  LS A+FAGLG+AGCL FDMGLATTPACFMST+L PF
Sbjct  114   EGNGNGV--IKVSLGRDPRVSGGKLSTAIFAGLGRAGCLAFDMGLATTPACFMSTLLSPF  171

Query  1566  QYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPP  1387
             +YDASIMMTASHLPYTRNGLKFFTK+GGLTS EVE ICD AARKYA R  KVST ++  P
Sbjct  172   EYDASIMMTASHLPYTRNGLKFFTKRGGLTSPEVEKICDLAARKYATRQTKVSTLIKTRP  231

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VDFMSAY+KHLR+IIKER+NHP HYDTPL+G QI+VNAGNGSGGFFTWDVLDKLGADT
Sbjct  232   KQVDFMSAYSKHLREIIKERINHPEHYDTPLKGLQIVVNAGNGSGGFFTWDVLDKLGADT  291

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
             FGSL+LNPDGMFPNHIPNPE+K AM+ TRAAVL+N+ADLGVVFDTDVDRSGVVD  GNPI
Sbjct  292   FGSLYLNPDGMFPNHIPNPENKIAMSHTRAAVLENSADLGVVFDTDVDRSGVVDNKGNPI  351

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHL  847
             NGD+LIALMSAIVLKEHPG+TVVTDARTSMGLT+FIT RGG+HCLYRVGYRNVIDKGV L
Sbjct  352   NGDKLIALMSAIVLKEHPGSTVVTDARTSMGLTKFITERGGRHCLYRVGYRNVIDKGVEL  411

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEE  667
             N+DG+ETHLMMETSGHGA+KEN+FLDDGAYMVVKIIIEMV+M+L GS EGIGSLI++LEE
Sbjct  412   NKDGIETHLMMETSGHGAVKENHFLDDGAYMVVKIIIEMVRMRLAGSNEGIGSLIENLEE  471

Query  666   PLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTN  487
             PLE  ELR+++LSEPR AKAK +EA+ +FR YIE+G L GWELDSCGDCWVSEGCLVD+N
Sbjct  472   PLEAVELRLNILSEPRDAKAKGIEAVATFREYIEEGKLKGWELDSCGDCWVSEGCLVDSN  531

Query  486   DHPAAIDAFMYRAKVSNEENG-EHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDK  310
             DHP+ IDA MYRA++S+EE+G E+GWVH+RQSIHNPNIAVN+QS + GGC SM R  RD+
Sbjct  532   DHPSTIDAHMYRARISDEESGEEYGWVHMRQSIHNPNIAVNMQSMLSGGCLSMTRVFRDQ  591

Query  309   FLLAGEMAKFLDISQIDEF  253
             FL A  +A+FLDIS  D +
Sbjct  592   FLEASGIARFLDISDFDNY  610



>ref|XP_004168100.1| PREDICTED: phosphomannomutase/phosphoglucomutase-like, partial 
[Cucumis sativus]
Length=575

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/558 (77%), Positives = 491/558 (88%), Gaps = 6/558 (1%)
 Frame = -1

Query  1908  VDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAV  1729
             VDEEM +IRRLQNGSDVRGVA+ GEKGR VDLT   VEAIAESF EWVI G+E+      
Sbjct  23    VDEEMGRIRRLQNGSDVRGVAIAGEKGRVVDLTAATVEAIAESFAEWVIEGMETG-----  77

Query  1728  VESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASI  1549
              +SV VS+G DPRISG +LS AVFAG+ +AGCLVFDMGLATTPACFMSTVL PF YDASI
Sbjct  78    -QSVSVSVGRDPRISGGALSVAVFAGVSRAGCLVFDMGLATTPACFMSTVLSPFSYDASI  136

Query  1548  MMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFM  1369
             M+TASHLPYTRNG+KFFTK+GGL+S EVE IC++AA KYANR+ KVST LR PPSKVDFM
Sbjct  137   MLTASHLPYTRNGMKFFTKRGGLSSPEVEEICNRAAMKYANRVVKVSTLLRTPPSKVDFM  196

Query  1368  SAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHL  1189
             +AY++HLRDIIK+R+NHP HYDTPL+GFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHL
Sbjct  197   AAYSQHLRDIIKQRINHPLHYDTPLKGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHL  256

Query  1188  NPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLI  1009
             NPDGMFPNHIPNPEDKTAM++TRA VL+N ADLGVVFDTDVDRSGVVD  GNPINGD+LI
Sbjct  257   NPDGMFPNHIPNPEDKTAMSLTRAKVLENKADLGVVFDTDVDRSGVVDHQGNPINGDKLI  316

Query  1008  ALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             ALMS+IVL++HP TT+VTDARTS+ LT+FIT RGG+HCLYRVGYRNVIDKG+ LN DG+E
Sbjct  317   ALMSSIVLRDHPATTIVTDARTSVALTKFITSRGGRHCLYRVGYRNVIDKGIQLNMDGIE  376

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAE  649
             THLMMETSGHGALKENYFLDDGAYMVVKIIIEMV+MKLEGS+EGIGSLIKDLEEPLE+AE
Sbjct  377   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVRMKLEGSDEGIGSLIKDLEEPLESAE  436

Query  648   LRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAI  469
             LR++V+S+P  AK KAVE IE+FR ++++G L GWELDSCGDCWV EGCLVD NDHP  I
Sbjct  437   LRLNVISDPSFAKEKAVEVIETFRDFVQEGKLEGWELDSCGDCWVHEGCLVDLNDHPKPI  496

Query  468   DAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEM  289
             DA MYR KV ++ENGE GWVHLRQSIHNPN+A+N+QS++ GGC  + +D RDKFL+A   
Sbjct  497   DAQMYRVKVFDKENGEVGWVHLRQSIHNPNLALNMQSSLQGGCLQITKDFRDKFLMASGC  556

Query  288   AKFLDISQIDEFARNGNL  235
              +FLD+ Q+++F   G L
Sbjct  557   DRFLDVDQVEKFVNTGLL  574



>ref|XP_010274724.1| PREDICTED: uncharacterized protein LOC104609970 [Nelumbo nucifera]
Length=615

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/574 (75%), Positives = 496/574 (86%), Gaps = 5/574 (1%)
 Frame = -1

Query  1941  SLTANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVI  1762
             S  + ++N++ VDEE+++I+RLQNGSDVRGVA++GEKGR VDLTPPAVEAI+ESFGEWVI
Sbjct  41    SFNSARYNQIVVDEEVDRIKRLQNGSDVRGVAMEGEKGRRVDLTPPAVEAISESFGEWVI  100

Query  1761  SGLESERGG----AVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPAC  1594
              GL  E  G    A  E VRVSLG DPRISG  LS AVF+GL +AGCL FDMGLATTPAC
Sbjct  101   DGLSKEGAGRGRVAEEEDVRVSLGRDPRISGAPLSVAVFSGLSRAGCLAFDMGLATTPAC  160

Query  1593  FMSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAK  1414
             FMST+LPPF Y ASIMMTASHLPYTRNGLKFFT+KGGL STEVE ICD+AA KYANR+AK
Sbjct  161   FMSTLLPPFTYHASIMMTASHLPYTRNGLKFFTRKGGLKSTEVEKICDRAAFKYANRLAK  220

Query  1413  VSTALRA-PPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTW  1237
             VST L A  P++V+FMS YA++LR+II++ VNHP HY+TPLQGFQIIVNAGNGSGGFFTW
Sbjct  221   VSTTLNALAPARVNFMSTYAEYLREIIRKEVNHPLHYETPLQGFQIIVNAGNGSGGFFTW  280

Query  1236  DVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRS  1057
             DVLDKLGADTFGS++L PDGMFP+HIPNPEDKTAMA+TRAAVL+N+ADLG+VFDTDVDRS
Sbjct  281   DVLDKLGADTFGSINLKPDGMFPSHIPNPEDKTAMALTRAAVLENSADLGIVFDTDVDRS  340

Query  1056  GVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGY  877
             GVVD +G  IN DRLIALM+AIVL+EHPGT +VTDARTSM LTRFITGRGG+HC+YR GY
Sbjct  341   GVVDSAGRAINRDRLIALMAAIVLREHPGTAIVTDARTSMALTRFITGRGGKHCMYRTGY  400

Query  876   RNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG  697
             RNVIDKG+ LN DGV+THLM+ETSGHGA KEN+FLDDGAYMV+KIIIEMV+MKL GS E 
Sbjct  401   RNVIDKGIQLNRDGVDTHLMIETSGHGAFKENHFLDDGAYMVLKIIIEMVRMKLSGSGES  460

Query  696   IGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCW  517
             I  LIK+LE+P ET ELRM++LSEPR AK KA EAIE+FR YIE+G + GWELDSCGDCW
Sbjct  461   IDHLIKELEDPAETIELRMNILSEPRFAKDKAAEAIETFRKYIEEGRINGWELDSCGDCW  520

Query  516   VSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQ  337
             VSEGCLVD+ND P ++DA MYR KVS++E+G HGWV LRQSIHNPNIAV +QS +PGGC 
Sbjct  521   VSEGCLVDSNDEPTSVDAHMYRVKVSDQEHGLHGWVQLRQSIHNPNIAVTMQSIVPGGCL  580

Query  336   SMARDLRDKFLLAGEMAKFLDISQIDEFARNGNL  235
             S+ R L D+FLL   M   LDISQI++F +NG+L
Sbjct  581   SITRALHDQFLLVSGMDIILDISQIEKFIKNGHL  614



>emb|CAA53507.1| phosphoglucomutase [Spinacia oleracea]
Length=583

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/558 (76%), Positives = 486/558 (87%), Gaps = 7/558 (1%)
 Frame = -1

Query  1905  DEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLE-----SER  1741
             D+++E+I+RLQNGSDV  VAL+GEKGR VDLTPPAVEAIAESFGEW+I+ L       E+
Sbjct  26    DDDIERIKRLQNGSDVSRVALEGEKGREVDLTPPAVEAIAESFGEWLIAKLRDDDDYKEK  85

Query  1740  GGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY  1561
              G  V+ V+VSLG DPR++G  LS AVF+GL +AGCL FDMGLATTPACFMSTV P F Y
Sbjct  86    QG--VDVVKVSLGKDPRVTGAKLSVAVFSGLARAGCLAFDMGLATTPACFMSTVFPHFSY  143

Query  1560  DASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSK  1381
               SIMMTASHLPYTRNGLKFFT++GGLTS EVE ICD+AARKYANR AKVS  L  PP+K
Sbjct  144   HGSIMMTASHLPYTRNGLKFFTRRGGLTSLEVEEICDRAARKYANRQAKVSLTLINPPTK  203

Query  1380  VDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFG  1201
             V+ MSAYA HLRDIIKER+NHPT+YDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFG
Sbjct  204   VNLMSAYANHLRDIIKERINHPTNYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFG  263

Query  1200  SLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPING  1021
             SL+LNPDGMFPNHIPNPEDK AMA+TRAAVL+N+ADLG+VFDTDVDRSGVVD  GNPING
Sbjct  264   SLYLNPDGMFPNHIPNPEDKKAMALTRAAVLENSADLGIVFDTDVDRSGVVDNKGNPING  323

Query  1020  DRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNE  841
             D+LIALMS+IVLKEHP TT+VTDARTS+GL+RFIT RGG+HCLYRVGYRNVIDKGV LNE
Sbjct  324   DKLIALMSSIVLKEHPETTIVTDARTSIGLSRFITNRGGKHCLYRVGYRNVIDKGVQLNE  383

Query  840   DGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPL  661
             D +ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMV+M+L GS EGIG+LI+DLE+P+
Sbjct  384   DDIETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVRMRLSGSSEGIGNLIEDLEDPV  443

Query  660   ETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDH  481
             E+ ELRMDV+SEPR+AK KAVE I++FR Y+E+  L GW LDSCGDCWV EGCLVD N++
Sbjct  444   ESVELRMDVISEPRYAKTKAVEVIDTFRRYVEEDKLEGWMLDSCGDCWVGEGCLVDLNEN  503

Query  480   PAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLL  301
             P AIDA MYR KV + E  EHGWVHLRQS+HNPNIAVN+QS+IPGGC+SM    +DKFL 
Sbjct  504   PTAIDAHMYRVKVLDNEQNEHGWVHLRQSVHNPNIAVNMQSSIPGGCRSMTEIFKDKFLF  563

Query  300   AGEMAKFLDISQIDEFAR  247
             A  + K +D SQI+++ +
Sbjct  564   ASGLDKVVDTSQIEQYVK  581



>ref|XP_010681886.1| PREDICTED: uncharacterized protein LOC104896793 [Beta vulgaris 
subsp. vulgaris]
Length=612

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/616 (71%), Positives = 508/616 (82%), Gaps = 5/616 (1%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIA-QSFPKIKLSLRVESSLTANKHNE  1915
             MA TS+T   L   A+K  F      K    +L ++  SF     ++ V SS T  +   
Sbjct  1     MACTSST-FILNHNANKAKFRWPQERKSFQSTLNLSCASFSTRSNTIFVRSSSTT-QDVI  58

Query  1914  VAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGG  1735
             +  D+E+EKI+RLQNGSDVRGVAL+GEKGR+VDLTPPAVEAIAESFGEW+I+ L  +   
Sbjct  59    ITNDDEIEKIKRLQNGSDVRGVALEGEKGRTVDLTPPAVEAIAESFGEWLIAKLRDDHEK  118

Query  1734  AVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDA  1555
             A  + V VSLG DPRISG  LSAAVFAGL +AGC+  DMGLATTPACFMSTVLP F YD 
Sbjct  119   A--KDVTVSLGRDPRISGAVLSAAVFAGLSKAGCVPIDMGLATTPACFMSTVLPAFSYDG  176

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVD  1375
             SIMMTASHLPYTRNGLKFFTK GG TS EVE +CD+AARKYANR A+VS  L  PP + D
Sbjct  177   SIMMTASHLPYTRNGLKFFTKSGGFTSLEVEELCDRAARKYANRQARVSLVLTKPPIRAD  236

Query  1374  FMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  1195
              MSAY+KHL+DIIKER+NHPTHYDTPL GFQIIVNAGNGSGGFFTWDVLD+LGADTFGSL
Sbjct  237   LMSAYSKHLQDIIKERINHPTHYDTPLDGFQIIVNAGNGSGGFFTWDVLDRLGADTFGSL  296

Query  1194  HLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDR  1015
             HLNPDGMFPNHIPNPEDK AMA+T+AAVL+++ADLG+VFDTDVDRSGVVD  GN INGD+
Sbjct  297   HLNPDGMFPNHIPNPEDKKAMALTKAAVLEHSADLGIVFDTDVDRSGVVDNQGNSINGDK  356

Query  1014  LIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDG  835
             LIALMSAIVLKEHP TT+VTDARTS+GL+RFI  +GG+HCLYRVGYRNVI+KGV LN++G
Sbjct  357   LIALMSAIVLKEHPETTIVTDARTSIGLSRFIANKGGKHCLYRVGYRNVINKGVQLNKEG  416

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLET  655
             +ETHLMMETSGHGALKENY+LDDGAYMVVKIIIEMV+M+L GS EGIGSLI+ LE+PLE+
Sbjct  417   IETHLMMETSGHGALKENYYLDDGAYMVVKIIIEMVRMRLAGSSEGIGSLIEGLEDPLES  476

Query  654   AELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPA  475
              ELRMDVLSEPRHAK KA+E IE+FR Y+E+  L GW LDSCGDCWV EGCLVD N++P 
Sbjct  477   VELRMDVLSEPRHAKTKAIEVIETFRRYVEEEKLEGWVLDSCGDCWVGEGCLVDLNENPT  536

Query  474   AIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAG  295
             AIDA MYR KV ++E  E GWVHLRQS+HNPNIAVN+QS+I GGC SMA+  RDKFL+A 
Sbjct  537   AIDAHMYRVKVLDKEQNESGWVHLRQSVHNPNIAVNMQSSILGGCHSMAKVFRDKFLIAS  596

Query  294   EMAKFLDISQIDEFAR  247
              + K LD+S I+ + +
Sbjct  597   GLDKILDLSDIERYLK  612



>ref|XP_010916818.1| PREDICTED: uncharacterized protein LOC105041573 [Elaeis guineensis]
Length=625

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/576 (72%), Positives = 496/576 (86%), Gaps = 5/576 (1%)
 Frame = -1

Query  1953  RVESSLTANKHNEVAV-DEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESF  1777
             RVES    ++   V V DEE ++IRRLQNGSDVRGVAL+GEK R+VDLTP AVEAIAESF
Sbjct  50    RVESLTGTDRSIGVLVTDEEGDRIRRLQNGSDVRGVALEGEKERTVDLTPQAVEAIAESF  109

Query  1776  GEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA  1597
             GEW+      ++G    E +RVS+G DPRISG  L AAVFAGL +AGC+VFDMGLATTPA
Sbjct  110   GEWISENSRRDQGQPD-EKIRVSVGRDPRISGPRLGAAVFAGLARAGCMVFDMGLATTPA  168

Query  1596  CFMSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKY-ANRM  1420
             CFMSTVLP F YDASIMMTASHLPYTRNGLKFFT+KGGL+S++VE +C++AARKY A +M
Sbjct  169   CFMSTVLPGFAYDASIMMTASHLPYTRNGLKFFTRKGGLSSSDVEDLCERAARKYTARKM  228

Query  1419  AKVSTALRAPP--SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGF  1246
                      PP  ++VD MSAYA+HLR II +R+NHP+HY TPL+GF++IVNAGNGSGGF
Sbjct  229   GLGRGGGGVPPAATRVDLMSAYAQHLRTIIMDRINHPSHYHTPLKGFKVIVNAGNGSGGF  288

Query  1245  FTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDV  1066
             FTW+VLDKLGADTFGSLHL PDGMFPNHIPNPED+TAM++TRAAVL++ ADLG+VFDTDV
Sbjct  289   FTWNVLDKLGADTFGSLHLEPDGMFPNHIPNPEDRTAMSLTRAAVLEHGADLGIVFDTDV  348

Query  1065  DRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYR  886
             DRSGVVD SG  INGDRLIALM+AIVL+EHPGTTVVTDARTS+ LTRFIT RGG HCLYR
Sbjct  349   DRSGVVDSSGTTINGDRLIALMAAIVLREHPGTTVVTDARTSVALTRFITARGGHHCLYR  408

Query  885   VGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGS  706
             VGYRNVIDKGV LN DGVETHLMMET+GH ALKENYFLDDGAY+VVKIIIEMV+MKL GS
Sbjct  409   VGYRNVIDKGVQLNRDGVETHLMMETTGHAALKENYFLDDGAYLVVKIIIEMVRMKLAGS  468

Query  705   EEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCG  526
             +EGIGS +K+LEEP+E+ ELRM++L++P++AK K  EA+++F+ +IE+G+L GWELD+CG
Sbjct  469   DEGIGSFLKELEEPVESVELRMNILTQPKYAKEKGAEAVDTFKKFIEEGHLQGWELDACG  528

Query  525   DCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPG  346
             DCWVSEGCLVD+ND PAAIDA MYRA+VS+E +G+HGW+HLRQS+HNPNIA+N+QS++ G
Sbjct  529   DCWVSEGCLVDSNDTPAAIDAHMYRAQVSDEVHGQHGWMHLRQSVHNPNIALNMQSSVIG  588

Query  345   GCQSMARDLRDKFLLAGEMAKFLDISQIDEFARNGN  238
             GCQ+MA+  RD+FLLA  + K LDI+QI+++A  G 
Sbjct  589   GCQAMAKVFRDRFLLASGLEKILDITQIEKYAEKGT  624



>ref|XP_009421114.1| PREDICTED: uncharacterized protein LOC104000728 [Musa acuminata 
subsp. malaccensis]
Length=629

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/612 (68%), Positives = 503/612 (82%), Gaps = 22/612 (4%)
 Frame = -1

Query  2034  FPSFP-------IHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNEVAVDEEMEKIRRL  1876
             FP+ P       + +P  ++L +A + P+         S T  + N ++ +EE + IRRL
Sbjct  27    FPANPFKRSATLLDRPFRQALRLAATVPQ-------AVSGTDQQTNVLSANEEGDTIRRL  79

Query  1875  QNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGL--ESERGGAVVESVRVSLG  1702
             QNGSDVRGVAL+GEKGRSVDLTP AVEAIAESFGEWV+  L  ESE+  A    VRVS G
Sbjct  80    QNGSDVRGVALEGEKGRSVDLTPQAVEAIAESFGEWVMESLTRESEQEMA---KVRVSFG  136

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              DPR+SG +LS AV AGL +AGCLVFDMGLATTPACFMSTVLP F YDASIMMTASHLPY
Sbjct  137   RDPRLSGPALSTAVLAGLSRAGCLVFDMGLATTPACFMSTVLPQFAYDASIMMTASHLPY  196

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPP---SKVDFMSAYAKH  1351
             TRNGLKFFT++GGL ++EVE ICD+AARK+  R   +  +   P    + VDFMSAYA+H
Sbjct  197   TRNGLKFFTRRGGLNASEVEDICDRAARKHTTRRMGLGYSGSVPSLTRNNVDFMSAYAEH  256

Query  1350  LRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMF  1171
             LR IIKER+NHP HYDTPL+GF+++VNAGNGSGGFFTW+VLDKLGADTFGSLHL PDGMF
Sbjct  257   LRTIIKERINHPHHYDTPLEGFKVVVNAGNGSGGFFTWNVLDKLGADTFGSLHLEPDGMF  316

Query  1170  PNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAI  991
             PNHIPNPED+TAM++TRAAVL+  ADLG+VFDTDVDRSGVVD +G  INGDRLIALM+AI
Sbjct  317   PNHIPNPEDRTAMSLTRAAVLEQQADLGIVFDTDVDRSGVVDSTGAAINGDRLIALMAAI  376

Query  990   VLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMME  811
             VL+EHPGTTVVTDARTS+ LT FI  RGG HCLYRVGYRNVIDKG+ LN DGVETHLMME
Sbjct  377   VLREHPGTTVVTDARTSVALTEFIAARGGHHCLYRVGYRNVIDKGIQLNRDGVETHLMME  436

Query  810   TSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVL  631
             T+GHGALKEN+FLDDGAYMVVKIIIEMV+MKL GS EGIGSLIK+L++PLE+ ELRM++L
Sbjct  437   TTGHGALKENHFLDDGAYMVVKIIIEMVRMKLMGSSEGIGSLIKELKDPLESVELRMNIL  496

Query  630   SEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYR  451
             ++P+HAK K  E +E+ +  IE+G L GW LD+CGDCWVS+GCLVD+ND P  IDA MYR
Sbjct  497   TQPKHAKQKGAEVVETLKQNIEEGRLRGWHLDACGDCWVSDGCLVDSNDTPVDIDAHMYR  556

Query  450   AKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDI  271
             A+VS+E +G+HGW+ +RQS+HNPNIA+N+QS++ GGCQ++   LRD+FLLA  + +F+DI
Sbjct  557   ARVSDEVHGQHGWIQIRQSVHNPNIAINMQSSMVGGCQAITTTLRDEFLLASGLEEFVDI  616

Query  270   SQIDEFARNGNL  235
             SQ+D +AR+G+L
Sbjct  617   SQVDAYARSGSL  628



>ref|XP_008809830.1| PREDICTED: uncharacterized protein LOC103721410 [Phoenix dactylifera]
Length=650

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/628 (67%), Positives = 506/628 (81%), Gaps = 13/628 (2%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSL----RVESSLTANK  1924
             MA+T+    SL T         FP      RS+ + + +P  +       R+ES  + ++
Sbjct  1     MAATAAPSTSLPTPRCNSWRNIFPSPANTPRSVNVFK-YPSGRTQRAAAGRLESLTSTDR  59

Query  1923  H-NEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES  1747
                 V  DEE ++IRRLQNGSDVRGVAL+GEKGR+VDLTP AVEAIAESFGEW+      
Sbjct  60    SIGVVGTDEEGDRIRRLQNGSDVRGVALEGEKGRTVDLTPQAVEAIAESFGEWISENSRK  119

Query  1746  ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF  1567
             E+G    E +RVS+G DPRISG  L AAVFAGL +AGC+VFDMGLATTPACFMSTVLP F
Sbjct  120   EQGQD--EKIRVSVGRDPRISGPRLGAAVFAGLARAGCMVFDMGLATTPACFMSTVLPGF  177

Query  1566  QYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTA-----  1402
              YDASIMMTASHLPY RNGLKFFT+KGGL+S++VE IC++AARKY  R  ++        
Sbjct  178   AYDASIMMTASHLPYPRNGLKFFTRKGGLSSSDVEEICERAARKYTARKMELGGGGGGGG  237

Query  1401  LRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDK  1222
             +    ++VDFMSAYA+HLR II ER+NHP+HY TPL+GF++IVNAGNGSGGFFTW+VLDK
Sbjct  238   MTPAATRVDFMSAYAQHLRTIIMERINHPSHYHTPLKGFKVIVNAGNGSGGFFTWNVLDK  297

Query  1221  LGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDR  1042
             LGADTFGSLHL PDGMFPNHIPNPED+TAM++TRAAVL++ ADLG+VFDTDVDRSGVVD 
Sbjct  298   LGADTFGSLHLEPDGMFPNHIPNPEDRTAMSLTRAAVLEHGADLGIVFDTDVDRSGVVDS  357

Query  1041  SGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVID  862
             SG  INGDRLIALM+AIVL+EHPGTTVVTDARTS  LTRFIT RGG HCLYRVGYRNVID
Sbjct  358   SGTAINGDRLIALMAAIVLREHPGTTVVTDARTSAALTRFITARGGHHCLYRVGYRNVID  417

Query  861   KGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLI  682
             KGVHLN DGVETHLMMET+GH ALKEN+FLDDGAY+VVKIIIEMV+MKL G +EGIGSL+
Sbjct  418   KGVHLNRDGVETHLMMETTGHAALKENHFLDDGAYLVVKIIIEMVRMKLAGLDEGIGSLL  477

Query  681   KDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGC  502
             K+LEEP E+ ELRM++L++P++AK K  EA+E+F  YIE G+L GWELD+CGDCWVSEGC
Sbjct  478   KELEEPEESVELRMNILAQPKYAKEKGAEAVETFMKYIEWGHLQGWELDTCGDCWVSEGC  537

Query  501   LVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARD  322
             L D+ND PAAIDA MYRA+VS+E +G+HGW+HLRQS+HNP+IA+N+QS + GGC++MA+ 
Sbjct  538   LADSNDIPAAIDAHMYRARVSDEVHGQHGWIHLRQSVHNPDIAINMQSAVIGGCRAMAKV  597

Query  321   LRDKFLLAGEMAKFLDISQIDEFARNGN  238
              RD+FL A  +   LDI+QID++   G 
Sbjct  598   FRDRFLRASGLEIILDITQIDDYVEKGT  625



>ref|XP_008464700.1| PREDICTED: uncharacterized protein LOC103502521 isoform X2 [Cucumis 
melo]
Length=552

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/551 (75%), Positives = 467/551 (85%), Gaps = 14/551 (3%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIA-SKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNE  1915
             MAST T   S++T   S PNF  FP +KPL   +  + +F K      V ++    +H  
Sbjct  1     MAST-TLGTSIKTRGDSFPNFILFP-NKPLSPKVS-SFAFLKRAAPRGVAATWRTAEHGG  57

Query  1914  V----AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES  1747
                   VDEEM +IRRLQNGSDVRGVA++GEKGR+VDLT  AVEAIAESF EWVI+G+E+
Sbjct  58    ALAAEEVDEEMGRIRRLQNGSDVRGVAIEGEKGRTVDLTAAAVEAIAESFSEWVINGMET  117

Query  1746  ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF  1567
              R      SV VS+G DPRISG +LSAAVFAG+ +AGCLVFDMGLATTPACFMSTVL PF
Sbjct  118   GR------SVSVSVGRDPRISGSALSAAVFAGVSRAGCLVFDMGLATTPACFMSTVLSPF  171

Query  1566  QYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPP  1387
              YDASIM+TASHLPYTRNG+KFFTK+GGL+S EVE ICD+AA KYANR+ KVST LR PP
Sbjct  172   SYDASIMLTASHLPYTRNGMKFFTKRGGLSSPEVEEICDRAAAKYANRVVKVSTLLRTPP  231

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
             SKVDFM AY+KHLRDIIK+R+NHP HYDTPLQGF+IIVNAGNGSGGFFTWDVLDKLGADT
Sbjct  232   SKVDFMGAYSKHLRDIIKQRINHPLHYDTPLQGFKIIVNAGNGSGGFFTWDVLDKLGADT  291

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
             FGSLHLNPDGMFPNHIPNPEDKTAM++TRA++L + ADLGVVFDTDVDRSGVVD  GNPI
Sbjct  292   FGSLHLNPDGMFPNHIPNPEDKTAMSLTRASLLDHNADLGVVFDTDVDRSGVVDHEGNPI  351

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHL  847
             NGD+LIALMSAIVL+EHP TT+VTDARTS+ LT+FIT RGG+HCLYRVGYRNVIDKG+ L
Sbjct  352   NGDKLIALMSAIVLREHPATTIVTDARTSVALTKFITNRGGRHCLYRVGYRNVIDKGIQL  411

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEE  667
             N DG+ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMV+MKLEGS EGIGSLIKDLEE
Sbjct  412   NMDGIETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVRMKLEGSNEGIGSLIKDLEE  471

Query  666   PLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTN  487
             PLE+AELR++V+SEP  AK KAVE IE+FR ++++G L GWELDSCGDCWV EGCLVD N
Sbjct  472   PLESAELRLNVISEPSFAKEKAVEVIETFRDFVQEGKLEGWELDSCGDCWVHEGCLVDLN  531

Query  486   DHPAAIDAFMY  454
             DHP  IDA MY
Sbjct  532   DHPKPIDAQMY  542



>ref|XP_008464701.1| PREDICTED: uncharacterized protein LOC103502521 isoform X3 [Cucumis 
melo]
Length=544

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/551 (75%), Positives = 467/551 (85%), Gaps = 14/551 (3%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIA-SKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNE  1915
             MAST T   S++T   S PNF  FP +KPL   +  + +F K      V ++    +H  
Sbjct  1     MAST-TLGTSIKTRGDSFPNFILFP-NKPLSPKVS-SFAFLKRAAPRGVAATWRTAEHGG  57

Query  1914  V----AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES  1747
                   VDEEM +IRRLQNGSDVRGVA++GEKGR+VDLT  AVEAIAESF EWVI+G+E+
Sbjct  58    ALAAEEVDEEMGRIRRLQNGSDVRGVAIEGEKGRTVDLTAAAVEAIAESFSEWVINGMET  117

Query  1746  ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF  1567
              R      SV VS+G DPRISG +LSAAVFAG+ +AGCLVFDMGLATTPACFMSTVL PF
Sbjct  118   GR------SVSVSVGRDPRISGSALSAAVFAGVSRAGCLVFDMGLATTPACFMSTVLSPF  171

Query  1566  QYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPP  1387
              YDASIM+TASHLPYTRNG+KFFTK+GGL+S EVE ICD+AA KYANR+ KVST LR PP
Sbjct  172   SYDASIMLTASHLPYTRNGMKFFTKRGGLSSPEVEEICDRAAAKYANRVVKVSTLLRTPP  231

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
             SKVDFM AY+KHLRDIIK+R+NHP HYDTPLQGF+IIVNAGNGSGGFFTWDVLDKLGADT
Sbjct  232   SKVDFMGAYSKHLRDIIKQRINHPLHYDTPLQGFKIIVNAGNGSGGFFTWDVLDKLGADT  291

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
             FGSLHLNPDGMFPNHIPNPEDKTAM++TRA++L + ADLGVVFDTDVDRSGVVD  GNPI
Sbjct  292   FGSLHLNPDGMFPNHIPNPEDKTAMSLTRASLLDHNADLGVVFDTDVDRSGVVDHEGNPI  351

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHL  847
             NGD+LIALMSAIVL+EHP TT+VTDARTS+ LT+FIT RGG+HCLYRVGYRNVIDKG+ L
Sbjct  352   NGDKLIALMSAIVLREHPATTIVTDARTSVALTKFITNRGGRHCLYRVGYRNVIDKGIQL  411

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEE  667
             N DG+ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMV+MKLEGS EGIGSLIKDLEE
Sbjct  412   NMDGIETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVRMKLEGSNEGIGSLIKDLEE  471

Query  666   PLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTN  487
             PLE+AELR++V+SEP  AK KAVE IE+FR ++++G L GWELDSCGDCWV EGCLVD N
Sbjct  472   PLESAELRLNVISEPSFAKEKAVEVIETFRDFVQEGKLEGWELDSCGDCWVHEGCLVDLN  531

Query  486   DHPAAIDAFMY  454
             DHP  IDA MY
Sbjct  532   DHPKPIDAQMY  542



>ref|XP_006448229.1| hypothetical protein CICLE_v10014623mg [Citrus clementina]
 gb|ESR61469.1| hypothetical protein CICLE_v10014623mg [Citrus clementina]
Length=525

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/515 (79%), Positives = 452/515 (88%), Gaps = 11/515 (2%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFP---IHKPLHRSLGIAQSFPKIKLSLR---VESSLTA  1930
             MAST+T   SLQ+ +S+ +F S P     KP   +       P +  S++   V+SS+T 
Sbjct  1     MASTTTPSISLQSNSSRTSFLSSPGPKCPKPFQIT---GLKLPFLSHSIKFTHVKSSVT-  56

Query  1929  NKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLE  1750
             +K+NEV VDEEM++IRRLQNGSDVRGVAL+GEKGR+VDLTP AVEAIAESFGEWVI  LE
Sbjct  57    DKYNEVVVDEEMDRIRRLQNGSDVRGVALEGEKGRTVDLTPSAVEAIAESFGEWVIRSLE  116

Query  1749  SERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPP  1570
             +ERG  V E V+VSLG DPR+SG SLS AVFAGL +AGCLVFDMGLATTPACFMST+LPP
Sbjct  117   NERGRPV-EDVKVSLGKDPRVSGPSLSVAVFAGLARAGCLVFDMGLATTPACFMSTLLPP  175

Query  1569  FQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAP  1390
             F YDASIMMTASHLPYTRNGLKFFTKKGGLTS  VE IC +AARK+ANR+ KVST  R P
Sbjct  176   FAYDASIMMTASHLPYTRNGLKFFTKKGGLTSPVVEEICGEAARKFANRLTKVSTVPRNP  235

Query  1389  PSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGAD  1210
             P++VDFMSAYAKHLRDIIKERVNHP HY+TP++GFQIIVNAGNGSGGFFTWDVLDKLGAD
Sbjct  236   PTRVDFMSAYAKHLRDIIKERVNHPLHYETPIKGFQIIVNAGNGSGGFFTWDVLDKLGAD  295

Query  1209  TFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNP  1030
             TFGSLHLNPDGMFPNHIPNP DKTAMA+TRAAVL+N ADLGVVFDTDVDRSGVVD  GNP
Sbjct  296   TFGSLHLNPDGMFPNHIPNPGDKTAMALTRAAVLENNADLGVVFDTDVDRSGVVDNKGNP  355

Query  1029  INGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVH  850
             INGD+LIALMSAIVLKEHPGTT+VTDARTSM LT+FIT RGG HCLYRVGYRNVIDKGVH
Sbjct  356   INGDKLIALMSAIVLKEHPGTTIVTDARTSMPLTKFITDRGGNHCLYRVGYRNVIDKGVH  415

Query  849   LNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLE  670
             LNEDG+ETHLMMETSGHGALKENYFLDDGAY+VVKIII+MV+MKLEGS+EGIGSLIKDLE
Sbjct  416   LNEDGIETHLMMETSGHGALKENYFLDDGAYLVVKIIIQMVRMKLEGSDEGIGSLIKDLE  475

Query  669   EPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIE  565
             EPLE+ ELRM+++SEPR+AKAK  EAIE FR YIE
Sbjct  476   EPLESIELRMNIISEPRYAKAKGSEAIEEFRKYIE  510



>ref|NP_001057639.1| Os06g0476200 [Oryza sativa Japonica Group]
 dbj|BAD35745.1| putative phosphomannomutase [Oryza sativa Japonica Group]
 dbj|BAF19553.1| Os06g0476200 [Oryza sativa Japonica Group]
 gb|EEE65712.1| hypothetical protein OsJ_21347 [Oryza sativa Japonica Group]
Length=625

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/581 (68%), Positives = 467/581 (80%), Gaps = 12/581 (2%)
 Frame = -1

Query  1974  PKIKLSLRVESSLTANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVE  1795
             PK     R+E+S  A         E+ + IRRLQNG DVRGVAL+GE GR+VDLTP AVE
Sbjct  52    PKAATGGRLETSTDA----AAVAGEDGDVIRRLQNGPDVRGVALEGENGRAVDLTPLAVE  107

Query  1794  AIAESFGEWV---ISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVF  1624
              IAESFGEW+   +  LES R G     VRVS+G DPR+SG  L AA+FAGL +AGC VF
Sbjct  108   VIAESFGEWLREELQQLESGRDGG---EVRVSVGRDPRLSGARLGAALFAGLARAGCSVF  164

Query  1623  DMGLATTPACFMSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKA  1444
             D+GLATTPACFMST LP F YDASIMMTASHLPYTRNGLKFF K+GGLTS EVE +CD+A
Sbjct  165   DVGLATTPACFMSTKLPRFSYDASIMMTASHLPYTRNGLKFFMKRGGLTSGEVEGVCDRA  224

Query  1443  ARKYANRMAKVSTALRAPPS--KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVN  1270
             ARKY  R   +      PP   +VD MSAYA+HLR+IIKERV HPTHYDTPL+GF++IVN
Sbjct  225   ARKYVARKMGLGGGRGMPPVVMRVDLMSAYAQHLRNIIKERVAHPTHYDTPLKGFKVIVN  284

Query  1269  AGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADL  1090
             AGNG GGFFTWDVL+KLGADT GSLHL PDG FP+H+PNPED TAM++TR AVL + ADL
Sbjct  285   AGNGCGGFFTWDVLEKLGADTTGSLHLEPDGKFPHHMPNPEDTTAMSLTRDAVLDHGADL  344

Query  1089  GVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR  910
             GVVFDTDVDRSGVVD +G  INGDRLIALMSAIVL EHPGTTVVTDARTS GLTRFI  R
Sbjct  345   GVVFDTDVDRSGVVDATGAAINGDRLIALMSAIVLDEHPGTTVVTDARTSDGLTRFIQAR  404

Query  909   GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEM  730
             GG HCLYRVGYRNVIDKGV LN DGVETHLMMET+GHGALKEN FLDDGAYMVVKIIIEM
Sbjct  405   GGHHCLYRVGYRNVIDKGVQLNADGVETHLMMETTGHGALKENNFLDDGAYMVVKIIIEM  464

Query  729   VKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLP  550
             V+M+L G E  +G+LI DLEEP E+  +RM++L E ++AK +  +A+E+FR++I++G L 
Sbjct  465   VRMRLVGLEGSVGTLIMDLEEPAESKLMRMNILGEAKYAKQRGTQAVETFRNHIQEGKLN  524

Query  549   GWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAV  370
             GW LD CGDC VS+GCLVDTND P  +DA+MYRAK  +E  GE GWVH+RQS+HNPNIA+
Sbjct  525   GWVLDDCGDCSVSQGCLVDTNDDPFDVDAYMYRAKFFDEYKGELGWVHIRQSVHNPNIAI  584

Query  369   NLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQIDEFAR  247
             N+QS+IPGGC+SMA+DL D++LL   + +F+DI+++ +F +
Sbjct  585   NMQSSIPGGCKSMAKDLLDRYLLTSGVNEFVDITEVQKFVK  625



>ref|XP_004965413.1| PREDICTED: uncharacterized protein LOC101782278 [Setaria italica]
Length=619

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/621 (66%), Positives = 479/621 (77%), Gaps = 15/621 (2%)
 Frame = -1

Query  2082  TSTTPQSLQTI--ASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNEVA  1909
             T+++P +LQ    AS       P   P  R     Q   +   S R + S+T  +  EV 
Sbjct  5     TTSSPATLQPCKHASHGEVRRCP-PLPWRRRRSYGQVTTRATASSRGQPSVTGGR-VEVP  62

Query  1908  VD------EEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES  1747
             V       EE + IRRLQNG DVRGVAL+GE GR VDLTP AVE IAESFGEW+   L+ 
Sbjct  63    VGVAAEAGEEGDSIRRLQNGPDVRGVALEGENGRPVDLTPLAVEVIAESFGEWLHEELQR  122

Query  1746  ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF  1567
               G    E +RVS+G DPR+SG  LSAA+FAGL +AGC VFD+GLATTPACFMSTVLP F
Sbjct  123   PEG----EELRVSVGRDPRLSGARLSAALFAGLARAGCSVFDVGLATTPACFMSTVLPRF  178

Query  1566  QYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKY-ANRMAKVSTALRAP  1390
              YDAS+MMTASHLPYTRNGLKFFTK+GGLTS +VE IC +AA+KY A +M      +   
Sbjct  179   NYDASVMMTASHLPYTRNGLKFFTKRGGLTSGDVEKICYRAAKKYVARKMGSGGGGMPPV  238

Query  1389  PSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGAD  1210
               +VD MSAYA+HLRDIIK+RV HPTHYDTPL+GF+++VNAGNG GGFFTWDVL+KLGAD
Sbjct  239   VMRVDLMSAYAQHLRDIIKQRVAHPTHYDTPLKGFKVVVNAGNGCGGFFTWDVLEKLGAD  298

Query  1209  TFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNP  1030
             T GSLHL PDG FPNH+PNPED TAM++TR AVL + ADLGVVFDTDVDRSGVVD +G  
Sbjct  299   TTGSLHLEPDGTFPNHMPNPEDATAMSLTRDAVLAHGADLGVVFDTDVDRSGVVDDTGAA  358

Query  1029  INGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVH  850
             INGDRLIALMSAIVL EHP TTVVTDAR S GLTRFI  RGGQHCLYRVGYRNVIDKGV 
Sbjct  359   INGDRLIALMSAIVLDEHPSTTVVTDARASDGLTRFIASRGGQHCLYRVGYRNVIDKGVQ  418

Query  849   LNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLE  670
             LN DGVETHLMMET+GHGALKENYFLDDGAYMVVKI+IEMV+MKL G E G+GSLI DLE
Sbjct  419   LNTDGVETHLMMETTGHGALKENYFLDDGAYMVVKIVIEMVRMKLSGLEGGVGSLIMDLE  478

Query  669   EPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDT  490
             EP E+  LRM++L EP++AK +   A+E+F+ YIE+  L GW LD CGDC V+EGCLVDT
Sbjct  479   EPAESVLLRMNILGEPKYAKQRGTMAVEAFKKYIEEDKLSGWVLDDCGDCSVAEGCLVDT  538

Query  489   NDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDK  310
             NDHP  +DA+MYRAK+ +E     G VH+RQS+HNPNIA+N+QS +P GC+ MARDL  +
Sbjct  539   NDHPIDVDAYMYRAKLYDENKKPVGMVHVRQSVHNPNIALNMQSYVPDGCKFMARDLHKR  598

Query  309   FLLAGEMAKFLDISQIDEFAR  247
             FLLA  + +F+DIS++++F +
Sbjct  599   FLLASGVNEFVDISEVEKFVK  619



>dbj|BAK05013.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/555 (71%), Positives = 451/555 (81%), Gaps = 4/555 (1%)
 Frame = -1

Query  1902  EEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVE  1723
             EE + IRRLQNG DVRGVAL+GEKGR+VDLTP AVE I ESFGEW+        G    +
Sbjct  71    EEGDVIRRLQNGPDVRGVALEGEKGRAVDLTPLAVEVIGESFGEWLRDQRREPEGEEGEQ  130

Query  1722  SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMM  1543
              +RVS+G DPR+SG  LSA +FAGL +AGC VFDMGLATTPACFMST+LP F YDASIMM
Sbjct  131   -LRVSVGRDPRLSGSRLSAVLFAGLAKAGCAVFDMGLATTPACFMSTILPRFSYDASIMM  189

Query  1542  TASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPS---KVDF  1372
             TASHLPYTRNGLKFFTK+GGL+S EVE ICD+AARKYA R   +       P    +VD 
Sbjct  190   TASHLPYTRNGLKFFTKRGGLSSVEVEGICDRAARKYAARKMGLGGGGLGMPPVVMRVDL  249

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             MSAYAKHLRDIIKERV HPTHYDTPL+GF++IVNAGNG GGFF WDVL+KLGADT GSLH
Sbjct  250   MSAYAKHLRDIIKERVAHPTHYDTPLEGFKVIVNAGNGCGGFFAWDVLEKLGADTTGSLH  309

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             L PDGMFPNH+PNPED TAM++TR AVL N ADLGVVFDTDVDRSGVVD SG  INGDRL
Sbjct  310   LEPDGMFPNHMPNPEDATAMSLTRGAVLANGADLGVVFDTDVDRSGVVDDSGAAINGDRL  369

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGV  832
             IAL+SAIVL EHPGTTVVTDAR   GLTRFI  RGG+HCLYRVGYRNVIDKG  LN DGV
Sbjct  370   IALISAIVLAEHPGTTVVTDARAGDGLTRFIEARGGRHCLYRVGYRNVIDKGAQLNADGV  429

Query  831   ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETA  652
             ETH+MMET+GHGAL+EN+FLDDGAYMVVKIIIEMV+M+L G E G+G LI+DLEEP E+ 
Sbjct  430   ETHVMMETTGHGALRENHFLDDGAYMVVKIIIEMVRMRLAGLEGGVGGLIRDLEEPAESV  489

Query  651   ELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAA  472
              LRMD++ EP+ AK + VEA+E+F+ YIE G L GW LD CGDC V +GCLVD NDHP  
Sbjct  490   LLRMDIVGEPKSAKQRGVEAVEAFKKYIEDGKLSGWVLDDCGDCSVDQGCLVDNNDHPID  549

Query  471   IDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGE  292
             +DA+MYRAK  +E     GWVH+RQS+HNPNIA+NLQS +PGGC+SMA DL ++FLL   
Sbjct  550   VDAYMYRAKFYDESQRPLGWVHIRQSVHNPNIALNLQSCVPGGCRSMAVDLFERFLLTSG  609

Query  291   MAKFLDISQIDEFAR  247
             + +F+DIS++ +F +
Sbjct  610   VNEFVDISEVQKFVK  624



>gb|EEC80611.1| hypothetical protein OsI_22972 [Oryza sativa Indica Group]
Length=625

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/581 (68%), Positives = 466/581 (80%), Gaps = 12/581 (2%)
 Frame = -1

Query  1974  PKIKLSLRVESSLTANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVE  1795
             PK     R+E+S  A         E+ + IRRLQNG DVRGVAL+GE GR+VDLTP AVE
Sbjct  52    PKAATGGRLETSTDA----AAVAGEDGDVIRRLQNGPDVRGVALEGENGRAVDLTPLAVE  107

Query  1794  AIAESFGEWV---ISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVF  1624
              IAESFGEW+   +  LES R G     VRVS+G DPR+SG  L AA+FAGL +AGC VF
Sbjct  108   VIAESFGEWLREELQQLESGRDGG---EVRVSVGRDPRLSGARLGAALFAGLARAGCSVF  164

Query  1623  DMGLATTPACFMSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKA  1444
             D+GLATTPACFMST LP F YDASIMMTASHLPYTRNGLK F K+GGLTS EVE +CD+A
Sbjct  165   DVGLATTPACFMSTKLPRFSYDASIMMTASHLPYTRNGLKLFMKRGGLTSGEVEGVCDRA  224

Query  1443  ARKYANRMAKVSTALRAPPS--KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVN  1270
             ARKY  R   +      PP   +VD MSAYA+HLR+IIKERV HPTHYDTPL+GF++IVN
Sbjct  225   ARKYVARKMGLGGGRGMPPVVMRVDLMSAYAQHLRNIIKERVAHPTHYDTPLKGFKVIVN  284

Query  1269  AGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADL  1090
             AGNG GGFFTWDVL+KLGADT GSLHL PDG FP+H+PNPED TAM++TR AVL + ADL
Sbjct  285   AGNGCGGFFTWDVLEKLGADTTGSLHLEPDGKFPHHMPNPEDTTAMSLTRDAVLDHGADL  344

Query  1089  GVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR  910
             GVVFDTDVDRSGVVD +G  INGDRLIALMSAIVL EHPGTTVVTDARTS GLTRFI  R
Sbjct  345   GVVFDTDVDRSGVVDATGAAINGDRLIALMSAIVLDEHPGTTVVTDARTSDGLTRFIQAR  404

Query  909   GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEM  730
             GG HCLYRVGYRNVIDKGV LN DGVETHLMMET+GHGALKEN FLDDGAY+VVKIIIEM
Sbjct  405   GGHHCLYRVGYRNVIDKGVQLNADGVETHLMMETTGHGALKENNFLDDGAYIVVKIIIEM  464

Query  729   VKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLP  550
             V+M+L G E  +G+LI DLEEP E+  +RM++L E ++AK +  +A+E+FR++I++G L 
Sbjct  465   VRMRLVGLEGSVGTLIMDLEEPAESKLMRMNILGEAKYAKQRGTQAVETFRNHIQEGKLN  524

Query  549   GWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAV  370
             GW LD CGDC VS+GCLVDTND P  +DA+MYRAK  +E  GE GWVH+RQS+HNPNIA+
Sbjct  525   GWVLDDCGDCSVSQGCLVDTNDDPFDVDAYMYRAKFFDEYKGELGWVHIRQSVHNPNIAI  584

Query  369   NLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQIDEFAR  247
             N+QS+IPGGC+SMA+DL D++LL   + +F+DI+++ +F +
Sbjct  585   NMQSSIPGGCKSMAKDLLDRYLLTSGVNEFVDITEVQKFVK  625



>ref|XP_008651739.1| PREDICTED: uncharacterized protein LOC100383547 isoform X2 [Zea 
mays]
 tpg|DAA60888.1| TPA: hypothetical protein ZEAMMB73_594547 [Zea mays]
Length=618

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/631 (65%), Positives = 481/631 (76%), Gaps = 29/631 (5%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVES---------S  1939
             MA  +T+P ++Q  + K            H S G A+  P   LS +  S         +
Sbjct  1     MAMVTTSPATVQPSSCK------------HTSRGAARCCPPPLLSWKTRSFGQQVTTRAT  48

Query  1938  LTANKHNEVAV----DEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGE  1771
               +++     V     EE + IRRLQNGSDVRGVAL+GEKGR+VDLTP AVEAIAESFGE
Sbjct  49    AASSRGQPAGVAQAGGEEGDSIRRLQNGSDVRGVALEGEKGRAVDLTPLAVEAIAESFGE  108

Query  1770  WVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACF  1591
             W +   E    G   E +RVS+G DPR+SG  LSAA+FAGL +AGC VFDMGLATTPACF
Sbjct  109   W-LREEELRLRGQEPEQLRVSVGRDPRLSGPRLSAALFAGLARAGCSVFDMGLATTPACF  167

Query  1590  MSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKV  1411
             MST+LP F YD SIMMTASHLPYTRNGLKFFTK+GGLTS +VE ICD+AA KY  R   V
Sbjct  168   MSTILPRFNYDGSIMMTASHLPYTRNGLKFFTKRGGLTSGDVENICDRAAHKYVARKTGV  227

Query  1410  STALRAPPS---KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFT  1240
                 R  P    +VD MSAYA+HLRDIIK+RV HPTHYDTPL+GF+++VNAGNG GGFFT
Sbjct  228   GGGGRGTPPVVMRVDLMSAYAQHLRDIIKQRVAHPTHYDTPLRGFKVVVNAGNGCGGFFT  287

Query  1239  WDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDR  1060
             WDVL+KLGADT GSLHL PDG FPNHIPNPED TAM++TR AVL   ADLGVVFDTDVDR
Sbjct  288   WDVLEKLGADTTGSLHLEPDGRFPNHIPNPEDATAMSLTRGAVLAQGADLGVVFDTDVDR  347

Query  1059  SGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVG  880
             SGVVD  G  INGDRLIALMSAIVL EHPGT VVTDAR S GLTRF+  RGG+HCLYRVG
Sbjct  348   SGVVDAGGAAINGDRLIALMSAIVLGEHPGTMVVTDARASDGLTRFVESRGGRHCLYRVG  407

Query  879   YRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEE  700
             YRNVIDKGV LN DGVETHLMMET+GHGALKENYFLDDGAYMVVKIIIEMV+MKL G E 
Sbjct  408   YRNVIDKGVQLNADGVETHLMMETTGHGALKENYFLDDGAYMVVKIIIEMVRMKLAGVEG  467

Query  699   GIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDC  520
             G+GSLI+DL+EP E+  LRMDV+ EP+ AK +A  A+E+F++YI++  L GW LD CGDC
Sbjct  468   GVGSLIRDLQEPAESVLLRMDVMGEPKDAKERATHAVEAFKNYIQEDKLFGWVLDDCGDC  527

Query  519   WVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGC  340
              V+EGCL+DTN+ P  +DA MYRAK+ +E     G VH+RQS+HNPNIA+N+QS  PGGC
Sbjct  528   SVAEGCLMDTNNDPIDVDAHMYRAKLYDENQRAVGMVHIRQSVHNPNIALNMQSYAPGGC  587

Query  339   QSMARDLRDKFLLAGEMAKFLDISQIDEFAR  247
             +SMA+DL ++FLLA  +  FLDISQ+++F +
Sbjct  588   KSMAKDLLERFLLASGLNGFLDISQVEKFVQ  618



>ref|XP_006838103.1| hypothetical protein AMTR_s00106p00039260 [Amborella trichopoda]
 gb|ERN00672.1| hypothetical protein AMTR_s00106p00039260 [Amborella trichopoda]
Length=677

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/550 (71%), Positives = 450/550 (82%), Gaps = 7/550 (1%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             IRRLQNGSDVRGVAL+GE+G+ VDLTP AV A+AESFG WV    + +  G +    RVS
Sbjct  131   IRRLQNGSDVRGVALEGEEGKEVDLTPQAVRALAESFGLWVAE--KQDHPGPL----RVS  184

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHL  1528
             LG DPRISG  LS+A F GL  AGC  FD+GLATTPACFMST+LP F YDASIMMTASHL
Sbjct  185   LGRDPRISGAELSSAAFEGLCDAGCEAFDIGLATTPACFMSTILPSFSYDASIMMTASHL  244

Query  1527  PYTRNGLKFFTKKGGLTSTEVEAICDKAARKY-ANRMAKVSTALRAPPSKVDFMSAYAKH  1351
             P+TRNGLKFFT  GGL S +VE ICDKAA  Y +N   +  + +    S VDFM  YA+H
Sbjct  245   PFTRNGLKFFTADGGLNSKDVEEICDKAAAIYCSNEKPRAISTVGVRVSSVDFMRVYAEH  304

Query  1350  LRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMF  1171
             LR+IIKERVNHP HYDTPL GF+I+VNAGNGSGGFF  +VLDKLGADT GSL+L+PDGMF
Sbjct  305   LRNIIKERVNHPLHYDTPLLGFKIVVNAGNGSGGFFAREVLDKLGADTGGSLNLDPDGMF  364

Query  1170  PNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAI  991
             PNHIPNPEDK AMA T+A+VL++ A LG+VFDTDVDRSGVVD  GNPINGDRLIALMS I
Sbjct  365   PNHIPNPEDKVAMATTKASVLRHHAHLGIVFDTDVDRSGVVDEKGNPINGDRLIALMSTI  424

Query  990   VLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMME  811
             VL +HP +T+VTDARTS+ LTRFIT RGG HCLYRVGYRNVIDKGV LN  GVETHLMME
Sbjct  425   VLSQHPDSTIVTDARTSIALTRFITSRGGNHCLYRVGYRNVIDKGVQLNRAGVETHLMME  484

Query  810   TSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVL  631
             T+GHGALKEN FLDDGAYMVVKIIIEMV+M+L GS EGIGSLI++LEEP E+ ELRM++L
Sbjct  485   TTGHGALKENRFLDDGAYMVVKIIIEMVRMRLAGSNEGIGSLIQELEEPTESVELRMNIL  544

Query  630   SEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYR  451
             + P+ AK +  + IE+ R +IE+G L GWELDSCGDCWVSEGCLVDTND P AIDA MYR
Sbjct  545   THPQQAKERGAQTIEALRRFIEEGRLEGWELDSCGDCWVSEGCLVDTNDEPTAIDAHMYR  604

Query  450   AKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDI  271
             AKV +EENG++GWVH+RQS+HNPNIA+N+QS+I  GCQSM R L ++F+ A  + + LD 
Sbjct  605   AKVWDEENGQYGWVHIRQSVHNPNIAINMQSSINSGCQSMCRMLFERFIRANSLDEDLDT  664

Query  270   SQIDEFARNG  241
             SQ++ FAR G
Sbjct  665   SQVESFARKG  674



>ref|XP_008651738.1| PREDICTED: uncharacterized protein LOC100383547 isoform X1 [Zea 
mays]
Length=625

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/638 (65%), Positives = 481/638 (75%), Gaps = 36/638 (6%)
 Frame = -1

Query  2091  MASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVES--------SL  1936
             MA  +T+P ++Q  + K            H S G A+  P   LS +  S        + 
Sbjct  1     MAMVTTSPATVQPSSCK------------HTSRGAARCCPPPLLSWKTRSFGQQVTTRAT  48

Query  1935  TANKHNE-----VAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGE  1771
              A+   +      A  EE + IRRLQNGSDVRGVAL+GEKGR+VDLTP AVEAIAESFGE
Sbjct  49    AASSRGQPAGVAQAGGEEGDSIRRLQNGSDVRGVALEGEKGRAVDLTPLAVEAIAESFGE  108

Query  1770  WVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACF  1591
             W +   E    G   E +RVS+G DPR+SG  LSAA+FAGL +AGC VFDMGLATTPACF
Sbjct  109   W-LREEELRLRGQEPEQLRVSVGRDPRLSGPRLSAALFAGLARAGCSVFDMGLATTPACF  167

Query  1590  MSTVLPPFQYDASIM-------MTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKY  1432
             MST+LP F YD SIM       MTASHLPYTRNGLKFFTK+GGLTS +VE ICD+AA KY
Sbjct  168   MSTILPRFNYDGSIMIGVACMQMTASHLPYTRNGLKFFTKRGGLTSGDVENICDRAAHKY  227

Query  1431  ANRMAKVSTALRAPPS---KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGN  1261
               R   V    R  P    +VD MSAYA+HLRDIIK+RV HPTHYDTPL+GF+++VNAGN
Sbjct  228   VARKTGVGGGGRGTPPVVMRVDLMSAYAQHLRDIIKQRVAHPTHYDTPLRGFKVVVNAGN  287

Query  1260  GSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVV  1081
             G GGFFTWDVL+KLGADT GSLHL PDG FPNHIPNPED TAM++TR AVL   ADLGVV
Sbjct  288   GCGGFFTWDVLEKLGADTTGSLHLEPDGRFPNHIPNPEDATAMSLTRGAVLAQGADLGVV  347

Query  1080  FDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQ  901
             FDTDVDRSGVVD  G  INGDRLIALMSAIVL EHPGT VVTDAR S GLTRF+  RGG+
Sbjct  348   FDTDVDRSGVVDAGGAAINGDRLIALMSAIVLGEHPGTMVVTDARASDGLTRFVESRGGR  407

Query  900   HCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKM  721
             HCLYRVGYRNVIDKGV LN DGVETHLMMET+GHGALKENYFLDDGAYMVVKIIIEMV+M
Sbjct  408   HCLYRVGYRNVIDKGVQLNADGVETHLMMETTGHGALKENYFLDDGAYMVVKIIIEMVRM  467

Query  720   KLEGSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWE  541
             KL G E G+GSLI+DL+EP E+  LRMDV+ EP+ AK +A  A+E+F++YI++  L GW 
Sbjct  468   KLAGVEGGVGSLIRDLQEPAESVLLRMDVMGEPKDAKERATHAVEAFKNYIQEDKLFGWV  527

Query  540   LDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQ  361
             LD CGDC V+EGCL+DTN+ P  +DA MYRAK+ +E     G VH+RQS+HNPNIA+N+Q
Sbjct  528   LDDCGDCSVAEGCLMDTNNDPIDVDAHMYRAKLYDENQRAVGMVHIRQSVHNPNIALNMQ  587

Query  360   SNIPGGCQSMARDLRDKFLLAGEMAKFLDISQIDEFAR  247
             S  PGGC+SMA+DL ++FLLA  +  FLDISQ+++F +
Sbjct  588   SYAPGGCKSMAKDLLERFLLASGLNGFLDISQVEKFVQ  625



>ref|XP_003560751.2| PREDICTED: uncharacterized protein LOC100828045 isoform X1 [Brachypodium 
distachyon]
Length=656

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/549 (71%), Positives = 452/549 (82%), Gaps = 10/549 (2%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             IRRLQNG DVRGVAL+GEKGR VDLTP AVE I ESFGEW+    E++      + VRVS
Sbjct  109   IRRLQNGPDVRGVALEGEKGRPVDLTPLAVELIGESFGEWLHDQREAQE-----QQVRVS  163

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHL  1528
             +G DPR+SG  LSAA+FAGL  AGC VFDMGLATTPACFMST+LP F YDASIMMTASHL
Sbjct  164   VGRDPRLSGPRLSAALFAGLASAGCAVFDMGLATTPACFMSTILPQFSYDASIMMTASHL  223

Query  1527  PYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANR--MAKVSTALRAPPS--KVDFMSAY  1360
             PYTRNGLKFFTK+GGLTS EVE ICD AARKYA R  MA  +     PP+  +VD MSAY
Sbjct  224   PYTRNGLKFFTKRGGLTSNEVERICDLAARKYAARKKMAGGNNN-NMPPAVPQVDLMSAY  282

Query  1359  AKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPD  1180
             A+HLRDIIKERV HPT YDTPL+GF++ VNAGNG GGFF  DVL KLGADT GSLHL+PD
Sbjct  283   AEHLRDIIKERVAHPTSYDTPLEGFKVTVNAGNGCGGFFATDVLAKLGADTSGSLHLDPD  342

Query  1179  GMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALM  1000
             G FPNH+PNPED TAM++TR AVL + ADLGVVFDTDVDRSGVVD +G  INGDRLIAL+
Sbjct  343   GTFPNHMPNPEDATAMSLTRGAVLAHGADLGVVFDTDVDRSGVVDSTGAAINGDRLIALI  402

Query  999   SAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHL  820
             SAIVL+EHPGTTVVTDAR   GLTRFI  RGG+HCLYRVGYRNVIDKG  LNEDGVETH+
Sbjct  403   SAIVLREHPGTTVVTDARAGDGLTRFIEARGGRHCLYRVGYRNVIDKGAQLNEDGVETHV  462

Query  819   MMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRM  640
             MMET+GHGALKEN+FLDDGAYMVVKI+IEMV+M+L GSE G+GSLI+DLEEP E   LRM
Sbjct  463   MMETTGHGALKENHFLDDGAYMVVKIVIEMVRMRLAGSEGGVGSLIEDLEEPAEAVLLRM  522

Query  639   DVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF  460
             D+  EP++AK + ++A+E+F+ YI++G L GW LD CGDC V +GCLVD+NDHP  +DA+
Sbjct  523   DIGGEPKYAKQRGIQAVETFKEYIQEGKLEGWVLDDCGDCSVDQGCLVDSNDHPIDVDAY  582

Query  459   MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKF  280
             MYRAK  +E  G+ GWVH+RQS+HNPNIA+N+QS IPGGC+SMA DL  +FLL   + +F
Sbjct  583   MYRAKFYDESLGQVGWVHIRQSVHNPNIALNMQSCIPGGCKSMATDLFHRFLLTSGVNEF  642

Query  279   LDISQIDEF  253
             +DI+++  F
Sbjct  643   VDITKVQNF  651



>ref|XP_002459972.1| hypothetical protein SORBIDRAFT_02g019490 [Sorghum bicolor]
 gb|EER96493.1| hypothetical protein SORBIDRAFT_02g019490 [Sorghum bicolor]
Length=629

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/556 (71%), Positives = 454/556 (82%), Gaps = 3/556 (1%)
 Frame = -1

Query  1905  DEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVV  1726
             +EE + IRRLQNGSDVRGVAL+GEK R+VDLTP AVEAIAESFGEW+       RG    
Sbjct  74    EEEGDSIRRLQNGSDVRGVALEGEKCRAVDLTPLAVEAIAESFGEWLREEELRLRGEEPQ  133

Query  1725  ESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIM  1546
             + +RVS+G DPR+SG  L AA+FAGL  AGC VFDMGLATTPACFMST+LP F YDASIM
Sbjct  134   QQLRVSVGRDPRLSGPRLGAALFAGLASAGCSVFDMGLATTPACFMSTILPRFNYDASIM  193

Query  1545  MTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANR--MAKVSTALRAPPS-KVD  1375
             +TASHLPYTRNGLKFFTK+GGLTS +VE ICD+AA+KY  R  M    T    P   +VD
Sbjct  194   LTASHLPYTRNGLKFFTKRGGLTSGDVETICDRAAQKYVARRKMGLGDTPPPPPVVMRVD  253

Query  1374  FMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  1195
              MSAYA+HLRDIIK+RV HP HYDTPL+GF+++VNAGNG GGFFT DVL+KLGADT GSL
Sbjct  254   LMSAYAQHLRDIIKQRVAHPEHYDTPLRGFKVVVNAGNGCGGFFTRDVLEKLGADTTGSL  313

Query  1194  HLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDR  1015
             HL+PDG FPNH+PNPED TAM++TR AVL   ADLGVVFDTDVDRSGVVD  G  INGDR
Sbjct  314   HLDPDGRFPNHMPNPEDATAMSLTRGAVLAQGADLGVVFDTDVDRSGVVDAGGAAINGDR  373

Query  1014  LIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDG  835
             LIALMSAIVL EH GT VVTDAR S GLTRFI  RGG+HCLYRVGYRNVIDKGV LN+DG
Sbjct  374   LIALMSAIVLGEHGGTMVVTDARASDGLTRFIESRGGRHCLYRVGYRNVIDKGVQLNDDG  433

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLET  655
             VETHLMMET+GHGAL+ENYFLDDGAYMVVKIIIEMV+MKL G E G+GSLI DLEEP E+
Sbjct  434   VETHLMMETTGHGALRENYFLDDGAYMVVKIIIEMVRMKLAGVEGGVGSLIADLEEPAES  493

Query  654   AELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPA  475
               LRMDVL EP+HAK +A +A+E+F+ YI +  L GW LD CGDC VSEGCL D+ND P 
Sbjct  494   VLLRMDVLGEPKHAKQRATQAVEAFKKYIMEDKLSGWVLDDCGDCSVSEGCLEDSNDRPI  553

Query  474   AIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAG  295
              +DA+MYRAK+ +E     G VHLRQS+HNPNIA+N+QS +PGGC+SMA+DL  +FLLA 
Sbjct  554   DVDAYMYRAKLYDENERALGMVHLRQSVHNPNIALNMQSYVPGGCKSMAKDLHQRFLLAS  613

Query  294   EMAKFLDISQIDEFAR  247
              + +F+DIS++++F +
Sbjct  614   GLNEFVDISEVEKFIK  629



>ref|XP_006656933.1| PREDICTED: uncharacterized protein LOC102704346 [Oryza brachyantha]
Length=633

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/574 (67%), Positives = 458/574 (80%), Gaps = 17/574 (3%)
 Frame = -1

Query  1950  VESSLTANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGE  1771
             +++S +     E A D     IRRLQNG DVRGVAL+GEKGR+VDLTP AVE IAESFGE
Sbjct  67    LKTSTSGTAREEAAGD----VIRRLQNGPDVRGVALEGEKGRAVDLTPLAVEVIAESFGE  122

Query  1770  WV----ISGLESER--GGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLA  1609
             W+    +  LES    GG     +RVS+G DPR+SG +L AA+FAGL +AGC VFDMGLA
Sbjct  123   WLRDQDLQPLESRTTDGG----EMRVSVGRDPRLSGAALGAALFAGLARAGCAVFDMGLA  178

Query  1608  TTPACFMSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYA  1429
             TTPACFMST LP F YDASIMMTASHLPYTRNGLKFFTK+GGLTS +VE ICD AARKY 
Sbjct  179   TTPACFMSTKLPRFSYDASIMMTASHLPYTRNGLKFFTKRGGLTSGDVEDICDLAARKYV  238

Query  1428  NRMAKVSTALRAPPS--KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGS  1255
              R   +      PP   +V+ M+AYA+HLRDIIKERV HPTHYDTPL+GF++IVNAGNG 
Sbjct  239   ARKMGLGGGRGMPPVVMRVNAMTAYAQHLRDIIKERVAHPTHYDTPLKGFKVIVNAGNGC  298

Query  1254  GGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFD  1075
             GGFFTWDVL+KLGADT GSLHL PDG FP   P      AM++TRAAVL   ADLGVVFD
Sbjct  299   GGFFTWDVLEKLGADTTGSLHLEPDGEFPPPPPRGP-PPAMSLTRAAVLGRGADLGVVFD  357

Query  1074  TDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHC  895
             TDVDRSGVVD +G  INGDRLIALMS++VL EHPGTTVVTDAR   GLTRFI  RGG+HC
Sbjct  358   TDVDRSGVVDATGAAINGDRLIALMSSVVLGEHPGTTVVTDARAGEGLTRFIEARGGRHC  417

Query  894   LYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKL  715
             LYRVGYRNVIDKGV LN DGVETHLMMET+GHGALKENYFLDDGAYMVVKIIIEMV+M+L
Sbjct  418   LYRVGYRNVIDKGVQLNADGVETHLMMETTGHGALKENYFLDDGAYMVVKIIIEMVRMRL  477

Query  714   EGSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELD  535
             +G E  IGSLIKDLEEP E+  LRM++L E ++AK +  +A+++F +YI++  L GW LD
Sbjct  478   QGLEGSIGSLIKDLEEPAESVLLRMNILGEAKYAKQRGAQAVQTFYNYIQERKLNGWVLD  537

Query  534   SCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSN  355
              CGDC VS+GCLVDTND+P A+DA+MYRAK  ++ N + GWVH+RQS+HNPNIA+N+QS+
Sbjct  538   DCGDCSVSQGCLVDTNDNPIAVDAYMYRAKFFDDYNRQLGWVHIRQSVHNPNIAINMQSS  597

Query  354   IPGGCQSMARDLRDKFLLAGEMAKFLDISQIDEF  253
             +PGGC+SMA++L +++LL   +  F+DISQ+ +F
Sbjct  598   VPGGCKSMAKNLLERYLLTSGINDFVDISQVQKF  631



>ref|XP_010227685.1| PREDICTED: uncharacterized protein LOC100828045 isoform X2 [Brachypodium 
distachyon]
Length=441

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/437 (70%), Positives = 363/437 (83%), Gaps = 5/437 (1%)
 Frame = -1

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANR--MAKVSTALRAPPS--  1384
             + MTASHLPYTRNGLKFFTK+GGLTS EVE ICD AARKYA R  MA  +     PP+  
Sbjct  1     MQMTASHLPYTRNGLKFFTKRGGLTSNEVERICDLAARKYAARKKMAGGNNN-NMPPAVP  59

Query  1383  KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  1204
             +VD MSAYA+HLRDIIKERV HPT YDTPL+GF++ VNAGNG GGFF  DVL KLGADT 
Sbjct  60    QVDLMSAYAEHLRDIIKERVAHPTSYDTPLEGFKVTVNAGNGCGGFFATDVLAKLGADTS  119

Query  1203  GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPIN  1024
             GSLHL+PDG FPNH+PNPED TAM++TR AVL + ADLGVVFDTDVDRSGVVD +G  IN
Sbjct  120   GSLHLDPDGTFPNHMPNPEDATAMSLTRGAVLAHGADLGVVFDTDVDRSGVVDSTGAAIN  179

Query  1023  GDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLN  844
             GDRLIAL+SAIVL+EHPGTTVVTDAR   GLTRFI  RGG+HCLYRVGYRNVIDKG  LN
Sbjct  180   GDRLIALISAIVLREHPGTTVVTDARAGDGLTRFIEARGGRHCLYRVGYRNVIDKGAQLN  239

Query  843   EDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEP  664
             EDGVETH+MMET+GHGALKEN+FLDDGAYMVVKI+IEMV+M+L GSE G+GSLI+DLEEP
Sbjct  240   EDGVETHVMMETTGHGALKENHFLDDGAYMVVKIVIEMVRMRLAGSEGGVGSLIEDLEEP  299

Query  663   LETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTND  484
              E   LRMD+  EP++AK + ++A+E+F+ YI++G L GW LD CGDC V +GCLVD+ND
Sbjct  300   AEAVLLRMDIGGEPKYAKQRGIQAVETFKEYIQEGKLEGWVLDDCGDCSVDQGCLVDSND  359

Query  483   HPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFL  304
             HP  +DA+MYRAK  +E  G+ GWVH+RQS+HNPNIA+N+QS IPGGC+SMA DL  +FL
Sbjct  360   HPIDVDAYMYRAKFYDESLGQVGWVHIRQSVHNPNIALNMQSCIPGGCKSMATDLFHRFL  419

Query  303   LAGEMAKFLDISQIDEF  253
             L   + +F+DI+++  F
Sbjct  420   LTSGVNEFVDITKVQNF  436



>ref|NP_001169666.1| hypothetical protein [Zea mays]
 gb|ACN34446.1| unknown [Zea mays]
Length=458

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/440 (71%), Positives = 361/440 (82%), Gaps = 3/440 (1%)
 Frame = -1

Query  1557  ASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPS--  1384
             A + MTASHLPYTRNGLKFFTK+GGLTS +VE ICD+AA KY  R   V    R  P   
Sbjct  19    ACMQMTASHLPYTRNGLKFFTKRGGLTSGDVENICDRAAHKYVARKTGVGGGGRGTPPVV  78

Query  1383  -KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VD MSAYA+HLRDIIK+RV HPTHYDTPL+GF+++VNAGNG GGFFTWDVL+KLGADT
Sbjct  79    MRVDLMSAYAQHLRDIIKQRVAHPTHYDTPLRGFKVVVNAGNGCGGFFTWDVLEKLGADT  138

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
              GSLHL PDG FPNHIPNPED TAM++TR AVL   ADLGVVFDTDVDRSGVVD  G  I
Sbjct  139   TGSLHLEPDGRFPNHIPNPEDATAMSLTRGAVLAQGADLGVVFDTDVDRSGVVDAGGAAI  198

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHL  847
             NGDRLIALMSAIVL EHPGT VVTDAR S GLTRF+  RGG+HCLYRVGYRNVIDKGV L
Sbjct  199   NGDRLIALMSAIVLGEHPGTMVVTDARASDGLTRFVESRGGRHCLYRVGYRNVIDKGVQL  258

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEE  667
             N DGVETHLMMET+GHGALKENYFLDDGAYMVVKIIIEMV+MKL G E G+GSLI+DL+E
Sbjct  259   NADGVETHLMMETTGHGALKENYFLDDGAYMVVKIIIEMVRMKLAGVEGGVGSLIRDLQE  318

Query  666   PLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTN  487
             P E+  LRMDV+ EP+ AK +A  A+E+F++YI++  L GW LD CGDC V+EGCL+DTN
Sbjct  319   PAESVLLRMDVMGEPKDAKERATHAVEAFKNYIQEDKLFGWVLDDCGDCSVAEGCLMDTN  378

Query  486   DHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
             + P  +DA MYRAK+ +E     G VH+RQS+HNPNIA+N+QS  PGGC+SMA+DL ++F
Sbjct  379   NDPIDVDAHMYRAKLYDENQRAVGMVHIRQSVHNPNIALNMQSYAPGGCKSMAKDLLERF  438

Query  306   LLAGEMAKFLDISQIDEFAR  247
             LLA  +  FLDISQ+++F +
Sbjct  439   LLASGLNGFLDISQVEKFVQ  458



>ref|XP_009802461.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104247987 
[Nicotiana sylvestris]
Length=355

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/355 (85%), Positives = 332/355 (94%), Gaps = 3/355 (1%)
 Frame = -1

Query  1287  FQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVL  1108
              Q+IVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMA+TRAAVL
Sbjct  1     MQVIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMALTRAAVL  60

Query  1107  QNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLT  928
             +N ADLG+VFDTDVDRSGVVD  GNPINGDRLIALMSAIVLKEHP TT+VTDARTSM LT
Sbjct  61    ENKADLGIVFDTDVDRSGVVDSEGNPINGDRLIALMSAIVLKEHPSTTIVTDARTSMALT  120

Query  927   RFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVV  748
             +FIT +GGQHCLYRVGYRNVIDKGV+LN+DG+ETHLMMETSGHGALKEN+FLDDGAYMVV
Sbjct  121   KFITKKGGQHCLYRVGYRNVIDKGVNLNKDGIETHLMMETSGHGALKENHFLDDGAYMVV  180

Query  747   KIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYI  568
             KIIIEMV+MKLEGSE GIGSLI+DLEEPLE+AE+RM VLSEPR+AKAKAVEAIE+FR +I
Sbjct  181   KIIIEMVRMKLEGSEGGIGSLIEDLEEPLESAEVRMIVLSEPRNAKAKAVEAIEAFRTHI  240

Query  567   EKG---NLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQ  397
             E+    +LPGWELD+CGDCWVS+GCLVDTND PAAIDAFMYRAKVS+E+NGEHGWVHLRQ
Sbjct  241   EEAYXXHLPGWELDACGDCWVSDGCLVDTNDDPAAIDAFMYRAKVSDEQNGEHGWVHLRQ  300

Query  396   SIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQIDEFARNGNLN  232
             SIHNPNIAVNLQS IPGGCQ MA+ LRD+FLL   M K LDISQID++ARNGNL+
Sbjct  301   SIHNPNIAVNLQSTIPGGCQFMAKVLRDRFLLPSGMDKILDISQIDKYARNGNLS  355



>ref|XP_006390835.1| hypothetical protein EUTSA_v100183050mg, partial [Eutrema salsugineum]
 ref|XP_006390836.1| hypothetical protein EUTSA_v100183050mg, partial [Eutrema salsugineum]
 gb|ESQ28121.1| hypothetical protein EUTSA_v100183050mg, partial [Eutrema salsugineum]
 gb|ESQ28122.1| hypothetical protein EUTSA_v100183050mg, partial [Eutrema salsugineum]
Length=421

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/430 (75%), Positives = 359/430 (83%), Gaps = 14/430 (3%)
 Frame = -1

Query  2091  MASTSTTP--QSLQTIASKPNFPSFPIHKPLHRS-LGIAQSFPKIKLSLRVESSLTANKH  1921
             MASTST+    S   I+    F   P    + RS L    + P IK  LR+ SS  A K 
Sbjct  1     MASTSTSSFMASKAVISETALFLCSP--GIIKRSFLTFTPASPSIK-PLRIRSS-NATKF  56

Query  1920  NEV--AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES  1747
             +EV  ++DE+M++IRRLQNGSDVRGVAL+GEKGR+VDLTP AVEAIAESFGEWV S  ES
Sbjct  57    DEVTNSIDEDMDQIRRLQNGSDVRGVALEGEKGRTVDLTPAAVEAIAESFGEWVAS-TES  115

Query  1746  ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF  1567
                G      RVSLG DPR+SG  LS AVFAGL +AGCL FDMGLATTPACFMST+L PF
Sbjct  116   NGNGVT----RVSLGRDPRVSGGKLSTAVFAGLARAGCLGFDMGLATTPACFMSTLLSPF  171

Query  1566  QYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPP  1387
             +YDASIMMTASHLPYTRNGLKFFTK+GGLTS EVE ICD AARKYANR  KVST +R  P
Sbjct  172   EYDASIMMTASHLPYTRNGLKFFTKRGGLTSPEVEKICDLAARKYANRQTKVSTLIRTRP  231

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VDFMSAY+KHLR+IIKER+NHP HYDTPL+GFQI+VNAGNGSGGFFTWDVLDKLGADT
Sbjct  232   EQVDFMSAYSKHLREIIKERINHPEHYDTPLKGFQIVVNAGNGSGGFFTWDVLDKLGADT  291

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
             FGSL+LNPDGMFPNHIPNPEDKTAM+ TRAAVL+N+ADLGVVFDTDVDRSGVVD  GNPI
Sbjct  292   FGSLYLNPDGMFPNHIPNPEDKTAMSRTRAAVLENSADLGVVFDTDVDRSGVVDNRGNPI  351

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHL  847
             NGD+LIALMSAIVLKEHPG+T+VTDARTSMGLTRFIT RGG+HCLYRVGYRNVIDKGV L
Sbjct  352   NGDKLIALMSAIVLKEHPGSTIVTDARTSMGLTRFITERGGRHCLYRVGYRNVIDKGVEL  411

Query  846   NEDGVETHLM  817
             N +G+ETHLM
Sbjct  412   NREGIETHLM  421



>ref|XP_010427876.1| PREDICTED: uncharacterized protein LOC104712640 [Camelina sativa]
Length=411

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/385 (77%), Positives = 335/385 (87%), Gaps = 9/385 (2%)
 Frame = -1

Query  1995  LGIAQSFPKIKLSLRVESSLTANKHNEV--AVDEEMEKIRRLQNGSDVRGVALQGEKGRS  1822
             L  + + P +K  LR  SS  A K NEV  +VDE+M++IRRLQNGSDVRGVAL+GEKGR+
Sbjct  34    LSFSPASPSVK-PLRTRSS-NATKFNEVTSSVDEDMDQIRRLQNGSDVRGVALEGEKGRT  91

Query  1821  VDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQ  1642
             VDLTP AVEAIAESFGEWV +  E    G +    +VSLG DPR+SG  LS A+FAGLG+
Sbjct  92    VDLTPAAVEAIAESFGEWV-AATEGNPNGVI----KVSLGRDPRVSGGKLSTAIFAGLGR  146

Query  1641  AGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVE  1462
             AGCL FDMGLATTPACFMST+L PF+YDASIMMTASHLPYTRNGLKFFTK+GGLTS EVE
Sbjct  147   AGCLAFDMGLATTPACFMSTLLSPFEYDASIMMTASHLPYTRNGLKFFTKRGGLTSPEVE  206

Query  1461  AICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQ  1282
              ICD AARKYA R +KVST ++  P +VDFMSAY+KHLR+IIKER+NHP HYDTPL+GFQ
Sbjct  207   KICDLAARKYATRQSKVSTLIKTRPKQVDFMSAYSKHLREIIKERINHPEHYDTPLKGFQ  266

Query  1281  IIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQN  1102
             I+VNAGNGSGGFFTWDVLDKLGADTFGSL+LNPDGMFPNHIPNPE+K AM+ TRAAVL+N
Sbjct  267   IVVNAGNGSGGFFTWDVLDKLGADTFGSLYLNPDGMFPNHIPNPENKIAMSHTRAAVLEN  326

Query  1101  AADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRF  922
             +ADLGVVFDTDVDRSGVVD  GNPINGD+LIALMSAIVLKEHPG+TVVTDARTSMGLT+F
Sbjct  327   SADLGVVFDTDVDRSGVVDNRGNPINGDKLIALMSAIVLKEHPGSTVVTDARTSMGLTKF  386

Query  921   ITGRGGQHCLYRVGYRNVIDKGVHL  847
             IT RGG+HCLYRVGYRNVIDKG ++
Sbjct  387   ITERGGRHCLYRVGYRNVIDKGANI  411



>gb|EPS61324.1| hypothetical protein M569_13472 [Genlisea aurea]
Length=565

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/514 (60%), Positives = 363/514 (71%), Gaps = 52/514 (10%)
 Frame = -1

Query  1830  GRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAG  1651
             GR + L  P       S   W   G   ER        RVS G DPRI+G  LS+A FAG
Sbjct  85    GRWILLRQPWKPLPRASANGWCRIGETMER------RRRVSFGRDPRITGAVLSSAAFAG  138

Query  1650  LGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTST  1471
             L +AGC V+DMGL TTPACF+ST+L PF YDASIMMTASHLP TRNGLKFFTKKGGLTS 
Sbjct  139   LSRAGCEVYDMGLGTTPACFVSTILNPFSYDASIMMTASHLPLTRNGLKFFTKKGGLTSP  198

Query  1470  EVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQ  1291
             EVE ICD+A RKYANR A+VSTA+++PP KVDFMSAY++HLR+ IK++VNHP HYD+PL+
Sbjct  199   EVEEICDRAGRKYANRHARVSTAIKSPPRKVDFMSAYSEHLRETIKKKVNHPLHYDSPLE  258

Query  1290  GFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAV  1111
             G++IIVNAGNGSGGFFTWDVLD+LGADTFGSLHLNPDGMFPNHIPNPED TAMA TR+AV
Sbjct  259   GYKIIVNAGNGSGGFFTWDVLDRLGADTFGSLHLNPDGMFPNHIPNPEDATAMASTRSAV  318

Query  1110  LQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGL  931
             ++  ADLG+VFDTDVDRSGVVDR G P                           R   G 
Sbjct  319   IRTGADLGIVFDTDVDRSGVVDREGKP-------------------------HQRRQGGR  353

Query  930   TRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMV  751
             T         HCLYRVGYRNVIDKG+ LN  G++THLMMETSGHGALKEN+FLDDGAYMV
Sbjct  354   T---------HCLYRVGYRNVIDKGIRLNRRGIDTHLMMETSGHGALKENHFLDDGAYMV  404

Query  750   VKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHY  571
             V+IIIEMV+MK++G  +GIGSLIKDL+EPLE+ ELRM+++SEP  AK    E IE FR +
Sbjct  405   VRIIIEMVRMKIQGITQGIGSLIKDLDEPLESVELRMNIISEPELAKTTGTEVIEGFRSF  464

Query  570   IEKGNLPGWELDSCGDCW-VSEGCLVDTNDHPAAIDA-----FMYRAKVSNEENGEHGWV  409
             +++G          G  W +   C   ++             F+ R K+S+    EHGW+
Sbjct  465   VQEGRF---TRVGNGFMWRIGVHCSSSSSSSFFCFFFISPSYFIDRVKISDS---EHGWI  518

Query  408   HLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
             HLRQS HNPNIA+N QS I GGC+S+A  LRD++
Sbjct  519   HLRQSTHNPNIAINAQSMIEGGCKSIAATLRDEY  552



>dbj|BAD35746.1| putative phosphomannomutase [Oryza sativa Japonica Group]
 dbj|BAD35298.1| putative phosphomannomutase [Oryza sativa Japonica Group]
Length=495

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/416 (72%), Positives = 330/416 (79%), Gaps = 12/416 (3%)
 Frame = -1

Query  1974  PKIKLSLRVESSLTANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVE  1795
             PK     R+E+S  A         E+ + IRRLQNG DVRGVAL+GE GR+VDLTP AVE
Sbjct  52    PKAATGGRLETSTDA----AAVAGEDGDVIRRLQNGPDVRGVALEGENGRAVDLTPLAVE  107

Query  1794  AIAESFGEWV---ISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVF  1624
              IAESFGEW+   +  LES R G     VRVS+G DPR+SG  L AA+FAGL +AGC VF
Sbjct  108   VIAESFGEWLREELQQLESGRDGG---EVRVSVGRDPRLSGARLGAALFAGLARAGCSVF  164

Query  1623  DMGLATTPACFMSTVLPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKA  1444
             D+GLATTPACFMST LP F YDASIMMTASHLPYTRNGLKFF K+GGLTS EVE +CD+A
Sbjct  165   DVGLATTPACFMSTKLPRFSYDASIMMTASHLPYTRNGLKFFMKRGGLTSGEVEGVCDRA  224

Query  1443  ARKYANRMAKVSTALRAPPS--KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVN  1270
             ARKY  R   +      PP   +VD MSAYA+HLR+IIKERV HPTHYDTPL+GF++IVN
Sbjct  225   ARKYVARKMGLGGGRGMPPVVMRVDLMSAYAQHLRNIIKERVAHPTHYDTPLKGFKVIVN  284

Query  1269  AGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADL  1090
             AGNG GGFFTWDVL+KLGADT GSLHL PDG FP+H+PNPED TAM++TR AVL + ADL
Sbjct  285   AGNGCGGFFTWDVLEKLGADTTGSLHLEPDGKFPHHMPNPEDTTAMSLTRDAVLDHGADL  344

Query  1089  GVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR  910
             GVVFDTDVDRSGVVD +G  INGDRLIALMSAIVL EHPGTTVVTDARTS GLTRFI  R
Sbjct  345   GVVFDTDVDRSGVVDATGAAINGDRLIALMSAIVLDEHPGTTVVTDARTSDGLTRFIQAR  404

Query  909   GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKI  742
             GG HCLYRVGYRNVIDKGV LN DGVETHLMMET+GHGALKEN FLDDG    V I
Sbjct  405   GGHHCLYRVGYRNVIDKGVQLNADGVETHLMMETTGHGALKENNFLDDGTPSYVHI  460



>gb|KDO64611.1| hypothetical protein CISIN_1g021442mg [Citrus sinensis]
Length=312

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/311 (82%), Positives = 288/311 (93%), Gaps = 0/311 (0%)
 Frame = -1

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
             MFPNHIPNPEDKTAMA+TRAAVL+N ADLGVVFDTDVDRSGVVD  GNPINGD+LIALMS
Sbjct  1     MFPNHIPNPEDKTAMALTRAAVLENNADLGVVFDTDVDRSGVVDNKGNPINGDKLIALMS  60

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
             AIVLKEHPGTT+VTDARTSM LT+FIT RGG HCLYRVGYRNVIDKGVHLNEDG+ETHLM
Sbjct  61    AIVLKEHPGTTIVTDARTSMALTKFITDRGGNHCLYRVGYRNVIDKGVHLNEDGIETHLM  120

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             METSGHGALKENYFLDDGAYMVVKIII+MV+MKLEGS+EGIGSLIKDLEEPLE+ ELRM+
Sbjct  121   METSGHGALKENYFLDDGAYMVVKIIIQMVRMKLEGSDEGIGSLIKDLEEPLESIELRMN  180

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             ++SEPR+AKAK  EAIE FR YIE+G L GWELDSCGDCWVSEGCLVD+N+ PAAIDA M
Sbjct  181   IISEPRYAKAKGSEAIEEFRKYIEEGRLQGWELDSCGDCWVSEGCLVDSNESPAAIDARM  240

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFL  277
             YRAKV++EE+G++GW+HLRQSIHNPNIAVN+QS +PGGC+S+ + LRDKFLLA  M K L
Sbjct  241   YRAKVTDEEHGQYGWIHLRQSIHNPNIAVNVQSMVPGGCRSITKSLRDKFLLASGMDKVL  300

Query  276   DISQIDEFARN  244
             DISQI+++A +
Sbjct  301   DISQIEKYAES  311



>gb|KDO64612.1| hypothetical protein CISIN_1g021442mg [Citrus sinensis]
Length=289

 Score =   525 bits (1351),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 243/289 (84%), Positives = 271/289 (94%), Gaps = 0/289 (0%)
 Frame = -1

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
             MFPNHIPNPEDKTAMA+TRAAVL+N ADLGVVFDTDVDRSGVVD  GNPINGD+LIALMS
Sbjct  1     MFPNHIPNPEDKTAMALTRAAVLENNADLGVVFDTDVDRSGVVDNKGNPINGDKLIALMS  60

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
             AIVLKEHPGTT+VTDARTSM LT+FIT RGG HCLYRVGYRNVIDKGVHLNEDG+ETHLM
Sbjct  61    AIVLKEHPGTTIVTDARTSMALTKFITDRGGNHCLYRVGYRNVIDKGVHLNEDGIETHLM  120

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             METSGHGALKENYFLDDGAYMVVKIII+MV+MKLEGS+EGIGSLIKDLEEPLE+ ELRM+
Sbjct  121   METSGHGALKENYFLDDGAYMVVKIIIQMVRMKLEGSDEGIGSLIKDLEEPLESIELRMN  180

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             ++SEPR+AKAK  EAIE FR YIE+G L GWELDSCGDCWVSEGCLVD+N+ PAAIDA M
Sbjct  181   IISEPRYAKAKGSEAIEEFRKYIEEGRLQGWELDSCGDCWVSEGCLVDSNESPAAIDARM  240

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDK  310
             YRAKV++EE+G++GW+HLRQSIHNPNIAVN+QS +PGGC+S+ + LRDK
Sbjct  241   YRAKVTDEEHGQYGWIHLRQSIHNPNIAVNVQSMVPGGCRSITKSLRDK  289



>gb|EYU30079.1| hypothetical protein MIMGU_mgv1a0042811mg, partial [Erythranthe 
guttata]
 gb|EYU30080.1| hypothetical protein MIMGU_mgv1a0042811mg, partial [Erythranthe 
guttata]
Length=352

 Score =   470 bits (1210),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 250/355 (70%), Positives = 272/355 (77%), Gaps = 16/355 (5%)
 Frame = -1

Query  2088  ASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTAN------  1927
             +S  T PQSL+T     N PS  + +     L    SF   +  LRVE S TA       
Sbjct  5     SSAPTAPQSLRT-----NSPSLFLKQSKSFQLRFPSSFSSSRFQLRVECSSTAAAAAAER  59

Query  1926  -KHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLE  1750
                   AVDEEM+KIRRLQNGSDVRGVAL GEKGR VDLTPPAVEAIAESFGEWV   LE
Sbjct  60    YSDEAAAVDEEMDKIRRLQNGSDVRGVALDGEKGRMVDLTPPAVEAIAESFGEWVAGELE  119

Query  1749  SERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLP-  1573
              E G A   +VRVSLG DPRISG  LSAAVFAGLG+AGC +F MGL    A +++   P 
Sbjct  120   KESGAAAA-AVRVSLGRDPRISGPILSAAVFAGLGRAGCEIFIMGLEIYLAIYIANFDPI  178

Query  1572  -PFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALR  1396
              P  +     MTASHLPYTRNGLKFFTKKGGLTS +VE ICD+AARKYANR+AKVSTALR
Sbjct  179   SPI-FTLCGRMTASHLPYTRNGLKFFTKKGGLTSPQVEEICDRAARKYANRLAKVSTALR  237

Query  1395  APPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLG  1216
               P KVDFMSAYAKHLR+IIK+RVNHP HYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLG
Sbjct  238   VLPKKVDFMSAYAKHLRNIIKQRVNHPLHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLG  297

Query  1215  ADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGV  1051
             AD FGSLHLNPDGMFPNHIPNPEDK AM+MT++AVLQN ADLG+VFDTDVDRSGV
Sbjct  298   ADPFGSLHLNPDGMFPNHIPNPEDKIAMSMTQSAVLQNNADLGIVFDTDVDRSGV  352



>ref|XP_005535333.1| phosphoglucomutase [Cyanidioschyzon merolae strain 10D]
 dbj|BAM79047.1| phosphoglucomutase [Cyanidioschyzon merolae strain 10D]
Length=612

 Score =   464 bits (1194),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 263/565 (47%), Positives = 350/565 (62%), Gaps = 41/565 (7%)
 Frame = -1

Query  1911  AVDEEMEK---IRRLQNGSDVRGVALQGEKGRS-VDLTPPAVEAIAESFGEWVISGLES-  1747
             A+D E E+      LQNGSDVRGVAL  E  R+ V LTP     IA +F  W+ +  +  
Sbjct  73    ALDTETEEKAIYLELQNGSDVRGVALATEGSRTLVTLTPERAAEIAGAFARWLKASTDRR  132

Query  1746  ERGGAVVESV-RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPP  1570
             E+  AV   V RV++G DPR+SG +L  AV   L   GC V+D+GLATTPA FMSTVL  
Sbjct  133   EQHDAVRGGVFRVAVGRDPRLSGPALRDAVILALASEGCDVYDVGLATTPAMFMSTVLEE  192

Query  1569  FQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMA------KVS  1408
             F++D ++M+TASHLP  RNGLKFFT++GG    EV  + + A     +R A      + S
Sbjct  193   FKFDGALMLTASHLPPDRNGLKFFTERGGTDKREVRMLLENAFEHSQSRDAYSIENRQHS  252

Query  1407  TALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVL  1228
              AL     K D M+AYA +LR  I++ + +  +   PL G  IIV+AGNGS GFF  DVL
Sbjct  253   GAL---AKKADLMAAYAAYLRSCIEKGIRNAKNPLKPLDGAHIIVDAGNGSAGFFATDVL  309

Query  1227  DKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVV  1048
               LGAD  GS  L PDG FPNH+PNPED+ AM M   AVL++ ADLG+VFDTD DR G V
Sbjct  310   APLGADIQGSQFLEPDGTFPNHVPNPEDQQAMKMASEAVLKSGADLGIVFDTDGDRCGFV  369

Query  1047  DRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNV  868
             +R G P+N +RLIA++SAIVL+EHPG T++TD+ TS GL  FI  RGG H  YR GY+N+
Sbjct  370   NRDGKPMNRNRLIAVLSAIVLREHPGATILTDSVTSNGLAEFIRKRGGHHFRYRKGYKNI  429

Query  867   IDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGS  688
             IDKG+ LN+ GV+  L +ETSGHGA++ENY LDDGAY+ VKI+ E++ ++ +G   GI S
Sbjct  430   IDKGIELNQSGVDCPLAIETSGHGAMRENYMLDDGAYLAVKIVSELINLQRQGDHRGIDS  489

Query  687   LIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNL-PGWELDSCGDCWVS  511
             L+  L EPLE  E R+++L+E      K +  +E+F  ++      P W L+        
Sbjct  490   LLDGLAEPLEEKEFRLNLLTENYKETGKMI--VEAFHDFVTSAEAPPNWRLEKEN----Y  543

Query  510   EGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
             EG  V       A+D          E NG  GW+ LRQS+H+P + +N++S   GG + +
Sbjct  544   EGWRV-------AVD----------EGNGRAGWLLLRQSLHDPLLPLNVESETQGGVKRI  586

Query  330   ARDLRDKFLLAGEMAKFLDISQIDE  256
             AR L D    A   A  LD+S +++
Sbjct  587   ARILYD--WAAPRFASVLDLSPLEK  609



>ref|XP_002500529.1| phosphoglucomutase/phosphomannomutase family protein [Micromonas 
sp. RCC299]
 gb|ACO61787.1| phosphoglucomutase/phosphomannomutase family protein [Micromonas 
sp. RCC299]
Length=546

 Score =   451 bits (1160),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 249/526 (47%), Positives = 335/526 (64%), Gaps = 34/526 (6%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             +++LQNGSDVRGVAL+G  G  V L   A   I  +F +W+     +++ G     + ++
Sbjct  29    LKKLQNGSDVRGVALEGVPGEPVTLNEEAAYLIGAAFVDWL-----ADKKGKKPSELSIA  83

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGC-LVFDMGLATTPACFMSTVLPPFQYDASIMMTASH  1531
             +G DPR+SG +L+ A+FAG G      V DMG+ATTPACFM+TV P   YDA IM+TASH
Sbjct  84    VGRDPRLSGPALANAMFAGFGSKDVGRVVDMGIATTPACFMATVTPGVAYDAGIMLTASH  143

Query  1530  LPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPS--KVDFMSAYA  1357
             LP+ RNG KFFT  GGL   +++ IC+ AA          +  L    +   V F+  YA
Sbjct  144   LPFNRNGAKFFTSDGGLDKADIKRICEDAAAACQAAPDGHAIPLDGDDAVESVPFLEDYA  203

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
               LRD+IK+  NHPT YD PL G +IIV+AGNGSGGFF   VL+ LGAD +GS  L+PDG
Sbjct  204   AQLRDLIKKGANHPTAYDEPLTGMKIIVDAGNGSGGFFAKSVLEPLGADVYGSQFLDPDG  263

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNH PNPED  AM     A ++  ADLGV+FDTDVDRS V+D  GNPIN ++LIAL++
Sbjct  264   KFPNHSPNPEDAEAMDSAVEATVKAKADLGVIFDTDVDRSAVIDGDGNPINRNKLIALLA  323

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
             AI+L EHPG+TVVTD+ TS GL  FI G+GG+H  Y  GY+NVI++GV  ++ G   HLM
Sbjct  324   AIILDEHPGSTVVTDSVTSDGLAEFIEGKGGKHVRYMRGYKNVINEGVRRDKAGEPCHLM  383

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGHGA+KENY LDDGAY+ VKIIIE V+ +L G  +GI  L+ +L EPLE  E+R+ 
Sbjct  384   IETSGHGAMKENYCLDDGAYIAVKIIIEAVRRRLSGG-KGISDLLSELREPLEEKEVRLK  442

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             +  +    KA   + +E  +  +  G++ G+                     P  ++   
Sbjct  443   ITCD--DFKAYGGDVLEQLKEAV--GSMKGYT--------------------PVDVNYEG  478

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
             YR    +E +G+ GW  LRQS+H+P + +N +S IPGG  +MA+D+
Sbjct  479   YRVN-RDEGDGKRGWFLLRQSLHDPVMVLNFESEIPGGVDAMAKDV  523



>emb|CEF96535.1| Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/III [Ostreococcus 
tauri]
Length=527

 Score =   441 bits (1135),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 260/554 (47%), Positives = 346/554 (62%), Gaps = 34/554 (6%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             + E++RRLQNGSDVRGVA+ G +G +V L      AI  +F EW+     S +G  +   
Sbjct  6     DAERVRRLQNGSDVRGVAMDGVEGEAVTLDATTARAIGTAFAEWLARDESSAQGKTI---  62

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMT  1540
                 +G DPR+SG++L   +FAG+ +AG  V DMGLATTPACFMS V    +YD ++M+T
Sbjct  63    ---GVGRDPRLSGEALRDGMFAGMVEAGATVVDMGLATTPACFMSCVTEGVEYDGAVMLT  119

Query  1539  ASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAAR--KYANRMAKVSTALRAPPSKVDFMS  1366
             ASHLP+ RNG+KFFTK GGL   +++ IC +AA   +     AK    + + P    F+ 
Sbjct  120   ASHLPFNRNGMKFFTKHGGLDKPDIKEICARAAELVEAGGGDAKAPAGVTSAP----FLP  175

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              YA  L +II++ VN   +Y+ PL G +I+V+AGNGSGGFF   VL++LGADT GS  L+
Sbjct  176   TYAVQLCEIIRKGVNSKDNYEKPLSGMKIVVDAGNGSGGFFVDMVLNQLGADTTGSQFLD  235

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDG FPNH PNPEDK AM     AVL   ADLG+VFDTDVDRS V+D SG  IN ++LIA
Sbjct  236   PDGNFPNHSPNPEDKAAMEAGVRAVLNAKADLGIVFDTDVDRSAVIDASGKEINRNKLIA  295

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVET  826
             L+S IVLKE PG+T+VTD+ TS GL +FI  +GG+H  +  GY+NVI+KG  LN  GV+T
Sbjct  296   LLSEIVLKETPGSTIVTDSVTSDGLHKFIIDKGGKHLRFMRGYKNVINKGKELNASGVDT  355

Query  825   HLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAEL  646
              LM+ETSGHGA++ENY LDDGAY+ VKIIIE V+ +    E  IG +++ LEEPLE AE+
Sbjct  356   PLMIETSGHGAMRENYDLDDGAYLAVKIIIEAVRRR-NAKEPSIGQVLESLEEPLEEAEV  414

Query  645   RMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAID  466
             R+ + S+P   K   +  IES    +        E  S G C             PA  +
Sbjct  415   RLKI-SDPDF-KEYGLNVIESLLAEVND----TVEHSSFGKC------------RPAEDN  456

Query  465   AFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMA  286
                 R  V +E NG+ GW  LR S+H+P + +N +S + GG + MA +    ++L     
Sbjct  457   YEGLRVCV-DEGNGKQGWFLLRCSLHDPVMVLNFESQVEGGVRVMAEEF-GTWILDQNYD  514

Query  285   KFLDISQIDEFARN  244
             K LD S + E   N
Sbjct  515   K-LDCSSVHELYSN  527



>ref|WP_015167380.1| phosphomannomutase [Synechococcus sp. PCC 7502]
 ref|YP_007104856.1| phosphomannomutase [Synechococcus sp. PCC 7502]
 gb|AFY72721.1| phosphomannomutase [Synechococcus sp. PCC 7502]
Length=526

 Score =   439 bits (1130),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 235/523 (45%), Positives = 333/523 (64%), Gaps = 35/523 (7%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVA+ G     V+LTP   + + ++F +W+     +++    V  + +S+
Sbjct  16    KKLQNGSDIRGVAIAGVVDEPVNLTPEITQILGQAFTQWL-----TQKVNKPVAELTISV  70

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG SL+ AV AG+   G  V+D G+A+TPA FMST+   F  D +IM+TASHLP
Sbjct  71    GRDSRLSGLSLTEAVIAGITSIGARVYDFGMASTPAMFMSTIAEGFNCDGAIMLTASHLP  130

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT  GGL   ++  I   A       +A ++ +     +K DF+S Y++ L 
Sbjct  131   FNRNGLKFFTAGGGLEKQDITEILALAEAGEFQELA-IAPSSTNQITKQDFISIYSQQLV  189

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               I+ +VNHP ++D PLQG +IIV+AGNG+GGF+   VL+ LGADT GS  L PDG FPN
Sbjct  190   QKIRIQVNHPHNFDQPLQGLKIIVDAGNGAGGFYAAQVLEPLGADTTGSQFLEPDGNFPN  249

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             H+PNPEDK AMA    AV+ + AD G++FDTDVDRS  VD+ G+ +N +RLIALMSAI+L
Sbjct  250   HVPNPEDKVAMASICQAVIDHKADFGIIFDTDVDRSAAVDQFGHELNRNRLIALMSAIIL  309

Query  984   KEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             +EHP +T+VTD+ TS GL  FIT    G H  ++ GY+NVI++ + LN+ G E+ L +ET
Sbjct  310   QEHPHSTIVTDSITSDGLNEFITKDLQGTHHRFKRGYKNVINEAILLNQLGKESWLAIET  369

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGHGALKENYFLDDGAY+V K++IE+ K KL G    +  LI +L+EP+E++E R+ + +
Sbjct  370   SGHGALKENYFLDDGAYLVSKLLIELAKSKLAG--RNLTDLIANLKEPVESSEFRIKITA  427

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             E  + KA   EAI   + +  +   P WE              +  N++           
Sbjct  428   E--NFKAIGNEAIAQLQIFASQQ--PDWE--------------IVPNNYEG--------V  461

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
             +VS   + E+GW  LR S+H+P I +N++SNI GG   +A  L
Sbjct  462   RVSCSSDSENGWFLLRLSLHDPVIPLNIESNIAGGVTKIATRL  504



>ref|WP_035289417.1| phosphoglucomutase [Clostridium sp. KNHs214]
Length=508

 Score =   435 bits (1119),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 233/528 (44%), Positives = 331/528 (63%), Gaps = 38/528 (7%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             + +L NG+D+RGVAL+G +G  V+LTP  VE +  +F +W+     S +    +E++++S
Sbjct  5     LEKLINGNDIRGVALEGVEGEKVNLTPEIVEILGLAFAKWL-----SIKKDVKIENLKIS  59

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHL  1528
             +G D R+SG++L +++  G+   G  VFD GLA+TPA FM+TVL  ++YD +IMMTASHL
Sbjct  60    VGRDSRLSGENLKSSLIKGIKNGGSEVFDCGLASTPAMFMTTVLEGYKYDGAIMMTASHL  119

Query  1527  PYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
             P+ RNG+KFFT +G +  T+++ + +      A  M  +    +   + +DF+S Y+K L
Sbjct  120   PFNRNGMKFFTNEGAIEKTDLKEVVN-----IAKEMKAIDGVKKGKVNTIDFISQYSKFL  174

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
                IK  VN   + + PL+GF+IIV+AGNG+GGFF   VL  LGADT GS    PDG FP
Sbjct  175   VGKIKAGVNSSINKEEPLKGFKIIVDAGNGAGGFFVDKVLKPLGADTEGSQFTEPDGRFP  234

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NHIPNPEDK AM   + AVL N ADLG++FDTDVDR+ VVD  GN IN ++LIAL+SAI+
Sbjct  235   NHIPNPEDKVAMHSIQKAVLDNKADLGIIFDTDVDRAAVVDSHGNEINRNKLIALISAII  294

Query  987   LKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMME  811
             L+E+P TTVVTD+ TS GL  FI  + GG+H  ++ GY+NVI++ + LN  G E H+ +E
Sbjct  295   LEENPKTTVVTDSVTSEGLKEFIENKCGGKHHRFKRGYKNVINEAIRLNNKGEECHIAIE  354

Query  810   TSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVL  631
             TSGH ALKENYFLDDGAY+V KI+++  K+K E  E+ I +LIKDLEE   + E RM + 
Sbjct  355   TSGHAALKENYFLDDGAYLVSKILVKTAKLKEENGED-IHNLIKDLEEASISNEYRMKIT  413

Query  630   SEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYR  451
              E        V  +E  + Y ++    GWE +      V   C                 
Sbjct  414   CEDFKEYGNKV--LEDLKIYCDR--REGWEFEVPNYEGVRVKC-----------------  452

Query  450   AKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                 N+ENG  GW  +R S+H+P I +N++++   G + +  +L   F
Sbjct  453   ----NKENG-GGWFLVRLSLHDPVIPMNVETDSREGEKLIVNELNKFF  495



>ref|XP_003056559.1| phosphoglucomutase/phosphomannomutase family protein [Micromonas 
pusilla CCMP1545]
 gb|EEH59935.1| phosphoglucomutase/phosphomannomutase family protein [Micromonas 
pusilla CCMP1545]
Length=583

 Score =   437 bits (1123),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 239/540 (44%), Positives = 330/540 (61%), Gaps = 42/540 (8%)
 Frame = -1

Query  1893  EKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVR  1714
             E I  LQNGSDVRGVA  G +G  V L   A   I  +F  W+   +  +     +  ++
Sbjct  64    EVILALQNGSDVRGVATDGVQGEPVALNEEAAFLIGTAFVHWLAKKVNKQ-----IPELK  118

Query  1713  VSLGMDPRISGKSLSAAVFAGLGQAGCLV-FDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
             +++G DPR+SG +L +A+F+G    G     D+GL+TTPACFM+T+      DA +M+TA
Sbjct  119   IAVGRDPRLSGPALVSALFSGFVAEGLKNGIDVGLSTTPACFMTTITKETNCDAGVMLTA  178

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMA---------KVSTALRAPPS  1384
             SHLP+ RNG+KFFTK+GGL S ++  IC  AA++                 + A+     
Sbjct  179   SHLPFNRNGMKFFTKQGGLDSEDISQICTAAAKRCKETPGGHPVSVPDVDGNVAISGVVC  238

Query  1383  KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  1204
                 ++ Y+K LR++I E V      D PL+  +I+V+AGNGSGGFF   VL+ LGAD  
Sbjct  239   SEYLLTHYSKMLRELIIEGVGAG---DKPLEAMKIVVDAGNGSGGFFATHVLEPLGADIS  295

Query  1203  GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPIN  1024
             GS+ LNPDG FPNH PNPED  AM+  R   +   ADLG++FDTDVDRS V+ + G+ IN
Sbjct  296   GSVFLNPDGSFPNHAPNPEDPYAMSFARDVTVNTDADLGIIFDTDVDRSAVIGKGGDSIN  355

Query  1023  GDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLN  844
              ++LIAL+SAIVL+EHPG+T+VTD+ TS GL  FI  +GG H  Y  GY+NVI+KG  LN
Sbjct  356   RNKLIALLSAIVLEEHPGSTIVTDSVTSDGLASFIESKGGNHLRYMRGYKNVINKGKELN  415

Query  843   EDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEP  664
             EDGVETHLM+ETSGHGA+KEN+ LDDGAY+ VKIII+ VKM+  G E GI  L+ +L+EP
Sbjct  416   EDGVETHLMIETSGHGAMKENHNLDDGAYIAVKIIIQAVKMRAAG-EGGISDLLSELQEP  474

Query  663   LETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTND  484
             LE  E+R+ +  +    KA  +  I++ +  ++ G   G+                    
Sbjct  475   LEEREVRLKI--KAADFKAVGLAVIDNLKKDVKAGKFEGYS-------------------  513

Query  483   HPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFL  304
              P  I+    R +V +E  G  GW  LRQS+H+P + +N +S + GG + MA+ L+  F 
Sbjct  514   -PLDINYEGLRVRV-DEGTGAFGWFLLRQSLHDPVMVLNFESEVHGGVEIMAKALKTWFF  571



>ref|WP_008275431.1| phosphoglucomutase [Cyanothece sp. CCY0110]
 gb|EAZ91606.1| phosphoglucomutase/phosphomannomutase family protein [Cyanothece 
sp. CCY0110]
Length=508

 Score =   433 bits (1113),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 237/544 (44%), Positives = 339/544 (62%), Gaps = 45/544 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G     V+LTP   + + ++F  W+      ++ G     + +SL
Sbjct  7     KKLQNGSDIRGVALEGVADEPVNLTPEVAKILGQAFTSWL-----GKKLGKPPSELTISL  61

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG +L ++V  G+  +G  V+D  +A+TPA FMST+      D +IM+TASHLP
Sbjct  62    GRDSRLSGPTLLSSVTEGISLSGSKVYDFDIASTPAMFMSTITSELSCDGAIMLTASHLP  121

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFTK+GGL   ++  I + A     N    V+   +    K DF+S YA+ L 
Sbjct  122   FNRNGLKFFTKEGGLNKGDITDILNLAE----NNNFPVAKE-KGSVEKYDFISIYAQGLV  176

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               ++E VNHP H++ PLQG +IIV+AGNG+GGF+   VL  LGADT GS  L+P+G FPN
Sbjct  177   KKVRESVNHPDHFEQPLQGLKIIVDAGNGAGGFYAEKVLKPLGADTKGSQFLDPNGTFPN  236

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE++ AM     AV+ N AD G++FDTDVDR   VD SG  +N +RLIAL+SAIVL
Sbjct  237   HIPNPENEVAMQSICQAVVDNKADFGIIFDTDVDRGAAVDSSGKELNRNRLIALISAIVL  296

Query  984   KEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             KEHPG+T+VTD+ TS GLT FI     G H  ++ GY+NVI++ + LN +G E+ L +ET
Sbjct  297   KEHPGSTIVTDSITSDGLTTFIEKELNGVHHRFKRGYKNVINESIRLNNEGQESWLAIET  356

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGHGA+KENYFLDDGAY+V K++IE+ K K +G  + + +LI +L+EP E+ E R+ + +
Sbjct  357   SGHGAMKENYFLDDGAYLVTKLLIELAKCKQQG--KVLTNLISNLKEPEESQEFRLKIKT  414

Query  627   EP-RHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYR  451
             E  +    + +E ++ F    E      W+L                N++          
Sbjct  415   ENFKDYGNQVIEKLQEFATTQEN-----WQLVP--------------NNYEG--------  447

Query  450   AKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDI  271
              ++S + N E GW+ LR S+H+P I +N++SNI GG ++MA  L + FL   E    LD+
Sbjct  448   VRISCQSNDEKGWLLLRLSLHDPVIPINIESNISGGVKNMATKLLE-FLKGFEA---LDL  503

Query  270   SQID  259
             +  D
Sbjct  504   TTFD  507



>ref|WP_015222525.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Cyanobacterium stanieri]
 ref|YP_007164856.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Cyanobacterium stanieri PCC 7202]
 gb|AFZ47207.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Cyanobacterium stanieri PCC 7202]
Length=503

 Score =   432 bits (1111),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 227/529 (43%), Positives = 327/529 (62%), Gaps = 42/529 (8%)
 Frame = -1

Query  1893  EKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVR  1714
             E  ++LQNGSD+RGVAL+G +G  V+LTP  ++ + +SF +W+     SE+       + 
Sbjct  4     ENWKKLQNGSDIRGVALEGIEGEKVNLTPEIIKILGKSFAQWL-----SEKLSKSPSQLI  58

Query  1713  VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTAS  1534
             +SLG D R+SG++L   +   + + G  V++  +A+TPA FMST+      D +IM+TAS
Sbjct  59    ISLGRDSRLSGENLLGTIATAISELGVTVYNFEMASTPAMFMSTIDTDLNCDGAIMLTAS  118

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAK  1354
             HLP+ RNGLKFFTK+GGL   ++  I +KA     N   +    +       +FM+ YA 
Sbjct  119   HLPFNRNGLKFFTKQGGLEKQDITNILEKAQENSFNYTKEKGNIINK-----NFMAKYAD  173

Query  1353  HLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGM  1174
                  I++ VNHP H++ PL+  +IIV+AGNG+GGFF   VL  LGAD  GS  L PDG 
Sbjct  174   LFVKQIRQAVNHPRHFEEPLKELKIIVDAGNGAGGFFADKVLKPLGADITGSQFLEPDGT  233

Query  1173  FPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSA  994
             FPNHIPNPE+  AMA    AV+++ AD G++FDTDVDRS  VD +G  +N +RLIAL+SA
Sbjct  234   FPNHIPNPENPEAMASICEAVIKHKADFGIIFDTDVDRSAAVDSTGKELNRNRLIALISA  293

Query  993   IVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
             I+L+EHP +T+VTD+ TS GLT+FI    GG+H  ++ GY+NVI++ + LN +G+E+ L 
Sbjct  294   IILQEHPQSTIVTDSITSEGLTKFIEQNLGGKHHRFKRGYKNVINEALRLNNEGIESWLA  353

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGH ALKENYFLDDGAY++ K++IE+ K+KL   ++ +  LI  LEEPLE+ E+R+ 
Sbjct  354   IETSGHAALKENYFLDDGAYLITKLLIELAKLKL--MDKRLTELINSLEEPLESKEIRLT  411

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             + ++             +F+ Y              G+  + E  +   N     I    
Sbjct  412   IKAD-------------NFKEY--------------GNNIIEELTIFTNNQSDWQIVPNN  444

Query  456   YR-AKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQS-MARDLR  316
             Y   +VS     E GW  LR S+H+P I +N++SN+ GG +  MAR  R
Sbjct  445   YEGVRVSCPSEEEKGWFLLRLSLHDPVIPINIESNVQGGVEKIMARLFR  493



>ref|WP_017306046.1| hypothetical protein [Spirulina subsalsa]
Length=517

 Score =   432 bits (1111),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 227/521 (44%), Positives = 321/521 (62%), Gaps = 41/521 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G     V+LTP     + ++F +W+     SE+       +++ +
Sbjct  11    KKLQNGSDIRGVALEGVPDEVVNLTPEVATGLGQAFVQWL-----SEKRAKSTPELKIGV  65

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG  L  A   G+   GC V+D G+A+TPA FMSTV P F+ D +IM+TASHLP
Sbjct  66    GRDSRLSGVELMGATIRGIQALGCRVYDFGMASTPAMFMSTVTPDFECDGAIMLTASHLP  125

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKA-ARKYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
             + RNG KFFT +GGL   ++ AI   A  + +  ++   S   R      DFM+ YA  L
Sbjct  126   FNRNGFKFFTAEGGLGKQDISAILSLAEGQDFPEKVEGGSIEQR------DFMAVYAAGL  179

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
                ++E VNHP  ++ PL+G +IIV+AGNG+GGF+   VL  LGADT GS  L PDGMFP
Sbjct  180   VQKVREGVNHPQRFERPLEGLKIIVDAGNGAGGFYVDQVLKPLGADTTGSQFLEPDGMFP  239

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NH+PNPE+K AMA    AVL   ADLG++FDTDVDR   V+ +G  +N +RLIAL++AIV
Sbjct  240   NHVPNPENKEAMAAICQAVLAEKADLGIIFDTDVDRGAAVEENGQELNRNRLIALIAAIV  299

Query  987   LKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMME  811
             L+EHPG+T+VTD+ TS GL+RFI     G H  ++ GY+NVI++ + LN+ G E+ L +E
Sbjct  300   LREHPGSTIVTDSITSDGLSRFIEDELKGVHHRFKRGYKNVINEAIRLNQAGQESWLAIE  359

Query  810   TSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVL  631
             TSGHGA++ENYFLDDGAY++ K+++E+ K K EG +  +G LI  LEEPLE+ E R+ + 
Sbjct  360   TSGHGAMRENYFLDDGAYLITKLLVELAKAKQEGRQ--LGDLIAQLEEPLESEEFRLKIK  417

Query  630   SEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYR  451
              E              F+ Y       G ++    + W  E       ++   +      
Sbjct  418   GE-------------DFKEY-------GKQVIEVLERWAGE------QENWGIVLPNYEG  451

Query  450   AKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMA  328
              +V+     E GW  LR S+H+P I +N++SN+ GG   +A
Sbjct  452   VRVNCHGEKERGWFLLRLSLHDPVIPLNIESNVKGGVSKIA  492



>ref|WP_035991226.1| phosphoglucomutase [Leptolyngbya sp. KIOST-1]
Length=509

 Score =   431 bits (1109),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 230/522 (44%), Positives = 326/522 (62%), Gaps = 43/522 (8%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNGSD+RGVAL+G   ++V+LTP  V  + ++F  W+ + L+       V+++ +++G 
Sbjct  12    LQNGSDIRGVALEGVPDQAVNLTPEVVNTLGKAFATWLAAELDLP-----VDALAIAVGR  66

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYT  1519
             D R+SG +L  AV  G+   GC V D+G+A+TPA FMSTVLP F    +IMMTASHLP+ 
Sbjct  67    DSRLSGPTLMQAVIEGMAALGCQVLDVGMASTPAMFMSTVLPEFGCQGAIMMTASHLPFN  126

Query  1518  RNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDI  1339
             RNGLKFFT++GGL   ++  I + A + +       +T    P  + D + AYA  L   
Sbjct  127   RNGLKFFTRRGGLGKGDISRILELAEQGH------FATTTPVPVERRDLIGAYAAGLVQQ  180

Query  1338  IKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHI  1159
             I++ VNHP H++ PL+G +IIV+AGNG+GGFF   VL+ LGA+T GS  L+PDG FPNH+
Sbjct  181   IRQAVNHPDHFEQPLRGLKIIVDAGNGAGGFFASQVLEPLGANTSGSQFLDPDGTFPNHV  240

Query  1158  PNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKE  979
             PNPED  A+A    AV+   AD G++FDTDVDR   VD  G  +N +RLIAL+SAIVL+E
Sbjct  241   PNPEDAVAIASICQAVVNQGADFGLIFDTDVDRGAAVDTDGRELNRNRLIALISAIVLQE  300

Query  978   HPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSG  802
             HPGTT+VTD+ TS GLTRFI G  GG H  +R GY+NVI++ + LNE G  + L +E SG
Sbjct  301   HPGTTIVTDSTTSDGLTRFIEGDLGGIHHRFRRGYKNVINEAIRLNEAGQPSWLAIEASG  360

Query  801   HGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS-E  625
             HGA+KENYFLDDGAY+V K++IE+ K +  G    +  LI  L++P  + E R+ +L+ E
Sbjct  361   HGAMKENYFLDDGAYLVSKLLIELAKARRSGKR--LTDLIASLQDPHTSQEYRLKILAPE  418

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
             P+   A+ +  ++ F             + +  D W              AI+      +
Sbjct  419   PQVYGAEVMNQLKGF-------------VATQAD-W--------------AIEPSYEGVR  450

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
             VS     E+GW  +R S+H+P + +N++SN+ GG   +   L
Sbjct  451   VSCSNPDENGWFMVRMSLHDPVLPLNVESNVAGGVAKITERL  492



>ref|WP_039725781.1| phosphoglucomutase [Lyngbya confervoides]
 gb|KIF14104.1| phosphoglucomutase [Aphanocapsa montana BDHKU210001]
 gb|KIF39038.1| phosphoglucomutase [Lyngbya confervoides BDU141951]
Length=512

 Score =   431 bits (1108),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 236/526 (45%), Positives = 325/526 (62%), Gaps = 41/526 (8%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNGSD+RGVA+ G     V+LTP     + ++F  W+ + L           + +++G 
Sbjct  13    LQNGSDIRGVAIAGVPDEPVNLTPEVAYTLGQAFVSWLAAQLHQP-----AAELTLAIGR  67

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYT  1519
             D R+SG  L AAV  G+   G  V+D+GLA+TPA FMSTVLP FQ D +IM+TASHLP+ 
Sbjct  68    DSRLSGPVLMAAVIKGMAAMGSRVYDVGLASTPAMFMSTVLPEFQCDGAIMLTASHLPFN  127

Query  1518  RNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDI  1339
             RNGLKFFT++GGL   ++  I + AA+   N  A  +      P   D +SAYA  L   
Sbjct  128   RNGLKFFTRQGGLGKPDITKILELAAQ---NEFAVTTVPGAIVPR--DLLSAYAAELVRQ  182

Query  1338  IKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHI  1159
             I+  VNHP H+D PL+G +I+V+AGNG+GGF+T  VL+ LGADT GS  L+PDG FPNH+
Sbjct  183   IRTAVNHPDHFDEPLRGLKIVVDAGNGAGGFYTDKVLEPLGADTTGSQFLDPDGNFPNHV  242

Query  1158  PNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKE  979
             PNPE+  AMA    AV  N AD G++FDTDVDR   VD  G  +N +RLIAL++AIVL+E
Sbjct  243   PNPENAVAMAAICGAVTANQADFGIIFDTDVDRGAAVDHEGRELNRNRLIALIAAIVLQE  302

Query  978   HPGTTVVTDARTSMGLTRFI-TGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSG  802
             HPG+T+VTD+ TS GLTRFI     G H  ++ GY+NVI++ + LNE G E+ L +ETSG
Sbjct  303   HPGSTIVTDSITSDGLTRFIEQDLDGVHHRFKRGYKNVINEAMRLNEAGQESWLAIETSG  362

Query  801   HGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEP  622
             HGA++ENYFLDDGAY+V K++ E+ K +L G    +  LI +L+EP+E+ ELR+ +L EP
Sbjct  363   HGAMRENYFLDDGAYLVSKLLGELAKARLSGKR--LTDLIANLQEPVESQELRLKIL-EP  419

Query  621   RHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA-K  445
                K    + I   + ++ +   PGW              +V  N          Y   +
Sbjct  420   DF-KTHGNQVITQLQTFVAEQ--PGW-------------AIVPNN----------YEGIR  453

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
             V+     E GW  LR S+H+P + +N++SN+ GG   +   L+  F
Sbjct  454   VACTNANEDGWFLLRLSLHDPVLPLNVESNVEGGVAQITAKLQAFF  499



>ref|WP_006507573.1| phosphomannomutase [Xenococcus sp. PCC 7305]
 gb|ELS05329.1| phosphomannomutase [Xenococcus sp. PCC 7305]
Length=508

 Score =   430 bits (1105),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 231/531 (44%), Positives = 326/531 (61%), Gaps = 39/531 (7%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             M   ++LQNGSD+RGVAL+G    +V+LTP     + ++F  W+   ++   G      +
Sbjct  1     MTNWKQLQNGSDIRGVALEGIPDETVNLTPKVANILGKAFVSWLTQQIDKSAG-----EL  55

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
              +++G D R+SG SL  ++  G+G  GC V+D  +A+TPA FMSTV P F  D +IM+TA
Sbjct  56    TIAVGRDSRLSGPSLMQSLMEGMGSCGCQVYDFAIASTPAMFMSTVTPGFNCDGAIMLTA  115

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYA  1357
             SHLP+ RNG KFFT +GGL   ++ AI + A +   N  A  +T       + DF++ YA
Sbjct  116   SHLPFNRNGFKFFTPQGGLGKPDIAAILELAEQ---NDFAIATTTKEL--QQHDFIAVYA  170

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
               L + I+E VNHP ++D PL G +I+V+AGNG+GGF+   VL  LGADT GS  L+PDG
Sbjct  171   AGLANKIREAVNHPENFDQPLTGLKILVDAGNGAGGFYADQVLKPLGADTTGSQFLDPDG  230

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNHIPNPEDK AMA  R AV+ N +D G++FDTDVDR   VD  GN +N +RLIAL+S
Sbjct  231   NFPNHIPNPEDKDAMASIRQAVIDNQSDFGIIFDTDVDRVAAVDYLGNELNRNRLIALIS  290

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHL  820
             AIVL+EHPG+T+VTD+ TS GL +FI     G H  ++ GY+NVI++ + LN++G E+ L
Sbjct  291   AIVLREHPGSTIVTDSITSDGLGQFIEQELTGVHHRFKRGYKNVINESLRLNQEGQESWL  350

Query  819   MMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRM  640
              +ETSGHGA+KENYFLDDGAY+  K++IE+ K KLE   + I  LI  L+EP E++E R+
Sbjct  351   AIETSGHGAMKENYFLDDGAYLATKLLIELAKSKLE--RKLITDLIAKLQEPDESSEFRL  408

Query  639   DVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF  460
              + ++   +  K V  I   + +                        V  N++       
Sbjct  409   KIGTDDFKSYGKDV--ISQLKEF----------------ALTQADWQVVPNNYEG-----  445

Query  459   MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                 ++S +   E GW  LR S+H+P I +N++SN+ GG   +   L D F
Sbjct  446   ---VRISCKSPKEDGWFLLRLSLHDPVIPLNVESNVAGGVAQIVPKLLDFF  493



>ref|XP_001415757.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94049.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=524

 Score =   430 bits (1105),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 251/526 (48%), Positives = 333/526 (63%), Gaps = 33/526 (6%)
 Frame = -1

Query  1890  KIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRV  1711
             ++++LQNGSD+RGVAL G +G ++ L      AI  +F +W    L +    A  + + V
Sbjct  2     RVKKLQNGSDIRGVALDGVEGEAITLDAATASAIGRAFADW----LRARNPNA--KDISV  55

Query  1710  SLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASH  1531
              +G DPR+SG++L   +FAG+ + G  V DMGLATTPACFM+ V    +YD S+M+TASH
Sbjct  56    GVGRDPRLSGETLRDGMFAGMVEGGARVIDMGLATTPACFMACVTEGAKYDGSVMLTASH  115

Query  1530  LPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVD--FMSAYA  1357
             LP+ RNG+KFFT +GGL   ++  IC +AA      +  V+    AP   V   F+  YA
Sbjct  116   LPFNRNGMKFFTSEGGLDKPDITDICARAAAYVEAGVGSVT----APSGVVSAPFLPTYA  171

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
               L DII++ VN   +YD PL G +I+V+AGNGSGGFF   VL+ LGADT GS  L+P+G
Sbjct  172   AQLCDIIRKGVNFTDNYDKPLTGMKIVVDAGNGSGGFFADMVLEALGADTSGSQFLDPNG  231

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNH PNPEDK AMA     VL   ADLG+VFDTDVDRS V+D SG  IN ++LIAL+S
Sbjct  232   NFPNHSPNPEDKEAMAAGVQCVLNAKADLGIVFDTDVDRSAVIDSSGKEINRNKLIALLS  291

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
              IVLKE PG T+VTD+ TS GL +FIT +GG+H  +  GY+NVI+KG  LN  GV T LM
Sbjct  292   EIVLKESPGATIVTDSVTSDGLHKFITAKGGKHVRFMRGYKNVINKGKELNASGVVTPLM  351

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGHGA+KENY LDDGAY+ VKIIIE V+ +L  +E  IG +++ LEEPLE AE+R+ 
Sbjct  352   IETSGHGAMKENYDLDDGAYLAVKIIIEAVRRRL-ANEPSIGQVLETLEEPLEEAEVRLK  410

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             + ++P   KA  +  IE+    +   N P   L   G C             PA  +   
Sbjct  411   I-ADPDF-KAYGLNVIENLLAAV---NDPAHSL--FGKC------------KPAPDNYEG  451

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
              R  V +E +G  GW  LR S+H+P + +N +S    G Q+MA + 
Sbjct  452   LRVCV-DEGDGRQGWFLLRCSLHDPVMVLNFESQTQCGVQTMAEEF  496



>ref|WP_026100882.1| phosphoglucomutase [Synechococcus sp. PCC 7336]
Length=507

 Score =   427 bits (1099),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 236/525 (45%), Positives = 324/525 (62%), Gaps = 43/525 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G  G +V+LTP  V  +  +F  W+   LE          + +S+
Sbjct  7     KKLQNGSDIRGVALEGIPGEAVNLTPEVVRVLGRAFVAWLSQKLEKP-----ATDLTLSV  61

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG  L+ A   G+  AGC VFD G+A+TPA F STV P F  D ++M+TASHLP
Sbjct  62    GRDSRLSGPELAKAAMEGMTAAGCRVFDFGMASTPAMFKSTVTPGFDCDGAMMVTASHLP  121

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAA-RKYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
             + RNG+KFFT +GGL   ++  I   A  R +A+     S   R      DF+S YA  L
Sbjct  122   FNRNGMKFFTARGGLDKQDISDILALAENRNFADSAEPGSLEQR------DFISVYADEL  175

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
                +++ V+HP H+D PLQG +IIV+AGNG+GGF+   VL  LGADT GS  L+PDG FP
Sbjct  176   VAEVRQGVSHPDHFDRPLQGLKIIVDAGNGAGGFYADKVLAPLGADTTGSQFLDPDGKFP  235

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NH+PNPE+K AMA    AV+++ AD G++FDTDVDR   VDRSG  +N +R IAL+SAIV
Sbjct  236   NHVPNPENKQAMASICQAVIEHGADFGIIFDTDVDRGAAVDRSGRELNRNRPIALVSAIV  295

Query  987   LKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMME  811
             L+EHPG+T+VTD+ TS GL++FI G   G H  ++ GY+NVI++ + LN +G E+ L +E
Sbjct  296   LREHPGSTIVTDSITSEGLSQFIEGDLNGVHHRFKRGYKNVINESIRLNNEGRESWLAIE  355

Query  810   TSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVL  631
             TSGHGA+KENYFLDDGAY+V  ++IE+ K  L+G  E +  LI +L+EP E+ E R+ + 
Sbjct  356   TSGHGAMKENYFLDDGAYLVTILLIELAKSALKG--ESLTDLIANLKEPEESREFRLGLG  413

Query  630   SEPRHAKAKAV-EAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMY  454
              E        V E +E+F       +   WE+ S       EG                 
Sbjct  414   VEDFKTYGNGVIEKLEAF-----ASDRDDWEIASPN----YEGV----------------  448

Query  453   RAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
               +VS     E GW  LR S+H+P + +N++SN+ GG   +A  L
Sbjct  449   --RVSCRSPQEGGWFLLRLSLHDPVMPLNIESNVTGGVAKIASRL  491



>ref|WP_017710813.1| hypothetical protein [Prochlorothrix hollandica]
Length=532

 Score =   428 bits (1100),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 237/534 (44%), Positives = 332/534 (62%), Gaps = 38/534 (7%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVAL G  G +V+LTP   E + ++F  W+ + LE          + +++G
Sbjct  29    KLQNGSDIRGVALDGVPGEAVNLTPAVAETLGKAFVTWLGTTLEK-----APPQLTIAIG  83

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              D R+SG  L AAV AG+   G  V+++GLA+TPA FMSTV P +Q   +IM+TASHLP+
Sbjct  84    RDSRLSGPDLLAAVVAGMTSLGATVWEVGLASTPAMFMSTVTPGWQCQGAIMLTASHLPF  143

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKV-STALRAPPSKVDFMSAYAKHLR  1345
              RNGLKFFT +GGL   ++ AI D AA   A     V S       ++ D M+ YA  L 
Sbjct  144   NRNGLKFFTAQGGLGKPDITAILDLAA---AGDWGSVPSDTAIGTVAQRDLMAVYAASLV  200

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             ++I+   NHP HY TPLQG ++IV+AGNGSGGF+   VL+ LGADT GS  L+PDG FPN
Sbjct  201   EMIRSGANHPHHYATPLQGLKVIVDAGNGSGGFYAAQVLEPLGADTTGSQFLDPDGTFPN  260

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             H+PNPED  AMA    AV+   AD G++FDTDVDR   VD  G  +N +RLIAL+SA+VL
Sbjct  261   HVPNPEDPEAMAAICGAVVAAKADFGLIFDTDVDRGAAVDSQGKELNRNRLIALISAVVL  320

Query  984   KEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             +EHP +T+VTD+ TS GLT+FI    GG H  ++ GY+NVI++ V LN+ G E+ L +ET
Sbjct  321   QEHPASTIVTDSITSDGLTQFIEQHLGGTHHRFKRGYKNVINEAVGLNKAGQESWLAIET  380

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGHGA++ENYFLDDGAY+V K+++E+ K K+ G    I  LI +L+EP+E+ E R+ + +
Sbjct  381   SGHGAMRENYFLDDGAYLVSKLLVELSKSKVAG--RSITDLIANLQEPVESQEFRLKIKA  438

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             E    K    + I + + +   G  P WE+                      +       
Sbjct  439   E--DFKTYGTQVIAALQDF--AGQQPDWEI----------------------VPKNYEGV  472

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMA  286
             +++    GE GW  LR S+H+P + +N++SN+ GG  ++A  L+  F   G++A
Sbjct  473   RIACGSPGESGWFLLRLSLHDPVMPLNIESNVAGGVAAIAARLQPFFQGCGDLA  526



>ref|WP_006453438.1| phosphoglucomutase [Synechococcus sp. PCC 7335]
 gb|EDX83694.1| Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
I protein [Synechococcus sp. PCC 7335]
Length=512

 Score =   427 bits (1097),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 228/536 (43%), Positives = 326/536 (61%), Gaps = 40/536 (7%)
 Frame = -1

Query  1914  VAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGG  1735
             +A+ +   + +RLQNGSD+RGVAL G  G SV+LTP     + ++F  W+   LE     
Sbjct  1     MAIQQLSREWQRLQNGSDIRGVALAGVAGESVNLTPEVAYRLGQAFVSWLAEKLEK----  56

Query  1734  AVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDA  1555
             A  E + VS+G D R+SG +L   +  G+   G  V D  +A+TPA FMSTV   ++ D 
Sbjct  57    ATTELI-VSVGRDSRLSGPTLKDGLATGMMSLGTKVLDFAIASTPAMFMSTVTDGYRCDG  115

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVD  1375
             +IM+TASHLP+ RNG KFFT  GGL   ++ AI        A   + + T+ +      D
Sbjct  116   AIMLTASHLPFNRNGFKFFTADGGLNKPDITAIL-----TLAEENSFLETSKKGKLEARD  170

Query  1374  FMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  1195
             F+S YA  L   I++ VNH  +YD PL+G  I+V+AGNG+GGF+   VL  LGADT GS 
Sbjct  171   FISVYADGLVQQIRQSVNHSENYDQPLEGLHIVVDAGNGAGGFYASKVLVPLGADTSGSQ  230

Query  1194  HLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDR  1015
              L PDG FPNHIPNPE++ AM+  R++VL N AD G++FDTDVDRS  VD  GN +N ++
Sbjct  231   FLEPDGNFPNHIPNPENEAAMSAIRSSVLDNKADFGIIFDTDVDRSAAVDPQGNELNRNK  290

Query  1014  LIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDG  835
             LIAL+SA+VL+EHPG+T+VTD+ TS GL +FI   GG H  ++ GY+NVI++ V LN +G
Sbjct  291   LIALISAVVLREHPGSTIVTDSITSDGLAQFIAELGGVHHRFKRGYKNVINEAVRLNGEG  350

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLET  655
              E+ L +ETSGHGA++ENYFLDDGAY+V K+++E+   +   S + I  LI +L+EP E+
Sbjct  351   EESWLAIETSGHGAMRENYFLDDGAYLVSKLLVELAIAR--QSNKVITDLISNLKEPAES  408

Query  654   AELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPA  475
              E R+ +L+E   +  + V  I+  + ++E    PGW +       +   C         
Sbjct  409   QEYRLKILTEDFKSHGEKV--IKRLQSFVEAQ--PGWHIVPNNYEGIRVTC---------  455

Query  474   AIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                              E GW  LR S+H+P + +N++SN  GG +++ + L + F
Sbjct  456   ---------------TKEQGWFLLRLSLHDPVLPLNIESNTKGGVEAIKQRLLNFF  496



>ref|WP_009169793.1| phosphoglucomutase [Clostridium sp. DL-VIII]
 gb|EHI99121.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Clostridium sp. DL-VIII]
Length=503

 Score =   426 bits (1095),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 238/541 (44%), Positives = 332/541 (61%), Gaps = 46/541 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RG+A+ G  G+ V+L P   + IA  F    +  LE+ +  A  E++++++G
Sbjct  7     KLQNGSDIRGIAIGG-AGKKVNLVPQVAKFIAYGF----VRMLEN-KINAKAENLKIAVG  60

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
             +D R+SG  L AAV   L   GC V+D  +ATTPA FM+TVL  ++ D SIM+TASHLPY
Sbjct  61    IDSRLSGPDLKAAVIEELTDLGCSVYDCSMATTPAMFMTTVLENYKCDGSIMITASHLPY  120

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRD  1342
               NGLKFFTK+GG    +++ I   A+++ +   A +        SKVD +  Y+K L  
Sbjct  121   YYNGLKFFTKEGGCEKEDIQNILSIASKEESYNSANLGEV-----SKVDLIDEYSKILAG  175

Query  1341  IIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNH  1162
             +I+   +   +YD PL GF+I+V+AGNG+GGFF + VL  LGAD  GS   +PDG FPNH
Sbjct  176   MIRRGADAKVNYDKPLAGFKIVVDAGNGAGGFFAYKVLKTLGADITGSQFTDPDGTFPNH  235

Query  1161  IPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLK  982
             IPNPE+K AM   R AVL+N ADLG++FDTDVDR+ +VD  G  IN + LIAL+S+IVL+
Sbjct  236   IPNPENKEAMESIRNAVLENRADLGIIFDTDVDRAAIVDSHGMEINKNALIALISSIVLE  295

Query  981   EHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSG  802
             EHP + +VTD+ TS GL  FI   GG H  ++ GYRNVI++ V LN +G E+ L +ETSG
Sbjct  296   EHPNSIIVTDSITSTGLGEFINKSGGIHHRFKRGYRNVINEAVRLNNEGKESDLAIETSG  355

Query  801   HGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEP  622
             H ALKENYFLDDGAY++ KI+I+M K+  EG    I SLIKDL+ P E+ + R+++  E 
Sbjct  356   HAALKENYFLDDGAYLIAKILIKMAKLNAEGKR--IESLIKDLKMPCESTDFRIEIRKEN  413

Query  621   -RHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
              R   ++ +  +ES+       N  G+ +       +   C                   
Sbjct  414   FREYGSRIIGDLESY------ANRTGFSIVPNNYEGIRVAC-------------------  448

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQ  265
               N+ NG+ GW  LR S+H P +A+N++S+  GG Q +     DK L   E    L+IS 
Sbjct  449   --NKANGD-GWFLLRLSLHEPVLALNIESDTKGGTQIII----DKLLPFLEKYDQLEISS  501

Query  264   I  262
             I
Sbjct  502   I  502



>ref|WP_019504044.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=510

 Score =   425 bits (1093),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 228/543 (42%), Positives = 334/543 (62%), Gaps = 48/543 (9%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G    +V+LTP   + +  +F +W+     S++       + +++
Sbjct  7     KKLQNGSDIRGVALEGVTDETVNLTPNVAKTLGNAFAQWL-----SQQAKKSTTELTIAI  61

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG++LS +V  G+  AGC V++  +A+TPA FMSTV   F  D +IM+TASHLP
Sbjct  62    GRDSRLSGETLSQSVIEGIAIAGCQVYNFEIASTPAMFMSTVTSGFMCDGAIMLTASHLP  121

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT +GGL   ++  I   A    A  +    T      S  +F++ YA  L 
Sbjct  122   FNRNGLKFFTPQGGLGKPDITNILSIAE---AGNLKTSDT--EGESSNHNFIAIYAAKLV  176

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             + I++ VNHP +++ PL G +I+V+AGNG+GGF+   VL  LGADT GS  L+PDGMFPN
Sbjct  177   ETIRQGVNHPDNFEQPLTGLKIVVDAGNGAGGFYVDQVLKPLGADTTGSQFLDPDGMFPN  236

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE+K AMA    AV+++ AD G++FDTDVDR   VD  G+ +N +R+IAL+SAIVL
Sbjct  237   HIPNPENKEAMASICQAVIEHQADFGIIFDTDVDRVAAVDHQGHELNRNRMIALISAIVL  296

Query  984   KEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             +EHPG+T+VTD+ TS GLT+FI    GG+H  ++ GY+NVI++ + LN  G E+ L +ET
Sbjct  297   QEHPGSTIVTDSITSDGLTQFIEQNLGGKHHRFKRGYKNVINESIRLNNAGSESWLAIET  356

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGHGA+KENYFLDDGAY+  K++ E+ K KL+G  + +  LI DL+EP+E+ E R+ +  
Sbjct  357   SGHGAMKENYFLDDGAYLATKLLAELAKSKLQG--KLLTDLISDLQEPVESEEFRLKI--  412

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
                         +E F+ Y   GN    EL++             + D    +       
Sbjct  413   -----------QVEDFKAY---GNDVIAELET----------FARSQDDWQIVPNNYEGV  448

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDIS  268
             ++S + + E GW  LR S+H+P I +N++SN+  G   + + L         +A F D  
Sbjct  449   RISCQSSTEDGWFLLRLSLHDPVIPLNIESNVNQGVSKIVQRL---------LAFFRDFE  499

Query  267   QID  259
              +D
Sbjct  500   ALD  502



>ref|WP_015219098.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Cyanobacterium aponinum]
 ref|YP_007161413.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Cyanobacterium aponinum PCC 10605]
 gb|AFZ53369.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Cyanobacterium aponinum PCC 10605]
Length=513

 Score =   425 bits (1093),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 230/529 (43%), Positives = 322/529 (61%), Gaps = 44/529 (8%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             M   ++LQNGSD+RGVAL+G +G  V+LTP  V+ + ++F +W+    E +     +  +
Sbjct  1     MVNWQKLQNGSDIRGVALEGIEGEEVNLTPEVVKTLGKAFTQWLQQKTEKK-----LNQL  55

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
              +S+G D R+SG+ L+ AV  G+   G  V +  L +TPA FMS +   F  D +IM+TA
Sbjct  56    VISIGRDSRLSGEVLAQAVTLGITSLGAKVLNFDLCSTPAMFMSCITEGFNCDGAIMLTA  115

Query  1536  SHLPYTRNGLKFFTKKGGLTS---TEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMS  1366
             SHLP+ RNGLKFFT  GGL      ++ AI +K      N   KV           DF+S
Sbjct  116   SHLPFNRNGLKFFTPDGGLEKQNIADILAIAEKNVFSETNEEGKVENH--------DFIS  167

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y+    + I+  VNHP H++ PL+G +IIV+AGNG+GGF+   VL  LGAD  GS  L 
Sbjct  168   VYSNLFVEKIRSHVNHPQHFEQPLKGLKIIVDAGNGAGGFYAEKVLKPLGADITGSQFLE  227

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDG FPNHIPNPE+K AMA    AV+ N AD G++FDTDVDRS  VD  G  +N +RLIA
Sbjct  228   PDGNFPNHIPNPENKEAMASIAQAVIDNQADFGIIFDTDVDRSAAVDSQGKELNRNRLIA  287

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVET  826
             L+S+I+LKEHP +T+VTD+ TS GLT+FI   GG+H  ++ GY+NVI++ + LN+ G E+
Sbjct  288   LISSIILKEHPRSTIVTDSITSDGLTKFIEDLGGKHHRFKRGYKNVINESLRLNKVGEES  347

Query  825   HLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAEL  646
              + +ETSGH ALKENYFLDDGAY+V K++IE+ K++L+G  + +  LI +L EP+E+ E 
Sbjct  348   WVAIETSGHAALKENYFLDDGAYLVTKLLIELAKLRLKG--QNLTDLISNLIEPIESEEF  405

Query  645   RMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAID  466
             R+ +  E        V  I+    Y+E  N   WE+ +       EG             
Sbjct  406   RLKINVEDFQNYGNNV--IDKLGFYVE--NQTDWEIVTPN----YEGI------------  445

Query  465   AFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
                 R   S+ E  E GW  LR S+H+P I +N+++N+ GG   +A  L
Sbjct  446   ----RVSCSSPE--EQGWFLLRLSLHDPVIPLNIETNVQGGVNKIASRL  488



>ref|WP_015163936.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Pseudanabaena sp. PCC 7367]
 ref|YP_007101390.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Pseudanabaena sp. PCC 7367]
 gb|AFY68962.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Pseudanabaena sp. PCC 7367]
Length=513

 Score =   425 bits (1092),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 227/528 (43%), Positives = 327/528 (62%), Gaps = 41/528 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RG+AL+G    SV+LT      + ++F  W+ + +        ++ + +S+
Sbjct  8     KKLQNGSDIRGIALEGVADESVNLTSEVARKLGQAFATWLAAKVNKP-----IDKLLISV  62

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG  L  A  AG+   G  V+D  LA+TPA FMSTV   F  + +IM+TASHLP
Sbjct  63    GRDSRLSGPDLMQATIAGINSMGAQVYDFDLASTPAMFMSTVTIGFSCEGAIMLTASHLP  122

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNG+KFFT +GGL   ++  I   AA   AN+    +   +A  +K DF+S YA    
Sbjct  123   FNRNGMKFFTAQGGLNKQDITDILALAA---ANKFELANAPGKA--TKRDFISVYADQFV  177

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               I+  VNHP H+  PLQG +IIV+AGNG+GGF+   VL  LGADT GS  L+PDG FPN
Sbjct  178   TKIRNAVNHPKHFKQPLQGLKIIVDAGNGAGGFYADKVLKTLGADTTGSQFLDPDGTFPN  237

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             H+PNPE+K AMA    AV+++ AD G++FDTDVDRS  VD  GN +N +RLIAL++AIV+
Sbjct  238   HVPNPENKVAMASICDAVVKHQADFGIIFDTDVDRSAAVDGQGNELNRNRLIALIAAIVI  297

Query  984   KEHPGTTVVTDARTSMGLTRFI-TGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
              EHPG+T+VTD+ TS GLT+FI    GG+H  ++ GY+NVI++ V LNE G E+ L +ET
Sbjct  298   NEHPGSTIVTDSITSDGLTKFIEQDLGGKHHRFKRGYKNVINEAVRLNEAGQESWLAIET  357

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDV-L  631
             SGH A+KENYFLDDGAY+V K++IE+ K KL G  + +  LI +L+EP+E++E R+ + +
Sbjct  358   SGHAAMKENYFLDDGAYLVSKLLIELAKAKLAG--KSLTDLIANLKEPVESSEFRLKIGV  415

Query  630   SEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYR  451
              + +    + ++ + +F    E+ +   W++       +   C  D  D           
Sbjct  416   DDFKTHGQQVIDKLTAFA--TEQSD---WQIVPNNYEGIRVACPADNED-----------  459

Query  450   AKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                        GW  LR S+H+P I +N++SN+ GG  ++A  L   F
Sbjct  460   -----------GWFLLRLSLHDPVIPLNIESNVAGGVNAIAARLLTFF  496



>ref|WP_017293907.1| hypothetical protein [Geminocystis herdmanii]
Length=507

 Score =   424 bits (1091),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 233/528 (44%), Positives = 320/528 (61%), Gaps = 43/528 (8%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVAL G +G  V+LTP  +  I ++F  W    L  E+G    E V +S+G
Sbjct  8     KLQNGSDIRGVALTGVEGEEVNLTPDVIATIGKAFTMW----LSQEKGKKPSELV-ISIG  62

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              D R+SG++L  A+ + +   G  V+D  +A+TPA FMST+   F  D  IM+TASHLP+
Sbjct  63    RDSRLSGETLMNALMSSIELLGVKVYDFAMASTPAMFMSTITEGFNCDGGIMLTASHLPF  122

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRD  1342
              RNGLKFFT KGGL    +  I   A +       K          K DFM+ YA     
Sbjct  123   NRNGLKFFTDKGGLEKQNITDILTLAEKGEFPTNEK-----EGFIEKRDFMTVYANQFVS  177

Query  1341  IIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNH  1162
              I+E VNHP ++DTPLQG +IIV+AGNG+GGF+   VL  LGAD  GS  L PDG FPNH
Sbjct  178   KIREEVNHPDNFDTPLQGLKIIVDAGNGAGGFYATKVLQPLGADINGSQFLEPDGTFPNH  237

Query  1161  IPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLK  982
             IPNPE+K AM     AV+++ AD G++FDTDVDRS  VD  G  +N ++LIAL+SAI+LK
Sbjct  238   IPNPENKEAMESICQAVIRHQADFGIIFDTDVDRSAAVDSQGKELNRNKLIALISAIILK  297

Query  981   EHPGTTVVTDARTSMGLTRFI-TGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             EHP +T+VTD+ TS GLT FI     G+H  ++ GY+NVI++ + LN++G E+ + +ETS
Sbjct  298   EHPHSTIVTDSITSDGLTAFIEEDLQGKHHRFKRGYKNVINEALRLNQEGTESWIAIETS  357

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH ALKENYFLDDGAY+V K++IE+ K+KL   +  +  LI +L+EP+E+ E R+ + +E
Sbjct  358   GHAALKENYFLDDGAYLVTKLLIELAKLKLVNKD--LTDLINNLKEPVESEEFRLIINAE  415

Query  624   P-RHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
               +    K +E +  F       N P W              +V  N          Y  
Sbjct  416   NFKEYGTKVIEKLTEF-----SANQPHW-------------TIVPNN----------YEG  447

Query  447   -KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
              +VS +   E GW  LR S+H+P + +N+++NI GG + +A  L   F
Sbjct  448   IRVSCQSPSEKGWFLLRLSLHDPVLPLNIETNIEGGIEKIASRLLTFF  495



>ref|WP_021670356.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
II [Prevotella disiens]
 gb|ERJ74606.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
II [Prevotella disiens JCM 6334 = ATCC 29426]
Length=494

 Score =   424 bits (1089),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 224/518 (43%), Positives = 322/518 (62%), Gaps = 43/518 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G +G +V+LT      +A++F  W+      E+ G   +++  ++
Sbjct  4     KKLQNGSDIRGVALEGIEGENVNLTEEVTSILAQAFVRWL-----GEKNGKTQQTI--AI  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+S  +L  A  AG    G  V + G+A+TPA FM+TV    + D ++M+TASHLP
Sbjct  57    GSDSRLSSPTLRDAFSAGASAMGAKVLNFGMASTPAMFMATVDESLKADGTVMVTASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT KGGL   ++  I + AA + A +     T  +     VDFM  Y + L+
Sbjct  117   WNRNGLKFFTAKGGLEKADIARILELAAAQNAQQ-----TEGKGEVKDVDFMQTYCQILK  171

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             D I++ VN     D PL+G  IIV+AGNG+GGFF   VL+ LGA+T GS  L P+G FPN
Sbjct  172   DYIRKSVNSG---DQPLKGMHIIVDAGNGAGGFFANKVLEPLGANTAGSQFLEPNGNFPN  228

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             H+PNPE+K AMA    AV+ N ADLG++FDTDVDRS +VDR+G PIN + LIAL+SA++L
Sbjct  229   HVPNPENKEAMASICKAVVDNKADLGIIFDTDVDRSAIVDRTGAPINRNALIALISAVIL  288

Query  984   KEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             +EHP +T+VTD+ TS GL +FI  R G H  +R GY+NVI++ + LN +G E+ L +ETS
Sbjct  289   REHPQSTIVTDSVTSDGLAKFIADRKGVHHRFRRGYKNVINESLRLNAEGEESWLAIETS  348

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH AL+ENYFLDDGAY+V K+I+E   ++ EG E  +  LI DL++P E+ E+R  + ++
Sbjct  349   GHAALRENYFLDDGAYLVAKLIVEAANLRKEGKE--LQDLISDLQQPEESKEIRFKITTD  406

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                   + V  +E  R   EK    GW++ +     V   C  +                
Sbjct  407   DFKKYGEKV--LEHIRLNAEKHK--GWQIVTPNHEGVRIACTAEN---------------  447

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                    E GW  LRQS+H+P + +N++SN+ GG +++
Sbjct  448   -------EQGWFLLRQSLHDPVLPLNIESNVKGGVEAI  478



>ref|WP_004356366.1| phosphoglucomutase [Prevotella disiens]
 gb|EFL46361.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
II [Prevotella disiens FB035-09AN]
Length=494

 Score =   423 bits (1088),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 224/518 (43%), Positives = 322/518 (62%), Gaps = 43/518 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G +G +V+LT      +A++F  W+      E+ G   +++  ++
Sbjct  4     KKLQNGSDIRGVALEGIEGENVNLTEEVTSILAQAFVRWL-----GEKNGKTQQTI--AI  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+S  +L  A  AG    G  V + G+A+TPA FM+TV    + D ++M+TASHLP
Sbjct  57    GSDSRLSSPTLRDAFSAGASAMGAKVLNFGMASTPAMFMATVDESLKADGTVMVTASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT KGGL   ++  I + AA + A +     T  +     VDFM  Y + L+
Sbjct  117   WNRNGLKFFTAKGGLEKADIARILELAAAQNAQQ-----TEGKGEVKDVDFMQTYCQILK  171

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             D I++ VN     D PL+G  IIV+AGNG+GGFF   VL+ LGA+T GS  L P+G FPN
Sbjct  172   DYIRKSVNSG---DQPLKGMHIIVDAGNGAGGFFANKVLEPLGANTAGSQFLEPNGNFPN  228

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             H+PNPE+K AMA    AV+ N ADLG++FDTDVDRS +VDR+G PIN + LIAL+SA++L
Sbjct  229   HVPNPENKEAMASICKAVVDNKADLGIIFDTDVDRSAIVDRTGAPINRNTLIALISAVIL  288

Query  984   KEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             +EHP +T+VTD+ TS GL +FI  R G H  +R GY+NVI++ + LN +G E+ L +ETS
Sbjct  289   REHPQSTIVTDSVTSDGLAKFIADRKGVHHRFRRGYKNVINESLRLNAEGEESWLAIETS  348

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH AL+ENYFLDDGAY+V K+I+E   ++ EG E  +  LI DL++P E+ E+R  + ++
Sbjct  349   GHAALRENYFLDDGAYLVAKLIVEAANLRKEGKE--LQDLISDLQQPEESKEIRFKITTD  406

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                   + V  +E  R   EK    GW++ +     V   C  +                
Sbjct  407   DFKKYGEKV--LEHIRLNAEKHE--GWQIVTPNHEGVRIACTAEN---------------  447

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                    E GW  LRQS+H+P + +N++SN+ GG +++
Sbjct  448   -------EQGWFLLRQSLHDPVLPLNIESNVKGGVEAI  478



>ref|WP_013334283.1| phosphoglucomutase [Cyanothece sp. PCC 7822]
 ref|YP_003899599.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Cyanothece sp. PCC 7822]
 gb|ADN17533.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Cyanothece sp. PCC 7822]
Length=510

 Score =   424 bits (1090),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 232/540 (43%), Positives = 331/540 (61%), Gaps = 43/540 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RG+AL+G     V+LT      + ++F  W+   L     G    ++ +S+
Sbjct  7     KKLQNGSDIRGIALEGVADEPVNLTEEVANILGKAFVTWLKKQL-----GQPASNLTISV  61

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG  L  AV  G+   GC V+D  +A+TPA FMST+   F  DA+IM+TASHLP
Sbjct  62    GRDSRLSGPKLMTAVMEGISTTGCRVYDFDMASTPAMFMSTISQKFACDAAIMLTASHLP  121

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNG KFFT KGGL   ++  I      K A+     + A      K+DF+S YA  L 
Sbjct  122   FNRNGFKFFTAKGGLDKQDISEIL-----KLASENVFETVATPGEIEKLDFISVYADSLV  176

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             + ++E VN   +Y+ PL G +IIV+AGNG+GGF+   VL  LGADT GS  ++PDG FPN
Sbjct  177   NKVREPVNDSQNYEQPLLGLKIIVDAGNGAGGFYADKVLKTLGADTKGSQFIDPDGRFPN  236

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE++ AMA  R AVL++ ADLG++FDTDVDR+ VV  SG  +N +RLIAL+SAIVL
Sbjct  237   HIPNPENEEAMASIRQAVLEHKADLGIIFDTDVDRAAVVTNSGKELNRNRLIALISAIVL  296

Query  984   KEHPGTTVVTDARTSMGLTRFI-TGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             +EHPG+T+VTD+ TS GLT FI     G H  ++ GY+NVI++ + LN++G E+ L +ET
Sbjct  297   QEHPGSTIVTDSITSDGLTEFIEQDLKGIHHRFKRGYKNVINESMRLNQEGQESWLAIET  356

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGH ALKENYFLDDGAY+V K+II +  ++LEG  +G+  LI  L+EP E+ E R+ +  
Sbjct  357   SGHAALKENYFLDDGAYLVTKLIINLALLRLEG--KGLNDLITTLKEPQESQEYRLKI--  412

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
               ++ K    + IE  + +  K     W+              V  N++           
Sbjct  413   NRQNFKECGEQVIEKLQEFASKQT--DWQ--------------VVPNNYEG--------M  448

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDIS  268
             ++S +   E GW+ LR S+H+P + +N++SN+ GG   +   + D F    +  +FLD+S
Sbjct  449   RISCKSPQEKGWLLLRLSLHDPVMPLNIESNVEGGVSQIVNRIFDFF----KPFEFLDLS  504



>ref|WP_036884469.1| phosphoglucomutase [Prevotella disiens]
 gb|KGF47310.1| phosphoglucomutase [Prevotella disiens DNF00882]
Length=494

 Score =   423 bits (1088),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 224/518 (43%), Positives = 321/518 (62%), Gaps = 43/518 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G +G +V+LT      +A++F  W+      E+ G   +++  ++
Sbjct  4     KKLQNGSDIRGVALEGIEGENVNLTEEVTSILAQAFVRWL-----GEKNGKTQQTI--AI  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+S  +L  A  AG    G  V + G+A+TPA FM+TV    + D ++M+TASHLP
Sbjct  57    GSDSRLSSPTLRDAFSAGASAMGAKVLNFGMASTPAMFMATVDESLKADGTVMVTASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT KGGL   ++  I + AA + A +     T  +     VDFM  Y + L+
Sbjct  117   WNRNGLKFFTAKGGLEKADIARILELAAAQNAQQ-----TEGKGEVKDVDFMQTYCQILK  171

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             D I++ VN     D PL+G  IIV+AGNG+GGFF   VL+ LGA+T GS  L PDG FPN
Sbjct  172   DYIRKSVNSG---DQPLKGMHIIVDAGNGAGGFFANKVLEPLGANTAGSQFLEPDGNFPN  228

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             H+PNPE+K AM     AV+ N ADLG++FDTDVDRS +VDR+G PIN + LIAL+SA++L
Sbjct  229   HVPNPENKEAMVSICKAVVDNKADLGIIFDTDVDRSAIVDRTGAPINRNTLIALISAVIL  288

Query  984   KEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             +EHP +T+VTD+ TS GL +FI  R G H  +R GY+NVI++ + LN +G E+ L +ETS
Sbjct  289   REHPQSTIVTDSVTSDGLAKFIADRKGVHHRFRRGYKNVINESLRLNAEGEESWLAIETS  348

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH AL+ENYFLDDGAY+V K+I+E   ++ EG E  +  LI DL++P E+ E+R  + ++
Sbjct  349   GHAALRENYFLDDGAYLVAKLIVEAANLRKEGKE--LQDLISDLQQPEESKEIRFKITTD  406

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                   + V  +E  R   EK    GW++ +     V   C  +                
Sbjct  407   DFKKYGEKV--LEHIRLNAEKHE--GWQIVTPNHEGVRIACTAEN---------------  447

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                    E GW  LRQS+H+P + +N++SN+ GG +++
Sbjct  448   -------EQGWFLLRQSLHDPVLPLNIESNVKGGVEAI  478



>ref|WP_015183935.1| phosphomannomutase [Microcoleus sp. PCC 7113]
 ref|YP_007123205.1| phosphomannomutase [Microcoleus sp. PCC 7113]
 gb|AFZ19799.1| phosphomannomutase [Microcoleus sp. PCC 7113]
Length=510

 Score =   423 bits (1088),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 233/546 (43%), Positives = 331/546 (61%), Gaps = 54/546 (10%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G    SV+LTP     + ++F +W+      ++ G     + +S+
Sbjct  7     KKLQNGSDIRGVALEGVANESVNLTPQVANILGKAFVKWL-----EQKVGKSASDLTISV  61

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG  L   V  G+   G  V+D  +A+TPA F+STV   F  D +IM+TASHLP
Sbjct  62    GRDSRLSGPELMQGVMEGISSIGSRVYDFAMASTPAMFVSTVTSGFDCDGAIMLTASHLP  121

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAAR-KYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
             + RNGLKFFT +GGL   ++  I   A + ++   +AK +        + DF+S YA   
Sbjct  122   FNRNGLKFFTAQGGLEKKDISDILALAEKNEFEEAVAKGAI------EQHDFISVYADGF  175

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
              + I++ VNHP H++ PLQG +IIV+AGNG+GGF+   VL  LGADT GS  L PDG FP
Sbjct  176   VNKIRQAVNHPQHFEQPLQGLRIIVDAGNGAGGFYAQKVLAPLGADTTGSQFLEPDGTFP  235

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NHIPNPE+K AMA    AV+ N AD G++FDTDVDR   VD+ G  +N +RLIAL+SAIV
Sbjct  236   NHIPNPENKEAMASICQAVIANKADFGIIFDTDVDRGAAVDQFGKELNRNRLIALISAIV  295

Query  987   LKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMME  811
             L+EHPG+T+VTD+ TS GLT+FI G   G H  ++ GY+NVI++ + LN++G ++ L +E
Sbjct  296   LREHPGSTIVTDSITSDGLTQFIEGELKGVHHRFKRGYKNVINESIRLNQEGQDSWLAIE  355

Query  810   TSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVL  631
             TSGHGA+KENYFLDDGAY+V K++IE+ + KL+G  + +  LI  L+EP E+ E R+ + 
Sbjct  356   TSGHGAMKENYFLDDGAYLVSKLLIELAQSKLQG--KSLPDLIATLKEPEESEEFRLKI-  412

Query  630   SEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGC--LVDTNDHPAAIDAFM  457
                          +  F+ Y       G E+      +VSE     V  N++        
Sbjct  413   ------------GVPDFKSY-------GHEVIKKLQAFVSEQSDWTVVPNNYEG------  447

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFL  277
                +VS   + E GW  LR S+H+P + +N++SN+ GG   +A  L         +A F 
Sbjct  448   --MRVSCRSSMEDGWFLLRLSLHDPVLPLNIESNVKGGVSQIATRL---------IAFFQ  496

Query  276   DISQID  259
             D   +D
Sbjct  497   DFESLD  502



>ref|WP_024750168.1| phosphoglucomutase [Cyanothece sp. ATCC 51472]
Length=508

 Score =   423 bits (1088),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 229/525 (44%), Positives = 328/525 (62%), Gaps = 39/525 (7%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G     V+LTP   + + ++F  W+      ++ G V   + +SL
Sbjct  7     KKLQNGSDIRGVALEGIPDEKVNLTPEVAKILGQAFVSWL-----GKKLGKVPSELIISL  61

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG +L AAV  G+   G  V+  G+A+TPA FMST+ P    D +IM+TASHLP
Sbjct  62    GRDSRLSGPNLLAAVTEGISLLGSKVYGFGIASTPAMFMSTINPEINCDGAIMLTASHLP  121

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFTK GGL   ++  I +  A +   ++A+    ++      DF+S YA+ L 
Sbjct  122   FNRNGLKFFTKDGGLNKGDIADILN-LAEENEFQIAQQKGIIQ----NYDFISVYAQGLV  176

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               ++E VNH  ++D PL+G +IIV+AGNG+GGF+   VL  LGADT GS  L PDG FPN
Sbjct  177   KKVREGVNHLDNFDQPLKGLKIIVDAGNGAGGFYAEKVLKPLGADTTGSQFLEPDGTFPN  236

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE++ AM     AVL N AD G++FDTDVDRS  VD  G  +N +RLIAL+SAIVL
Sbjct  237   HIPNPENEEAMQSICQAVLDNKADFGIIFDTDVDRSAAVDSFGKELNRNRLIALISAIVL  296

Query  984   KEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             +EHPG+T+VTD+ TS GLT FI     G H  ++ GY+NVI++ + LN++G E+ L +ET
Sbjct  297   QEHPGSTIVTDSITSEGLTSFIEEELNGVHHRFKRGYKNVINESIRLNDEGQESWLAIET  356

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGHGA+KENYFLDDGAY+V K++IE+ K + +G  + +  LI +L+EP E+ E R+ + +
Sbjct  357   SGHGAMKENYFLDDGAYLVTKLLIELAKCQQQG--KVLTDLIANLKEPEESQEFRLKIKT  414

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             E  + K    + I   + +                    E   +  N++           
Sbjct  415   E--NFKDYGNDIIRKLQQF----------------AATQENWQIVPNNYEG--------V  448

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRD  313
             ++S   + E+GW+ LR S+H+P I +N++SNI GG Q++A  L D
Sbjct  449   RISCSSSDENGWLLLRLSLHDPVIPINIESNISGGVQNIATKLLD  493



>ref|WP_009543274.1| phosphoglucomutase [Cyanothece sp. ATCC 51142]
 ref|YP_001806096.1| putative phosphoglucomutases [Cyanothece sp. ATCC 51142]
 gb|ACB54030.1| putative phosphoglucomutases [Cyanothece sp. ATCC 51142]
Length=509

 Score =   423 bits (1088),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 229/525 (44%), Positives = 328/525 (62%), Gaps = 39/525 (7%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G     V+LTP   + + ++F  W+      ++ G V   + +SL
Sbjct  8     KKLQNGSDIRGVALEGIPDEKVNLTPEVAKILGQAFVSWL-----GKKLGKVPSELIISL  62

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG +L AAV  G+   G  V+  G+A+TPA FMST+ P    D +IM+TASHLP
Sbjct  63    GRDSRLSGPNLLAAVTEGISLLGSKVYGFGIASTPAMFMSTINPEINCDGAIMLTASHLP  122

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFTK GGL   ++  I +  A +   ++A+    ++      DF+S YA+ L 
Sbjct  123   FNRNGLKFFTKDGGLNKGDIADILN-LAEENEFQIAQQKGIIQ----NYDFISVYAQGLV  177

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               ++E VNH  ++D PL+G +IIV+AGNG+GGF+   VL  LGADT GS  L PDG FPN
Sbjct  178   KKVREGVNHLDNFDQPLKGLKIIVDAGNGAGGFYAEKVLKPLGADTTGSQFLEPDGTFPN  237

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE++ AM     AVL N AD G++FDTDVDRS  VD  G  +N +RLIAL+SAIVL
Sbjct  238   HIPNPENEEAMQSICQAVLDNKADFGIIFDTDVDRSAAVDSFGKELNRNRLIALISAIVL  297

Query  984   KEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             +EHPG+T+VTD+ TS GLT FI     G H  ++ GY+NVI++ + LN++G E+ L +ET
Sbjct  298   QEHPGSTIVTDSITSEGLTSFIEEELNGVHHRFKRGYKNVINESIRLNDEGQESWLAIET  357

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGHGA+KENYFLDDGAY+V K++IE+ K + +G  + +  LI +L+EP E+ E R+ + +
Sbjct  358   SGHGAMKENYFLDDGAYLVTKLLIELAKCQQQG--KVLTDLIANLKEPEESQEFRLKIKT  415

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             E  + K    + I   + +                    E   +  N++           
Sbjct  416   E--NFKDYGNDIIRKLQQF----------------AATQENWQIVPNNYEG--------V  449

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRD  313
             ++S   + E+GW+ LR S+H+P I +N++SNI GG Q++A  L D
Sbjct  450   RISCSSSDENGWLLLRLSLHDPVIPINIESNISGGVQNIATKLLD  494



>ref|WP_006631399.1| phosphoglucomutase [Microcoleus vaginatus]
 gb|EGK90422.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Microcoleus vaginatus FGP-2]
Length=508

 Score =   422 bits (1085),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 235/545 (43%), Positives = 327/545 (60%), Gaps = 51/545 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RG+AL+G     V+LTP     + +SF  W++     ++       + +++G
Sbjct  8     KLQNGSDIRGIALEGVPNEKVNLTPEIATILGKSFVSWLV-----QKVNKPAAELTIAIG  62

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              D R+SG +L  AV  G+   G  V+D  +A+TPA FMST+ P F  D +IM+TASHLP+
Sbjct  63    RDSRLSGPTLMQAVMEGIASVGATVYDFEMASTPAMFMSTITPGFDCDGAIMLTASHLPF  122

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKY---ANRMAKVSTALRAPPSKVDFMSAYAKH  1351
              RNGLKFFT KGGL   ++  I   A   Y   A+   K++        K DF+S YA  
Sbjct  123   NRNGLKFFTAKGGLQKQDITDILTLAQSNYFQPASSPGKIT--------KHDFISVYANQ  174

Query  1350  LRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMF  1171
                 I+E VNHP ++D PL G +I+V+AGNG+GGF+   VL  LGADT GS  L PDG F
Sbjct  175   FVKKIRESVNHPDNFDEPLTGLKIVVDAGNGAGGFYVDKVLKPLGADTTGSQFLEPDGTF  234

Query  1170  PNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAI  991
             PNH+PNPEDK AM     AV+++ AD G++FDTDVDRS  VD+ G  +N +RLIAL+SAI
Sbjct  235   PNHVPNPEDKQAMQSVCQAVIEHQADFGIIFDTDVDRSAAVDQVGKELNRNRLIALISAI  294

Query  990   VLKEHPGTTVVTDARTSMGLTRFI-TGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             VLKEHPG+T+VTD+ TS GLT+FI     G H  ++ GY+NVID+ + L E G E+ L +
Sbjct  295   VLKEHPGSTIVTDSITSDGLTQFIEQDLKGIHHRFKRGYKNVIDESIRLTEAGHESWLAI  354

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDV  634
             ETSGHGALKENYFLDDGAY+V K++IE+ K KL  + + +  LI +L+EP E+AE R+ +
Sbjct  355   ETSGHGALKENYFLDDGAYLVSKLLIELAKSKL--ANQSLPDLIANLKEPEESAEFRIKL  412

Query  633   LSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMY  454
               +    KA+    IE  + ++           S    W     +V  N          Y
Sbjct  413   GVD--DFKAQGDRVIEQLQEFV-----------STQADW----KIVPNN----------Y  445

Query  453   RA-KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFL  277
                ++S     E GW  LR S+H+P + +N++SN+ GG   +   L   F    +  + L
Sbjct  446   EGLRISCTSASESGWFLLRLSLHDPVMPLNVESNVKGGVAHIVARLLTFF----QTTESL  501

Query  276   DISQI  262
             D+S +
Sbjct  502   DLSAL  506



>ref|WP_022157192.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
II [Prevotella sp. CAG:520]
 emb|CDB05609.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
II [Prevotella sp. CAG:520]
Length=489

 Score =   421 bits (1083),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 235/530 (44%), Positives = 337/530 (64%), Gaps = 46/530 (9%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G +G  V+LTP  +E IA+SF  W+       R  +  E+  +++
Sbjct  4     KKLQNGSDIRGVALEGIEGEHVNLTPEVIETIAKSFVRWI-------RNNSDCETPTIAV  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             GMD R+SG S+ +A   G  +AG  V D GLA+TPA FM+T+    +  AS+M+TASHLP
Sbjct  57    GMDCRLSGSSIKSAFVKGAVEAGANVVDCGLASTPAMFMTTISEHVKATASVMVTASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAAR-KYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
             + RNGLKFFT KGGL S ++ +I   A   ++A   AK S+      S +DFM  Y++H+
Sbjct  117   FNRNGLKFFTPKGGLDSKDIASILTIAENGEFAFEGAKGSS------STLDFMDIYSRHI  170

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
              D I+E VN    Y  PL+G  IIV+AGNG+GGFF   +L  LGADT GS  L+PDG FP
Sbjct  171   ADYIREGVN-ADDYQHPLKGMHIIVDAGNGNGGFFE-KILSMLGADTKGSQFLDPDGRFP  228

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NHIPNPED+ AMA    AV ++ ADLGV+FDTDVDRS ++ R G PIN + LIAL+S+++
Sbjct  229   NHIPNPEDREAMASVCKAVEESDADLGVIFDTDVDRSAIIGRKGEPINRNSLIALISSVI  288

Query  987   LKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             L EHPG+T+VTD+ TS GL  +I+ +GG+H  +R GY+NVI++G+ LNE G E  L +ET
Sbjct  289   LDEHPGSTIVTDSVTSDGLAEYISEKGGRHHRFRRGYKNVINEGIRLNEAGEECWLAIET  348

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGH AL+EN+FLDDGAY+  K+I+   K+  EG +  +  +I  L++P E+ E+R+  L+
Sbjct  349   SGHAALRENHFLDDGAYLAAKLIVFAAKLYKEGKQ--VHEVIASLKQPKESKEIRIK-LT  405

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             +P   KA+  + +E  +   +   + GW              +V+ N          Y  
Sbjct  406   DPDF-KAQGAKVLEDMK--AKAAGVEGW-------------TIVEPN----------YEG  439

Query  447   -KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLL  301
              +VS     E GW  LR S+H+P + +N++SN+ GG +++   L+   L+
Sbjct  440   LRVSCGNVDEAGWWLLRMSLHDPVMPLNIESNVGGGVEAIEGKLKSLGLI  489



>ref|WP_013239544.1| MULTISPECIES: phosphoglucomutase [Clostridium]
 ref|YP_003781056.1| phosphomannomutase [Clostridium ljungdahlii DSM 13528]
 ref|YP_008698381.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Clostridium autoethanogenum DSM 10061]
 gb|ADK15954.1| phosphomannomutase [Clostridium ljungdahlii DSM 13528]
 gb|AGY75125.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Clostridium autoethanogenum DSM 10061]
Length=504

 Score =   421 bits (1083),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 231/543 (43%), Positives = 331/543 (61%), Gaps = 43/543 (8%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             +E++ +LQNG+D+RG+A++  + + V+LT   V+AIA  F +W+       +G      +
Sbjct  2     IEELHKLQNGTDIRGIAIENPE-KKVNLTAVEVKAIAGGFIKWLKDKKNIRKG-----KI  55

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
             ++++GMD R+SG  +   +   L   GC V+D GL TTPA FM+TVL  ++ D SIM+TA
Sbjct  56    KIAVGMDSRLSGPEIKEVILNELVNLGCSVYDCGLCTTPAMFMTTVLGNYKCDGSIMITA  115

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYA  1357
             SHLPY  NGLKFFT+ GG    +++ I D A  K          + +   SKVDF+  Y+
Sbjct  116   SHLPYYHNGLKFFTENGGCEKEDIKYILDSAVEKDLKY-----PSYKGEISKVDFIDTYS  170

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
               L + I++ +N    Y+ PL  F+IIV+AGNG+GGFF   VL KLGA+  GS  +NPDG
Sbjct  171   NLLVEKIRKGINSNEDYEMPLSKFKIIVDAGNGAGGFFASKVLKKLGAEVEGSQFINPDG  230

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNHIPNPE K AM   R AVL+N ADLG+VFD DVDR+ +VD  G  IN + LIAL+S
Sbjct  231   RFPNHIPNPEAKEAMDSIRKAVLENKADLGIVFDADVDRAAIVDAGGMEINRNSLIALIS  290

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
             +I+L+EHPG+T+VTD+ TS GL+ FI   GG+H  ++ GYRNVI++G+ LNE G + +L 
Sbjct  291   SIILEEHPGSTIVTDSVTSNGLSEFIENLGGKHHRFKRGYRNVINEGIRLNEQGEKCYLA  350

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGH ALKENYFLDDGAY++ KI+++M K+  +G  + I  LIK L+   E+ E R D
Sbjct  351   IETSGHAALKENYFLDDGAYLISKILVKMAKLHKQG--KSIEDLIKSLKISPESLEFRFD  408

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             +L+     K      +   + Y+EK N  GW                  N+ P   +   
Sbjct  409   ILNSS--FKDYGYRILGDLKKYVEKIN--GW------------------NEAPNNYEGVR  446

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFL  277
                   N+ NG+ GW  LR S+H P + +N++S+   G + +  +L++  +   E    L
Sbjct  447   VNC---NKLNGD-GWFLLRISLHEPVLCLNIESDSKEGIKVIMDNLKNFLINYNE----L  498

Query  276   DIS  268
             DIS
Sbjct  499   DIS  501



>ref|WP_036480361.1| phosphoglucomutase [Myxosarcina sp. GI1]
Length=507

 Score =   421 bits (1083),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 222/532 (42%), Positives = 328/532 (62%), Gaps = 49/532 (9%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G    +V+LTP   + + ++F  W+     SE+ G   E + VS+
Sbjct  7     KKLQNGSDIRGVALEGVPEETVNLTPEVAKTLGQAFANWL-----SEKVGKSPEELVVSV  61

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG++L  +   G+ + GC V++ G+A+TPA FMST+ P F  D  +M+TASHLP
Sbjct  62    GRDSRLSGQTLIESFMEGMSECGCQVYNFGIASTPAMFMSTIDPKFNCDGGVMLTASHLP  121

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKV----DFMSAYA  1357
             + RNG KFFT + GL   ++  I + A +   N  A VS      P+K     DF+S YA
Sbjct  122   FNRNGFKFFTNRSGLDKKDIADILNLAEQ---NNFATVS------PTKAIEQHDFISVYA  172

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
               L + ++  VN   ++D PL+G +I+ +AGNG+GGF+   VL  LGADT GS  L PDG
Sbjct  173   AGLVETVRNAVNSSENFDRPLEGLKIVADAGNGAGGFYVDKVLQPLGADTTGSQFLEPDG  232

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNH+PNPE++ AMA    AV+ N AD G++FDTDVDR+  VD  GN +N +RLIAL+S
Sbjct  233   TFPNHVPNPENQEAMAAICQAVIDNDADFGIIFDTDVDRAAAVDHQGNELNRNRLIALIS  292

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHL  820
             AIVL+EHPG+T+VTD+ TS GL++FI     G H  ++ GY+NVI++ + LN++G E+ L
Sbjct  293   AIVLQEHPGSTIVTDSITSEGLSKFIEKDLNGVHHRFKRGYKNVINESIRLNQEGQESWL  352

Query  819   MMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRM  640
              +ETSGHGA+KENYFLDDGAY+  K++ E+ K K EG  + +  LI +L EP+E+ E R+
Sbjct  353   AIETSGHGAMKENYFLDDGAYLATKLLAELAKSKQEG--KFLTDLIANLVEPVESEEYRL  410

Query  639   DVLSEPRHAKA-KAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDA  463
              +  +   A   K +E ++ F       +   W+              +  N++      
Sbjct  411   KITVDDFKAYGNKVIEKLQEFAR-----SQTDWK--------------IVPNNYEG----  447

Query  462   FMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                  ++S +   E GW  LR S+H+P + +N++SN+ GG + +   L + F
Sbjct  448   ----VRISCQSPDEDGWFLLRLSLHDPVLPLNIESNVSGGVEKIVSRLNEFF  495



>ref|WP_015175946.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Oscillatoria nigro-viridis]
 ref|YP_007115059.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ06643.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Oscillatoria nigro-viridis PCC 7112]
Length=508

 Score =   419 bits (1078),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 235/542 (43%), Positives = 328/542 (61%), Gaps = 45/542 (8%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RG+AL+G     V+LTP     + +SF  W++  +   + GA    + +++G
Sbjct  8     KLQNGSDIRGIALEGVPNEKVNLTPEIATILGKSFVSWLVQKVN--KPGA---ELTIAIG  62

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              D R+SG +L  AV  G+   G  V+D  +A+TPA FMST+ P F  D +IM+TASHLP+
Sbjct  63    RDSRLSGPTLMQAVMEGIASVGATVYDFDMASTPAMFMSTITPGFDCDGAIMLTASHLPF  122

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRD  1342
              RNGLKFFT KGGL   +   I D  A   +N     ++      +K DF+S YA     
Sbjct  123   NRNGLKFFTAKGGLQKQD---ITDILALAQSNNFQPAASP--GNITKHDFISVYANQFVT  177

Query  1341  IIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNH  1162
              I+E VNHP +++ PL G +I+V+AGNG+GGF+   VL  LGADT GS  L PDG FPNH
Sbjct  178   KIREAVNHPDNFEQPLTGLKIVVDAGNGAGGFYVDQVLKPLGADTTGSQFLEPDGTFPNH  237

Query  1161  IPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLK  982
             +PNPEDK AM     AV+++ AD G++FDTDVDRS  VDR G  +N +RLIAL+SAIVL+
Sbjct  238   VPNPEDKQAMQSICQAVIEHQADFGIIFDTDVDRSAAVDRVGKELNRNRLIALISAIVLQ  297

Query  981   EHPGTTVVTDARTSMGLTRFI-TGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             EHPG+T+VTD+ TS GLT+FI     G H  ++ GY+NVID+ + LNE G E+ L +ETS
Sbjct  298   EHPGSTIVTDSITSDGLTQFIEQDLKGIHHRFKRGYKNVIDESIRLNEAGQESWLAIETS  357

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GHGALKENYFLDDGAY+V K++IE+ K KL  + + +  LI +L+EP E+AE R+ +  +
Sbjct  358   GHGALKENYFLDDGAYLVSKLLIELAKSKL--ANQSLPDLIANLKEPEESAEFRIKMGVD  415

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA-  448
                 KA     +E  + ++           S    W     +V  N          Y   
Sbjct  416   --DFKAHGSRVLEQLQEFV-----------STQADW----KIVPNN----------YEGL  448

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDIS  268
             ++S     E GW  LR S+H+P + +N++SN+ GG   +     D+ L   +  + LD S
Sbjct  449   RISCTSPSESGWFLLRLSLHDPVMPLNVESNVKGGVAHIV----DRLLGFFQTTESLDFS  504

Query  267   QI  262
              +
Sbjct  505   AL  506



>ref|WP_009627585.1| Phosphoglucomutase [Pseudanabaena biceps]
 gb|ELS32288.1| Phosphoglucomutase [Pseudanabaena biceps PCC 7429]
Length=510

 Score =   419 bits (1078),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 232/550 (42%), Positives = 337/550 (61%), Gaps = 48/550 (9%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             +++QNGSD+RGVA+ G     V+LTP  V  + ++F  W+     S++       + +S+
Sbjct  7     QKIQNGSDIRGVAIAGVPNEEVNLTPEVVSILGKAFASWL-----SQKLNKPTTELLISV  61

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG  L  AV  G+   G  V+D+ +A+TPA FMST+   F+ D +IM+TASHLP
Sbjct  62    GRDSRLSGAELMQAVMTGINALGSQVYDLAIASTPAMFMSTITDGFKCDGAIMLTASHLP  121

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT +GGL   ++  I        A +   V +  +   ++ +F++ YA    
Sbjct  122   FNRNGLKFFTAQGGLEKKDITDIL-----TLAEKNEFVVSESQGKITEHNFIAVYASQFV  176

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               I+  VNHP HY+ PL+G ++IV+AGNG+GGF+   VL  LGAD  GS  L+PDG FPN
Sbjct  177   TQIRRAVNHPEHYEQPLKGLKVIVDAGNGAGGFYADQVLLPLGADITGSQFLDPDGTFPN  236

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             H+PNPEDK AMA    AV+++ AD G++FDTDVDRS  VD+ G  +N +RLIAL+SAIVL
Sbjct  237   HVPNPEDKAAMAAICDAVIKHQADFGIIFDTDVDRSAAVDQFGKELNRNRLIALISAIVL  296

Query  984   KEHPGTTVVTDARTSMGLTRFIT-GRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             +EHP +T+VTD+ TS GLT+FI     G+H  ++ GY+NVI++ + LN+ G E+ L +ET
Sbjct  297   QEHPQSTIVTDSITSDGLTKFIERDLQGKHHRFKRGYKNVINESIRLNQTGHESWLAIET  356

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGHGA+KENYFLDDGAY+V K++IE+ K KL G  + +  LI +L+EP+E+ E R+ +  
Sbjct  357   SGHGAMKENYFLDDGAYLVSKLLIELAKSKLTG--KSLTDLIVNLQEPIESEEFRIKMTV  414

Query  627   EPRHAKA-KAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYR  451
             +   A   + +  +++F       N P W++         EG  V  N    +ID     
Sbjct  415   DDFKALGDRLINDLQAF-----ASNQPDWQIVPHN----YEGIRVSCN----SID-----  456

Query  450   AKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDI  271
                      E+GW  LR S+H+P + +N++SNI GG   + + L   F    +  + LDI
Sbjct  457   ---------ENGWFLLRLSLHDPVMPLNIESNIEGGVAKILQRLTAFF----QSIEGLDI  503

Query  270   SQIDEFARNG  241
             S    F+RNG
Sbjct  504   S---AFSRNG  510



>ref|WP_015133190.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Leptolyngbya sp. PCC 7376]
 ref|YP_007070250.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Leptolyngbya sp. PCC 7376]
 gb|AFY37416.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Leptolyngbya sp. PCC 7376]
Length=509

 Score =   419 bits (1078),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 240/547 (44%), Positives = 339/547 (62%), Gaps = 48/547 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVAL+G     V+LT   V  + ++FG W+   L+        + + V++G
Sbjct  8     QLQNGSDIRGVALKGIVNEPVNLTAERVTLLGKAFGTWLSQQLDQP-----TDRLIVAVG  62

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              D R+SG++LSAAV  GL   G  V+D+ +A+TPA FMST+   F  D +IM+TASHLP+
Sbjct  63    RDSRLSGEALSAAVTTGLTSLGIQVYDVAIASTPAMFMSTITEGFDCDGAIMLTASHLPF  122

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRD  1342
              RNGLKFFTKKGGL   +++A     A   AN    ++T      ++ D M+ YA+ L  
Sbjct  123   NRNGLKFFTKKGGLDKPDIKA---ILALAAANEFEAIATP--GNVTERDLMAVYAEQLVK  177

Query  1341  IIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNH  1162
              I+E VN  T+++ PL+G +I+V+AGNGSGGF+   VL  LGADT GS  L PDGMFPNH
Sbjct  178   TIREGVNAKTNFEQPLKGLKIVVDAGNGSGGFYVDRVLQPLGADTTGSQFLEPDGMFPNH  237

Query  1161  IPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLK  982
             IPNPE++TAMA   AAV  N AD G++FDTDVDR   VD SG  +N +RLIALMS +VL+
Sbjct  238   IPNPENETAMAAISAAVTANKADFGIIFDTDVDRGAAVDPSGKELNRNRLIALMSVVVLR  297

Query  981   EHPGTTVVTDARTSMGLTRFI-TGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             EHPG+T+VTD+ TS GL  FI    GG H  YR GY+NVI++ + LNE G E+ L +ETS
Sbjct  298   EHPGSTIVTDSITSDGLATFIEQDLGGVHFRYRRGYKNVINQAIALNESGEESWLAIETS  357

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVL-S  628
             GHGA+KEN+FLDDGAY++ K+++E+ K+  +G  + I  LI  L+EP+E+ E R  +  S
Sbjct  358   GHGAMKENHFLDDGAYLITKLLVEVAKLHEQG--KTITDLIATLQEPVESEEFRFKITES  415

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             + +      +E ++ F    E      W++         EG                   
Sbjct  416   DFKTYGLGVIEKLKDFAAQQEN-----WQIVPKN----REGI------------------  448

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDIS  268
             +VS + +G+ GW  LR S+H+P + +N++SN+ GG + +   L + FL      K+ D++
Sbjct  449   RVSCKSSGQDGWFLLRLSLHDPVMPLNVESNVKGGVEKINSQLLE-FL-----QKYEDLT  502

Query  267   QIDEFAR  247
              I EF +
Sbjct  503   -IGEFGK  508



>ref|WP_027428091.1| phosphoglucomutase [Lachnospiraceae bacterium AD3010]
Length=502

 Score =   419 bits (1077),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 239/551 (43%), Positives = 336/551 (61%), Gaps = 51/551 (9%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             +E   +L+NGSD+RG+A++ E   +V+LT  AV  +A +F  W+  G  S++       +
Sbjct  3     IEDYAKLRNGSDIRGIAMENEWNEAVNLTGEAVSHLAAAFIVWL--GKNSDK-----RPL  55

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
             R+++G D R++G  L  +VF G+   G L FD+GLA+TPACFMSTVL    +D SIM+TA
Sbjct  56    RIAVGRDSRLTGPELQKSVFDGIASEGALPFDLGLASTPACFMSTVLGDEPFDGSIMITA  115

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYA  1357
             SHLPY RNGLKFF+ KGGL   ++  + + A  +   +   V       P K DFM +Y 
Sbjct  116   SHLPYHRNGLKFFSPKGGLEKEDIVLLTETAPGRQVEKTGTV-------PEKSDFMDSYC  168

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
              +LR+ I   VN   H D PL+G  IIV+AGNG+GGFF   VL +LGADT GS +L PDG
Sbjct  169   AYLREKICSGVNAADH-DHPLKGLHIIVDAGNGAGGFFADRVLKELGADTEGSRYLEPDG  227

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNHIPNPE++ A    R A +   ADLG++FDTDVDR+G V   G  +  + LIA++S
Sbjct  228   RFPNHIPNPENREAAEAIREATVSTNADLGIIFDTDVDRAGAVLPDGRALTRNDLIAVLS  287

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
             +IV+ EHPGTT+VTD+ TS GL  FI  +GG H  ++ GYRNVI++ + LN +G+E+ L 
Sbjct  288   SIVINEHPGTTIVTDSITSDGLAAFIREKGGVHKRFKRGYRNVINESIKLNNEGIESDLA  347

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGHGALKENYFLDDGAY++VK++ E+ K K       I  +I  L+EPLE+AE+R  
Sbjct  348   IETSGHGALKENYFLDDGAYLMVKLLTELGKGK------NINEMISGLKEPLESAEIRFP  401

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             V +E        + A+ S     EK    GW L+        EG  ++T           
Sbjct  402   VTAEDVQENGDRILALLS--ESAEK--TEGWSLEKEN----YEGVRINT-----------  442

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFL  277
                   ++ +GE GW  LR+S+H P + +NL+S+  GG + MA  L    L   + +  +
Sbjct  443   ------DKAHGE-GWFLLRKSLHEPIMPLNLESDTKGGNKLMAAAL----LKVLKESSGI  491

Query  276   DISQIDEFARN  244
             D+S ++ F +N
Sbjct  492   DLSPLESFVQN  502



>ref|WP_008313443.1| phosphomannomutase [Leptolyngbya sp. PCC 6406]
Length=518

 Score =   419 bits (1078),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 230/526 (44%), Positives = 323/526 (61%), Gaps = 43/526 (8%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNGSD+RGVAL G  G  V+LTP    A+ ++F  W+ + L+       +  + ++LG 
Sbjct  12    LQNGSDIRGVALDGVPGEVVNLTPAIATALGQAFATWLATSLKR-----AISDLTIALGR  66

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYT  1519
             D R+SG +L  AV  G+   G  V+D GLA+TPA FMST+ P +    +IM+TASHLP+ 
Sbjct  67    DSRLSGPTLMQAVAEGITSLGARVYDFGLASTPAMFMSTITPGYGCHGAIMLTASHLPFN  126

Query  1518  RNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDI  1339
             RNG+KFFT +GGL   ++ A+ D AA    +        +       DFM+ YA+ L   
Sbjct  127   RNGMKFFTVQGGLEKPDITALLDLAAAGAFS-----PAPVFGQRDSCDFMAVYAEQLVRT  181

Query  1338  IKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHI  1159
             I++ VNHPT +D PL G  I+V+AGNG+GGF+   VL+ LGAD  GS  L+PDG FPNH+
Sbjct  182   IRQGVNHPTQFDRPLTGLHIVVDAGNGAGGFYVSQVLEPLGADVTGSQFLDPDGTFPNHV  241

Query  1158  PNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKE  979
             PNPE   AMA  R AVL++ AD G++FDTDVDR+  VD  G  +N +RLIALM+AIVL+E
Sbjct  242   PNPEHPVAMAALRQAVLEHRADFGIIFDTDVDRAAAVDAQGQELNRNRLIALMAAIVLQE  301

Query  978   HPGTTVVTDARTSMGLTRFI-TGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSG  802
             HPG+T+VTD+ TS GLT+FI T   G H  +R GY+NVI++ + LNE G E+ L +ETSG
Sbjct  302   HPGSTIVTDSITSDGLTQFIETDLQGVHYRFRRGYKNVINEALRLNETGQESWLAIETSG  361

Query  801   HGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEP  622
             H ALKENYFLDDGAY+V K++IE+ K    G++  + + I  L+EP+E+ E R+ + +E 
Sbjct  362   HAALKENYFLDDGAYVVSKLLIELAKAHSAGTD--LSARIASLQEPVESREFRITITAE-  418

Query  621   RHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKV  442
                +A   + IE  R +            +    W      V  N H           ++
Sbjct  419   -DFQAYGTQVIEHLRTFA-----------TTQSDWT-----VVPNTHEG--------VRI  453

Query  441   SNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGG----CQSMARDLR  316
             + +   E GW  LR S+H+P + +N++SN+PGG    CQ++   L+
Sbjct  454   ACQAPQEGGWCLLRLSLHDPVLPLNVESNVPGGVGQICQTLVSYLQ  499



>ref|WP_026504093.1| phosphoglucomutase [Butyrivibrio sp. NC3005]
Length=501

 Score =   418 bits (1075),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 232/546 (42%), Positives = 332/546 (61%), Gaps = 51/546 (9%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNGSD+RG+A++ E G  V+LT  A   +  +F  W+I     E+ G   + ++++LG 
Sbjct  6     LQNGSDIRGIAMENETGAEVNLTNEAARDLGYAFAIWLI-----EQSGK--KDLKIALGR  58

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYT  1519
             D R++G++L  +   G+  AG L  D G+A+TPA FMSTVL    YD S+M+TASHLPY 
Sbjct  59    DSRLTGQALLESAAQGIAAAGVLCDDFGIASTPAMFMSTVLA--DYDGSVMITASHLPYY  116

Query  1518  RNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDI  1339
             RNG+KFFT KGGL   ++  +  KA       ++     L    +KV+FM  Y+K+LRD 
Sbjct  117   RNGMKFFTPKGGLEKAQIAELTKKADDVAKKEISFSKIGL----NKVNFMEDYSKYLRDK  172

Query  1338  IKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHI  1159
             I    N     + PL+G +IIV+AGNG+GGF+  +VL  LGAD  GS  L PDG FPNHI
Sbjct  173   I---CNGVGKSERPLEGLKIIVDAGNGAGGFYVENVLKPLGADVTGSQFLEPDGHFPNHI  229

Query  1158  PNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKE  979
             PNPE+K A    + A + N ADLG++FDTDVDR+G V  SG  +  + LIA++S I L+E
Sbjct  230   PNPENKEAAESIKNATIANKADLGIIFDTDVDRAGAVLPSGKTLTRNDLIAVLSRIALQE  289

Query  978   HPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGH  799
             HPGTT+VTD+ TS GL +FI   GG H  ++ GYRNVID+ + LN +G+++ L +ETSGH
Sbjct  290   HPGTTIVTDSVTSSGLAKFIKAHGGVHRRFKRGYRNVIDESIRLNNEGIDSQLAIETSGH  349

Query  798   GALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDV-LSEP  622
             GA KEN+FLDDGAY++VK++IEM      G  +G+  +I DLEEP E+ ELR  V L   
Sbjct  350   GAFKENFFLDDGAYLMVKLLIEM------GKGQGLEEMIADLEEPKESNELRFKVNLDAG  403

Query  621   RHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKV  442
                +      ++    ++E+ N  GW L+      V   C                    
Sbjct  404   EELQKNGDRILDGLVSFVERTN--GWSLEKDNFEGVRVNC--------------------  441

Query  441   SNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQI  262
              ++ENG+ GW+ LR+S+H P + +N++S+  GGC  +AR L++   L  E    LD++ +
Sbjct  442   -DKENGD-GWLLLRKSLHEPIMPLNIESDSEGGCLVIARKLKE--FLGKEST--LDLTPL  495

Query  261   DEFARN  244
             ++F  +
Sbjct  496   NDFCND  501



>ref|WP_006514706.1| phosphomannomutase [Leptolyngbya sp. PCC 7375]
 gb|EKV00285.1| phosphomannomutase [Leptolyngbya sp. PCC 7375]
Length=507

 Score =   418 bits (1075),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 227/527 (43%), Positives = 320/527 (61%), Gaps = 39/527 (7%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVA+ G     V+LTP   + + ++F  W+ + L           +++++
Sbjct  7     KKLQNGSDIRGVAIDGVPNEPVNLTPEIAQRLGQAFTNWLATKLSKP-----ATDLQLAV  61

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG +L  +V  G+   G  V+D+ +A+TPA FMSTV P F  D +IMMTASHLP
Sbjct  62    GRDSRVSGPALMQSVMDGMASLGANVYDVSMASTPAMFMSTVTPGFDCDGAIMMTASHLP  121

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT +GGL  T++  I   A +   N  +   TA        DF++ YA  L 
Sbjct  122   FNRNGLKFFTAQGGLAKTDITEILTLAEQ---NDFSLADTA--GTIETRDFIAVYADQLV  176

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               I+  VNHP H++ PLQG +IIV+AGNG+GGF+   VL+ LGADT GS  L PDGMFPN
Sbjct  177   QKIRNAVNHPQHFEQPLQGLKIIVDAGNGAGGFYANKVLEPLGADTTGSQFLEPDGMFPN  236

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE+  AMA    AVL N AD G++FDTDVDRS  VD  G  +N +RLIAL+SAIVL
Sbjct  237   HIPNPENHAAMASICQAVLANKADFGIIFDTDVDRSAAVDHQGQELNRNRLIALISAIVL  296

Query  984   KEHPGTTVVTDARTSMGLTRFI-TGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             +EHPG+T+VTD+ TS GL +FI     G+H  ++ GY+NVI + V LN+ G E+ L +ET
Sbjct  297   QEHPGSTIVTDSITSDGLAQFIEQDLRGKHHRFKRGYKNVITEAVRLNQTGEESWLAIET  356

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGHGA++ENYFLDDGAY+V K++IE+ K+K  G    +  LI  L+EP E+ E+R+ +  
Sbjct  357   SGHGAMRENYFLDDGAYLVSKLLIELAKVKQAG--RSLTDLIVTLKEPKESREIRIKIGV  414

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
                 +  ++V  I+  + ++E+                ++  LV  N             
Sbjct  415   NEFKSYGESV--IDQLKTFVEQQ---------------ADWSLVPNN---------YEGV  448

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
             +V+     E GW  LR S+H+P + +N++S + GG   +   L   F
Sbjct  449   RVACSSPKEDGWFLLRLSLHDPVLPLNIESTVEGGVAQITERLLTFF  495



>ref|WP_008050108.1| phosphoglucomutase [Arthrospira sp. PCC 8005]
 emb|CCE16002.1| Putative Phosphoglucomutase/phosphomannomutase [Arthrospira sp. 
PCC 8005]
 emb|CDM94562.1| Putative Phosphoglucomutase/phosphomannomutase [Arthrospira sp. 
PCC 8005]
Length=513

 Score =   418 bits (1075),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 226/531 (43%), Positives = 326/531 (61%), Gaps = 47/531 (9%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVA+ G     V+LTP     + ++F  WV     S++ G     + +++
Sbjct  10    KKLQNGSDIRGVAIAGVANEPVNLTPEIATILGKAFASWV-----SQKLGKNTAELTMAV  64

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG  LS AV  G+   G  V+D+ +A+TPA FMSTV P ++ D +IM+TASHLP
Sbjct  65    GRDSRLSGPVLSQAVMEGIISTGAQVYDLAIASTPAMFMSTVTPGWECDGAIMLTASHLP  124

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAP-PSKV---DFMSAYA  1357
             + RNGLKFFT +GGL   ++  I +         +AK++   ++P P  +   DF+S YA
Sbjct  125   FNRNGLKFFTPQGGLGKPDISEILE---------LAKLNDFAKSPTPGSIIQHDFISVYA  175

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
             + L + I++ VNHPT+ + PL G +IIV+AGNG+GGF+   VL  LGADT GS  L+PDG
Sbjct  176   EGLVNTIRQGVNHPTNLEQPLTGLKIIVDAGNGAGGFYAEKVLKPLGADTTGSQFLDPDG  235

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNH+PNPE++ AM     AV+ N AD G++FDTDVDR   VD+ G  +N +RLIAL+S
Sbjct  236   TFPNHVPNPENQAAMQSICQAVIDNKADFGIIFDTDVDRGAAVDQLGKELNRNRLIALIS  295

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHL  820
             AIVL+EHPG+ +VTD+ TS GLT FI     G H  ++ GY+NVI++ + LNE G E+ L
Sbjct  296   AIVLREHPGSAIVTDSITSDGLTHFIEQELKGVHHRFKRGYKNVINEAIRLNESGQESWL  355

Query  819   MMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRM  640
              +ETSGHGA+KENYFLDDGAY+V K++IE+ K  L+G  + +  LI +L+EP E+ E+R+
Sbjct  356   AIETSGHGAMKENYFLDDGAYLVSKLLIELAKTHLKG--KSLTDLIANLQEPAESEEVRI  413

Query  639   DVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF  460
              + ++   +    V  IE    ++ +     WE+                      +   
Sbjct  414   TIQNDDFQSLGNNV--IEKLNQFVSQQT--DWEI----------------------VPKN  447

Query  459   MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                 +VS     E GW  LR S+H+P + +N++SN+ GG   +A  L   F
Sbjct  448   YEGVRVSCGSPDEDGWFLLRLSLHDPVLPLNIESNVVGGVAKIANRLLGFF  498



>ref|WP_026072936.1| phosphoglucomutase [Nodosilinea nodulosa]
Length=517

 Score =   418 bits (1075),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 223/523 (43%), Positives = 320/523 (61%), Gaps = 41/523 (8%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNGSD+RGVAL G  G +V+LTP     + ++F  W+   L           + +++G 
Sbjct  16    LQNGSDIRGVALDGVAGEAVNLTPDVANLLGKAFATWLADELSLP-----ATDLAIAVGR  70

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYT  1519
             D R+SG +L AAV  G+   GC V D+ +A+TPA FMSTVLP F    +IM+TASHLP+ 
Sbjct  71    DSRLSGPTLMAAVIDGMTALGCRVMDVAMASTPAMFMSTVLPEFSCHGAIMLTASHLPFN  130

Query  1518  RNGLKFFTKKGGLTSTEVEAICDKAAR-KYANRMAKVSTALRAPPSKVDFMSAYAKHLRD  1342
             RNGLKFFT+ GGL   ++  I ++A +  +A      + A   P    D ++AY+  L  
Sbjct  131   RNGLKFFTQSGGLGKGDIARILERAEQGDFA------AAAFPGPVEHRDLIAAYSATLVQ  184

Query  1341  IIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNH  1162
              I++ VNHP ++D PL G +IIV+AGNG+GGF+   VL+ LGADT GS  L+PDG FPNH
Sbjct  185   QIRQSVNHPGNFDQPLHGLKIIVDAGNGAGGFYASQVLEPLGADTTGSQFLDPDGTFPNH  244

Query  1161  IPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLK  982
             +PNPE++ AMA    AV+ + AD G++FDTDVDR   VD +G  +N +RLIAL++ IVL+
Sbjct  245   MPNPENEAAMASICQAVVAHGADFGIIFDTDVDRGAAVDENGRELNRNRLIALIATIVLQ  304

Query  981   EHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
              HPG+T+VTD+ TS GLT+FI G  GG H  ++ GY+NVI++ V LNE G    L +ETS
Sbjct  305   AHPGSTIVTDSITSDGLTQFIEGDLGGIHHRFKRGYKNVINEAVRLNESGQAAWLAIETS  364

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GHGA+KENYFLDDGAY+V ++++E+ K +L G    +  LI  L+EP E+ E R+ +L  
Sbjct  365   GHGAMKENYFLDDGAYLVSQLLVELAKTRLAGKR--LTDLIATLQEPEESREFRLKILET  422

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                    +V  I+  + ++   +   WE+                      +       +
Sbjct  423   DFQPYGNSV--IDRLQGFVATQS--DWEV----------------------VPKNYEGVR  456

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLR  316
             V+ +   E+GW  LR S+H+P + +N++SN+ GG   +A  LR
Sbjct  457   VACQAADENGWFLLRLSLHDPVLPLNIESNVAGGVAKIAARLR  499



>ref|WP_006619315.1| phosphoglucomutase [Arthrospira platensis]
 ref|YP_005069717.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI91179.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR55024.1| phosphoglucomutase [Arthrospira platensis str. Paraca]
Length=513

 Score =   418 bits (1074),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 229/544 (42%), Positives = 332/544 (61%), Gaps = 51/544 (9%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVA+ G     V+LTP     + ++F  WV     S++ G     + +++
Sbjct  10    KKLQNGSDIRGVAIAGVANEPVNLTPEIATILGKAFASWV-----SQKLGKNTAELTMAV  64

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG  LS AV  G+   G  V+D+ +A+TPA FMSTV P ++ D +IM+TASHLP
Sbjct  65    GRDSRLSGPVLSQAVMEGIISTGAQVYDLAIASTPAMFMSTVTPGWECDGAIMLTASHLP  124

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAP-PSKV---DFMSAYA  1357
             + RNGLKFFT +GGL  +++  I +         +AK++    +P P  +   DF+S YA
Sbjct  125   FNRNGLKFFTPQGGLGKSDISEILE---------LAKLNDFANSPTPGSIIQHDFISVYA  175

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
             + L + I++ VNHPT+++ PL G +IIV+AGNG+GGF+   VL  LGADT GS  L+PDG
Sbjct  176   EGLVNKIRQGVNHPTNFEQPLTGLKIIVDAGNGAGGFYAEKVLKPLGADTTGSQFLDPDG  235

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNH+PNPE++ AM     AV+ N AD G++FDTDVDR   VD  G  +N +RLIAL+S
Sbjct  236   TFPNHVPNPENQAAMESICQAVIDNKADFGIIFDTDVDRGAAVDNLGKELNRNRLIALIS  295

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHL  820
             AIVL+E+PG+ +VTD+ TS GLT FI     G H  ++ GY+NVI++ + LNE G E+ L
Sbjct  296   AIVLRENPGSAIVTDSITSDGLTHFIEQELKGVHHRFKRGYKNVINEAIRLNETGQESWL  355

Query  819   MMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRM  640
              +ETSGHGA+KENYFLDDGAY+V K++IE+ K  L+G  + +  LI +L+EP E+ E+R+
Sbjct  356   AIETSGHGAMKENYFLDDGAYLVSKLLIELAKTHLQG--KSLTDLIANLQEPAESQEVRI  413

Query  639   DVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF  460
              + ++    K+     IE    ++ +     WE+                      +   
Sbjct  414   TIQND--DFKSLGNNVIEKLNQFVSQQT--DWEI----------------------VPKN  447

Query  459   MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKF  280
                 +VS     E GW  LR S+H+P + +N++SN+ GG   +A  L   F    +   +
Sbjct  448   YEGVRVSCGSPDEDGWFLLRLSLHDPVLPLNIESNVVGGVAKIANRLLGFF----QGIDY  503

Query  279   LDIS  268
             LDIS
Sbjct  504   LDIS  507



>ref|WP_006626204.1| MULTISPECIES: phosphoglucomutase [Arthrospira]
 gb|EDZ92496.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Arthrospira maxima CS-328]
 gb|EKD05834.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Arthrospira platensis C1]
Length=513

 Score =   417 bits (1073),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 226/531 (43%), Positives = 326/531 (61%), Gaps = 47/531 (9%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVA+ G     V+LTP     + ++F  WV     S++ G     + +++
Sbjct  10    KKLQNGSDIRGVAIAGVANEPVNLTPEIATILGKAFASWV-----SQKLGKNTAELTMAV  64

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG  LS AV  G+   G  V+D+ +A+TPA FMSTV P ++ D +IM+TASHLP
Sbjct  65    GRDSRLSGPVLSQAVMEGIISTGAQVYDLAIASTPAMFMSTVTPGWECDGAIMLTASHLP  124

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAP-PSKV---DFMSAYA  1357
             + RNGLKFFT +GGL   ++  I +         +AK++   ++P P  +   DF+S YA
Sbjct  125   FNRNGLKFFTPQGGLGKPDISEILE---------LAKLNDFAKSPTPGSIIQHDFISVYA  175

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
             + L + I++ VNHPT+ + PL G +IIV+AGNG+GGF+   VL  LGADT GS  L+PDG
Sbjct  176   EGLVNTIRQGVNHPTNLEQPLTGLKIIVDAGNGAGGFYAEKVLKPLGADTTGSQFLDPDG  235

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNH+PNPE++ AM     AV+ N AD G++FDTDVDR   VD+ G  +N +RLIAL+S
Sbjct  236   TFPNHVPNPENQAAMQSICQAVIDNKADFGIIFDTDVDRGAAVDQLGKELNRNRLIALIS  295

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHL  820
             AIVL+EHPG+ +VTD+ TS GLT FI     G H  ++ GY+NVI++ + LNE G E+ L
Sbjct  296   AIVLREHPGSAIVTDSITSDGLTHFIEQELKGVHHRFKRGYKNVINEAIRLNESGQESWL  355

Query  819   MMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRM  640
              +ETSGHGA+KENYFLDDGAY+V K++IE+ K  L+G  + +  LI +L+EP E+ E+R+
Sbjct  356   AIETSGHGAMKENYFLDDGAYLVSKLLIELAKTHLKG--KSLTDLIANLQEPAESEEVRI  413

Query  639   DVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF  460
              + ++    K+     IE    ++ +     WE+                      +   
Sbjct  414   TIQND--DFKSLGNNVIEKLTQFVSQQT--DWEI----------------------VPKN  447

Query  459   MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                 +VS     E GW  LR S+H+P + +N++SN+ GG   +A  L   F
Sbjct  448   YEGVRVSCGSPDEDGWFLLRLSLHDPVLPLNIESNVVGGVAKIANRLLGFF  498



>ref|WP_034934697.1| phosphoglucomutase [Gloeocapsa sp. PCC 73106]
Length=500

 Score =   417 bits (1072),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 244/542 (45%), Positives = 331/542 (61%), Gaps = 50/542 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVAL+G    SV+LTP     + ++F +WV     +   G   E++ +SLG
Sbjct  8     QLQNGSDIRGVALEGVPDESVNLTPEVTRRLGKAFAQWV-----ATTTGKSPEALTISLG  62

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              D RISG  L  AV AG+   G  V+D G+A+TPA FMST+   F  D +IM+TASHLP+
Sbjct  63    RDSRISGPQLMQAVTAGITSLGAQVYDFGIASTPAMFMSTITEGFNCDGAIMLTASHLPF  122

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRD  1342
              RNGLKFFT KGGL   ++  I   AA+                  + DF+S YA    +
Sbjct  123   NRNGLKFFTPKGGLDKQDIGEILLLAAQN------------DTKVEQRDFISVYANQFVE  170

Query  1341  IIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNH  1162
              I+  VNHP ++  PLQG +IIV+AGNG+GGF+   VL  LGADT GS  L+PDG FPNH
Sbjct  171   KIRREVNHPENFKQPLQGLKIIVDAGNGAGGFYVEKVLKPLGADTTGSQFLDPDGNFPNH  230

Query  1161  IPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLK  982
             IPNPE+K AMA   AAV +  ADLG++FDTDVDR+  VD +G  +N +RLIAL+S IVL 
Sbjct  231   IPNPENKEAMASICAAVREYQADLGIIFDTDVDRAAAVDSTGKELNRNRLIALISGIVLA  290

Query  981   EHPGTTVVTDARTSMGLTRFIT-GRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             EHPG+T+VTD+ TS GLT+FI     G H  ++ GY+NVI++ V LN+ G E+ L +ETS
Sbjct  291   EHPGSTIVTDSITSDGLTKFIEHNLAGIHHRFQRGYKNVINEAVRLNQLGQESWLAIETS  350

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GHGA++ENYFLDDGAY+V KIII++ +++L G  + +  LI +LEEP E+ E R+ + SE
Sbjct  351   GHGAMRENYFLDDGAYLVTKIIIKLAQLRLAG--KSLNDLIAELEEPKESEEFRLKIKSE  408

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                   K V  IE+ + + E  +   W++       V   C       PA          
Sbjct  409   NFKDYGKMV--IENLQKFAETQS--DWQVVPKNYEGVRVAC-----QSPA----------  449

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQ  265
                    E+GW  LR S+H+P I +N++SN+  G   +A  L+  FL + E+   LD+S 
Sbjct  450   -------ENGWFLLRLSLHDPVIPINIESNVTQGVGKIADRLK-SFLKSYEL---LDLSA  498

Query  264   ID  259
              D
Sbjct  499   FD  500



>ref|WP_010479183.1| phosphoglucomutase [Acaryochloris sp. CCMEE 5410]
Length=518

 Score =   417 bits (1073),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 229/528 (43%), Positives = 318/528 (60%), Gaps = 43/528 (8%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVAL+G +G +V+LTP   + +  +F  W+   L        V  + V +G
Sbjct  10    QLQNGSDIRGVALEGVEGEAVNLTPEIAQILGMAFVHWLSQTLNKS-----VTELTVGVG  64

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              D RISG +L  AV AG+ Q G   ++ GLA+TPA F STV   F  D +IM+TASHLP+
Sbjct  65    RDSRISGPTLMDAVLAGITQMGSNGYNFGLASTPAMFKSTVTDGFNCDGAIMLTASHLPF  124

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRD  1342
              RNGLKFFT +GGL   ++  I   AA +   + A          S+ +F+  YA  L  
Sbjct  125   NRNGLKFFTAQGGLGKGDITQILSLAAEQTFEKAADPGQV-----SEHNFIGVYAAELVS  179

Query  1341  IIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNH  1162
              I+  VNHP  ++ PLQG  I+V+AGNG+GGF+   VL  LGAD  GS  L+PDG FPNH
Sbjct  180   QIRTAVNHPDQFEQPLQGLHIVVDAGNGAGGFYAEQVLKPLGADITGSQFLDPDGTFPNH  239

Query  1161  IPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLK  982
             IPNPE+K AMA    AV +  AD G++FDTDVDR+  VD  G  +N +RLIAL+SA+VL+
Sbjct  240   IPNPENKEAMAAICQAVTEQQADFGIIFDTDVDRAAAVDHQGQDLNRNRLIALISAVVLR  299

Query  981   EHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             EHPG+T+VTD+ TS GLT+FI    GG H  ++ GY+NVI++ + LN+ G E+ L +ETS
Sbjct  300   EHPGSTIVTDSITSDGLTQFIGDELGGVHHRFKRGYKNVINESIRLNQSGQESWLAIETS  359

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GHGA+KENYFLDDGAY++ K+++E+ K K+ G    I  LI +L EP E+ E R+ + ++
Sbjct  360   GHGAMKENYFLDDGAYLISKLLVELAKSKMAG--RNITDLIANLTEPQESEEYRIKIQAD  417

Query  624   PRHAKAKAV-EAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
                A   +V   +E F      G    W+             +V  N          Y  
Sbjct  418   DFKAHGNSVISKLEEF-----AGQQTDWQ-------------IVPNN----------YEG  449

Query  447   -KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
              +++     E GW+ LR S+H+P + +N++SN+ GG  S+A  L   F
Sbjct  450   IRIACSSPSEQGWLLLRLSLHDPVLPLNIESNVEGGVASIAAKLTPFF  497



>gb|ELS00180.1| phosphomannomutase, partial [Gloeocapsa sp. PCC 73106]
Length=502

 Score =   417 bits (1071),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 244/542 (45%), Positives = 331/542 (61%), Gaps = 50/542 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVAL+G    SV+LTP     + ++F +WV     +   G   E++ +SLG
Sbjct  10    QLQNGSDIRGVALEGVPDESVNLTPEVTRRLGKAFAQWV-----ATTTGKSPEALTISLG  64

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              D RISG  L  AV AG+   G  V+D G+A+TPA FMST+   F  D +IM+TASHLP+
Sbjct  65    RDSRISGPQLMQAVTAGITSLGAQVYDFGIASTPAMFMSTITEGFNCDGAIMLTASHLPF  124

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRD  1342
              RNGLKFFT KGGL   ++  I   AA+                  + DF+S YA    +
Sbjct  125   NRNGLKFFTPKGGLDKQDIGEILLLAAQN------------DTKVEQRDFISVYANQFVE  172

Query  1341  IIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNH  1162
              I+  VNHP ++  PLQG +IIV+AGNG+GGF+   VL  LGADT GS  L+PDG FPNH
Sbjct  173   KIRREVNHPENFKQPLQGLKIIVDAGNGAGGFYVEKVLKPLGADTTGSQFLDPDGNFPNH  232

Query  1161  IPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLK  982
             IPNPE+K AMA   AAV +  ADLG++FDTDVDR+  VD +G  +N +RLIAL+S IVL 
Sbjct  233   IPNPENKEAMASICAAVREYQADLGIIFDTDVDRAAAVDSTGKELNRNRLIALISGIVLA  292

Query  981   EHPGTTVVTDARTSMGLTRFIT-GRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             EHPG+T+VTD+ TS GLT+FI     G H  ++ GY+NVI++ V LN+ G E+ L +ETS
Sbjct  293   EHPGSTIVTDSITSDGLTKFIEHNLAGIHHRFQRGYKNVINEAVRLNQLGQESWLAIETS  352

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GHGA++ENYFLDDGAY+V KIII++ +++L G  + +  LI +LEEP E+ E R+ + SE
Sbjct  353   GHGAMRENYFLDDGAYLVTKIIIKLAQLRLAG--KSLNDLIAELEEPKESEEFRLKIKSE  410

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                   K V  IE+ + + E  +   W++       V   C       PA          
Sbjct  411   NFKDYGKMV--IENLQKFAETQS--DWQVVPKNYEGVRVAC-----QSPA----------  451

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQ  265
                    E+GW  LR S+H+P I +N++SN+  G   +A  L+  FL + E+   LD+S 
Sbjct  452   -------ENGWFLLRLSLHDPVIPINIESNVTQGVGKIADRLK-SFLKSYEL---LDLSA  500

Query  264   ID  259
              D
Sbjct  501   FD  502



>ref|WP_024998090.1| phosphoglucomutase [Prevotella falsenii]
Length=494

 Score =   416 bits (1069),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 231/523 (44%), Positives = 319/523 (61%), Gaps = 53/523 (10%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G +G SV+LT     A+A++F  W+      E+ G  V+++ V  
Sbjct  4     KKLQNGSDIRGVALEGIEGESVNLTNEITSALAQAFTAWL-----GEKNGKAVQTIAV--  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D RIS  +L  A   G    G  V + G+A+TPA FM+TV      D ++M+TASHLP
Sbjct  57    GSDSRISSPALRQAFADGAAAVGATVLNFGMASTPAMFMATVDEQLHTDGAVMITASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKA-----ARKYANRMAKVSTALRAPPSKVDFMSAY  1360
             + RNGLKFFT KGGL   ++  I + A     A K  N   K           VDFM+ Y
Sbjct  117   WNRNGLKFFTAKGGLEKADIARILELAPQFIGAEKKGNGEVK----------DVDFMATY  166

Query  1359  AKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPD  1180
                L + I+  VN     D PL+G +IIV+AGNG+GGFF   VL  LGADT GS  L PD
Sbjct  167   CDILTNYIRRGVNAG---DQPLKGMRIIVDAGNGAGGFFANKVLKPLGADTTGSQFLEPD  223

Query  1179  GMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALM  1000
             G FPNHIPNPE+K AMA    AV+ N ADLG++FDTDVDRS +VDR+G  IN + LIAL+
Sbjct  224   GHFPNHIPNPENKEAMASICKAVVDNKADLGIIFDTDVDRSAIVDRTGKSINRNALIALI  283

Query  999   SAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHL  820
             +A++L+EHP +T+VTD+ TS GL +FI  R G+H  +R GY+NVI++ + LNE+G E+ L
Sbjct  284   AAVILREHPESTIVTDSVTSDGLAKFIADRNGKHHRFRRGYKNVINESLRLNENGEESWL  343

Query  819   MMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRM  640
              +ETSGH AL+ENYFLDDGAY+V K+I+E   ++ EG E  +  LI DL++P+E+ E+R 
Sbjct  344   AIETSGHAALRENYFLDDGAYLVAKLIVEAACLRKEGKE--LQDLIADLQQPVESKEIRF  401

Query  639   DVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF  460
              + ++    K+   + +E  +   EK +   W+L S       EG  +   D        
Sbjct  402   KIDTD--DFKSYGEQVLEHIKAAAEKEH--DWQLVSPN----YEGVRIACTDEK------  447

Query  459   MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                         E GW  LRQS+H+P + +N++SN+ GG   +
Sbjct  448   ------------EQGWFLLRQSLHDPVLPLNIESNVEGGVSRI  478



>ref|WP_007789892.1| phosphoglucomutase [Peptostreptococcus stomatis]
 gb|EFM64564.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
II [Peptostreptococcus stomatis DSM 17678]
Length=490

 Score =   415 bits (1067),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 223/528 (42%), Positives = 321/528 (61%), Gaps = 45/528 (9%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGR-SVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             M+K+  LQNG+D+RGVA + +K    + LT   V+ +   F  W+I   + +        
Sbjct  1     MDKLYSLQNGTDIRGVAYKDDKSDMEITLTREDVKNLVRGFATWIIDKDKKDH-------  53

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMT  1540
             +++S+G D R++G     A    L + G  V D G+ATTPA FMST++  ++ D +IM T
Sbjct  54    IKISIGTDSRLTGPDFRQACVEALTEIGVDVVDCGMATTPAMFMSTIIDGYKCDGAIMFT  113

Query  1539  ASHLPYTRNGLKFFTKKGGLTSTEVEAICDKA-ARKYANRMAKVSTALRAPPSKVDFMSA  1363
             ASH+PY  NGLK FT +G L  ++++ + D   A  + +  +K +   +      D +  
Sbjct  114   ASHMPYVYNGLKMFTSQGCLEKSDLKDVIDICVAGNFVDGNSKGNLIEK------DLIED  167

Query  1362  YAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNP  1183
             YA+ L D I+  V+ P +Y+ PL G +IIV+AGNG+GGFF   VL +LGADT GS  LNP
Sbjct  168   YAQILVDKIRAGVDSPENYEKPLAGMKIIVDAGNGAGGFFADKVLARLGADTQGSQFLNP  227

Query  1182  DGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIAL  1003
             DGMFPNHIPNPE+K AMA    A L N  DLG++FDTDVDR+ +V   G PIN + LIAL
Sbjct  228   DGMFPNHIPNPENKEAMASICQATLDNKGDLGIIFDTDVDRAAIVGSDGRPINKNALIAL  287

Query  1002  MSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETH  823
             +S+I+L+EHP TT+VTD+ TS GL +FI  RGG H  ++ GY+NVI++ + LNE+G E+H
Sbjct  288   ISSIILEEHPQTTIVTDSVTSNGLAKFIKARGGIHHRFKRGYKNVINEAIRLNEEGRESH  347

Query  822   LMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELR  643
             L +ETSGH A+KENYFLDDGAY++ KI+++  K+  E  +  IG LI DL+E LE  E+R
Sbjct  348   LAIETSGHAAIKENYFLDDGAYLISKILVKAAKLYRESQD--IGQLISDLDEALEDKEIR  405

Query  642   MDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDA  463
             + +  E +  ++ A + I+S    I+  ++ GW      D +  EG  VD  D       
Sbjct  406   LKI--EEKDFRSYANKLIKSLSEKIK--DIDGWA--EVADNY--EGIRVDCYD-------  450

Query  462   FMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
                          E GW  +R S+H P + +N +S+I GGC ++   L
Sbjct  451   -------------EKGWFLMRSSLHEPLLVINFESDIKGGCDTINEKL  485



>ref|WP_023925923.1| hypothetical protein [Prevotella nigrescens]
 gb|ETD28249.1| hypothetical protein HMPREF1173_01667 [Prevotella nigrescens 
CC14M]
Length=494

 Score =   415 bits (1067),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 228/518 (44%), Positives = 321/518 (62%), Gaps = 43/518 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G +G SV+LT     A+A++F  W+      E+ G   +++ V  
Sbjct  4     KKLQNGSDIRGVALEGIEGESVNLTNEVTTALAQAFVAWL-----GEKNGKTAQTIAV--  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D RIS  +L  A   G    G  V   G+A+TPA FM+TV      D ++M+TASHLP
Sbjct  57    GSDSRISSPALLQAFANGAAAVGATVLSFGMASTPAMFMATVDEQLNADGAVMITASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT KGGL  T++  I + A  ++     K +  ++A    +DFM+ Y   L 
Sbjct  117   WNRNGLKFFTAKGGLEKTDIARILELAP-QFMGAEKKGNGEVKA----IDFMATYCDILA  171

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             + I+  VN+    D PL+G +IIV+AGNG+GGFF  +VL  LGADT GS  L PDG FPN
Sbjct  172   NYIRRGVNNG---DQPLKGMRIIVDAGNGAGGFFATNVLKPLGADTTGSQFLEPDGYFPN  228

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE+K AMA    AV+ N ADLG++FDTDVDRS +VDR+G  IN + LIAL++A++L
Sbjct  229   HIPNPENKEAMASICKAVVDNKADLGIIFDTDVDRSAIVDRTGKSINRNALIALIAAVIL  288

Query  984   KEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             +EHP +T+VTD+ TS GL +FI  R G+H  +R GY+NVI++ + LNE+G E+ L +ETS
Sbjct  289   REHPESTIVTDSVTSDGLAKFIADRNGKHYRFRRGYKNVINESLRLNENGEESWLAIETS  348

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH AL+ENYFLDDGAY+V K+IIE   ++ EG E  +  LI DL++P E+ E+R  + ++
Sbjct  349   GHAALRENYFLDDGAYLVAKLIIEAACLRKEGKE--LQDLIADLQQPAESKEIRFKIDTD  406

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                 K    + +E  +   EK +   W+L +       EG  +   D             
Sbjct  407   --DFKTYGEQVLEHTKAAAEKEH--DWQLVAPN----YEGVRIACTDEK-----------  447

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                    E GW  LRQS+H+P + +N++SN+ GG   +
Sbjct  448   -------EQGWFLLRQSLHDPVLPLNIESNVEGGVSRI  478



>ref|WP_007353594.1| MULTISPECIES: phosphoglucomutase [Kamptonema]
 emb|CBN54367.1| Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [ [[Oscillatoria] sp. PCC 6506]
Length=508

 Score =   416 bits (1068),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 223/522 (43%), Positives = 318/522 (61%), Gaps = 39/522 (7%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RG+AL+G     V+LTP     + ++F  W+     +++       + +SLG
Sbjct  8     KLQNGSDIRGIALEGIPEEKVNLTPEIATILGKAFVYWL-----TQKINKPAAELTISLG  62

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              D R+SG  L  AV  G+   G  V+D  +A+TPA FMST+ P F  D +IM+TASHLP+
Sbjct  63    RDSRLSGPVLMQAVMEGIASVGSQVYDFEMASTPAMFMSTITPGFSCDGAIMLTASHLPF  122

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRD  1342
              RNGLKFFT +GGL   +   I D  A    N      T  +   +K DF+S YA     
Sbjct  123   NRNGLKFFTAQGGLQKKD---ITDILALAVNNNFPSSPTPGKI--TKHDFISVYANQFVT  177

Query  1341  IIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNH  1162
              I++ VNHP +++ PL G +I+V+AGNG+GGF+   VL  LGADT GS  L+PDG FPNH
Sbjct  178   KIRKAVNHPANFEQPLTGLKIVVDAGNGAGGFYVDKVLKPLGADTTGSQFLDPDGTFPNH  237

Query  1161  IPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLK  982
             +PNPEDK AM     AV+++ AD G++FDTDVDRS  VDR+G  +N +RLIAL+SAI+LK
Sbjct  238   VPNPEDKAAMQSICQAVIKHQADFGIIFDTDVDRSAAVDRTGKELNRNRLIALISAIILK  297

Query  981   EHPGTTVVTDARTSMGLTRFI-TGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             EHPG+T+VTD+ TS GLT+FI     G H  ++ GY+NVID+ + LN+ G E+ L +ETS
Sbjct  298   EHPGSTIVTDSITSDGLTQFIEQDLKGIHHRFKRGYKNVIDESIRLNQSGQESWLAIETS  357

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GHGAL+ENYFLDDGAY+V K++IE+ K KL  + + +  LI +L+EP E+ E R+ +  +
Sbjct  358   GHGALQENYFLDDGAYLVSKLLIELAKSKL--ANQSLPDLIANLKEPEESVEFRIKIGVD  415

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                +   +V  IE  + +                  + +   +  N++           +
Sbjct  416   DFKSHGNSV--IEKLQEF----------------AAMQKDWTIVPNNYEG--------VR  449

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
             +S     E GW  LR S+H+P + +N++SN+ GG   +A  L
Sbjct  450   ISCNSTNEDGWFLLRLSLHDPVMPLNIESNVKGGVARIATRL  491



>ref|XP_005714195.1| unnamed protein product [Chondrus crispus]
 emb|CDF34376.1| unnamed protein product [Chondrus crispus]
Length=698

 Score =   422 bits (1084),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 231/476 (49%), Positives = 308/476 (65%), Gaps = 33/476 (7%)
 Frame = -1

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMT  1540
             +RV+LG D RISG  L +A  AG+  AG  V D+GLATTPA FM+TVL P+++DA+ M+T
Sbjct  232   LRVALGRDSRISGPELLSAAAAGVAAAGAQVTDVGLATTPAMFMATVLEPYRFDAACMLT  291

Query  1539  ASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPS--KVDFMS  1366
             ASHLP  RNG+KFFT  G      V+A+ ++ A  +        T+  APP+  K+DF+ 
Sbjct  292   ASHLPPNRNGIKFFTSAGSANKKGVKALLERTADLFEAEGDAPETS--APPALEKIDFLP  349

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
             AY+ HL  +I+   NHP  YD PL GF+I+V+AGNG+ GFF   VL+ LGAD  G   L 
Sbjct  350   AYSAHLVRLIRAGCNHPHTYDKPLSGFKIVVDAGNGAAGFFASQVLEPLGADVVGQF-LE  408

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNH+PNPEDK AM+MT   V +  ADLGV+FDTDVDRSGVVD SG  IN +RLIA
Sbjct  409   PDGMFPNHVPNPEDKKAMSMTIDTVKRVGADLGVIFDTDVDRSGVVDPSGLGINRNRLIA  468

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVET  826
             L++ IVL++ PG+T+VTD+ TS GL RFI   GG H  Y+ GY+NVIDKG+ LN+ GV+T
Sbjct  469   LIAKIVLRDAPGSTIVTDSVTSNGLKRFIENEGGVHFRYKKGYKNVIDKGIELNDQGVQT  528

Query  825   HLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAEL  646
              L +ETSGHGA+KENY LDDGAY+ VKIIIEMV+++L G   GIG L+  L+ PLE  E 
Sbjct  529   ELAIETSGHGAMKENYMLDDGAYLAVKIIIEMVRLRLAGDMRGIGGLLDGLDAPLEEHEF  588

Query  645   RMDVLSEPRHAK--AKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAA  472
             R+  + +    +   + VEA   F   ++     GW ++        EG           
Sbjct  589   RLKFIDQENFGEYGGRVVEAFSEFASSVD-----GWTVEETN----YEG-----------  628

Query  471   IDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFL  304
                  +R  V +E + + GW+ LRQS+H+P + +N++S   GG  ++AR L + F 
Sbjct  629   -----FRVSV-DEGDDKAGWLLLRQSLHDPLLPLNIESEREGGVAAIARVLVNDFF  678



>ref|WP_004366380.1| phosphoglucomutase [Prevotella nigrescens]
 gb|EGQ15286.1| phosphoglucomutase/phosphomannomutase [Prevotella nigrescens 
ATCC 33563]
Length=522

 Score =   416 bits (1068),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 228/518 (44%), Positives = 320/518 (62%), Gaps = 43/518 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G +G SV+LT     A+A++F  W+      E+ G   +++ V  
Sbjct  32    KKLQNGSDIRGVALEGIEGESVNLTNEVTTALAQAFVAWL-----GEKNGKTAQTIAV--  84

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D RIS  +L  A   G    G  V   G+A+TPA FM+TV      D ++M+TASHLP
Sbjct  85    GSDSRISSPTLLQAFANGAAAVGATVLSFGMASTPAMFMATVDEQLNADGAVMITASHLP  144

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT KGGL  T++  I + A  ++     K +  ++A    +DFM+ Y   L 
Sbjct  145   WNRNGLKFFTAKGGLEKTDIARILELAP-QFMGAEKKGNGEVKA----IDFMATYCDILA  199

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             + I+  VN+    D PL+G +IIV+AGNG+GGFF  +VL  LGADT GS  L PDG FPN
Sbjct  200   NYIRRGVNNG---DQPLKGMRIIVDAGNGAGGFFATNVLKPLGADTTGSQFLEPDGYFPN  256

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE+K AMA    AV+ N ADLG++FDTDVDRS +VDR+G  IN + LIAL++A++L
Sbjct  257   HIPNPENKEAMASICKAVVDNKADLGIIFDTDVDRSAIVDRTGKSINRNALIALIAAVIL  316

Query  984   KEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             +EHP +T+VTD+ TS GL +FI  R G+H  +R GY+NVI++ + LNE+G E+ L +ETS
Sbjct  317   REHPESTIVTDSVTSDGLAKFIADRNGKHYRFRRGYKNVINESLRLNENGEESWLAIETS  376

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH AL+ENYFLDDGAY+V K+IIE   ++ EG E  +  LI DL++P E+ E+R  +  +
Sbjct  377   GHAALRENYFLDDGAYLVAKLIIEAACLRKEGKE--LQDLIADLQQPAESKEIRFKI--D  432

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                 K    + +E  +   EK +   W+L +       EG  +   D             
Sbjct  433   TDDFKTYGEQVLEHTKAAAEKEH--DWQLVAPN----YEGVRIACTDEK-----------  475

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                    E GW  LRQS+H+P + +N++SN+ GG   +
Sbjct  476   -------EQGWFLLRQSLHDPVLPLNIESNVEGGVSRI  506



>ref|WP_016566379.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium 
sp. CAG:226]
 emb|CCX50853.1| phosphoglucomutase/phosphomannomutase family protein [Clostridium 
sp. CAG:226]
Length=498

 Score =   414 bits (1065),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 238/524 (45%), Positives = 316/524 (60%), Gaps = 44/524 (8%)
 Frame = -1

Query  1890  KIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRV  1711
             ++ +LQNGSD+RGVA+Q E GRSVDLTP A  AI  +F   + + L  +        +RV
Sbjct  2     QLAKLQNGSDIRGVAIQTEGGRSVDLTPDAAYAIGRAFARVLKAKLNKD-------DIRV  54

Query  1710  SLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASH  1531
              +G D R+SG+ L AA+ AGL   G  V+D GLATTPA FM+TV   F +D S+M TASH
Sbjct  55    CMGRDSRLSGEMLCAALGAGLNAEGAGVYDAGLATTPAMFMATVTEGFMFDGSVMATASH  114

Query  1530  LPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKH  1351
             LPY RNG KFFT KGG    +++ I   A   YA+     +TA  A   K+DFM  YA  
Sbjct  115   LPYERNGFKFFTAKGGFEKADIKEILTIAETLYAD---GANTAFAA--EKIDFMGVYAAQ  169

Query  1350  LRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMF  1171
             L   I+      T+ + PL+G +II++AGNG+GGFF  DVL  LGA+T GSL   PDG F
Sbjct  170   LVGAIR----RGTNKERPLEGMRIIIDAGNGAGGFFERDVLLPLGANTAGSLFTEPDGHF  225

Query  1170  PNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAI  991
             PNH PNPED+ AMA     V +  ADLG++FDTDVDR+G V   G  +N +RLIA+++AI
Sbjct  226   PNHAPNPEDERAMAYIINGVKEAGADLGIIFDTDVDRAGAVLGDGRELNRNRLIAMIAAI  285

Query  990   VLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMME  811
              L EHPGTT+VTD+ TS GL  FI   GG H  +  GYRNVI++ + LN  G +  + ME
Sbjct  286   ELNEHPGTTIVTDSITSTGLAEFIAAHGGIHRRFMRGYRNVINEAIRLNNAGQDAQVAME  345

Query  810   TSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVL  631
             TSGHGALKENYFLDDGAY++VK++IE+ + +  G  E +G++I DL EP E  E RM + 
Sbjct  346   TSGHGALKENYFLDDGAYLMVKLLIELSRARDRG--ESLGAMIADLREPKEAREYRMALN  403

Query  630   SEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYR  451
             +E      ++V A  +     + G      +   GD +  EG  V  N  PA        
Sbjct  404   TEDFGPYGESVIAALTDWAKAQDG------VSLAGDNF--EGVRV--NFSPAR-------  446

Query  450   AKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
                       +GW  LR S+H P + +N++S+  GG   +A +L
Sbjct  447   ---------GNGWCLLRMSLHEPLMPLNIESDDVGGVDKIANEL  481



>ref|XP_010520182.1| PREDICTED: uncharacterized protein LOC104799379 isoform X2 [Tarenaya 
hassleriana]
Length=543

 Score =   415 bits (1067),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 246/562 (44%), Positives = 336/562 (60%), Gaps = 57/562 (10%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V+LT P  EAIA +FG W+    ++E      + +RVS+G
Sbjct  20    KLQNGSDIRGVAVAGIEGEPVNLTEPVTEAIAAAFGHWLFDKKKAES-----QRLRVSVG  74

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS ++L  AV  GL  AG  V   GLA+TPA F ST+     +    D +IM+TAS
Sbjct  75    HDSRISAQTLLDAVSRGLAVAGLDVVQYGLASTPAMFNSTLTEDEAFLCPVDGAIMITAS  134

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRM----AKVSTALRAPPSKVDFMS  1366
             HLPY RNG KFFT+ GGL   +++ I ++AA  Y N +     K      +  SK+D+M+
Sbjct  135   HLPYNRNGFKFFTRDGGLGKVDIKDILERAANIYKNILDESPLKKQNETSSSISKIDYMA  194

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y     D++K         + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  LN
Sbjct  195   VYTS---DLVKAVRKAAGDVEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLN  251

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD +G   N +RLIA
Sbjct  252   PDGMFPNHIPNPEDKTAMKAITQAVLDNKADLGIIFDTDVDRSAAVDSTGREFNRNRLIA  311

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG H  ++ GY+NVID+ + LN  G E
Sbjct  312   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGNHHRFKRGYKNVIDEAIRLNSIGEE  371

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLE  658
             +HL +ETSGHGALKEN++LDDGAY++VKI+ ++   +  G   G   +  L++ LEEP  
Sbjct  372   SHLAIETSGHGALKENHWLDDGAYLMVKILNKLASARAAGKGTGSKVLTDLVEGLEEPAV  431

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
               ELR+ +  +  H+  K      +FR Y E                     LV+T    
Sbjct  432   AVELRLKI--DQNHSDLKG----GTFRDYGEA-------------VLQHMSNLVET----  468

Query  477   AAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                D  + +A V+ E    +G  GW  LR S+H+P + +N++       QS    ++   
Sbjct  469   ---DPKLKKAPVNYEGVRVSGFGGWFLLRLSLHDPVLPLNIE------AQSEDDAVKLGL  519

Query  306   LLAGEMAKF--LDISQIDEFAR  247
             +++  + +F  LD S +D+F +
Sbjct  520   VVSNAVKEFMALDASALDKFVQ  541



>ref|WP_031292711.1| phosphoglucomutase [Leptolyngbya sp. Heron Island J]
Length=507

 Score =   414 bits (1063),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 226/527 (43%), Positives = 316/527 (60%), Gaps = 39/527 (7%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVA+ G     V+LTP   + + ++F  W+ +             +++++
Sbjct  7     KKLQNGSDIRGVAIDGVPNEPVNLTPEIAQRLGQAFTTWLATKFSKP-----TTELQLAV  61

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D RISG  L  +V  G+   G  V+D G+A+TPA FMSTV P F  D +IMMTASHLP
Sbjct  62    GRDSRISGPKLMKSVLHGIADLGAQVYDFGMASTPAMFMSTVTPGFDCDGAIMMTASHLP  121

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT +GGL  +++  I   A +   N     ++A     +  DF+S YA  L 
Sbjct  122   FNRNGLKFFTPQGGLGKSDIAEILTLAEQ---NNFIPAASA--GAIADRDFISVYADQLV  176

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               I+  VNHP H D PLQG +IIV+AGNG+GGF+   VL+ LGADT GS  L+PDGMFPN
Sbjct  177   QKIRIDVNHPDHPDQPLQGLKIIVDAGNGAGGFYASKVLEPLGADTTGSQFLDPDGMFPN  236

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE+  AMA    AVL + AD G++FDTDVDR+  VD  G  +N +RLIAL++AIVL
Sbjct  237   HIPNPENGAAMASICQAVLAHNADFGIIFDTDVDRAAAVDHQGQELNRNRLIALITAIVL  296

Query  984   KEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             +EHPG+T+VTD+ TS GLTRFI     G H  ++ GY+NVI + V LN+ G ++ L +ET
Sbjct  297   QEHPGSTIVTDSITSDGLTRFIEQELHGNHHRFKRGYKNVISEAVRLNQIGEDSWLAIET  356

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGHGA++ENYFLDDGAY++ K++IE+ + K  G    +  LI  L+EP E+ E+R+ +  
Sbjct  357   SGHGAMRENYFLDDGAYLISKLLIELARAKQAG--RSLTDLISTLKEPKESREIRLTI--  412

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             +    K+   + IE+   ++ + +   W L       V   C   T D            
Sbjct  413   QANEFKSYGEKVIENLTAFVAEQS--DWSLVPNNYEGVRVACSSPTED------------  458

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                       GW  LR S+H+P + +N++SN+  G   +   LR  F
Sbjct  459   ----------GWFLLRLSLHDPVLPLNVESNVEHGVAKILERLRTFF  495



>ref|WP_015162277.1| phosphomannomutase [Chamaesiphon minutus]
 ref|YP_007099720.1| phosphomannomutase [Chamaesiphon minutus PCC 6605]
 gb|AFY96193.1| phosphomannomutase [Chamaesiphon minutus PCC 6605]
Length=511

 Score =   414 bits (1063),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 221/522 (42%), Positives = 316/522 (61%), Gaps = 39/522 (7%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RG+AL+G     V+LTP   + + ++F  W+   +       +V     ++G
Sbjct  11    KLQNGSDIRGIALEGIPDEHVNLTPAVAKILGQAFVTWLCGKVNKPSTQLIV-----AVG  65

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              D R+SG ++  A   G+   G   +D  +A+TPA FMST+   F+ D +IM+TASHLP+
Sbjct  66    RDSRLSGPAIMQATLDGITDLGSEAYDFEMASTPAMFMSTITSGFECDGAIMLTASHLPF  125

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRD  1342
              RNGLKFFT +GGL   ++  I   AA            A +   S+ DFMS YA    +
Sbjct  126   NRNGLKFFTAQGGLEKKDISDILQLAASNNFE-----IAAAKGAISQRDFMSVYANQFVE  180

Query  1341  IIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNH  1162
              I++ VNHPT++D PL G +IIV+AGNG+GGF+   VL  LGADT GS  L PDG FPNH
Sbjct  181   QIRQAVNHPTNFDQPLSGLKIIVDAGNGAGGFYADRVLQPLGADTTGSQFLEPDGNFPNH  240

Query  1161  IPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLK  982
             +PNPED TAMA    AV+++ AD G++FDTDVDRS  VD  G  +N +RLI L+SAIVL+
Sbjct  241   VPNPEDPTAMAAICQAVIEHQADFGIIFDTDVDRSAAVDSMGKELNRNRLIGLISAIVLQ  300

Query  981   EHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             EHPG+T+VTD+ TS GLT+FI    GG H  ++ GY+NVI++ + LN+DG E+ + +ETS
Sbjct  301   EHPGSTIVTDSITSDGLTQFIQQDLGGIHHRFKRGYKNVINESIRLNQDGKESWVAIETS  360

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH A+KEN+FLDDGAY+V K+++E+ K  L G  + +  LI +L+EP+E+ ELR+ + + 
Sbjct  361   GHAAMKENHFLDDGAYLVSKLLVELAKCNLAG--KSLTDLIANLQEPVESKELRIKITTA  418

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                A     E I+  + ++   +   W++       V   C  ++ D             
Sbjct  419   DFQAYGN--EVIDRMQTFV--ASQSDWKIVPNNYEGVRVACTSESED-------------  461

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
                      GW  LR S+H+P I VN++SNI GG   + + L
Sbjct  462   ---------GWFLLRLSLHDPVIPVNIESNIAGGVDRIKQRL  494



>ref|WP_027400250.1| phosphoglucomutase [Anaerovorax odorimutans]
Length=517

 Score =   414 bits (1064),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 223/553 (40%), Positives = 332/553 (60%), Gaps = 47/553 (8%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             +++LQNGSD+RG+A++G  G SV+L       +A+ F  W+     SE  G   E++++S
Sbjct  6     LKKLQNGSDIRGIAIEGVLGESVNLNEFTAGLLAKGFVTWL-----SENTGKSAENLKIS  60

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHL  1528
             +G D RIS   L   +   +   G  V D GL++TP+ FMST+ P F  D ++M+TASHL
Sbjct  61    IGHDSRISASQLKNTLIQNMTDCGVSVIDCGLSSTPSMFMSTIFPDFTCDGAVMITASHL  120

Query  1527  PYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKV-STALRAPPSKVDFMSAYAKH  1351
             PY RNG KFF K GGL   ++  I   A     N   +  + A+     + D +  Y+  
Sbjct  121   PYNRNGFKFFNKDGGLNKKDISQIITYAEELEENDANEACNKAVSGTVIQADLIKVYSDF  180

Query  1350  LRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMF  1171
             L+D IKE +NH T+Y+ PL G +I+V+AGNG+GGF+   VL  LGADT  S  L PDG F
Sbjct  181   LKDKIKEGINHKTNYEKPLTGLKILVDAGNGAGGFYADKVLAPLGADTSCSQFLEPDGTF  240

Query  1170  PNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAI  991
             PNHIPNPEDK AM     AV+++ AD G++FDTDVDRS  VD+ GN IN + ++AL SA+
Sbjct  241   PNHIPNPEDKEAMESICRAVIKSKADFGLIFDTDVDRSSAVDKHGNEINRNSIVALASAL  300

Query  990   VLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             V + HPGTT+VTD+ TS GLT FI  + G +H  ++ GY+NVI++ + LN +G ++ L +
Sbjct  301   VAEVHPGTTIVTDSVTSDGLTEFIEQKLGCKHLRFKRGYKNVINESIRLNNEGTDSQLAI  360

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDV  634
             ETSGH ALKENYFLDDGAY+  KI+I+  K+ +EG  + + SLI+DL +P+E+ E R  +
Sbjct  361   ETSGHAALKENYFLDDGAYLATKIVIKAAKLAMEG--KTLDSLIEDLRQPMESKEFRFAI  418

Query  633   LSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF--  460
                          + E+F  Y              GD  +SE  L   +  P     F  
Sbjct  419   -------------SGENFSEY--------------GDNIISELELF-AHVGPGMTVTFPN  450

Query  459   MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKF  280
                 ++S + +  +GW  LR+S+H+P + +N++S+ P GC+ ++       +L   + K+
Sbjct  451   YEGVRISFDTSNGNGWCLLRKSLHDPIMPMNIESDSPNGCKIISN------ILYSFLKKY  504

Query  279   --LDISQIDEFAR  247
               L++++I++F +
Sbjct  505   DRLNLTKIEDFIK  517



>ref|WP_028901659.1| phosphoglucomutase [Prevotella corporis]
Length=494

 Score =   412 bits (1060),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 226/515 (44%), Positives = 317/515 (62%), Gaps = 43/515 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RG+AL+G +G  V+LT     AIA++F  W+     +ER G   ++V V  
Sbjct  4     KKLQNGSDIRGIALEGIEGEHVNLTDGVTRAIAKAFVAWL-----NERKGERKQTVAV--  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+S  +L  A   G    G  V D G+A+TPA FMST+    Q D ++M+TASHLP
Sbjct  57    GSDSRLSSPALRQAFAEGASGIGAKVMDFGMASTPAMFMSTIDKNLQVDGAVMVTASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT  GGL   ++  I + A + +     +    ++    +V+FM  Y++ L 
Sbjct  117   WNRNGLKFFTADGGLDKADIARILELAPQYF-----ETGDDVKGDVEQVEFMDIYSQMLV  171

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             D I+  V      + PL+G +IIV+AGNG+GGFF   VLD LGADT GS  L+PDG FPN
Sbjct  172   DYIRNGVGMG---EQPLKGMKIIVDAGNGAGGFFAHKVLDCLGADTTGSQFLDPDGHFPN  228

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             H+PNPEDK AMA    AV  N ADLG++FDTDVDRS +VDR+G PIN + LIAL++ ++L
Sbjct  229   HVPNPEDKQAMASICKAVTDNKADLGIIFDTDVDRSAIVDRTGEPINRNALIALIATVIL  288

Query  984   KEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             +EHPG+T+VTD+ TS GL  FI  R G H  +R GY+NVI++ + LN+ G E+ L +ETS
Sbjct  289   REHPGSTIVTDSVTSDGLAEFIANRKGIHHRFRRGYKNVINESLRLNKAGKESWLAIETS  348

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH AL+ENYFLDDGAY+V K+IIE  +++ EG E  +  LI DL +P E+ E+R  + + 
Sbjct  349   GHAALRENYFLDDGAYLVAKLIIEAARLRTEGKE--LQDLISDLRQPEESKEIRFKITNA  406

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                A  + V  +E  +      +  GWE+ +       EG                   +
Sbjct  407   DFKAYGQRV--LEDLQ--TAASSQEGWEIVAPN----HEGI------------------R  440

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGC  340
             V+    GE GW  LRQS+H+P + +N++S++ GG 
Sbjct  441   VACTSAGERGWFLLRQSLHDPVLPLNIESDVEGGV  475



>gb|ESA36405.1| phosphoglucomutase phosphomannomutase alpha beta alpha domain 
i [Leptolyngbya sp. Heron Island J]
Length=528

 Score =   414 bits (1063),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 226/527 (43%), Positives = 318/527 (60%), Gaps = 39/527 (7%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVA+ G     V+LTP   + + ++F  W+ +             +++++
Sbjct  28    KKLQNGSDIRGVAIDGVPNEPVNLTPEIAQRLGQAFTTWLATKFSKP-----TTELQLAV  82

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D RISG  L  +V  G+   G  V+D G+A+TPA FMSTV P F  D +IMMTASHLP
Sbjct  83    GRDSRISGPKLMKSVLHGIADLGAQVYDFGMASTPAMFMSTVTPGFDCDGAIMMTASHLP  142

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT +GGL  +++  I   A +   N     ++A     +  DF+S YA  L 
Sbjct  143   FNRNGLKFFTPQGGLGKSDIAEILTLAEQ---NNFIPAASA--GAIADRDFISVYADQLV  197

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               I+  VNHP H D PLQG +IIV+AGNG+GGF+   VL+ LGADT GS  L+PDGMFPN
Sbjct  198   QKIRIDVNHPDHPDQPLQGLKIIVDAGNGAGGFYASKVLEPLGADTTGSQFLDPDGMFPN  257

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE+  AMA    AVL + AD G++FDTDVDR+  VD  G  +N +RLIAL++AIVL
Sbjct  258   HIPNPENGAAMASICQAVLAHNADFGIIFDTDVDRAAAVDHQGQELNRNRLIALITAIVL  317

Query  984   KEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             +EHPG+T+VTD+ TS GLTRFI     G H  ++ GY+NVI + V LN+ G ++ L +ET
Sbjct  318   QEHPGSTIVTDSITSDGLTRFIEQELHGNHHRFKRGYKNVISEAVRLNQIGEDSWLAIET  377

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGHGA++ENYFLDDGAY++ K++IE+ + K  G    +  LI  L+EP E+ E+R+ +  
Sbjct  378   SGHGAMRENYFLDDGAYLISKLLIELARAKQAG--RSLTDLISTLKEPKESREIRLTI--  433

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             +    K+   + IE+   ++ +                S+  LV  N             
Sbjct  434   QANEFKSYGEKVIENLTAFVAEQ---------------SDWSLVPNN---------YEGV  469

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
             +V+     E GW  LR S+H+P + +N++SN+  G   +   LR  F
Sbjct  470   RVACSSPTEDGWFLLRLSLHDPVLPLNVESNVEHGVAKILERLRTFF  516



>ref|WP_012160792.1| phosphoglucomutase [Acaryochloris marina]
 ref|YP_001514486.1| phosphoglucomutase/phosphomannomutase family protein [Acaryochloris 
marina MBIC11017]
 gb|ABW25172.1| phosphoglucomutase/phosphomannomutase family protein [Acaryochloris 
marina MBIC11017]
Length=512

 Score =   413 bits (1061),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 227/527 (43%), Positives = 317/527 (60%), Gaps = 41/527 (8%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVAL+G +G +V+LTP   + +  +F  W+   L           + V +G
Sbjct  10    QLQNGSDIRGVALEGVEGEAVNLTPEIAQILGMAFVHWLSQTLNKS-----TSELTVGVG  64

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              D RISG +L  AV AG+ + G   ++ GLA+TPA F STV   F  D +IM+TASHLP+
Sbjct  65    RDSRISGPTLMDAVLAGITKMGSNGYNFGLASTPAMFKSTVTDGFNCDGAIMLTASHLPF  124

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRD  1342
              RNGLKFFT +GGL   ++  I   AA +   + A          S+ +F+  YA  L  
Sbjct  125   NRNGLKFFTAQGGLGKGDITQILSLAAEQTFEKAADPGQV-----SEHNFIGVYAAELVS  179

Query  1341  IIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNH  1162
              I+  VNHP  ++ PLQG  I+V+AGNG+GGF+   VL  LGAD  GS  L+PDG FPNH
Sbjct  180   QIRAAVNHPDQFEQPLQGLHIVVDAGNGAGGFYAEQVLKPLGADITGSQFLDPDGTFPNH  239

Query  1161  IPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLK  982
             IPNPE+K AMA    AV +  AD G++FDTDVDR+  VD  G  +N +RLIAL+SA+VL+
Sbjct  240   IPNPENKEAMAAICQAVTEQQADFGIIFDTDVDRAAAVDHLGQDLNRNRLIALISAVVLR  299

Query  981   EHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             EHPG+T+VTD+ TS GL++FI    GG H  ++ GY+NVI++ V LN+ G E+ L +ETS
Sbjct  300   EHPGSTIVTDSITSDGLSQFIGDELGGVHHRFKRGYKNVINESVRLNQSGQESWLAIETS  359

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GHGA+KENYFLDDGAY++ K+++E+ K K+ G    I  LI +L EP E+ E R+ + ++
Sbjct  360   GHGAMKENYFLDDGAYLISKLLVELAKSKMAG--RNITDLIANLTEPQESEEYRIKIQTD  417

Query  624   PRHAKAKAV-EAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
                A   +V   +E F      G    W++         EG  +  N  P+         
Sbjct  418   DFKAHGNSVISKLEEF-----AGQQTDWQIVPNN----YEGIRIALNS-PS---------  458

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                     E GW+ LR S+H+P + +N++SN+ GG  S++  L   F
Sbjct  459   --------EQGWLLLRLSLHDPVLPLNIESNVEGGVASISAKLTSFF  497



>ref|WP_028898083.1| phosphoglucomutase [Prevotella sp. HUN102]
Length=494

 Score =   411 bits (1056),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 218/515 (42%), Positives = 315/515 (61%), Gaps = 43/515 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             +++QNGSD+RG+AL+G +G +V+LT     AIA++F  W+      E+ G  +++V V  
Sbjct  4     KKIQNGSDIRGIALEGIEGENVNLTNEVANAIAKAFVAWL-----KEKNGKTMQTVAV--  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+S  ++  A   G    G  V + G+A+TPA FMSTV    + D ++M+TASHLP
Sbjct  57    GSDSRLSSPAIREAFAEGASGTGAQVLEFGMASTPAMFMSTVDKDLKVDGAVMVTASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT +GGL   +++ I + A   Y      V    +    KVDFM  Y + L 
Sbjct  117   WNRNGLKFFTTEGGLDKGDIKRILELAPDFY-----NVENTNKGKIEKVDFMDTYCRILT  171

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             D I+E        + PL+G +I+V+AGNG+GGFF   VLD LGADT  S  L PDG FPN
Sbjct  172   DYIREGAGIG---NEPLKGMKIVVDAGNGAGGFFAHKVLDNLGADTSASQFLEPDGHFPN  228

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             H+PNPEDK AMA    AV++  ADLG++FDTDVDRS +V R+G PIN + LIAL++ ++L
Sbjct  229   HVPNPEDKAAMASICKAVVEQKADLGIIFDTDVDRSAIVGRTGAPINRNALIALIATVIL  288

Query  984   KEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             +EHPG+T+VTD+ TS GL  FI  +GG H  +R GY+NVI++ + LNE   E+ L +ETS
Sbjct  289   REHPGSTIVTDSVTSDGLAEFIAAKGGIHHRFRRGYKNVINESLRLNEANEESWLAIETS  348

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH AL+ENYFLDDGAY+V K+++E  +++ EG E  +  LI DL EP E+ E+R  + ++
Sbjct  349   GHAALRENYFLDDGAYLVAKLLVEAARLRTEGKE--LQDLISDLREPAESKEIRFKIATD  406

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
               + K    + +E  ++ IEK     W++ +     +   C  +                
Sbjct  407   --NFKEYGQKVLEDLQNKIEK--QADWKIVAPNHEGIRIACTAEN---------------  447

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGC  340
                    E GW  LRQS+H+P + +N++S++ GG 
Sbjct  448   -------EKGWFLLRQSLHDPVLPLNIESDVEGGV  475



>ref|WP_007310475.1| phosphoglucomutase [Crocosphaera watsonii]
 gb|EHJ13121.1| phosphoglucomutase/phosphomannomutase family protein [Crocosphaera 
watsonii WH 0003]
 emb|CCQ49297.1| phosphoglucomutase/phosphomannomutase family protein [Crocosphaera 
watsonii WH 8502]
 emb|CCQ59301.1| phosphoglucomutase/phosphomannomutase family protein [Crocosphaera 
watsonii WH 0005]
Length=509

 Score =   412 bits (1058),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 231/520 (44%), Positives = 320/520 (62%), Gaps = 39/520 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G  G SV+LTP     IA+  G+  IS LE + G +  + + +SL
Sbjct  7     KKLQNGSDIRGVALEGIPGESVNLTP----EIAKILGQAFISWLEKKLGKSASKLI-ISL  61

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG  L AA   G+   G  V++  +A+TPA FMST+ P    D +IM+TASHLP
Sbjct  62    GRDSRLSGPDLLAAASEGISLLGSTVYNFEIASTPAMFMSTINPDLSCDGAIMLTASHLP  121

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFTK GGL   ++  I + A     N    V T  +      DF+S Y++ L 
Sbjct  122   FNRNGLKFFTKNGGLNKGDITEILNLAE----NNNFPVGTE-KGNIKDYDFISVYSEGLV  176

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               ++E VNH  +++ PL+G +IIV+AGNG+GGF+   VL  LGADT GS  L+PDG FPN
Sbjct  177   KKVREGVNHTENFEQPLKGLKIIVDAGNGAGGFYAEKVLKPLGADTEGSQFLDPDGTFPN  236

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE++ AM     AV+ N AD G++FDTDVDR   VD  G  +N +RLIAL+SA++L
Sbjct  237   HIPNPENEEAMESICRAVIDNKADFGIIFDTDVDRGAAVDNFGKELNRNRLIALISAMIL  296

Query  984   KEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             KEHPG+T+VTD+ TS GL+ FIT    G H  +R GY+NVI++ + LN +G E+ L +ET
Sbjct  297   KEHPGSTIVTDSITSDGLSEFITQELNGVHHRFRRGYKNVINEAIRLNNEGQESWLAIET  356

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGHGA+KENYFLDDGAY+V K++I++   + EG  + +   I  L+EP E+ E R+ + +
Sbjct  357   SGHGAMKENYFLDDGAYLVTKLLIKLANCQQEG--KNLAEFIAKLQEPEESQEFRVKINT  414

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             E        V  IE  + ++              D W     LV  N     I       
Sbjct  415   ESFQDYGNQV--IEKLKEFV-----------ITQDDW----QLVPNNYEGVRISC-----  452

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMA  328
               S +EN   GW+ LR S+H+P I +N++SN+ GG + +A
Sbjct  453   -CSGDEN---GWLLLRLSLHDPVIPLNVESNVSGGVKKIA  488



>ref|XP_005644325.1| Phosphoglucomutase, first 3 domain-containing protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE19781.1| Phosphoglucomutase, first 3 domain-containing protein [Coccomyxa 
subellipsoidea C-169]
Length=496

 Score =   411 bits (1056),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 233/490 (48%), Positives = 307/490 (63%), Gaps = 48/490 (10%)
 Frame = -1

Query  1713  VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTAS  1534
             + +G DPRISG  L+AA+ AGL   G  V   G ATTPA FMST+   ++YD ++M+TAS
Sbjct  1     MQIGRDPRISGPILAAALAAGLTSKGVHVARFGYATTPAMFMSTISKGYEYDGAVMITAS  60

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVE-----AICDKAAR---------KYANRMAKVSTALR  1396
             HLPY RNG KFFT+ GG    +V      A+ + AA          +Y +    +++AL 
Sbjct  61    HLPYNRNGFKFFTRDGGFEKGDVSQLLQLAVAEHAAEDAPHTRPGDRYTDDAFVLASALH  120

Query  1395  APP---SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLD  1225
               P     VDFM  YA HLR+IIK+ ++HP +Y+ PL+GF+IIV+AGNGSGGF   DVL 
Sbjct  121   TDPGLIDYVDFMPVYAAHLREIIKKGIDHPDNYERPLEGFKIIVDAGNGSGGFLASDVLA  180

Query  1224  KLGADTFG-----SLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDR  1060
              LGADT G     S +L+PDG FPNH+PNPEDK AMA    AV  + ADLG+V DTDVDR
Sbjct  181   PLGADTTGAHLSSSQYLDPDGWFPNHVPNPEDKAAMAAGVRAVNASRADLGIVVDTDVDR  240

Query  1059  SGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVG  880
             S VV  +G PIN +R IALM+ I L+++PGTT+VTD+ TS GLT FITG GG+H  YR G
Sbjct  241   SAVVAGNGTPINSNRYIALMAYIALRKYPGTTIVTDSVTSNGLTEFITGLGGKHFRYRRG  300

Query  879   YRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEE  700
             Y+NVI +GV LN+ GV T LMMETSGHGA+KENY+LDDG Y   +I+I MVK  LEG  +
Sbjct  301   YKNVIGQGVKLNQQGVRTELMMETSGHGAMKENYYLDDGTYSASQIVIIMVKRYLEGLGK  360

Query  699   GIG-SLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEK--GNLPGWELDSC  529
              I  SL+ DL+EP+E+ E R+ +  +      +A+ A   F  +IE   G   GWEL+  
Sbjct  361   DIYVSLLADLKEPVESNEFRLKLKGDDFQKDGQAILA--GFHDWIEDGAGGAQGWELEK-  417

Query  528   GDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIP  349
                           +H        +R  V +E +G  GW  LR S+H+P + +N++S+  
Sbjct  418   -------------ENHEG------WRVSV-DEGDGRRGWALLRASLHDPLLVLNVESDQR  457

Query  348   GGCQSMARDL  319
             GG   + R +
Sbjct  458   GGSCGIVRQI  467



>ref|WP_012862673.1| phosphoglucomutase [Sebaldella termitidis]
 ref|YP_003310022.1| phosphomannomutase [Sebaldella termitidis ATCC 33386]
 gb|ACZ10091.1| Phosphomannomutase [Sebaldella termitidis ATCC 33386]
Length=506

 Score =   411 bits (1056),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 225/533 (42%), Positives = 325/533 (61%), Gaps = 48/533 (9%)
 Frame = -1

Query  1893  EKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVR  1714
             +K+ RLQ+ SD+RG+A+Q E  R V L       +A+ +    IS + S+R G   E +R
Sbjct  3     KKLERLQSSSDIRGIAVQFE-DREVTLNRETAALLAQGY----ISHI-SKRLGKNPEDMR  56

Query  1713  VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTAS  1534
             VSLG+D R++G+ L  A    L  AG  V+D GLATTP+ FMSTV   ++ D+++M TAS
Sbjct  57    VSLGVDSRVTGEKLKCAFAEVLMDAGMEVYDFGLATTPSMFMSTVFENYKCDSAVMFTAS  116

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAK  1354
             HLP+  NG+KFFT KGG  + +++ I +KA  + + + AK     +   ++   +  Y++
Sbjct  117   HLPFYYNGIKFFTDKGGFENEDIKEITEKAI-ELSEKQAKKHIQ-KGKINRTSILKDYSE  174

Query  1353  HLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGM  1174
              L + I+E VN   +Y+ PL+G +IIV+AGNGSGGFF  +VL+ LGADT GS  LNPDG 
Sbjct  175   FLVNKIREGVNSSKNYEKPLEGMRIIVDAGNGSGGFFAKEVLEVLGADTTGSAFLNPDGN  234

Query  1173  FPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSA  994
             FPNHIPNPED+TA+   + +V +N ADLG++FDTDVDR+  VD++GN IN +RLIAL SA
Sbjct  235   FPNHIPNPEDQTAINFLKKSVTENNADLGIIFDTDVDRAACVDKAGNEINRNRLIALTSA  294

Query  993   IVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             IVL E PG+T+VTD+ TS  +  FI   GG+H  Y+ GY+NVI+K + LN  G++ HL +
Sbjct  295   IVLDEFPGSTIVTDSVTSDEVHEFIVRSGGKHFRYQRGYKNVINKALELNRQGIQCHLAI  354

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDV  634
             ETSGH A KEN FLDDGAY+  KI+I++ K+  EG  + I  L++  +EP E+ E+R+ +
Sbjct  355   ETSGHAAFKENKFLDDGAYLTAKILIKLAKLNEEG--KNIEDLLEGYKEPEESKEIRLRI  412

Query  633   LSEPRHAKA-KAVEAIESFRHYIE-----KGNLPGWELDSCGDCWVSEGCLVDTNDHPAA  472
              ++ R+    K ++ IE+     E     K N  G  +    +C   EG           
Sbjct  413   TADSRNEYMDKLMKDIETHSKKTENWKQVKENYEGIRV----NCTYKEG-----------  457

Query  471   IDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRD  313
                               GW  LR S+H P I +N++SN   G   + +++ D
Sbjct  458   -----------------KGWFLLRSSLHEPIICINIESNFQNGTDLITKEVTD  493



>ref|WP_035309912.1| phosphoglucomutase [Clostridium sp. HMP27]
 gb|KGK86985.1| phosphoglucomutase [Clostridium sp. HMP27]
Length=501

 Score =   410 bits (1055),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 226/525 (43%), Positives = 327/525 (62%), Gaps = 44/525 (8%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             ++NG+D+RGVA++ E  R V+LT   V++IA++F   V+  L S++    ++ +++S+GM
Sbjct  8     VKNGTDIRGVAVKNED-RPVNLTEEMVKSIAKAF---VV--LISKKKNKNLKELKLSIGM  61

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYT  1519
             D RI+ + L   +   +   GC V+D+G+ +TPA FMSTV+  +++D +I +TASHLPY 
Sbjct  62    DSRITSEKLKEILMTEIKALGCTVYDLGMCSTPAMFMSTVIEGYKFDGAIEITASHLPYY  121

Query  1518  RNGLKFFTKKGGLTS---TEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
              NG KFFT KGG  S   TE+  I ++     A+   +V T        VDFM  Y++ L
Sbjct  122   YNGFKFFTDKGGFESRDVTELLEIAEQGDFPQASLSGEVIT--------VDFMEVYSQFL  173

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
             R+ I + +N   +   PL+GF+I+V+AGNG GGFF   +L KLGAD  GS  L PDG FP
Sbjct  174   RNKITDGINDNKNKLKPLEGFKIVVDAGNGVGGFFAERILSKLGADISGSQFLEPDGTFP  233

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NHIPNPE+K AM   R A L+N ADLG++FDTDVDR+ +VD  G+ IN + +IAL SAIV
Sbjct  234   NHIPNPENKQAMEAIREATLKNGADLGIIFDTDVDRAAIVDNKGSEINRNLIIALSSAIV  293

Query  987   LKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             L+EHPG+ VVTD+ TS G+ +FI  RGG H  ++ GY+NVI++ +  N++G E+HL +ET
Sbjct  294   LEEHPGSIVVTDSVTSNGVKKFIEARGGLHHRFKRGYKNVINEAIRFNKEGKESHLAIET  353

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGH ALKENYFLDDGAY+V KI+I+M K++ EG +  +  LI DLE P E+ E R+ + S
Sbjct  354   SGHAALKENYFLDDGAYLVAKILIKMAKLRNEGGKT-LSDLIADLEVPYESIEKRIKINS  412

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             E    K   +  +E  + YI +  + GW ++      V   C                  
Sbjct  413   E--DFKNYGLSVLEDLKEYINQ--VSGWSIEPNNYEGVRVNC------------------  450

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRD  313
                + ENG +GW  LR S+H P + +N++S+  GG   +   L +
Sbjct  451   ---DRENG-NGWFLLRLSLHEPVMPLNIESDEEGGVNKIITKLTE  491



>ref|WP_012860912.1| phosphoglucomutase [Sebaldella termitidis]
 ref|YP_003308247.1| phosphoglucosamine mutase [Sebaldella termitidis ATCC 33386]
 gb|ACZ08316.1| Phosphoglucosamine mutase [Sebaldella termitidis ATCC 33386]
Length=506

 Score =   411 bits (1056),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 222/530 (42%), Positives = 319/530 (60%), Gaps = 39/530 (7%)
 Frame = -1

Query  1896  MEKI-RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             MEK+ R+LQ+GSD+RG+A+Q E  + V L    V A+A+ +  ++     S++ G   E 
Sbjct  1     MEKVLRKLQSGSDIRGIAIQHED-KQVTLNRETVAALAQGYVNYI-----SKKLGKNPEE  54

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMT  1540
             + VS G DPRI+G  L  A    L  AG  V+D GL+TTP+ FMST+   +  DA+IM T
Sbjct  55    IAVSAGTDPRITGGKLQCAFIEELLDAGMTVYDFGLSTTPSMFMSTIFEKYNCDAAIMFT  114

Query  1539  ASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAY  1360
             ASHLP+  NG+KFFTK+GG    +++ + + +     N   K +   +    K   +  Y
Sbjct  115   ASHLPFYYNGIKFFTKEGGFEKEDIKQVIENSIDILKNSTVKQTK--KGKIVKTTIIKDY  172

Query  1359  AKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPD  1180
             +K L + I+  VN   +Y+ PL+G  I+V+AGNG+GGFF  +VL+ LGA T GS  LNPD
Sbjct  173   SKFLVEKIRTEVNSKKNYEKPLEGLHIVVDAGNGAGGFFAEEVLEVLGAKTAGSAFLNPD  232

Query  1179  GMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALM  1000
             G+FPNH+PNPED+TAM   + AVL + AD G++FDTDVDR+  VD++G  IN +RLIAL 
Sbjct  233   GLFPNHVPNPEDETAMGFLKRAVLNSKADFGIIFDTDVDRASCVDKNGEEINRNRLIALS  292

Query  999   SAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHL  820
             SAIVL+++PG+T+VTD+ TS  L  FIT  GG+H  Y+ GY+NVI+K   LNE G+E  L
Sbjct  293   SAIVLEQNPGSTIVTDSITSDELNEFITKLGGKHFRYQRGYKNVINKAKELNEKGIECPL  352

Query  819   MMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRM  640
              +ETSGH A KEN FLDDGAY+  KI+I + K+  E   + I  L++  +EPLE+ E+R+
Sbjct  353   AIETSGHAAFKENNFLDDGAYLTAKILITLAKLHEEN--KNIEDLLEGYKEPLESKEIRL  410

Query  639   DVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF  460
             +V    +  K  A + I     ++++   P W               V+ N         
Sbjct  411   NV--NTQSIKEYADKVISELEQFVKEE--PEW-------------SQVEEN---------  444

Query  459   MYRAKVSNEENGE-HGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRD  313
              Y     N + GE  GW  LR S+H P I +N++++  GG +   + L +
Sbjct  445   -YEGIRVNCKGGEGSGWFLLRSSLHEPIICINMEADYAGGVEKTEKKLAE  493



>ref|WP_021836330.1| Phosphoglucomutase [Crocosphaera watsonii]
 emb|CCQ63136.1| Phosphoglucomutase [Crocosphaera watsonii WH 0401]
Length=509

 Score =   411 bits (1056),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 231/520 (44%), Positives = 319/520 (61%), Gaps = 39/520 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G  G SV+LTP     IA+  G+  IS LE + G +  + + +SL
Sbjct  7     KKLQNGSDIRGVALEGIPGESVNLTP----EIAKILGQAFISWLEKKLGKSASKLI-ISL  61

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG  L AA   G+   G  V++  +A+TPA FMST+ P    D +IM+TASHLP
Sbjct  62    GRDSRLSGPDLLAATSEGISLLGSTVYNFEIASTPAMFMSTINPDLSCDGAIMLTASHLP  121

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFTK GGL   ++  I + A     N    V T  +      DF+S Y++ L 
Sbjct  122   FNRNGLKFFTKNGGLNKGDITEILNLAE----NNNFPVGTE-KGNIKDYDFISVYSEGLV  176

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               ++E VNH  +++ PL+G +IIV+AGNG+GGF+   VL  LGADT GS  L+PDG FPN
Sbjct  177   KKVREGVNHTENFEQPLKGLKIIVDAGNGAGGFYAEKVLKPLGADTEGSQFLDPDGTFPN  236

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE++ AM     AV+ N AD G++FDTDVDR   VD  G  +N +RLIAL+SA +L
Sbjct  237   HIPNPENEEAMESICRAVIDNKADFGIIFDTDVDRGAAVDNFGKELNRNRLIALISATIL  296

Query  984   KEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             KEHPG+T+VTD+ TS GL+ FIT    G H  +R GY+NVI++ + LN +G E+ L +ET
Sbjct  297   KEHPGSTIVTDSITSDGLSEFITQELNGVHHRFRRGYKNVINEAIRLNNEGQESWLAIET  356

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGHGA+KENYFLDDGAY+V K++I++   + EG  + +   I  L+EP E+ E R+ + +
Sbjct  357   SGHGAMKENYFLDDGAYLVTKLLIKLANCQQEG--KNLAEFIAKLQEPEESQEFRVKINT  414

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             E        V  IE  + ++              D W     LV  N     I       
Sbjct  415   ESFQDYGNQV--IEKLKEFV-----------ITQDDW----QLVPNNYEGVRISC-----  452

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMA  328
               S +EN   GW+ LR S+H+P I +N++SN+ GG + +A
Sbjct  453   -CSGDEN---GWLLLRLSLHDPVIPLNVESNVSGGVKKIA  488



>ref|WP_006045284.1| phosphoglucomutase [Prevotella pallens]
 gb|EGQ16792.1| phosphoglucomutase/phosphomannomutase [Prevotella pallens ATCC 
700821]
Length=494

 Score =   410 bits (1054),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 230/518 (44%), Positives = 323/518 (62%), Gaps = 43/518 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G +G SV+LT     A+A++F  W+      E+ G   +++ V  
Sbjct  4     KKLQNGSDIRGVALEGIEGESVNLTNEVTTALAQAFVAWL-----GEKNGKTAQAIAV--  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+S  +L  A   G   AG  V + G+A+TPA FM+ V      D ++M+TASHLP
Sbjct  57    GSDSRLSSPTLRQAFADGAAAAGATVLNFGMASTPAMFMAIVDEQLHADGAVMVTASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT KGGL   ++  I + A  ++     K +  ++A    VDFM+ Y   L 
Sbjct  117   WNRNGLKFFTAKGGLEKADIARILELAP-QFMGAEKKGNGEVKA----VDFMATYCDILA  171

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             + I+  VN+    D PLQG  IIV+AGNG+GGFF   VL  LGADT GS  L PDG FPN
Sbjct  172   NYIRRGVNNG---DQPLQGMHIIVDAGNGAGGFFANKVLKSLGADTTGSQFLEPDGNFPN  228

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE+K AMA    AV+++ ADLG++FDTDVDRS +VDR+G  IN + LIAL+SA++L
Sbjct  229   HIPNPENKEAMASICKAVVEHKADLGIIFDTDVDRSAIVDRTGKSINRNALIALISAVIL  288

Query  984   KEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             +EHPG+T+VTD+ TS GL +FI  R G+H  +R GY+NVI++ + LN +G E+ L +ETS
Sbjct  289   REHPGSTIVTDSVTSDGLAKFIADRNGKHHRFRRGYKNVINESLRLNANGEESWLAIETS  348

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH AL+ENYFLDDGAY+V K+I+E   ++ EG E  +  LI DL++P+E+ E+R  +  +
Sbjct  349   GHAALRENYFLDDGAYLVAKLIVEAACLRKEGKE--LQDLIADLQQPVESKEIRFKI--D  404

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                 KA   + +E  +  +EK +   W+L S     V   C                   
Sbjct  405   TNDFKAYGEQVLEHIKTAVEKDS--DWQLVSPNYEGVRIAC-------------------  443

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
              + EE  E GW  LRQS+H+P + +N++SN+ GG   +
Sbjct  444   -TGEE--EQGWFLLRQSLHDPVLPLNIESNVEGGVNRI  478



>gb|AHF01499.1| phosphoglucomutase [Thioalkalimicrobium aerophilum AL3]
Length=507

 Score =   410 bits (1055),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 227/521 (44%), Positives = 315/521 (60%), Gaps = 44/521 (8%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVAL G   + V+LT     +I ++F +W+ + L           ++V++G
Sbjct  8     QLQNGSDIRGVALLGIADQPVNLTASHANSIGQAFAQWLSAKLNKPAA-----ELKVAIG  62

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQ---YDASIMMTASH  1531
              D R+SG  L+  +  GL   G  V D GLA+TPA FM+TV P      +D S+M+TASH
Sbjct  63    RDSRLSGPDLAQGLAEGLMATGVAVTDFGLASTPAMFMATVKPALDQDVFDGSVMITASH  122

Query  1530  LPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKH  1351
             LP+ RNG KFFT  GGL   ++  +   AA+           A   P + +D+MS YA  
Sbjct  123   LPFNRNGFKFFTDAGGLDKPDIHQLLRLAAQS-------PHQACEQPVNTLDYMSIYAAD  175

Query  1350  LRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMF  1171
             L + +++ +NHP+ Y  PL+G +IIV+AGNG+GGFF   VL  LGADT GS  L PDG F
Sbjct  176   LVNKVRQAINHPSDYHQPLKGLKIIVDAGNGAGGFFVDKVLQPLGADTQGSQFLAPDGHF  235

Query  1170  PNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAI  991
             PNH+PNPED  AM    AAV+ + ADLG++FDTDVDRS  VD  G  IN +RLIALM+AI
Sbjct  236   PNHVPNPEDAQAMQSICAAVVHHQADLGLIFDTDVDRSAAVDEHGQAINRNRLIALMAAI  295

Query  990   VLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             +LK+ PG T+VTD+ TS GLT FI  +  G+H  ++ GY+NVI++ + LN  GV T L +
Sbjct  296   LLKDAPGATIVTDSVTSDGLTDFIEHQLQGKHHRFKRGYKNVINEAIRLNNQGVLTPLAI  355

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDV  634
             ETSGH ALK+NYFLDDGAY+V  ++IE+ K KL      + SLI  L+EP+E  E R  +
Sbjct  356   ETSGHAALKDNYFLDDGAYLVTLLLIELAKAKLLNLS--LTSLIATLQEPVEEQERRFHI  413

Query  633   LSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMY  454
             L        + V  +++  HY+ K   PGW      + +  EG                 
Sbjct  414   LQPDFQHYGQQV--LDALTHYVAKQ--PGWR--QVPNNY--EGI----------------  449

Query  453   RAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
               +V+ + + E GW  LR S+H+P +A+N++SNI GG  ++
Sbjct  450   --RVACQADDEQGWFLLRLSLHDPVLALNVESNIAGGVDNI  488



>ref|XP_009788112.1| PREDICTED: uncharacterized protein LOC104235970 [Nicotiana sylvestris]
Length=292

 Score =   402 bits (1034),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 205/271 (76%), Positives = 222/271 (82%), Gaps = 12/271 (4%)
 Frame = -1

Query  2091  MASTSTTPQSLQTI-ASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVESSLTANKHNE  1915
             MAS  T   S+QT   S+ NFP  PI+KP+H+ L I  +    K SLRVES  T N +N+
Sbjct  1     MASIPTPSHSIQTTNTSRTNFPCLPINKPIHKKLHICLN----KSSLRVESCSTPN-YND  55

Query  1914  VAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGG  1735
             V VDEEM+KIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLE E+  
Sbjct  56    VVVDEEMDKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLEKEK--  113

Query  1734  AVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDA  1555
                  VRVSLG DPRISG  LS AVFAGL +AGC+VFDMGLATTPACFMST+LPPF+YDA
Sbjct  114   ----DVRVSLGKDPRISGNMLSVAVFAGLSRAGCVVFDMGLATTPACFMSTILPPFEYDA  169

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVD  1375
             SIMMTASHLPYTRNGLKFFTKKGGLTS EVE ICDKAARKYANR AKVST L   P+ VD
Sbjct  170   SIMMTASHLPYTRNGLKFFTKKGGLTSPEVEEICDKAARKYANRFAKVSTTLPITPTMVD  229

Query  1374  FMSAYAKHLRDIIKERVNHPTHYDTPLQGFQ  1282
             FMSAYA+HLRDIIK+RVNHP HY TPL GFQ
Sbjct  230   FMSAYAEHLRDIIKDRVNHPFHYATPLTGFQ  260



>ref|WP_007305164.1| phosphoglucomutase [Crocosphaera watsonii]
 gb|EAM51160.1| Phosphoglucomutase/phosphomannomutase C terminal:Phosphoglucomutase/phosphomannomutase 
alpha/beta/alpha domain I:Phosphoglucomutase/phosphomannomutase 
alpha/beta/alpha domain II:Phosphoglucomutase/phosphomannomutase 
alpha/beta/alpha domain III 
[Crocosphaera watsonii WH 8501]
Length=509

 Score =   410 bits (1054),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 231/520 (44%), Positives = 319/520 (61%), Gaps = 39/520 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G  G SV+LTP     IA+  G+  IS LE + G +  + + +SL
Sbjct  7     KKLQNGSDIRGVALEGIPGESVNLTP----EIAKILGQAFISWLEKKLGKSASKLI-ISL  61

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+SG  L AA   G+   G  V++  +A+TPA FMST+ P    D +IM+TASHLP
Sbjct  62    GRDSRLSGPDLLAAASEGISLLGSTVYNFEIASTPAMFMSTINPDLSCDGAIMLTASHLP  121

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFTK GGL   ++  I + A     N    V T  +      DF+S Y++ L 
Sbjct  122   FNRNGLKFFTKNGGLNKGDITEILNLAE----NNNFPVGTE-KGNIKDYDFISVYSEGLV  176

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               ++E VNH  +++ PL+G +IIV+AGNG+GGF+   VL  LGADT GS  L+PDG FPN
Sbjct  177   KKVREGVNHTENFEQPLKGLKIIVDAGNGAGGFYAEKVLKPLGADTEGSQFLDPDGTFPN  236

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE++ AM     AV+ N AD G++FDTDVDR   VD  G  +N +RLIAL+SA++L
Sbjct  237   HIPNPENEEAMESICRAVIDNKADFGIIFDTDVDRGAAVDNFGKELNRNRLIALISAMIL  296

Query  984   KEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             KEHPG+T+VTD+ TS GL+ FIT    G H  +R GY+NVI++ + LN +G E+ L +ET
Sbjct  297   KEHPGSTIVTDSITSDGLSEFITQELNGVHHRFRRGYKNVINEAIRLNNEGQESWLAIET  356

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGHGA+KENYFLDDGAY+V K++I++   + EG  + +   I  L EP E+ E R+ + +
Sbjct  357   SGHGAMKENYFLDDGAYLVTKLLIKLANCQQEG--KNLAEFIAKLREPEESQEFRVKINT  414

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             E        V  IE  + ++              D W     LV  N     I       
Sbjct  415   ESFQDYGNQV--IEKLKEFV-----------ITQDDW----QLVPNNYEGVRISC-----  452

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMA  328
               S +EN   GW+ LR S+H+P I +N++SN+ GG + +A
Sbjct  453   -CSGDEN---GWLLLRLSLHDPVIPLNVESNVSGGVKKIA  488



>ref|XP_010520181.1| PREDICTED: uncharacterized protein LOC104799379 isoform X1 [Tarenaya 
hassleriana]
Length=614

 Score =   414 bits (1064),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 246/562 (44%), Positives = 337/562 (60%), Gaps = 57/562 (10%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V+LT P  EAIA +FG W+    ++E      + +RVS+G
Sbjct  91    KLQNGSDIRGVAVAGIEGEPVNLTEPVTEAIAAAFGHWLFDKKKAES-----QRLRVSVG  145

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS ++L  AV  GL  AG  V   GLA+TPA F ST+     +    D +IM+TAS
Sbjct  146   HDSRISAQTLLDAVSRGLAVAGLDVVQYGLASTPAMFNSTLTEDEAFLCPVDGAIMITAS  205

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRM----AKVSTALRAPPSKVDFMS  1366
             HLPY RNG KFFT+ GGL   +++ I ++AA  Y N +     K      +  SK+D+M+
Sbjct  206   HLPYNRNGFKFFTRDGGLGKVDIKDILERAANIYKNILDESPLKKQNETSSSISKIDYMA  265

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y     D++K         + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  LN
Sbjct  266   VYTS---DLVKAVRKAAGDVEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLN  322

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD +G   N +RLIA
Sbjct  323   PDGMFPNHIPNPEDKTAMKAITQAVLDNKADLGIIFDTDVDRSAAVDSTGREFNRNRLIA  382

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG H  ++ GY+NVID+ + LN  G E
Sbjct  383   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGNHHRFKRGYKNVIDEAIRLNSIGEE  442

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLE  658
             +HL +ETSGHGALKEN++LDDGAY++VKI+ ++   +  G   G   +  L++ LEEP  
Sbjct  443   SHLAIETSGHGALKENHWLDDGAYLMVKILNKLASARAAGKGTGSKVLTDLVEGLEEPAV  502

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
               ELR+ +  +  H+  K      +FR Y E                     LV+T    
Sbjct  503   AVELRLKI--DQNHSDLKG----GTFRDYGEA-------------VLQHMSNLVET----  539

Query  477   AAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                D  + +A V+ E    +G  GW  LR S+H+P + +N+++      QS    ++   
Sbjct  540   ---DPKLKKAPVNYEGVRVSGFGGWFLLRLSLHDPVLPLNIEA------QSEDDAVKLGL  590

Query  306   LLAGEMAKF--LDISQIDEFAR  247
             +++  + +F  LD S +D+F +
Sbjct  591   VVSNAVKEFMALDASALDKFVQ  612



>gb|KDP38076.1| hypothetical protein JCGZ_04719 [Jatropha curcas]
Length=246

 Score =   400 bits (1028),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 191/256 (75%), Positives = 218/256 (85%), Gaps = 24/256 (9%)
 Frame = -1

Query  1134  MAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVT  955
             MA+TRAAVL+N+ADLG+VFDTDVDRSGVVD  GNPINGD+LIALMSAIVLKE PGTT+VT
Sbjct  1     MALTRAAVLENSADLGIVFDTDVDRSGVVDNKGNPINGDKLIALMSAIVLKERPGTTIVT  60

Query  954   DARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYF  775
             DARTSM L+RFIT RGGQHCLYRVGYRNVIDKGV LN++G                    
Sbjct  61    DARTSMALSRFITDRGGQHCLYRVGYRNVIDKGVQLNKEG--------------------  100

Query  774   LDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVE  595
                 AYMVVKIIIEMV+MKL GS+EGIG LI+DLEEPLE+ +LRM+V+SEPRHAKA+A+E
Sbjct  101   ----AYMVVKIIIEMVRMKLGGSDEGIGILIEDLEEPLESVQLRMNVISEPRHAKARAIE  156

Query  594   AIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHG  415
             AIE FR YIE+G L GWELD+CGDCWVS+GCLVD+ND PAA+DA+MYRAKVSN+ENGE+G
Sbjct  157   AIEKFRSYIEEGKLEGWELDACGDCWVSDGCLVDSNDTPAAVDAYMYRAKVSNKENGEYG  216

Query  414   WVHLRQSIHNPNIAVN  367
             WVHLRQSIHNPNIAV+
Sbjct  217   WVHLRQSIHNPNIAVS  232



>ref|WP_025000937.1| phosphoglucomutase [Prevotella aurantiaca]
Length=494

 Score =   410 bits (1053),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 228/518 (44%), Positives = 318/518 (61%), Gaps = 43/518 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G +G SV+LT     A+A++F  W+      E+ G   +++ V  
Sbjct  4     KKLQNGSDIRGVALEGIEGESVNLTNEVTTALAQAFVAWL-----GEKNGKTAQAIAV--  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D RIS  +L  A   G    G  V   G+A+TPA FM+TV      D ++M+TASHLP
Sbjct  57    GSDSRISSPALCKAFADGAAAVGATVLSFGMASTPAMFMATVDEQLHADGAVMVTASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT KGGL   ++  I + A  ++     K +  ++A    VDFM+ Y   L 
Sbjct  117   WNRNGLKFFTAKGGLEKADIARILELAP-QFMGAEKKDNGEVKA----VDFMATYCDILA  171

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             + I+  VN+    D PLQG  IIV+AGNG+GGFF   VL  LGADT GS  L PDG FPN
Sbjct  172   NYIRRGVNNG---DQPLQGMHIIVDAGNGAGGFFANKVLKSLGADTTGSQFLEPDGHFPN  228

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE+K AMA    AV+++ ADLG++FDTDVDRS +VDR+G  IN + LIAL++A++L
Sbjct  229   HIPNPENKEAMASICKAVVEHKADLGIIFDTDVDRSAIVDRTGKSINRNALIALIAAVIL  288

Query  984   KEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             +EH G+T+VTD+ TS GL +FI  R G+H  +R GY+NVI++ + LN +G E+ L +ETS
Sbjct  289   REHLGSTIVTDSVTSDGLAKFIADRNGKHHRFRRGYKNVINESLRLNANGEESWLAIETS  348

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH AL+ENYFLDDGAY+V K+I+E   ++ EG E  + +LI DL++P+E+ E+R  +  +
Sbjct  349   GHAALRENYFLDDGAYLVAKLIVEAACLRKEGKE--LQNLIADLQQPVESKEIRFKIGID  406

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                 K    + +E  +   EK     W+L S     V   C                   
Sbjct  407   D--FKTYGEQVLEHIKMAAEKEQ--DWQLVSPNHEGVRIAC-------------------  443

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                EE  E GW  LRQS+H+P + +N++SN+ GG   +
Sbjct  444   -KGEE--EQGWFLLRQSLHDPVLPLNIESNVEGGVNRI  478



>ref|WP_004362062.1| hypothetical protein [Prevotella nigrescens]
 gb|ELX68486.1| hypothetical protein HMPREF0662_00237 [Prevotella nigrescens 
F0103]
Length=494

 Score =   409 bits (1052),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 226/518 (44%), Positives = 319/518 (62%), Gaps = 43/518 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G +G SV+LT     A+A++F  W+      E+ G   +++ V  
Sbjct  4     KKLQNGSDIRGVALEGIEGESVNLTNEVTTALAQAFVAWL-----GEKTGKTAQTIAV--  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D RIS  +L  A   G    G  V   G+A+TPA FM+TV    + D ++M+TASHLP
Sbjct  57    GCDSRISSPALLQAFADGAAAVGATVLSFGMASTPAMFMATVDEQLRADGAVMVTASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT KGGL   ++  I + A  ++     K +  ++A    VDFM+ Y   L 
Sbjct  117   WNRNGLKFFTAKGGLEKADIARILELAP-QFMGAEKKGNGEVKA----VDFMATYCDILA  171

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             + I+  VN     D PL+G +IIV+AGNG+GGFF  +VL  LGADT GS  L PDG FPN
Sbjct  172   NYIRCGVNDG---DQPLKGMRIIVDAGNGAGGFFANNVLKPLGADTTGSQFLEPDGHFPN  228

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE+K AMA    AV+ N ADLG++FDTDVDRS +VDR+G  IN + LIAL++A++L
Sbjct  229   HIPNPENKEAMASICKAVVDNKADLGIIFDTDVDRSAIVDRTGKSINRNALIALIAAVIL  288

Query  984   KEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             +EHP +++VTD+ TS GL +FI  R G+H  +R GY+NVI++ + LN +G E+ L +ETS
Sbjct  289   REHPESSIVTDSVTSDGLAKFIADRNGKHHRFRRGYKNVINESLRLNANGEESWLAIETS  348

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH AL+ENYFLDDGAY+V K+I+E   ++ EG E  +  LI DL++P E+ E+R  +  +
Sbjct  349   GHAALRENYFLDDGAYLVAKLIVEAACLRKEGKE--LQDLIADLQQPAESKEIRFKI--D  404

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                 KA   + +E  +   EK +   W+L S     V   C+ +                
Sbjct  405   TNDFKAYGEQVLEHIKAAAEKES--DWQLVSPNYEGVRVACMGEK---------------  447

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                    E GW  LRQS+H+P + +N++SN+ GG   +
Sbjct  448   -------EQGWFLLRQSLHDPVLPLNIESNVEGGVSRI  478



>ref|WP_028905091.1| phosphoglucomutase [Prevotella intermedia]
Length=494

 Score =   409 bits (1052),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 227/518 (44%), Positives = 318/518 (61%), Gaps = 43/518 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G +G SV+LT     A+A++F  W+      E+ G   +++ V  
Sbjct  4     KKLQNGSDIRGVALEGIEGESVNLTNEVTTALAQAFVAWL-----GEKNGKTAQTIAV--  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D RIS  +L  A   G    G  V   G+A+TPA FM+TV      D ++M+TASHLP
Sbjct  57    GSDSRISSPALLQAFANGAAAVGATVLSFGMASTPAMFMATVDEQLNADGAVMITASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT KGGL   ++  I + A  ++     K +  ++A    VDFM+ Y   L 
Sbjct  117   WNRNGLKFFTAKGGLEKADIARILELAP-QFMGAEKKGNGEVKA----VDFMATYCDILA  171

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             + I+  VN+    D PL+G +IIV+AGNG+GGFF   VL  LGADT GS  L PDG FPN
Sbjct  172   NYIRRGVNNG---DQPLRGMRIIVDAGNGAGGFFATKVLKPLGADTMGSQFLEPDGHFPN  228

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE+K AMA    AV+ N ADLG++FDTDVDRS +VDR+G  IN + LIAL++A++L
Sbjct  229   HIPNPENKEAMASICKAVVDNKADLGIIFDTDVDRSAIVDRTGKSINRNALIALIAAVIL  288

Query  984   KEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             +EHP +T+VTD+ TS GL +FI  R G+H  +R GY+NVI++ + LNE+G E+ L +ETS
Sbjct  289   REHPESTIVTDSVTSDGLAKFIADRNGKHHRFRRGYKNVINESLRLNENGEESWLAIETS  348

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH AL+ENYFLDDGAY+V K+I+E   ++ EG E  +  LI DL++P+E+ E+R  + ++
Sbjct  349   GHAALRENYFLDDGAYLVAKLIVEAACLRKEGKE--LQDLIADLQQPVESKEIRFKIDTD  406

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                 K    + +E  +   EK +   W+L S     V   C  +                
Sbjct  407   --DFKTYGEQVLEHIKAAAEKEH--DWQLVSPNYEGVRIACTSEK---------------  447

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                    E G   LRQS+H+P + +N++SNI GG   +
Sbjct  448   -------EQGCFLLRQSLHDPVLPLNIESNIEGGVNRI  478



>ref|XP_009603702.1| PREDICTED: phosphoglucomutase-2 isoform X2 [Nicotiana tomentosiformis]
Length=541

 Score =   410 bits (1055),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 241/542 (44%), Positives = 328/542 (61%), Gaps = 50/542 (9%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E     +LQNGSD+RGVA+ G +G  + LT P  EAIA  F  W+    +S +       
Sbjct  14    EKNDFLKLQNGSDIRGVAVDGVEGEPLTLTEPVTEAIAAGFAGWLRKKYDSSK------C  67

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DAS  1552
             +RVS+G D RIS + L  AV  GL +AG  V   GLA+TPA F ST+    ++    D S
Sbjct  68    LRVSIGHDSRISAQKLQDAVSQGLARAGVEVIQYGLASTPAMFNSTLTVDEEFSCPVDGS  127

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKY---ANRMAK-VSTALRAPPS  1384
             IM+TASHLPY RNG KFFT+ GGL   +++ I ++AA  Y   AN  +K   TA+     
Sbjct  128   IMITASHLPYNRNGFKFFTRAGGLGKPDIKDILERAAEIYKNIANEYSKGAETAVSLSVK  187

Query  1383  KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  1204
             +VD+MS YA +L   ++    +    + PL+GF I+V+AGNG+GGFF   VL+ LGA T 
Sbjct  188   RVDYMSIYASNLVAAVRRAAGN---IEKPLEGFHIVVDAGNGAGGFFVGKVLEPLGAITS  244

Query  1203  GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPIN  1024
             GS  L PDG+FPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD SG   N
Sbjct  245   GSQFLEPDGLFPNHIPNPEDKTAMEAITKAVLDNRADLGIIFDTDVDRSAAVDSSGREFN  304

Query  1023  GDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHL  847
              +RLIALMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + L
Sbjct  305   RNRLIALMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRL  364

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKD  676
             N  G E HL +ETSGHGAL+EN++LDDGAY++VK++ ++   +  G   G   +  +++ 
Sbjct  365   NSVGEEAHLAIETSGHGALRENHWLDDGAYLMVKLLNKLASARTSGQGGGSKVLTDMVEG  424

Query  675   LEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLV  496
             LEEP    ELR+ +  +  H+  K      SFR Y              G+  + +  L 
Sbjct  425   LEEPAVAVELRLKI--DQNHSDLKG----GSFRVY--------------GEAVLKQ--LE  462

Query  495   DTNDHPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMAR  325
             +T D     DA + +A V+ E    +G  GW  LR S+H+P + +N+++        +A 
Sbjct  463   NTVDS----DAKLLKAPVNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEAPSNEAAVKLAH  518

Query  324   DL  319
             D+
Sbjct  519   DV  520



>ref|WP_021803549.1| phosphomannomutase [Clostridium intestinale]
 gb|ERK29004.1| phosphomannomutase [Clostridium intestinale URNW]
Length=509

 Score =   409 bits (1052),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 222/549 (40%), Positives = 333/549 (61%), Gaps = 44/549 (8%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             +E++++LQNG+D+RG+A++  + + V+LTP  +  I   F +W+      E   +    +
Sbjct  2     IEELKKLQNGTDIRGIAIETSEHK-VNLTPQVIRFIGNGFVKWI-----KENKCSGKSKI  55

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
             ++++GMD R+SG  L  ++   L   GC V+D  ++TTPA FM+T+L  ++ D +IM+TA
Sbjct  56    KIAVGMDSRLSGPELRTSLIDLLINVGCDVYDCNMSTTPAMFMTTLLDNYKCDGAIMITA  115

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYA  1357
             SHLPY  NGLKFFTK+GG    ++E I       ++   +++S   +    +VD +  Y+
Sbjct  116   SHLPYYYNGLKFFTKEGGCEEKDIEDIL------FSTYNSEMSYTTKGELREVDLIDEYS  169

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
               L D I+  VN   +Y+ PL G +IIV+AGNG+GGFF   VL +LGA+T GS  L+PDG
Sbjct  170   NLLVDKIRSSVNSKRNYNKPLDGAKIIVDAGNGAGGFFANKVLMELGANTEGSQFLDPDG  229

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNHIPNPE+K AM   + AVL+  A+LG++FDTDVDR+ +V  +G  IN + LI L+S
Sbjct  230   TFPNHIPNPENKKAMESIKKAVLKWDANLGIIFDTDVDRAAIVSNTGEEINKNALIGLIS  289

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
             +IVL+EHP + +VTD+ TS GL  FI+  GG H  ++ GY+NVI++   LNE+G ++ L 
Sbjct  290   SIVLEEHPKSVIVTDSVTSTGLAEFISTLGGVHHRFKRGYKNVINESKRLNEEGRDSQLA  349

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGH ALKENYFLDDGAY++ KI+I+M K+K EG E  I SLI+ L+ P E+ ++R+ 
Sbjct  350   IETSGHAALKENYFLDDGAYLIAKILIKMAKLKEEGKE--ISSLIRGLKHPKESEDIRLK  407

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             +  E  + K+   + I   R Y  K  + GW +D        EG  ++ N          
Sbjct  408   IRRE--NFKSYGEQVISGVRQYAYK--VEGWNVDHEN----FEGIKINCN----------  449

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFL  277
                     EN   GW  LR S+H P + +N++S+  GG   +     D+     E    L
Sbjct  450   --------ENSGDGWFLLRLSLHEPVLPLNVESDSIGGVNKIL----DRLAPFLEKYSEL  497

Query  276   DISQIDEFA  250
             D+S I ++ 
Sbjct  498   DLSNISKYT  506



>ref|XP_009781930.1| PREDICTED: phosphoglucomutase-2 isoform X2 [Nicotiana sylvestris]
Length=540

 Score =   410 bits (1054),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 240/542 (44%), Positives = 326/542 (60%), Gaps = 51/542 (9%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E     +LQNGSD+RGVA+ G +G  + LT P  EAIA  F  W+    +S +       
Sbjct  14    EKSDFLKLQNGSDIRGVAVDGVEGEPLTLTEPVTEAIAAGFAGWLKKKYDSSK------R  67

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DAS  1552
             +RVS+G D RIS + L  AV  GL +AG  V   GLA+TPA F ST+    ++    D S
Sbjct  68    LRVSIGHDSRISAQKLQDAVSQGLARAGVEVIQYGLASTPAMFNSTLTVDEEFSCPVDGS  127

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKY---ANRMAK-VSTALRAPPS  1384
             IM+TASHLPY RNG KFFT+ GGL   +++ I ++AA  Y   AN  +K   TA+     
Sbjct  128   IMITASHLPYNRNGFKFFTRAGGLGKPDIKDILERAAEIYKNIANEDSKGAETAVSLSVK  187

Query  1383  KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  1204
             +VD+MS YA +L   ++    +    + PL+GF I+V+AGNG+GGFF   VL+ LGA T 
Sbjct  188   RVDYMSIYASNLVAAVRRAAGN---IEKPLEGFHIVVDAGNGAGGFFVGKVLEPLGAITS  244

Query  1203  GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPIN  1024
             GS  L PDG+FPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD SG   N
Sbjct  245   GSQFLEPDGLFPNHIPNPEDKTAMKAITKAVLDNRADLGIIFDTDVDRSAAVDSSGREFN  304

Query  1023  GDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHL  847
              +RLIALMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + L
Sbjct  305   RNRLIALMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRL  364

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKD  676
             N  G E HL +ETSGHGALKEN++LDDGAY++VK++ ++   +  G   G   +  +++ 
Sbjct  365   NSVGEEAHLAIETSGHGALKENHWLDDGAYLMVKLLNKLASARTSGQGSGSKVLTDMVEG  424

Query  675   LEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLV  496
             LEEP    ELR+ + ++             SFR Y              G+  + +  L 
Sbjct  425   LEEPAVAVELRLKIDNQSDLIGG-------SFRDY--------------GEAVLKQ--LE  461

Query  495   DTNDHPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMAR  325
             +T D     DA + +A V+ E    +G  GW  LR S+H+P + +N+++        +A 
Sbjct  462   NTVDS----DAKLLKAPVNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEAPSNEAAVKLAH  517

Query  324   DL  319
             D+
Sbjct  518   DV  519



>ref|WP_038457131.1| phosphoglucomutase [Clostridium beijerinckii]
Length=511

 Score =   409 bits (1051),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 215/516 (42%), Positives = 324/516 (63%), Gaps = 45/516 (9%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             +++++RLQ+G+D+RG+A++ E  +  +LTP  V  +   F EW+      +  G   +++
Sbjct  2     LQELKRLQSGTDIRGIAIEHEGTK--NLTPNLVNNVGFGFVEWL-----KKTKGLSSKNI  54

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
             ++++GMD R+SG  L  ++   L  +GC V+D G+ TTPA FM+T+L  +  D ++M+TA
Sbjct  55    KIAVGMDSRLSGPELKKSLIEALVDSGCNVYDCGICTTPAMFMTTILENYSCDGAVMITA  114

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAI--CDKAARKYANRMAKVSTALRAPPSKVDFMSA  1363
             SHLPY  NGLKFFTK+GG    ++E I  C   A K       V T        + F+  
Sbjct  115   SHLPYYYNGLKFFTKEGGCEKEDIENIIECSNLAEKKCTTKGLVET--------IYFIDV  166

Query  1362  YAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNP  1183
             Y+  L D I++ VN  T+Y+ PL+G +IIV+AGNG+GGFF + VL+KLGA   GS    P
Sbjct  167   YSNILVDKIRKNVNSKTNYERPLEGTKIIVDAGNGAGGFFAYKVLEKLGASVEGSQFTEP  226

Query  1182  DGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIAL  1003
             DG FPNHIPNPE++ AM   + AVL N ADLG++FDTDVDR+ +V   G  IN + LIAL
Sbjct  227   DGNFPNHIPNPENEEAMNSIKEAVLNNKADLGIIFDTDVDRAAIVSSDGKEINKNALIAL  286

Query  1002  MSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETH  823
             +S+IVL+E+P + +VTD+ TS GL+ FIT  GG H  ++ GY+NVI++   LN++G  + 
Sbjct  287   ISSIVLEENPNSIIVTDSVTSTGLSDFITSLGGIHHRFKRGYKNVINESKRLNKEGKLSC  346

Query  822   LMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELR  643
             L +ETSGH ALKENYFLDDGAY++ KI+I+M K+K EG E  I SLI++L+ P E+ ++R
Sbjct  347   LAIETSGHAALKENYFLDDGAYLIAKILIKMAKLKDEGKE--ISSLIENLKYPKESMDMR  404

Query  642   MDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDA  463
             +++  E   +  + +  IE  + Y++  N  GW ++      +   C             
Sbjct  405   INIKREDFKSYGEMI--IEGLKKYVDHVN--GWTIEPKNYEGIKINC-------------  447

Query  462   FMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSN  355
                     ++ENG+ GW+ LR S+H P + +N++S+
Sbjct  448   --------DKENGD-GWLLLRLSLHEPVLPLNIESD  474



>ref|WP_035632295.1| phosphoglucomutase [Lachnospiraceae bacterium ND2006]
Length=501

 Score =   409 bits (1050),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 228/543 (42%), Positives = 328/543 (60%), Gaps = 51/543 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RG+A++ E G  V+LT  AV  +A +F  W+       +G    +S+++++G
Sbjct  5     KLQNGSDIRGIAMENETG-PVNLTDDAVRHLAAAFAVWL-------KGKLNKDSLKIAVG  56

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              D R++G+    A   GL   GC   D GLA+TPA FM+TV   + YD SIM+TASHLP+
Sbjct  57    HDSRLTGELFVNAAIEGLNSEGCSCADCGLASTPAMFMTTVTEGYNYDGSIMITASHLPW  116

Query  1521  TRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRD  1342
              RNG+KFFT  GGL S++++ +   A +       ++S  L     K+DFM+ Y+ HL +
Sbjct  117   YRNGMKFFTAHGGLESSDIKELTAIAGK------TEISVPLNNNAEKLDFMTVYSDHLCE  170

Query  1341  IIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNH  1162
              IK  V     ++ PL+G  IIV+AGNG GGF+   VL+ LGADT GS  L PDG FPNH
Sbjct  171   TIKNAVK-ADDFEHPLKGLHIIVDAGNGDGGFYVSKVLEPLGADTTGSQFLEPDGHFPNH  229

Query  1161  IPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLK  982
             IPNPE+K A    + A L + ADLG++FDTDVDR+G +  SG  +  + LIA++S I L 
Sbjct  230   IPNPENKEAAEAIKNATLASKADLGIIFDTDVDRAGAILPSGRELTRNALIAVLSRIALS  289

Query  981   EHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSG  802
             EHPGTT+VTD+ TS GL  FIT  GG H  ++ GY+NVID+ + LN +G ++ L +ETSG
Sbjct  290   EHPGTTIVTDSVTSTGLAEFITSHGGVHRRFKRGYKNVIDESIRLNNEGTDSQLAIETSG  349

Query  801   HGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEP  622
             HGA KENYFLDDGAY++VK+++E+      G    +  +I DL+EP E+ ELR  VL+E 
Sbjct  350   HGAFKENYFLDDGAYLMVKLLVEL------GKGHKLDEMIADLKEPAESIELRFPVLAEN  403

Query  621   RHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKV  442
                 +  +  +E+ +  +   N  GW L                     A D F    ++
Sbjct  404   VSLISDKI--LETIKAAVPLTN--GWSL---------------------APDNF-EGVRI  437

Query  441   SNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQI  262
             + + +  +GW+ LR+S+H P + +N++S+  GGC  +AR L +  LL  E    LD+  I
Sbjct  438   NIDADHGNGWLLLRKSLHEPIMPLNIESDEEGGCSIIARTLYE--LLKPETT--LDLQSI  493

Query  261   DEF  253
              +F
Sbjct  494   IDF  496



>ref|WP_022316367.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
II [Prevotella sp. CAG:592]
 emb|CDD03531.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
II [Prevotella sp. CAG:592]
Length=489

 Score =   407 bits (1047),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 231/530 (44%), Positives = 326/530 (62%), Gaps = 46/530 (9%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G +G  V+LT  AVE IA SF  W        R      +  +++
Sbjct  4     KKLQNGSDIRGVALEGIEGEHVNLTEEAVETIARSFVCWT-------RKTTGTNTPTITV  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             GMD RISG  +  A   G  +AG  V D GLA+TPA FM+T+    +  A++M+TASHLP
Sbjct  57    GMDCRISGDMIKGAFVKGAKEAGANVVDCGLASTPAMFMTTISEQLKATAAVMVTASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKA-ARKYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
             + RNGLKFFT KGGL   ++ +I D A + +YA   A+ S         +DFM+ Y+KH+
Sbjct  117   FNRNGLKFFTPKGGLDKKDITSILDIAESGEYAYDGAEGSC------KTLDFMTIYSKHI  170

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
              D I   VN    +  PL+G  IIV+AGNG+GGFF   +L  LGA T GS  L PDG FP
Sbjct  171   ADYICHGVN-ADEFSQPLKGMHIIVDAGNGNGGFFE-KILKSLGAKTEGSQFLEPDGHFP  228

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NHIPNPE+  AMA    AV ++ AD+GV+FDTDVDRS ++   G PIN + LIAL+++++
Sbjct  229   NHIPNPENAEAMASVCKAVEESKADMGVIFDTDVDRSAIIGHKGEPINRNALIALIASVI  288

Query  987   LKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             L+EHPG+T+VTD+ TS GL  FIT  GG+H  +R GY+NVI++G+ LN+ G E  L +ET
Sbjct  289   LEEHPGSTIVTDSVTSDGLAEFITRLGGRHHRFRRGYKNVINEGIRLNQTGEECWLAIET  348

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGH AL+EN+FLDDGAY+  K+I+   K+  +G    +  +I  L++P E+ E+R+  L+
Sbjct  349   SGHAALRENHFLDDGAYLAAKLIVNAAKLYRQGKR--LDEMIATLKQPKESKEIRIK-LT  405

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             EP   KA+  E +E  +  +    + GW              +V+ N          Y  
Sbjct  406   EPDF-KAQGTEVLEDMKAKV--AGMAGW-------------TIVEPN----------YEG  439

Query  447   -KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLL  301
              +VS  ++GE GW  LR S+H+P + +N++SN+ GG  ++   L+   LL
Sbjct  440   LRVSCTDDGEKGWWLLRMSLHDPVMPLNIESNVEGGVAAIEAKLKGMGLL  489



>ref|WP_031583197.1| hypothetical protein [Lachnospiraceae bacterium AC2028]
Length=502

 Score =   408 bits (1048),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 241/562 (43%), Positives = 334/562 (59%), Gaps = 69/562 (12%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
              LQNGSD+RG+AL+ E G  V+LT  A   +A +F +W+     +E+ G   + +R+++G
Sbjct  5     ELQNGSDIRGIALENETGEKVNLTDKAACDLAAAFVKWI-----AEKTGK--KDIRIAIG  57

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPY  1522
              D R++G+SL +A   G+       FD+GLA+TPA FMSTVL    YD SIM+TASHLP+
Sbjct  58    RDSRLTGESLLSASAKGIISENGKAFDLGLASTPAMFMSTVLGDDPYDGSIMITASHLPW  117

Query  1521  TRNGLKFFTKKGGLTSTEVE---AICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKH  1351
              RNG+KFF  +GGL   E++   AI D  A +   R +K   A    P K  FM  Y  +
Sbjct  118   YRNGMKFFIARGGLEKNEIKEIAAIADTLAPE--GRESKDYPA----PEKASFMDTYTGY  171

Query  1350  LRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMF  1171
             LR  I   V+     D PL+G  I+V+AGNG+GGFF  DVL+KLGADT GS  L+PDG F
Sbjct  172   LRSKI---VDGCAKGDKPLEGLHIVVDAGNGAGGFFVRDVLEKLGADTAGSQFLDPDGHF  228

Query  1170  PNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAI  991
             PNHIPNPE+K A    + A + + ADLG++FDTDVDR+G V   G  +  + LIA +++I
Sbjct  229   PNHIPNPENKDAAEAIKVATVNSKADLGIIFDTDVDRAGAVLPDGKTLTRNDLIAALASI  288

Query  990   VLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMME  811
              L  +PGTT+VTD+ TS GL RFI  +GG H  ++ GYRNVID+ + LN+ G+++ L +E
Sbjct  289   ALNSNPGTTIVTDSVTSDGLARFIKSKGGVHKRFKRGYRNVIDEAIRLNDSGIDSQLAIE  348

Query  810   TSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVL  631
             TSGHGA KENYFLDDGAY++VK++IEM      G    I SLI  LEEP E+ ELR  V 
Sbjct  349   TSGHGAFKENYFLDDGAYLMVKLLIEM------GKGNNIASLISGLEEPAESVELRFHVG  402

Query  630   SEP--RHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
               P  +    + ++A+E     +E     GW L+        EG                
Sbjct  403   DVPDLQANGDRILKALEDAASSVE-----GWSLEKEN----YEGV---------------  438

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFL  277
                +V+ + +  +GW+ LR+S+H P + +N++S+  GG   +A  L D  ++A E  K L
Sbjct  439   ---RVNCDASHGNGWLLLRKSLHEPIMPLNIESDTKGGALIIANALYD--IIADE--KTL  491

Query  276   DISQIDEFARNGNLN*DTVCNR  211
             D++ I EF           CNR
Sbjct  492   DLTPIKEF-----------CNR  502



>ref|WP_023153616.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
II [Eubacterium brachy]
 gb|ESE28865.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
II [Eubacterium brachy ATCC 33089]
Length=507

 Score =   408 bits (1048),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 236/546 (43%), Positives = 329/546 (60%), Gaps = 48/546 (9%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             I++LQNGSD+RGVAL+   G  V+L       IA +F EW+   +           ++++
Sbjct  3     IKKLQNGSDIRGVALKIPGGEDVNLGKIEAVKIATAFAEWLKINVNK-----TFSEMKIA  57

Query  1707  LGMDPRISGKSL---SAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
             +GMD R++G SL   S+  FA LG     V D GLA+TPA FMSTV   F  D +IM+TA
Sbjct  58    IGMDSRLTGPSLKKYSSETFASLG---ICVLDCGLASTPAMFMSTVFDEFSADGAIMITA  114

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKV---DFMS  1366
             SHLP  RNG KFFT+KGGL+  ++  I + +      R +++ + ++  PS +   + M 
Sbjct  115   SHLPLNRNGFKFFTRKGGLSKKDISDILEISCTL---RNSEMESTMKFDPSLITESNLME  171

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              YAKHLR++I   V + T    PL+  +I+V+AGNGSGGFF  +VL  LGAD  GS  L 
Sbjct  172   RYAKHLRELIVSGVGNGTK---PLENMKILVDAGNGSGGFFPHNVLKPLGADISGSQFLE  228

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDG FPNH PNPE+K AM     AVL+N ADLG++FDTDVDRS  VDR+GNPI+ + LIA
Sbjct  229   PDGTFPNHEPNPENKNAMESISDAVLKNNADLGIIFDTDVDRSSAVDRNGNPISRNSLIA  288

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             L S+++ K  PGTT+VTD+ TS  LT FI GR G +H  ++ GY+NVIDK   LN DG++
Sbjct  289   LASSMLAKGFPGTTIVTDSVTSTHLTDFIEGRLGLKHLRFKRGYKNVIDKSRQLNADGID  348

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAE  649
             + L METSGHGA KENYFLDDGAY  VKIIIE    KL GS + I SLIKDL+ P E  E
Sbjct  349   SQLAMETSGHGAFKENYFLDDGAYTAVKIIIEAA--KLHGSRKSISSLIKDLKAPAEAEE  406

Query  648   LRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAI  469
             +R+ + ++   +    V         +E  NL              +G  ++T ++    
Sbjct  407   IRIAINADDFSSYGDTV-----LSRLLEWTNLK-----------EDDGLSLETPNYEG--  448

Query  468   DAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEM  289
                    +++ ++   +GW  LR+S+H+P + +N++S+  GG  ++   LR  FL+  + 
Sbjct  449   ------VRINFDQGAGNGWALLRKSLHDPILPLNIESDDVGGVTAIKNLLR-SFLIEFDK  501

Query  288   AKFLDI  271
                 D+
Sbjct  502   LDLTDL  507



>ref|WP_021660283.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
II [Clostridium sp. ATCC 29733]
 gb|ERI97363.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
II [Clostridium sp. ATCC 29733]
Length=507

 Score =   408 bits (1048),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 235/523 (45%), Positives = 319/523 (61%), Gaps = 40/523 (8%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             M   R LQNGSD+RGVAL+G  G  V+LT  A   +A +F  W+     S++ G  +  +
Sbjct  1     MGDYRALQNGSDIRGVALEGVAGEPVNLTEQAARELAAAFALWL-----SQKTGKPLPQL  55

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
              VS+G D R+SG +L AA   GL  AG  V D  +A+TPA FMSTVLP   YD +IM+TA
Sbjct  56    TVSVGRDSRLSGPALLAAAAEGLQDAGVSVVDCQMASTPAMFMSTVLPGHGYDGAIMITA  115

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYA  1357
             SHLPY RNGLKFFT++GGL   ++EA+ + A       + ++ +   AP  + D +S YA
Sbjct  116   SHLPYNRNGLKFFTREGGLEHEDIEALTELA-------LGELPSGQSAPVRQADLISDYA  168

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
              HL   I+E ++ P HY+ PLQGF+I V+AGNG+GGFF   VL  LGAD   S +L+PDG
Sbjct  169   LHLVKKIREGIDDPDHYNQPLQGFKIAVDAGNGAGGFFAQKVLCPLGADVSASRYLDPDG  228

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNH+PNPED  AM     AV +   DLG++FDTDVDR+G VDR+G  IN +RLIAL+S
Sbjct  229   RFPNHVPNPEDPAAMRSIIEAVKEGGCDLGLIFDTDVDRAGAVDRNGKEINRNRLIALLS  288

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
              IVL++ PG T+VTD+ TS  L  FI   GG H  ++ GY+NVI++ + L ++GV + L 
Sbjct  289   CIVLEDCPGGTIVTDSVTSSHLGAFIEELGGVHHRFKRGYKNVINESIRLAKEGVPSPLA  348

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGHGALKENY+LDDGAY+  KI+I+   ++  G    I +L+ DL+EP E  ELR  
Sbjct  349   IETSGHGALKENYYLDDGAYLCAKILIKAATLRQVGKT--IDTLLADLQEPAEAVELRFK  406

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             +      A  K V A      Y++    PGWE                  +H        
Sbjct  407   IKVPDFAAYGKQVLA--DLESYVDA--QPGWE--------------KAPQNHEG------  442

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMA  328
                +VS  + GE GW  LR S+H+P + +N++S+  GG + +A
Sbjct  443   --IRVSFFDEGERGWFLLRMSLHDPILPLNIESDDCGGAKKIA  483



>ref|WP_011967580.1| phosphoglucomutase [Clostridium beijerinckii]
 ref|YP_001307374.1| phosphomannomutase [Clostridium beijerinckii NCIMB 8052]
 gb|ABR32418.1| Phosphomannomutase [Clostridium beijerinckii NCIMB 8052]
 gb|AIU03110.1| phosphomannomutase [Clostridium beijerinckii ATCC 35702]
Length=509

 Score =   408 bits (1048),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 214/516 (41%), Positives = 324/516 (63%), Gaps = 45/516 (9%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             ++++++LQ+G+D+RG+A++ E  +  +LTP  V  +   F EW+      +  G   +++
Sbjct  2     LQELKKLQSGTDIRGIAIEYEGAK--NLTPNLVNNVGFGFVEWL-----KKTKGLSNKNI  54

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
             ++++GMD R+SG  L  ++   L  +GC V+D G+ TTPA FM+T+L  +  D ++M+TA
Sbjct  55    KIAVGMDSRLSGPELKKSLIEALVDSGCNVYDCGICTTPAMFMTTILENYSCDGAVMITA  114

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAI--CDKAARKYANRMAKVSTALRAPPSKVDFMSA  1363
             SHLPY  NGLKFFTK+GG    ++E I  C   A K       V T        + F+  
Sbjct  115   SHLPYYYNGLKFFTKEGGCEKEDIENIIECSNLAEKKCTTKGLVET--------IYFIDV  166

Query  1362  YAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNP  1183
             Y+  L D I++ VN  T+Y+ PL+G +IIV+AGNG+GGFF + VL+KLGA   GS    P
Sbjct  167   YSNILVDKIRKNVNSKTNYERPLEGTKIIVDAGNGAGGFFAYKVLEKLGASVEGSQFTEP  226

Query  1182  DGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIAL  1003
             DG FPNHIPNPE++ AM   + AVL N ADLG++FDTDVDR+ +V   G  IN + LIAL
Sbjct  227   DGNFPNHIPNPENEEAMNSIKEAVLNNKADLGIIFDTDVDRAAIVSSDGKEINKNALIAL  286

Query  1002  MSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETH  823
             +S+IVL+E+P + +VTD+ TS GL+ FIT  GG H  ++ GY+NVI++   LN++G  + 
Sbjct  287   ISSIVLEENPNSIIVTDSVTSTGLSDFITSLGGIHHRFKRGYKNVINESKRLNKEGKLSC  346

Query  822   LMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELR  643
             L +ETSGH ALKENYFLDDGAY++ KI+I+M K+K EG E  I SLI++L+ P E+ ++R
Sbjct  347   LAIETSGHAALKENYFLDDGAYLIAKILIKMAKLKDEGKE--ISSLIENLKYPKESMDMR  404

Query  642   MDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDA  463
             +++  E   +  + +  IE  + Y++  N  GW ++      +   C             
Sbjct  405   INIKREDFKSYGEMI--IEGLKKYVDHVN--GWTIEPKNYEGIKINC-------------  447

Query  462   FMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSN  355
                     ++ENG+ GW+ LR S+H P + +N++S+
Sbjct  448   --------DKENGD-GWLLLRLSLHEPVLPLNIESD  474



>ref|WP_006439097.1| phosphoglucomutase [[Clostridium] hiranonis]
 gb|EEA86169.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
II [ [[Clostridium] hiranonis DSM 13275]
Length=508

 Score =   407 bits (1047),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 226/527 (43%), Positives = 320/527 (61%), Gaps = 41/527 (8%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             MEKI +LQNG+D+RGVA   ++ + V LT   VE IA +F  W+      E+ G   E +
Sbjct  12    MEKIYKLQNGTDIRGVAYPNDE-KEVTLTKVEVEKIARAFHIWL-----KEKTGK--EKI  63

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
              V++G D RI+G+     +   L   GC V +  L+TTP+ FM+TV+  ++ D SIM+TA
Sbjct  64    VVAVGNDSRITGEEFRNTIIEALTSQGCDVVNCKLSTTPSMFMTTVMDGYKCDGSIMITA  123

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYA  1357
             SHLP+  NGLKFFT+ GGL   +++A+ D            V +A +    + + +  YA
Sbjct  124   SHLPFFYNGLKFFTENGGLEKADIKAMLDIVCEGKT-----VESAEKGSICERNLIDDYA  178

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
             + L D I++ VN  + Y+ P  G +IIV+AGNG+GGFF   VL+KLGADT GS  L PDG
Sbjct  179   EVLVDKIRKGVNSESCYEKPFDGMKIIVDAGNGAGGFFAEKVLEKLGADTEGSQFLEPDG  238

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
             MFPNHIPNPE+K AMA    AV+ N ADLG++FDTDVDR+ +V + G+ IN + LIA++S
Sbjct  239   MFPNHIPNPENKEAMASISKAVVDNKADLGIIFDTDVDRAALVGKDGSFINKNALIAVIS  298

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
              I+L+E+P TT+VTD+ TS+GL  FI   GG+H  ++ GY+NVI++ + LN +G E HL 
Sbjct  299   EILLEENPNTTIVTDSITSVGLAEFIENHGGKHHRFKRGYKNVINEAIRLNNEGEECHLA  358

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGH A+KENYFLDDGAY++ KI+I+  KM  EG  + I SLI DL+E  E  E+R+ 
Sbjct  359   IETSGHAAIKENYFLDDGAYLIAKILIKAAKMAKEG--KTIESLIADLKEAAEEKEVRIG  416

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             +  E     A+ +  +     ++E+     W L                   P   +   
Sbjct  417   INKEDFRPYAEQI--LSELSVFVEES--ENWSL------------------VPKNYEGI-  453

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLR  316
              RA  S E  GE GW  +R S+H P +A+N++SN  GG   +   L+
Sbjct  454   -RANCSGE--GEDGWFLIRISLHEPLLALNIESNEIGGTDKIYATLK  497



>ref|WP_011967899.1| phosphoglucomutase [Clostridium beijerinckii]
 ref|YP_001307694.1| phosphomannomutase [Clostridium beijerinckii NCIMB 8052]
 gb|ABR32738.1| Phosphomannomutase [Clostridium beijerinckii NCIMB 8052]
 gb|AIU03111.1| phosphomannomutase [Clostridium beijerinckii ATCC 35702]
Length=521

 Score =   408 bits (1048),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 215/516 (42%), Positives = 324/516 (63%), Gaps = 45/516 (9%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             +++++RLQ+G+D+RG+A++ E  +  +LTP  V  +   F EW+      +  G   +++
Sbjct  12    LQELKRLQSGTDIRGIAIEHEGTK--NLTPNLVNNVGFGFVEWL-----KKTKGLSSKNI  64

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
             ++++GMD R+SG  L  ++   L  +GC V+D G+ TTPA FM+T+L  +  D ++M+TA
Sbjct  65    KIAVGMDSRLSGPELKKSLIEALVDSGCNVYDCGICTTPAMFMTTILENYSCDGAVMITA  124

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAI--CDKAARKYANRMAKVSTALRAPPSKVDFMSA  1363
             SHLPY  NGLKFFTK+GG    ++E I  C   A K       V T        + F+  
Sbjct  125   SHLPYYYNGLKFFTKEGGCEKEDIENIIECSNLAEKKCTTKGLVET--------IYFIDV  176

Query  1362  YAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNP  1183
             Y+  L D I++ VN  T+Y+ PL+G +IIV+AGNG+GGFF + VL+KLGA   GS    P
Sbjct  177   YSNILVDKIRKNVNSKTNYERPLEGTKIIVDAGNGAGGFFAYKVLEKLGASVEGSQFTEP  236

Query  1182  DGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIAL  1003
             DG FPNHIPNPE++ AM   + AVL N ADLG++FDTDVDR+ +V   G  IN + LIAL
Sbjct  237   DGNFPNHIPNPENEEAMNSIKEAVLNNKADLGIIFDTDVDRAAIVSSDGKEINKNALIAL  296

Query  1002  MSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETH  823
             +S+IVL+E+P + +VTD+ TS GL+ FIT  GG H  ++ GY+NVI++   LN++G  + 
Sbjct  297   ISSIVLEENPNSIIVTDSVTSTGLSDFITSLGGIHHRFKRGYKNVINESKRLNKEGKLSC  356

Query  822   LMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELR  643
             L +ETSGH ALKENYFLDDGAY++ KI+I+M K+K EG E  I SLI++L+ P E+ ++R
Sbjct  357   LAIETSGHAALKENYFLDDGAYLIAKILIKMAKLKDEGKE--ISSLIENLKYPKESMDMR  414

Query  642   MDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDA  463
             +++  E   +  + +  IE  + Y++  N  GW ++      +   C             
Sbjct  415   INIKREDFKSYGEMI--IEGLKKYVDHVN--GWTIEPKNYEGIKINC-------------  457

Query  462   FMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSN  355
                     ++ENG+ GW+ LR S+H P + +N++S+
Sbjct  458   --------DKENGD-GWLLLRLSLHEPVLPLNIESD  484



>ref|WP_035293255.1| phosphoglucomutase [Clostridium sp. KNHs214]
Length=503

 Score =   407 bits (1046),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 222/526 (42%), Positives = 319/526 (61%), Gaps = 48/526 (9%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNG+DVRG+AL+G +G  ++LTP     I  SF  W+      E+ G  +  + +++G 
Sbjct  8     LQNGNDVRGIALEGMEGEKINLTPYHTTLIGLSFVNWL-----KEKTGKTL--LNIAIGN  60

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYT  1519
             D R+S  SL   +  G+      + D GLA+TPA FMST++   + D +IM+TASHLPY 
Sbjct  61    DSRLSAYSLKRGIIDGICLTNSSILDCGLASTPAMFMSTIIDEIKADGAIMITASHLPYN  120

Query  1518  RNGLKFFTKKGGLTSTEVEAIC----DKAARKYANR-MAKVSTALRAPPSKVDFMSAYAK  1354
             RNGLKFFTK G L   +V+ I     + A  +YA+R +    T +     KV+ M AY+K
Sbjct  121   RNGLKFFTKNGALEKEDVKEILTLAEEYATSEYASREIINCDTLI----GKVNLMDAYSK  176

Query  1353  HLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGM  1174
                 I+ E++   T  + PL   +I+V+AGNGSGGFF   VL  LGAD  GS  LNPDG 
Sbjct  177   ----ILVEKIRLATEDEKPLLNTKIVVDAGNGSGGFFVEKVLVPLGADVTGSQFLNPDGT  232

Query  1173  FPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSA  994
             FPNHIPNPEDK AM   +  VL N ADLG++FDTDVDR+ +VD +G  IN +RLIAL+S 
Sbjct  233   FPNHIPNPEDKDAMLSIKKCVLHNKADLGIIFDTDVDRAAIVDSNGEIINRNRLIALISN  292

Query  993   IVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             IVLKE+PGTT+VTD+ TS  L+ +I   GG H  ++ GY+NVI++ + LN+ G E+HL +
Sbjct  293   IVLKEYPGTTIVTDSVTSDELSLYIESIGGTHHRFKRGYKNVINESIRLNKTGEESHLAI  352

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDV  634
             ETSGH ALKENYFLDDGAY++VKI+I M +++ E   + + SLI  LEEP+ + E+R+ +
Sbjct  353   ETSGHAALKENYFLDDGAYLIVKILITMAQLRKEN--KSLHSLIDSLEEPISSKEIRIKI  410

Query  633   LSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMY  454
               E  +      + +++F+ ++   N  GW +                   P + +    
Sbjct  411   --EENNFIEYGTKVLDAFKEFVT--NTSGWSI------------------APNSYEGV--  446

Query  453   RAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLR  316
             R   SN +  E GW  +R S+H+P + +N++S +  G   +   ++
Sbjct  447   RVNCSNSD--ESGWCLIRMSLHDPVLPINIESKLKTGSDKIFEKIQ  490



>ref|WP_009167922.1| phosphoglucomutase [Clostridium sp. DL-VIII]
 gb|EHI97240.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Clostridium sp. DL-VIII]
Length=500

 Score =   407 bits (1046),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 223/544 (41%), Positives = 329/544 (60%), Gaps = 45/544 (8%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             ++++++LQ+G+D+RG+A   E     +LTP  V A+   F EW+ +    ++G     S+
Sbjct  2     LQELKKLQSGTDIRGIAT--EYNGIKNLTPDLVRALGNGFVEWLKNNKNIDKG-----SI  54

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
             ++++G+D R+SG  L  A+      +GC ++D G+ TTPA FM+T+L  +  D +IM+TA
Sbjct  55    KIAVGIDSRLSGPELKEALIKVFLNSGCRIYDCGMCTTPAMFMTTILEDYSCDGAIMITA  114

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYA  1357
             SHLPY  NGLKFFTK+GG    ++  I +     Y+    K           +DF+  Y+
Sbjct  115   SHLPYYYNGLKFFTKEGGCEKEDIVEIIE-----YSCLEGKSCAG--GSVENIDFIDVYS  167

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
               L + I++ VN   +Y+ PL+G +IIV+AGNG+GGFF   VL KLGAD  GS    PDG
Sbjct  168   NILVNKIRKSVNSEINYEFPLEGKKIIVDAGNGAGGFFAHKVLSKLGADIEGSQFTEPDG  227

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNHIPNPE+K AM   + AVL+N ADLG++FDTDVDR+ VV   G  IN + LIAL+S
Sbjct  228   NFPNHIPNPENKEAMESIKRAVLENNADLGIIFDTDVDRAAVVSSDGTEINKNALIALIS  287

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
             AIVL+E P +T+VTD+ TS GL  FIT  GG H  ++ GY+NVI++   LNE G E++L 
Sbjct  288   AIVLEETPNSTIVTDSVTSSGLAEFITNLGGIHHRFKRGYKNVINEAKRLNEKGSESNLA  347

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGH ALKENYFLDDGAY+V KI+I+M K+K EG +  + SLI++L+ P E+ ++R++
Sbjct  348   IETSGHAALKENYFLDDGAYLVAKILIKMAKLKEEGKD--VSSLIENLKYPKESRDIRIN  405

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             +         + +  IE  + Y+E+  + GW ++      V   C               
Sbjct  406   IKRADFRTYGEMI--IEGLKKYVEQ--IEGWTIEPQNYEGVRINC---------------  446

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFL  277
                   N+++G+ GW  LR S+H P +A+N++S+   G   M   L    L   +  +  
Sbjct  447   ------NKKSGD-GWFLLRLSLHEPVLALNVESDSDNGTNMMLEKL---ILFLKKYEELE  496

Query  276   DISQ  265
             DIS+
Sbjct  497   DISK  500



>ref|WP_038350910.1| phosphoglucomutase [Eubacterium limosum]
Length=494

 Score =   406 bits (1044),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 222/525 (42%), Positives = 325/525 (62%), Gaps = 49/525 (9%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E++ I +LQNGSD+RG+A++G +G  ++LT      IA SF +W    L+++ G    +S
Sbjct  2     EIQNITKLQNGSDIRGIAMEGVEGERINLTQDMAMKIAYSFSKW----LKAKTGK---DS  54

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMT  1540
             + V++G D R++G +L+ AV  GL   G  V+D G+ATTPA FM+T+ P    D ++M+T
Sbjct  55    LSVAVGRDSRLTGPNLAQAVCLGLVSDGGHVYDCGIATTPAMFMTTLDPEMDCDGAVMIT  114

Query  1539  ASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVD--FMS  1366
             ASHLP+ RNG+K FTK GGL   ++ AI ++A          + T  +    + D  F+ 
Sbjct  115   ASHLPFNRNGIKLFTKDGGLNKEDIAAILEQAE--------TIVTDFKIGGKREDTAFIP  166

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              YA ++  +I+E     T  +TPL+G  IIV+AGNG+GGFF   VL  LGADT GS  L+
Sbjct  167   RYAANIVAMIRE----ATGEETPLKGAHIIVDAGNGAGGFFAEGVLAPLGADTEGSQFLD  222

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDG FPNHIPNPED  A+   R AV+ + AD+G++FDTDVDRS V+D  G+ IN +  IA
Sbjct  223   PDGHFPNHIPNPEDPDAINAIRQAVIDSKADMGIIFDTDVDRSAVIDEKGDAINRNGFIA  282

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVET  826
              +++++L+++PGTT+VTD+ TS GLT +I G GG H  ++ GY+NVI++ V LN  GVET
Sbjct  283   FIASMLLEKYPGTTIVTDSVTSTGLTEYIEGLGGHHHRFKRGYKNVINEAVRLNAHGVET  342

Query  825   HLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAEL  646
             HL METSGHGA++ENYFLDDGAY+V   +I+  ++  EG    +   +KDL+EP E  E 
Sbjct  343   HLAMETSGHGAIRENYFLDDGAYLVTMALIKFAQLHREGKP--LSVFLKDLKEPAEAREY  400

Query  645   RMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAID  466
             R  + +E    K    E ++ FR + E+   PGW              +V+ N     +D
Sbjct  401   RFKITAE--DFKDYGQEVLDGFRKFAEE--QPGW-------------TIVEPNFEGIRVD  443

Query  465   AFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                        E+  +GW  +R S+H+P I +N++S+  GGC+ +
Sbjct  444   C---------GEDAGNGWCLMRMSLHDPIIPLNIESDEVGGCEKI  479



>ref|WP_007937388.1| MULTISPECIES: phosphoglucomutase [Pelosinus]
 gb|EIW16379.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Pelosinus fermentans B4]
 gb|EIW22640.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Pelosinus fermentans A11]
 gb|EIW29668.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Pelosinus fermentans DSM 17108]
Length=501

 Score =   407 bits (1045),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 219/522 (42%), Positives = 322/522 (62%), Gaps = 39/522 (7%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             ME  +RLQNG+D+RG+A+   +  +V LT   V AI   F +W++     E       S 
Sbjct  2     MESWKRLQNGTDIRGIAIATPQ-NAVTLTSTMVRAIGFGFRQWLL-----EVKNIQAASC  55

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
             ++++GMD R+SG  L  A+   L + GC V+D G++TTPA FM+T+L  +Q D ++M+TA
Sbjct  56    KIAIGMDSRLSGPELKTALIERLAELGCDVYDCGMSTTPAMFMTTILENYQCDGAVMITA  115

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYA  1357
             SHLP+  NGLKFFTK+GG    ++ AI + A++  +     + +  +    + D ++ Y+
Sbjct  116   SHLPFYHNGLKFFTKEGGCEKEDIAAILENASQADS-----ICSERKGIVDEKDLIAEYS  170

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
             + L   I++ VN   +Y+ PLQG  IIV+AGNG+GGFF   VL+ LGADT GS  L PDG
Sbjct  171   ELLVHTIRKGVNSQQNYEKPLQGCHIIVDAGNGAGGFFAAKVLEPLGADTTGSQFLEPDG  230

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNH PNPE++ AM   +AAVL+  ADLG++FD DVDR+ +V  +G  IN + LIAL+S
Sbjct  231   TFPNHSPNPENQAAMDSLKAAVLKTKADLGIIFDADVDRAAIVSSNGVEINRNALIALLS  290

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
              IVL EHP + +VTD+ TS GL RFI  +GG+   ++ GY+NVI++   LN  G   HL 
Sbjct  291   VIVLDEHPQSVIVTDSITSTGLRRFIEEQGGRQRRFKRGYKNVINEAKRLNATGEPCHLA  350

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGH A KENYFLDDGAY++ KI+I+M  ++ +  E  I S+I+ L+ P E+ E+R+ 
Sbjct  351   IETSGHAACKENYFLDDGAYLIAKILIKMAMLRQDNKE--IQSVIETLQFPYESDEIRIP  408

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             +L +   A   AV  +E     +EK  + GW L       V+E             D   
Sbjct  409   ILDKDFRAGGAAV--LEDLEKQVEK--VKGWSL-------VAEN-----------YDGI-  445

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                +VS +E+  +GW  LR S+H P + +N++S++ GG ++M
Sbjct  446   ---RVSTDESSGNGWFMLRISLHEPLLVLNIESDVEGGIKNM  484



>ref|XP_009603701.1| PREDICTED: phosphoglucomutase-2 isoform X1 [Nicotiana tomentosiformis]
Length=611

 Score =   410 bits (1055),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 241/542 (44%), Positives = 328/542 (61%), Gaps = 50/542 (9%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E     +LQNGSD+RGVA+ G +G  + LT P  EAIA  F  W+    +S +       
Sbjct  84    EKNDFLKLQNGSDIRGVAVDGVEGEPLTLTEPVTEAIAAGFAGWLRKKYDSSK------C  137

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DAS  1552
             +RVS+G D RIS + L  AV  GL +AG  V   GLA+TPA F ST+    ++    D S
Sbjct  138   LRVSIGHDSRISAQKLQDAVSQGLARAGVEVIQYGLASTPAMFNSTLTVDEEFSCPVDGS  197

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKY---ANRMAK-VSTALRAPPS  1384
             IM+TASHLPY RNG KFFT+ GGL   +++ I ++AA  Y   AN  +K   TA+     
Sbjct  198   IMITASHLPYNRNGFKFFTRAGGLGKPDIKDILERAAEIYKNIANEYSKGAETAVSLSVK  257

Query  1383  KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  1204
             +VD+MS YA +L   ++    +    + PL+GF I+V+AGNG+GGFF   VL+ LGA T 
Sbjct  258   RVDYMSIYASNLVAAVRRAAGN---IEKPLEGFHIVVDAGNGAGGFFVGKVLEPLGAITS  314

Query  1203  GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPIN  1024
             GS  L PDG+FPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD SG   N
Sbjct  315   GSQFLEPDGLFPNHIPNPEDKTAMEAITKAVLDNRADLGIIFDTDVDRSAAVDSSGREFN  374

Query  1023  GDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHL  847
              +RLIALMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + L
Sbjct  375   RNRLIALMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRL  434

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKD  676
             N  G E HL +ETSGHGAL+EN++LDDGAY++VK++ ++   +  G   G   +  +++ 
Sbjct  435   NSVGEEAHLAIETSGHGALRENHWLDDGAYLMVKLLNKLASARTSGQGGGSKVLTDMVEG  494

Query  675   LEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLV  496
             LEEP    ELR+ +  +  H+  K      SFR Y              G+  + +  L 
Sbjct  495   LEEPAVAVELRLKI--DQNHSDLKG----GSFRVY--------------GEAVLKQ--LE  532

Query  495   DTNDHPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMAR  325
             +T D     DA + +A V+ E    +G  GW  LR S+H+P + +N+++        +A 
Sbjct  533   NTVDS----DAKLLKAPVNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEAPSNEAAVKLAH  588

Query  324   DL  319
             D+
Sbjct  589   DV  590



>ref|WP_014355257.1| phosphoglucomutase [Acetobacterium woodii]
 ref|YP_005268543.1| phosphoglucomutase Pgm2 [Acetobacterium woodii DSM 1030]
 gb|AFA47654.1| phosphoglucomutase Pgm2 [Acetobacterium woodii DSM 1030]
Length=494

 Score =   406 bits (1043),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 223/535 (42%), Positives = 326/535 (61%), Gaps = 52/535 (10%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E++ I++LQNGSDVRG+A +G  G +V+ T      IA SF  W    LE + G     +
Sbjct  2     EIKNIKKLQNGSDVRGIAQEGIAGETVNFTQDMAMKIAFSFATW----LEKKSGKT---A  54

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMT  1540
             +  ++G D R+SG++L+ AV  GL   G  V+  G+ATTPA FM+T+ P  Q D ++M+T
Sbjct  55    LTFAIGRDSRLSGENLAQAVALGLVSKGNKVYQCGIATTPAMFMTTLDPVIQADGAVMVT  114

Query  1539  ASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKV---DFM  1369
             ASHLP+ RNGLKFFT+ GGL   ++  I           +A+       P  K    DF+
Sbjct  115   ASHLPFNRNGLKFFTRDGGLDKADITEIL---------ALAETIETDFTPGGKTLTYDFL  165

Query  1368  SAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHL  1189
              +YA H+ +II+E+    T  + PL G  I+V+AGNG+GGFF   VL  LGA+T GSL+L
Sbjct  166   PSYANHIVNIIREK----TGKNQPLAGAAIVVDAGNGAGGFFVEQVLVPLGANTKGSLYL  221

Query  1188  NPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLI  1009
             +PDG FPNH+PNPED TA+     AVL + ADLG++FDTDVDR+ ++D  GN IN +  I
Sbjct  222   DPDGSFPNHVPNPEDATAIDHISRAVLNHHADLGIIFDTDVDRAAIIDEKGNAINRNGFI  281

Query  1008  ALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             A ++++VL ++PG+T+VTD+ TS GLT +I   GG+H  ++ GY+NVI++ + LN  G+E
Sbjct  282   AFIASMVLSDYPGSTIVTDSITSTGLTEYIESLGGKHHRFKRGYKNVINEAIQLNSQGIE  341

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAE  649
             THL METSGHGA+KENYFLDDGAY+V   +I+  ++   G    I S +K L+EP E  E
Sbjct  342   THLAMETSGHGAIKENYFLDDGAYLVTMALIKFAELHQVGKP--ISSFLKGLKEPAEAKE  399

Query  648   LRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAI  469
             +R  + ++   A  + V A   F+ +    N PGW              +V+ N      
Sbjct  400   IRFKIAADDFKAYGERVLA--EFKTF--AANQPGW-------------TIVNPN------  436

Query  468   DAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFL  304
                    ++S + +  +GW  LR S+H+P + +N++S+  GGC+ +   L+ +FL
Sbjct  437   ---YEGVRISCDTSAGNGWCLLRMSLHDPIMPLNIESDSVGGCEIIETVLK-QFL  487



>ref|XP_009781929.1| PREDICTED: phosphoglucomutase-2 isoform X1 [Nicotiana sylvestris]
Length=610

 Score =   409 bits (1051),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 246/564 (44%), Positives = 335/564 (59%), Gaps = 55/564 (10%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E     +LQNGSD+RGVA+ G +G  + LT P  EAIA  F  W+    +S +       
Sbjct  84    EKSDFLKLQNGSDIRGVAVDGVEGEPLTLTEPVTEAIAAGFAGWLKKKYDSSK------R  137

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DAS  1552
             +RVS+G D RIS + L  AV  GL +AG  V   GLA+TPA F ST+    ++    D S
Sbjct  138   LRVSIGHDSRISAQKLQDAVSQGLARAGVEVIQYGLASTPAMFNSTLTVDEEFSCPVDGS  197

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKY---ANRMAK-VSTALRAPPS  1384
             IM+TASHLPY RNG KFFT+ GGL   +++ I ++AA  Y   AN  +K   TA+     
Sbjct  198   IMITASHLPYNRNGFKFFTRAGGLGKPDIKDILERAAEIYKNIANEDSKGAETAVSLSVK  257

Query  1383  KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  1204
             +VD+MS YA +L   ++    +    + PL+GF I+V+AGNG+GGFF   VL+ LGA T 
Sbjct  258   RVDYMSIYASNLVAAVRRAAGN---IEKPLEGFHIVVDAGNGAGGFFVGKVLEPLGAITS  314

Query  1203  GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPIN  1024
             GS  L PDG+FPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD SG   N
Sbjct  315   GSQFLEPDGLFPNHIPNPEDKTAMKAITKAVLDNRADLGIIFDTDVDRSAAVDSSGREFN  374

Query  1023  GDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHL  847
              +RLIALMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + L
Sbjct  375   RNRLIALMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRL  434

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKD  676
             N  G E HL +ETSGHGALKEN++LDDGAY++VK++ ++   +  G   G   +  +++ 
Sbjct  435   NSVGEEAHLAIETSGHGALKENHWLDDGAYLMVKLLNKLASARTSGQGSGSKVLTDMVEG  494

Query  675   LEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLV  496
             LEEP    ELR+ + ++             SFR Y              G+  + +  L 
Sbjct  495   LEEPAVAVELRLKIDNQSDLIGG-------SFRDY--------------GEAVLKQ--LE  531

Query  495   DTNDHPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMAR  325
             +T D     DA + +A V+ E    +G  GW  LR S+H+P + +N+++        +A 
Sbjct  532   NTVDS----DAKLLKAPVNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEAPSNEAAVKLAH  587

Query  324   DLRDKFLLAGEMAKFLDISQIDEF  253
             D+    L A +    LD S + +F
Sbjct  588   DV----LNAVKEFTALDTSALTKF  607



>ref|WP_013378931.1| phosphoglucomutase [Eubacterium limosum]
 ref|YP_003958572.1| Phosphoglucomutase/phosphomannomutase C terminal:Phosphoglucomutase/phosphomannomutase 
alpha/beta/alpha domain I:Phosphoglucomutase/phosphomannomutase 
alpha/beta/alpha domain II:Phosphoglucomutase/phosphomannomutase 
alpha/beta/alpha domain III 
[Eubacterium limosum KIST612]
 gb|ADO35609.1| Phosphoglucomutase/phosphomannomutase C terminal:Phosphoglucomutase/phosphomannomutase 
alpha/beta/alpha domain I:Phosphoglucomutase/phosphomannomutase 
alpha/beta/alpha domain II:Phosphoglucomutase/phosphomannomutase 
alpha/beta/alpha domain III 
[Eubacterium limosum KIST612]
Length=494

 Score =   405 bits (1040),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 221/525 (42%), Positives = 327/525 (62%), Gaps = 49/525 (9%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E++ I +LQNGSD+RG+A++G +G S++LT      IA SF +W    L+++ G    +S
Sbjct  2     EIQNITKLQNGSDIRGIAMEGVEGESINLTQDMAMKIAYSFSKW----LKAKTGK---DS  54

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMT  1540
             + V++G D R++G +L+ AV  GL   G  V+D G+ATTPA FM+T+ P    D ++M+T
Sbjct  55    LSVAVGRDSRLTGPNLAQAVCLGLVSDGDHVYDCGIATTPAMFMTTLDPEMDCDGAVMIT  114

Query  1539  ASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVD--FMS  1366
             ASHLP+ RNG+K FTK GGL   ++  I ++A          + T  +    + D  F+ 
Sbjct  115   ASHLPFNRNGIKLFTKDGGLNKEDIAEILEQAE--------TIVTDFKIGGRREDYAFIP  166

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              YA ++  +I+E     T  +TPL+G +IIV+AGNG+GGFF   VL  LGADT GS  L+
Sbjct  167   RYAANIVAMIRE----ATGEETPLKGARIIVDAGNGAGGFFADGVLAPLGADTRGSQFLD  222

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDG FPNHIPNPED  A+     AV+ + AD+G++FDTDVDRS V+D  G+ IN +  IA
Sbjct  223   PDGHFPNHIPNPEDPDAIDAICQAVIDSKADMGIIFDTDVDRSAVIDEKGDAINRNGFIA  282

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVET  826
              +++++L+++PGTT+VTD+ TS GLT +I G GG H  ++ GY+NVI++ V LNE GV+T
Sbjct  283   FIASMLLEKYPGTTIVTDSVTSTGLTEYIEGLGGHHHRFKRGYKNVINEAVRLNEHGVKT  342

Query  825   HLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAEL  646
             HL METSGHGA++ENYFLDDGAY+V   +I+  ++  EG    +   +KDL+EP E  E 
Sbjct  343   HLAMETSGHGAIRENYFLDDGAYLVTMALIKFAQLHREGKP--LSVFLKDLKEPAEAREY  400

Query  645   RMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAID  466
             R  + +E   A  +  E ++ FR + E+   PGW              +V+ N     +D
Sbjct  401   RFKITAEDFRAYGQ--EVLDGFRKFAEE--QPGW-------------TIVEPNFEGIRVD  443

Query  465   AFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                        E+  +GW  +R S+H+P I +N++S+  GGC+ +
Sbjct  444   C---------GEDAGNGWCLMRMSLHDPIIPLNIESDEVGGCEKI  479



>ref|XP_002871771.1| phosphoglucosamine mutase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH48030.1| phosphoglucosamine mutase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=581

 Score =   408 bits (1048),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 242/559 (43%), Positives = 333/559 (60%), Gaps = 50/559 (9%)
 Frame = -1

Query  1986  AQSFPKIKLSLRVESSLTANKHNEVAVDEEMEK--IRRLQNGSDVRGVALQGEKGRSVDL  1813
             A SF K +  L  + +   N  +       ++K    +L+NGSD+RGVA+ G +G SV L
Sbjct  22    AHSFSKYQTVLSKQRTFYCNAASSSVTVPSLDKTDFLKLKNGSDIRGVAVPGVEGESVSL  81

Query  1812  TPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGC  1633
               P  EAIA +FG+W++   ++E        +RVS+G D RIS ++L  AV  GLG +G 
Sbjct  82    PEPVTEAIAAAFGQWLLHKKKAES-----RRLRVSVGHDSRISAQTLLEAVSRGLGVSGL  136

Query  1632  LVFDMGLATTPACFMSTVLPPFQY----DASIMMTASHLPYTRNGLKFFTKKGGLTSTEV  1465
              V   GLA+TPA F ST+     +    D +IM+TASHLPY RNG KFFT  GGL   ++
Sbjct  137   DVVQFGLASTPAMFNSTLTDDETFLCPADGAIMITASHLPYNRNGFKFFTSDGGLGKVDI  196

Query  1464  EAICDKAARKYAN---RMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPL  1294
             + I ++AA  Y N      + S    +  +KVD+MS Y   L   ++         + PL
Sbjct  197   KNILERAADIYKNLSDENLRKSQRESSSITKVDYMSVYTSGLVKAVRRAAGD---LEKPL  253

Query  1293  QGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAA  1114
             +GF I+V+AGNG+GGFF   VL+ LGA T GS  L PDGMFPNHIPNPEDK+AM     A
Sbjct  254   EGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLEPDGMFPNHIPNPEDKSAMEAITKA  313

Query  1113  VLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMG  934
             VL N ADLG++FDTDVDRS  VD +G   N +RLIAL+SAIVL+EHPGTT+VTD+ TS G
Sbjct  314   VLNNKADLGIIFDTDVDRSAAVDSTGREFNRNRLIALLSAIVLEEHPGTTIVTDSVTSDG  373

Query  933   LTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAY  757
             LT FI  + GG+H  ++ GY+NVID+ + LN  G E+HL +ETSGHGALKEN++LDDGAY
Sbjct  374   LTSFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEESHLAIETSGHGALKENHWLDDGAY  433

Query  756   MVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIE  586
             ++VKI+ ++   +  G   G   +  L++ LEEP    ELR+ +  +  H   K  +   
Sbjct  434   LMVKILNKLAAARAAGQGSGSKVLTDLVEGLEEPKVALELRLKI--DKNHPDLKGSD---  488

Query  585   SFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEE---NGEHG  415
              FR Y EK       L    +        ++TN +       + RA V+ E    +G  G
Sbjct  489   -FREYGEK------VLQHVSNS-------IETNPN-------LKRAPVNYEGIRVSGFGG  527

Query  414   WVHLRQSIHNPNIAVNLQS  358
             W  LR S+H+P + +N+++
Sbjct  528   WFLLRLSLHDPVLPLNIEA  546



>ref|XP_009126193.1| PREDICTED: phosphoglucomutase-2 isoform X2 [Brassica rapa]
Length=540

 Score =   406 bits (1043),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 236/520 (45%), Positives = 318/520 (61%), Gaps = 45/520 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V L  P  EAIA +FG+W++      +  A  + +RVS+G
Sbjct  20    KLQNGSDIRGVAVPGVEGEPVSLPEPVTEAIAAAFGQWLL-----HKKNAGSQKLRVSVG  74

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS  +L  AV  GLG +G  V   GLA+TPA F ST+     +    D +IM+TAS
Sbjct  75    HDSRISAPTLLEAVSRGLGVSGVDVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITAS  134

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPS--KVDFMSAY  1360
             HLPY RNG KFFT +GGL   +++ I ++AA  Y N   +  T  +   S  KVD+M+ Y
Sbjct  135   HLPYNRNGFKFFTSEGGLGKVDIKNILERAADIYQNLSDENHTKSQREVSIKKVDYMAVY  194

Query  1359  AKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPD  1180
                L + +++        + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L PD
Sbjct  195   TSGLVNAVRKAAGG---LEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLEPD  251

Query  1179  GMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALM  1000
             GMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD SG   N +RLIAL+
Sbjct  252   GMFPNHIPNPEDKTAMQAITKAVLDNKADLGIIFDTDVDRSAAVDSSGREFNRNRLIALL  311

Query  999   SAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETH  823
             SAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G ETH
Sbjct  312   SAIVLEEHPGTTIVTDSVTSDGLTSFIEKKLGGKHHRFKRGYKNVIDEAIRLNSTGEETH  371

Query  822   LMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGS-----LIKDLEEPLE  658
             L +ETSGHGALKEN++LDDGAY++VKI+ ++   +  G  EG GS     L++ L+EP  
Sbjct  372   LAIETSGHGALKENHWLDDGAYLMVKILNKLASARAAG--EGSGSKVLTDLVEGLDEPKV  429

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
               ELR+ +  +  H+  +       FR Y E                VS     + N   
Sbjct  430   ALELRLKI--DKNHSDLEG----RDFREYGE-----------TVLQQVSNSIETNPNLKK  472

Query  477   AAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQS  358
             A+++    R       +G  GW  LR S+H+P + +N+++
Sbjct  473   ASVNYEGIRV------SGFGGWFLLRLSLHDPVLPLNIEA  506



>ref|XP_004237080.1| PREDICTED: uncharacterized protein LOC101259144 isoform X3 [Solanum 
lycopersicum]
Length=543

 Score =   406 bits (1043),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 237/542 (44%), Positives = 325/542 (60%), Gaps = 48/542 (9%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E     +LQNGSD+RGVA+ G +G  + LT    EAIA  F  W+++    ++     + 
Sbjct  14    EKSNFLKLQNGSDIRGVAIDGVEGEPLTLTETVTEAIAAGFSGWLLA----KKKNVSSKC  69

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DAS  1552
             +RVS+G D RIS + L  AV  GL +AG  V   GLA+TPA F ST+    ++    D S
Sbjct  70    LRVSVGHDSRISAQKLQDAVSRGLARAGVEVIQYGLASTPAMFNSTLTENEEFSCPVDGS  129

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKY---ANRMAK-VSTALRAPPS  1384
             IM+TASHLPY RNG KFFT  GGL   +++ I ++AA  Y   AN  +K   TA      
Sbjct  130   IMITASHLPYNRNGFKFFTSAGGLGKPDIKDILERAADIYKNIANENSKGAETAASLDVK  189

Query  1383  KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  1204
             +VD+MS YA +L   +++        + PL+GF IIV+AGNG+GGFF   VL+ LGA T 
Sbjct  190   RVDYMSVYASNLVAAVRKAAGS---IEKPLEGFHIIVDAGNGAGGFFVGKVLEPLGAITS  246

Query  1203  GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPIN  1024
             GS  L PDG+FPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD SG   N
Sbjct  247   GSQFLEPDGLFPNHIPNPEDKTAMKAITKAVLDNRADLGIIFDTDVDRSAAVDSSGREFN  306

Query  1023  GDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHL  847
              +RLIALMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + L
Sbjct  307   RNRLIALMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRL  366

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMK---LEGSEEGIGSLIKD  676
             N  G E HL +ETSGHGALKEN++LDDGAY++VK++ ++   +   L G  + +  +++ 
Sbjct  367   NSVGEEAHLAIETSGHGALKENHWLDDGAYLMVKLLNKLASARTSGLGGGSKVLTDMVEG  426

Query  675   LEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLV  496
             LEEP    ELR+ +  +  H   +      SFR Y E                     ++
Sbjct  427   LEEPAVAVELRLKI--DQNHPDLQG----GSFRDYGE--------------------AVL  460

Query  495   DTNDHPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMAR  325
                ++   +DA + +A V+ E    +G  GW  LR S+H+P + +N+++        +A 
Sbjct  461   KQLENTVELDAKLLKAPVNYEGVRVSGFGGWFLLRLSLHDPVLPLNIEAPSKEDAVKLAH  520

Query  324   DL  319
             D+
Sbjct  521   DV  522



>gb|ERK28959.1| phosphomannomutase [Clostridium intestinale URNW]
Length=506

 Score =   404 bits (1039),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 222/523 (42%), Positives = 324/523 (62%), Gaps = 45/523 (9%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             +++L+NG+D+RG+A++ E+ +   L+P  V+ +   F +++ +   ++      ++++V+
Sbjct  17    LKKLKNGTDIRGIAIETEEYKET-LSPEIVKLLGVGFAKFLKNKSNNK------DNIKVA  69

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHL  1528
             LGMD R+SG SL +A+   L + G  V D G+ TTP+ FM+TVL  ++ D SIM+TASHL
Sbjct  70    LGMDSRLSGPSLKSALTEYLTKVGVNVDDCGITTTPSMFMTTVLEDYKCDGSIMITASHL  129

Query  1527  PYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
             PY  NGLKFFT  GG    +++ I + A     + +  VS   +   S++D +  Y+K L
Sbjct  130   PYYYNGLKFFTPLGGCEKEDIDEIINLALEDNEDYIV-VS---QGTVSEIDLVKDYSKLL  185

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
              D    +V +    + PL G +IIV+AGNG+GGFF   VL +LGAD  GS  L+PDG FP
Sbjct  186   VD----KVRNAVGTEKPLAGSKIIVDAGNGAGGFFADKVLKELGADIEGSQFLDPDGTFP  241

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NHIPNPE+K AM   + AVL + ADLG++FDTDVDRS +V ++G  IN + LIAL+S+IV
Sbjct  242   NHIPNPENKEAMESIKNAVLNSKADLGIIFDTDVDRSAIVAKTGEEINKNALIALISSIV  301

Query  987   LKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             LKE+ G T+VTD+ TS GL  FIT  GG H  ++ GY+NVI++   LNE+G+ + L +ET
Sbjct  302   LKENEGATIVTDSITSTGLAEFITNLGGVHHRFKRGYKNVINEAKRLNEEGIVSPLAIET  361

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGH ALKENYFLDDGAY++VKI+IEM K+K EG +  I SLIKDL+ PLET E R+ +  
Sbjct  362   SGHAALKENYFLDDGAYLIVKILIEMSKLKKEGKD--IDSLIKDLKHPLETEEKRIKIKC  419

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             E      ++V  IE  +  +    + GW ++      +   CL                 
Sbjct  420   EDFRPYGQSV--IEDLKESV--STIEGWSIEPKNYEGIKINCL-----------------  458

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
                     E GW  LR S+H P +A+N++S++ GG + +   L
Sbjct  459   -------KEQGWFLLRLSLHEPLLALNIESDLTGGAKDIYSKL  494



>ref|XP_010319499.1| PREDICTED: uncharacterized protein LOC101259144 isoform X2 [Solanum 
lycopersicum]
Length=558

 Score =   406 bits (1043),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 243/564 (43%), Positives = 334/564 (59%), Gaps = 52/564 (9%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E     +LQNGSD+RGVA+ G +G  + LT    EAIA  F  W+++    ++     + 
Sbjct  29    EKSNFLKLQNGSDIRGVAIDGVEGEPLTLTETVTEAIAAGFSGWLLA----KKKNVSSKC  84

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DAS  1552
             +RVS+G D RIS + L  AV  GL +AG  V   GLA+TPA F ST+    ++    D S
Sbjct  85    LRVSVGHDSRISAQKLQDAVSRGLARAGVEVIQYGLASTPAMFNSTLTENEEFSCPVDGS  144

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKY---ANRMAK-VSTALRAPPS  1384
             IM+TASHLPY RNG KFFT  GGL   +++ I ++AA  Y   AN  +K   TA      
Sbjct  145   IMITASHLPYNRNGFKFFTSAGGLGKPDIKDILERAADIYKNIANENSKGAETAASLDVK  204

Query  1383  KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  1204
             +VD+MS YA +L   +++        + PL+GF IIV+AGNG+GGFF   VL+ LGA T 
Sbjct  205   RVDYMSVYASNLVAAVRKAAGS---IEKPLEGFHIIVDAGNGAGGFFVGKVLEPLGAITS  261

Query  1203  GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPIN  1024
             GS  L PDG+FPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD SG   N
Sbjct  262   GSQFLEPDGLFPNHIPNPEDKTAMKAITKAVLDNRADLGIIFDTDVDRSAAVDSSGREFN  321

Query  1023  GDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHL  847
              +RLIALMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + L
Sbjct  322   RNRLIALMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRL  381

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMK---LEGSEEGIGSLIKD  676
             N  G E HL +ETSGHGALKEN++LDDGAY++VK++ ++   +   L G  + +  +++ 
Sbjct  382   NSVGEEAHLAIETSGHGALKENHWLDDGAYLMVKLLNKLASARTSGLGGGSKVLTDMVEG  441

Query  675   LEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLV  496
             LEEP    ELR+ +  +  H   +      SFR Y E                     ++
Sbjct  442   LEEPAVAVELRLKI--DQNHPDLQG----GSFRDYGE--------------------AVL  475

Query  495   DTNDHPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMAR  325
                ++   +DA + +A V+ E    +G  GW  LR S+H+P + +N+++        +A 
Sbjct  476   KQLENTVELDAKLLKAPVNYEGVRVSGFGGWFLLRLSLHDPVLPLNIEAPSKEDAVKLAH  535

Query  324   DLRDKFLLAGEMAKFLDISQIDEF  253
             D+    L A +    LD S + +F
Sbjct  536   DV----LNAVKEFTALDTSALTKF  555



>ref|WP_014709779.1| phosphoglucomutase [Prevotella intermedia]
 ref|YP_006299138.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
I [Prevotella intermedia 17]
 gb|AFJ08236.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
I [Prevotella intermedia 17]
Length=494

 Score =   403 bits (1036),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 227/518 (44%), Positives = 319/518 (62%), Gaps = 43/518 (8%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G +G SV+LT     A+A++F  W+      E+ G   +++ V  
Sbjct  4     KKLQNGSDIRGVALEGIEGESVNLTNEVTTALAQAFVAWL-----GEKNGKTAQTIAV--  56

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D RIS  +L  A   G    G  V   G+A+TPA FM+TV      D ++M+TASHLP
Sbjct  57    GSDSRISSPALLQAFANGAAAGGATVLSFGMASTPAMFMATVDEQLNADGAVMITASHLP  116

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNGLKFFT KGGL   ++  I + A  ++     K +  ++A    VDFM+ Y   L 
Sbjct  117   WNRNGLKFFTAKGGLEKADIARILELAP-QFMGAEKKGNGEVKA----VDFMATYCNILA  171

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             + I+  VN+    D PL+G +IIV+AGNG+GGFF   VL+ LGADT GS  L PDG FPN
Sbjct  172   NYIRRGVNNG---DQPLKGMRIIVDAGNGAGGFFATKVLNPLGADTTGSQFLEPDGHFPN  228

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNPE+K AM     AV+ N ADLG++FDTDVDRS +VDR+G  IN + LIAL++A++L
Sbjct  229   HIPNPENKEAMTSICKAVVDNKADLGIIFDTDVDRSAIVDRTGKSINRNALIALIAAVIL  288

Query  984   KEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             +EHP +T+VTD+ TS GL +FI  R G+H  +R GY+NVI++ + LNE+G E+ L +ETS
Sbjct  289   REHPESTIVTDSVTSDGLAKFIADRNGKHHRFRRGYKNVINESLRLNENGEESWLAIETS  348

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH AL+ENYFLDDGAY+V K+IIE   ++ EG E  +  LI DL++P+E+ E+R  + ++
Sbjct  349   GHAALRENYFLDDGAYLVAKLIIEAACLRKEGKE--LQDLIADLQQPVESKEIRFKIHTD  406

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                 K    + +E  +   EK +   W+L S       EG  +   D             
Sbjct  407   --DFKIYGEQVLEHIKAAAEKEH--DWQLVSPN----YEGVRIACTDEK-----------  447

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                    E GW  LRQS+H+P + +N++SN+  G   +
Sbjct  448   -------EQGWFLLRQSLHDPVLPLNIESNVEDGVNRI  478



>ref|XP_006363536.1| PREDICTED: uncharacterized protein LOC102592762 isoform X2 [Solanum 
tuberosum]
Length=543

 Score =   405 bits (1040),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 235/542 (43%), Positives = 326/542 (60%), Gaps = 48/542 (9%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E     +LQNGSD+RGVA+ G +G  + LT    EAIA  F  W+++    ++     + 
Sbjct  14    EKSNFLKLQNGSDIRGVAVDGVEGEPLTLTETVTEAIAAGFSGWLLA----KKKNVSSKC  69

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DAS  1552
             +RVS+G D RIS + L  AV  GL +AG  V   GLA+TPA F ST+    ++    D S
Sbjct  70    LRVSIGHDSRISAQKLQDAVSRGLARAGVEVIQYGLASTPAMFNSTLTENEEFSCPVDGS  129

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKY---ANRMAK-VSTALRAPPS  1384
             IM+TASHLPY RNG KFFT  GGL   +++ I ++AA  Y   AN  +K   TA      
Sbjct  130   IMITASHLPYNRNGFKFFTSAGGLGKPDIKDILERAADIYKNIANDDSKGAETAASLDVK  189

Query  1383  KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  1204
             +VD+MS YA +L   +++   +    + PL+GF I+V+AGNG+GGFF   VL+ LGA T 
Sbjct  190   RVDYMSVYASNLVAAVRKAAGN---IEKPLEGFHIVVDAGNGAGGFFVGKVLEPLGAITS  246

Query  1203  GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPIN  1024
             GS  L PDG+FPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD SG   N
Sbjct  247   GSQFLEPDGLFPNHIPNPEDKTAMKAITKAVLDNRADLGIIFDTDVDRSAAVDSSGREFN  306

Query  1023  GDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHL  847
              +RLIALMSAI+L+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + L
Sbjct  307   RNRLIALMSAIILEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRL  366

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMK---LEGSEEGIGSLIKD  676
             N  G E HL +ETSGHGALKEN++LDDGAY++VK++ ++   +   L G  + +  +++ 
Sbjct  367   NSVGEEAHLAIETSGHGALKENHWLDDGAYLMVKLLNKLASARTSGLGGGSKVLTDMVEG  426

Query  675   LEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLV  496
             LEEP    ELR+ +  +  H   +      SFR Y E                     ++
Sbjct  427   LEEPAVAVELRLKI--DQNHPDLQG----GSFRDYGE--------------------AVL  460

Query  495   DTNDHPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMAR  325
                ++   +DA + +A V+ E    +G  GW  LR S+H+P + +N+++        +A 
Sbjct  461   KQLENTVELDAKLLKAPVNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEAPSKEDAVKLAH  520

Query  324   DL  319
             D+
Sbjct  521   DV  522



>ref|XP_007515616.1| phosphoglucomutase/phosphomannomutase family protein [Bathycoccus 
prasinos]
 emb|CCO14495.1| phosphoglucomutase/phosphomannomutase family protein [Bathycoccus 
prasinos]
Length=581

 Score =   406 bits (1043),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 238/545 (44%), Positives = 326/545 (60%), Gaps = 42/545 (8%)
 Frame = -1

Query  1893  EKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVR  1714
             E ++RLQNGSDVRGVAL G +   + +TP +V  +  +F +W+    E+E+         
Sbjct  67    ESLKRLQNGSDVRGVALAGVENEPITITPESVFCLGCAFVDWL---RETEKC-TNNPMCT  122

Query  1713  VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV----LPPFQYDASIM  1546
             V +G DPR+SG SL  A   G+   G +  D  L+TTPACF +TV    L P  Y+  +M
Sbjct  123   VGIGRDPRLSGPSLKDAFARGVQFKGGVAIDCELSTTPACFFATVSNRELGP-AYEGCVM  181

Query  1545  MTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMS  1366
             +TASHLP+ RNG+KFFTK GGL   +V  +C++AA   A    +++    A      ++ 
Sbjct  182   LTASHLPFNRNGIKFFTKDGGLDKKDVGFMCERAAEYIAEAEKEMAKGGEAKIESRPYID  241

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y+  LRD I + +N  T  + PL+GF+I+V+AGNGSGGFF   VL+ LGAD  GS  L+
Sbjct  242   KYSSILRDKIIKGINDGT--NEPLKGFKIVVDAGNGSGGFFATKVLEPLGADCTGSQFLD  299

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNH PNPE+K AM     AVL + ADLG+VFDTDVDRS V+D  G  IN ++LIA
Sbjct  300   PDGMFPNHAPNPEEKEAMESATKAVLASKADLGIVFDTDVDRSAVIDSFGKEINRNKLIA  359

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVET  826
             ++S I L++ PG+T+VTD+ TS GL  FI  +GG H  Y  GY+NVI+KG+ LN  G+  
Sbjct  360   VLSHIALQKEPGSTIVTDSVTSSGLKTFIESKGGIHLRYMRGYKNVINKGIELNSKGINA  419

Query  825   HLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAEL  646
              LM+ETSGHGA+KENY LDDGAY+ VKIIIE VK K      GIG +++ L+EPLE+ E+
Sbjct  420   PLMIETSGHGAMKENYNLDDGAYLAVKIIIEAVKRK-NAGGGGIGEILESLKEPLESLEV  478

Query  645   RMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAID  466
             R+ + + P   K  + + IE F+  IE G                E   V   ++   I 
Sbjct  479   RLKI-ANPEFKKVGS-DVIEQFKQAIESGYF--------------EPNFVCAKENFEGIR  522

Query  465   AFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMA  286
             A          E+   GW  LR S+H+P + +N++S+  GG +  A  +   F    E  
Sbjct  523   A----------ESEAKGWFLLRSSLHDPVMVLNIESDEEGGVKKYAEQIVKWF----EEK  568

Query  285   KFLDI  271
             KF D+
Sbjct  569   KFADV  573



>ref|WP_023973691.1| phosphoglucomutase [Clostridium pasteurianum]
 gb|ETD71073.1| phosphoglucomutase [Clostridium pasteurianum NRRL B-598]
Length=511

 Score =   404 bits (1037),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 215/516 (42%), Positives = 323/516 (63%), Gaps = 45/516 (9%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             +++++RLQ+G+D+RG+A++ E  +  +LTP  V  +   F EW+      +  G   +++
Sbjct  2     LQELKRLQSGTDIRGIAIEHEGTK--NLTPNLVNNVGFGFVEWL-----KKTKGLSNKNI  54

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
             ++++GMD R+SG  L  ++   L  +GC V+D G+ TTPA FM+T+L  +  D ++M+TA
Sbjct  55    KIAVGMDSRLSGPELKKSLIEALVDSGCNVYDCGICTTPAMFMTTILENYSCDGAVMITA  114

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAI--CDKAARKYANRMAKVSTALRAPPSKVDFMSA  1363
             SHLPY  NGLKFFTK+GG    ++E I  C   A K       V T        + F+  
Sbjct  115   SHLPYYYNGLKFFTKEGGGEKEDIEDIIECSNLAEKKCITKGLVET--------IYFIDV  166

Query  1362  YAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNP  1183
             Y+  L D I++ VN  T+Y+ PL+G +IIV+AGNG+GGFF + VL+KLGA   GS    P
Sbjct  167   YSNILVDKIRKNVNSKTNYERPLEGTKIIVDAGNGAGGFFAYKVLEKLGASVEGSQFTEP  226

Query  1182  DGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIAL  1003
             DG FPNHIPNPE++ AM   + AVL N ADLG++FDTDVDR+ +V   G  IN + LIAL
Sbjct  227   DGNFPNHIPNPENEEAMNSIKEAVLNNKADLGIIFDTDVDRAAIVSSDGKEINKNALIAL  286

Query  1002  MSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETH  823
             +S+IVL+E+P + +VTD+ TS GL+ FIT  GG H  ++ GY+NVI++   LN++G  + 
Sbjct  287   ISSIVLEENPNSIIVTDSVTSTGLSDFITSLGGIHHRFKRGYKNVINESKRLNKEGKLSC  346

Query  822   LMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELR  643
             L +ETSGH ALKENYFLDDGAY++ KI+I+M K+K EG E  I SLI++L+ P E+ ++R
Sbjct  347   LAIETSGHAALKENYFLDDGAYLIAKILIKMAKLKDEGKE--ISSLIENLKYPKESMDMR  404

Query  642   MDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDA  463
             +++  E   +  + +  IE  + Y +  N  GW ++      +   C             
Sbjct  405   INIKREDFKSYGEMI--IEGLKKYADHVN--GWTIEPKNYEGIKINC-------------  447

Query  462   FMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSN  355
                     ++ENG+ GW+ LR S+H P + +N++S+
Sbjct  448   --------DKENGD-GWLLLRLSLHEPVLPLNIESD  474



>ref|WP_039312073.1| phosphoglucomutase [Clostridium baratii]
 gb|AIY83063.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
II family protein [Clostridium baratii str. Sullivan]
Length=495

 Score =   403 bits (1035),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 218/522 (42%), Positives = 323/522 (62%), Gaps = 42/522 (8%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             ME++  L+NG+D+RGV+L+  K R V+LT   V  I++ F EW+   L +++G    +++
Sbjct  1     MERLHELKNGTDIRGVSLEN-KERPVNLTVNEVRLISKGFYEWL---LNNKKG----KNL  52

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
             +V++G D R+SG+     V   L   G  V+D  +ATTPA FM+TV+  +  D +IM+TA
Sbjct  53    KVAIGCDSRLSGECFKKEVINTLLAYGAKVYDCNMATTPAMFMTTVMDDYDCDGAIMITA  112

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYA  1357
             SHLPY  NGLKFFTK GG+   +++ I + +              +R        +  Y+
Sbjct  113   SHLPYYYNGLKFFTKDGGVDKKDIDEIINFSINNSLKESNDGKLEIRR------LIDDYS  166

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
             K L D I+  V+   +Y  PL+G  IIV+AGNGSGGFF   VL++LGA T GS  LNPDG
Sbjct  167   KILVDKIRLAVDSKKNYKKPLEGLNIIVDAGNGSGGFFANKVLEELGASTKGSQFLNPDG  226

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNHIPNPE+K A+     AV++N +DLG++FDTDVDR+ +VD+ GNPIN D LIAL+S
Sbjct  227   NFPNHIPNPENKEAIESICQAVIKNKSDLGIIFDTDVDRAAIVDKYGNPINKDALIALIS  286

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
              I+L E+PG+ +VTD+ T+ GL+RFI   GG+H  ++ GY+NVI++G+ LN +  E HL 
Sbjct  287   VIILNEYPGSAIVTDSITTDGLSRFIERLGGKHHRFKRGYKNVINEGIRLNGENEECHLA  346

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGH A+KENYFLDDGA++V KI++ + K+   G +  IG LIK+LEEPLE+ E R++
Sbjct  347   IETSGHAAIKENYFLDDGAFLVSKILVYVAKLAERGKD--IGELIKELEEPLESIEYRIN  404

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             +  E             ++R + E            G     E C+ ++N+       + 
Sbjct  405   IDRE-------------NYRDFGE------------GILKDLEECIKNSNEFKLPEKNYE  439

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                +V  +    +GW  LR S+H P +A+N+QS++  G +++
Sbjct  440   -GVRVICDSPKHNGWFLLRLSLHEPLLALNIQSDVENGVKNI  480



>ref|WP_027471315.1| phosphoglucomutase [Cytophaga fermentans]
 dbj|GAF01972.1| phosphomannomutase/phosphoglucomutase [Cytophaga fermentans DSM 
9555 = JCM 21142]
Length=506

 Score =   402 bits (1034),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 223/544 (41%), Positives = 326/544 (60%), Gaps = 47/544 (9%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVA+ G  G  ++LT    E +  +F  W+       +      ++ V++
Sbjct  8     KKLQNGSDIRGVAMDGIPGEEINLTCQVAEKLGRAFAHWL-----HHKTNLSTLTLTVAV  62

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R++G SL  A   GL   G  V+D G+A+TPA FM+TV   +  DA +M+TASHLP
Sbjct  63    GTDSRLTGPSLKKAFVQGLVHVGVDVYDCGIASTPAMFMATVDEDYCIDAGVMLTASHLP  122

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             + RNG KFFT +GG   +++  I   AAR + N +++          ++D++S Y+ HL 
Sbjct  123   FNRNGFKFFTPEGGANKSDITEILQWAARDHLNAISESGVV-----KELDYISTYSNHLV  177

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               I+  V        PL+G +IIV+AGNG+GGFF   VL+KLGADT GS  L+PDG FPN
Sbjct  178   HRIRSGVQSKVDKVQPLKGLKIIVDAGNGAGGFFAKKVLEKLGADTNGSQFLDPDGNFPN  237

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             H+PNPED+ AM     AV++  ADLG++FDTDVDRS +VD+ GN I+ + LIAL+SAIVL
Sbjct  238   HVPNPEDEVAMKSISDAVIREKADLGIIFDTDVDRSAIVDKQGNSIHRNELIALISAIVL  297

Query  984   KEHPGTTVVTDARTSMGLTRFI-TGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             +EHPG+TVVTD+ TS GLT FI T   G+H  ++ GY+NVI++ + LN  G E+ L +ET
Sbjct  298   EEHPGSTVVTDSITSDGLTWFIQTHLKGKHKRFKRGYKNVINESLRLNTAGEESWLAIET  357

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGH ALKENYFLDDGA++V K++++M  ++L   E  +  LI +L +P+E+ E R+ + +
Sbjct  358   SGHAALKENYFLDDGAFLVAKLLMKMADLRLHNKE--LSQLINELPKPIESKEFRLKIKT  415

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             +   +  ++V A       +E      WE        VSE                 Y  
Sbjct  416   KDFISYGQSVIAA------LENNLSSDWEK-------VSEN----------------YEG  446

Query  447   -KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDI  271
              +V  +   E GW  LR S+H+P I +N++SN+ GG + +   L+       E+   LD+
Sbjct  447   IRVQCKHESEDGWFLLRLSLHDPVIPINIESNVRGGVEVIVSKLKHIL----ELYIHLDL  502

Query  270   SQID  259
             S ++
Sbjct  503   SPLN  506



>ref|WP_026475441.1| phosphoglucomutase [Alkaliflexus imshenetskii]
Length=511

 Score =   402 bits (1034),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 225/536 (42%), Positives = 318/536 (59%), Gaps = 59/536 (11%)
 Frame = -1

Query  1884  RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL  1705
             ++LQNGSD+RGVAL+G K   V+LTP  V  + ESF  W +S + + +      S+ +S+
Sbjct  7     KKLQNGSDIRGVALEGVKNEDVNLTPEVVARLGESFAGW-LSQINTGK------SLNISV  59

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             GMD R+SG  L  A+   L   G  VFD G+A+TPA FMSTV+   + D +IM+TASHLP
Sbjct  60    GMDSRLSGPVLRKALSDSLIACGVNVFDFGMASTPAMFMSTVMGQTKMDGAIMLTASHLP  119

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             Y RNGLK FT  G L   ++  + + A    + +     T      ++ +FM  YA    
Sbjct  120   YNRNGLKLFTANGSLEKNDITDLLNIAESSKSFKAQAQGTV-----TESNFMDEYANSFV  174

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
             ++I+++VNHP +Y+ PL+G +I+V+AGNG+GGF+   VL  LGAD   S  LNPDG FPN
Sbjct  175   EMIRKQVNHPDNYEQPLKGLKIVVDAGNGAGGFYATKVLQPLGADISDSQFLNPDGRFPN  234

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             H+PNPED  AMA     V ++ ADLG++FDTDVDR+ +V   G+PIN ++LIAL+SA+VL
Sbjct  235   HVPNPEDAVAMASVVYRVKESKADLGIIFDTDVDRAALVGADGSPINRNKLIALISAVVL  294

Query  984   KEHPGTTVVTDARTSMGLTRFITG-RGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             +EHPGTTVVTD+ TS GL  FI     G+H  ++ GY+NVI++ + LN +G    L +ET
Sbjct  295   EEHPGTTVVTDSITSNGLGWFINDFLKGKHRRFKRGYKNVINEAIRLNSEGEACWLAIET  354

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGH ALKEN+F+DDGAY+V K+II M K+  +G  E + SLI +L  P ++ E+R+++  
Sbjct  355   SGHAALKENHFMDDGAYLVTKLIITMAKLNRKG--EKLSSLIDNLPLPNKSCEIRIEIKD  412

Query  627   EPRHAKAKAVEAIESFRHYIEK---------GNLPGWELDSCGDCWVSEGCLVDTNDHPA  475
                            F+ Y EK         GN PGW++       V   C     D P 
Sbjct  413   -------------SDFKAYGEKVIMDLGLLAGNKPGWDIAPDNFEGVRINC-----DLPQ  454

Query  474   AIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                              + GW  LR S+H+P I +N++S++ GG + +   L   F
Sbjct  455   -----------------QKGWFLLRLSLHDPVIPLNIESDVEGGLEDIIAHLTTFF  493



>ref|XP_010658403.1| PREDICTED: uncharacterized protein LOC100244432 isoform X4 [Vitis 
vinifera]
Length=544

 Score =   403 bits (1036),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 233/530 (44%), Positives = 326/530 (62%), Gaps = 50/530 (9%)
 Frame = -1

Query  1896  MEKIR--RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVE  1723
             +EK+   +LQNGSD+RGVA+ G +G  V LT P  EAIA +FG W+   LE ++      
Sbjct  13    LEKVDFLKLQNGSDIRGVAVAGVEGEPVTLTEPVTEAIAAAFGAWL---LEKKKADGS-R  68

Query  1722  SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DA  1555
              +RVS+G D RIS + L  AV  G+  AG  V   GLA+TPA F ST+    Q+    D 
Sbjct  69    RLRVSIGHDSRISAQKLQEAVSLGIASAGLEVVQYGLASTPAMFNSTLTEGEQFLCPADG  128

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAK--VSTALRAPPS-  1384
             SIM+TASHLPY RNG KFFT  GGL   +++ I ++AA  Y+N   +  V++  +A  S 
Sbjct  129   SIMITASHLPYNRNGFKFFTNAGGLGKADIKDILERAASIYSNFAVEGLVNSERKASVSI  188

Query  1383  -KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VD+M+ Y  +L + ++    +    + PL+G  I+V+AGNG+GGFF   VL+ LGA T
Sbjct  189   KRVDYMALYTSYLVEAVRRAAGN---IERPLEGLHIVVDAGNGAGGFFAEKVLEPLGAIT  245

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
              GS  L PDG+FPNHIPNPEDK AM     AVL N ADLG++FDTDVDRS  VD +G  +
Sbjct  246   TGSQFLEPDGLFPNHIPNPEDKEAMKAITQAVLANQADLGIIFDTDVDRSAAVDSTGREL  305

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVH  850
             N +RLIALMSAIVL++HPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + 
Sbjct  306   NRNRLIALMSAIVLEKHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIR  365

Query  849   LNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMK---LEGSEEGIGSLIK  679
             LN  G E+HL +ETSGHGALKEN++LDDGAY++VK++ ++   +   + G  E +  L++
Sbjct  366   LNSVGEESHLAIETSGHGALKENHWLDDGAYLMVKLLNKLASARASGIGGGSEVLTDLVE  425

Query  678   DLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCL  499
              L+EP    ELR+ +  +  H   K      SFR Y E                     +
Sbjct  426   GLQEPAAAVELRLKI--DKSHEDLKG----GSFREYGE--------------------AV  459

Query  498   VDTNDHPAAIDAFMYRAKVSNE---ENGEHGWVHLRQSIHNPNIAVNLQS  358
             +   ++    D  + +A V+ E    +G  GW  LR S+H+P + +N+++
Sbjct  460   LKLLENLTDSDPKLQKAPVNYEGVRASGFGGWFLLRLSLHDPVLPLNIEA  509



>ref|XP_009126192.1| PREDICTED: uncharacterized protein LOC103851114 isoform X1 [Brassica 
rapa]
Length=614

 Score =   405 bits (1042),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 236/520 (45%), Positives = 318/520 (61%), Gaps = 45/520 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V L  P  EAIA +FG+W++      +  A  + +RVS+G
Sbjct  94    KLQNGSDIRGVAVPGVEGEPVSLPEPVTEAIAAAFGQWLL-----HKKNAGSQKLRVSVG  148

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS  +L  AV  GLG +G  V   GLA+TPA F ST+     +    D +IM+TAS
Sbjct  149   HDSRISAPTLLEAVSRGLGVSGVDVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITAS  208

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPS--KVDFMSAY  1360
             HLPY RNG KFFT +GGL   +++ I ++AA  Y N   +  T  +   S  KVD+M+ Y
Sbjct  209   HLPYNRNGFKFFTSEGGLGKVDIKNILERAADIYQNLSDENHTKSQREVSIKKVDYMAVY  268

Query  1359  AKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPD  1180
                L + +++        + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L PD
Sbjct  269   TSGLVNAVRKAAGG---LEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLEPD  325

Query  1179  GMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALM  1000
             GMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD SG   N +RLIAL+
Sbjct  326   GMFPNHIPNPEDKTAMQAITKAVLDNKADLGIIFDTDVDRSAAVDSSGREFNRNRLIALL  385

Query  999   SAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETH  823
             SAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G ETH
Sbjct  386   SAIVLEEHPGTTIVTDSVTSDGLTSFIEKKLGGKHHRFKRGYKNVIDEAIRLNSTGEETH  445

Query  822   LMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGS-----LIKDLEEPLE  658
             L +ETSGHGALKEN++LDDGAY++VKI+ ++   +  G  EG GS     L++ L+EP  
Sbjct  446   LAIETSGHGALKENHWLDDGAYLMVKILNKLASARAAG--EGSGSKVLTDLVEGLDEPKV  503

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
               ELR+ +  +  H+  +       FR Y E                VS     + N   
Sbjct  504   ALELRLKI--DKNHSDLEG----RDFREYGE-----------TVLQQVSNSIETNPNLKK  546

Query  477   AAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQS  358
             A+++    R       +G  GW  LR S+H+P + +N+++
Sbjct  547   ASVNYEGIRV------SGFGGWFLLRLSLHDPVLPLNIEA  580



>ref|XP_004237078.1| PREDICTED: uncharacterized protein LOC101259144 isoform X1 [Solanum 
lycopersicum]
Length=613

 Score =   405 bits (1042),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 243/564 (43%), Positives = 334/564 (59%), Gaps = 52/564 (9%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E     +LQNGSD+RGVA+ G +G  + LT    EAIA  F  W+++    ++     + 
Sbjct  84    EKSNFLKLQNGSDIRGVAIDGVEGEPLTLTETVTEAIAAGFSGWLLA----KKKNVSSKC  139

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DAS  1552
             +RVS+G D RIS + L  AV  GL +AG  V   GLA+TPA F ST+    ++    D S
Sbjct  140   LRVSVGHDSRISAQKLQDAVSRGLARAGVEVIQYGLASTPAMFNSTLTENEEFSCPVDGS  199

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKY---ANRMAK-VSTALRAPPS  1384
             IM+TASHLPY RNG KFFT  GGL   +++ I ++AA  Y   AN  +K   TA      
Sbjct  200   IMITASHLPYNRNGFKFFTSAGGLGKPDIKDILERAADIYKNIANENSKGAETAASLDVK  259

Query  1383  KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  1204
             +VD+MS YA +L   +++        + PL+GF IIV+AGNG+GGFF   VL+ LGA T 
Sbjct  260   RVDYMSVYASNLVAAVRKAAGS---IEKPLEGFHIIVDAGNGAGGFFVGKVLEPLGAITS  316

Query  1203  GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPIN  1024
             GS  L PDG+FPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD SG   N
Sbjct  317   GSQFLEPDGLFPNHIPNPEDKTAMKAITKAVLDNRADLGIIFDTDVDRSAAVDSSGREFN  376

Query  1023  GDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHL  847
              +RLIALMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + L
Sbjct  377   RNRLIALMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRL  436

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMK---LEGSEEGIGSLIKD  676
             N  G E HL +ETSGHGALKEN++LDDGAY++VK++ ++   +   L G  + +  +++ 
Sbjct  437   NSVGEEAHLAIETSGHGALKENHWLDDGAYLMVKLLNKLASARTSGLGGGSKVLTDMVEG  496

Query  675   LEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLV  496
             LEEP    ELR+ +  +  H   +      SFR Y E                     ++
Sbjct  497   LEEPAVAVELRLKI--DQNHPDLQG----GSFRDYGE--------------------AVL  530

Query  495   DTNDHPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMAR  325
                ++   +DA + +A V+ E    +G  GW  LR S+H+P + +N+++        +A 
Sbjct  531   KQLENTVELDAKLLKAPVNYEGVRVSGFGGWFLLRLSLHDPVLPLNIEAPSKEDAVKLAH  590

Query  324   DLRDKFLLAGEMAKFLDISQIDEF  253
             D+    L A +    LD S + +F
Sbjct  591   DV----LNAVKEFTALDTSALTKF  610



>emb|CDY55933.1| BnaC02g44120D [Brassica napus]
Length=613

 Score =   405 bits (1042),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 252/600 (42%), Positives = 348/600 (58%), Gaps = 58/600 (10%)
 Frame = -1

Query  1986  AQSFPK---IKLSLRVESSLTANKHNEVAVDEEMEK--IRRLQNGSDVRGVALQGEKGRS  1822
             A S PK      S+  ++S   N     A    ++K    +LQNGSD+RGVA+ G +G  
Sbjct  53    AHSLPKYYQTTTSISKQTSFYCNASLSSATVPSLDKTDFLKLQNGSDIRGVAVPGVEGEP  112

Query  1821  VDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQ  1642
             V L  P  EAIA +FG+W++      +  A    +RVS+G D RIS  +L  AV  GLG 
Sbjct  113   VSLPEPVTEAIAAAFGQWLL-----HKKNAGSRKLRVSVGHDSRISAPTLLEAVSRGLGV  167

Query  1641  AGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTASHLPYTRNGLKFFTKKGGLTS  1474
             +G  V   GLA+TPA F ST+     +    D +IM+TASHLPY RNG KFFT +GGL  
Sbjct  168   SGVDVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITASHLPYNRNGFKFFTSEGGLGK  227

Query  1473  TEVEAICDKAARKYANRMAKVSTALRAPPS--KVDFMSAYAKHLRDIIKERVNHPTHYDT  1300
              +++ I ++AA  Y N   +  T  +   S  KVD+M+ Y   L   +++        + 
Sbjct  228   VDIKNILERAADIYQNFSDENLTKSQREVSIKKVDYMAVYTSGLVKAVRKAAGD---LEK  284

Query  1299  PLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTR  1120
             PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L PDGMFPNHIPNPEDKTAM    
Sbjct  285   PLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLEPDGMFPNHIPNPEDKTAMQAIT  344

Query  1119  AAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTS  940
              AVL N ADLG++FDTDVDRS  VD SG   N +RLIAL+SAIVL+EHPGTT+VTD+ TS
Sbjct  345   KAVLDNKADLGIIFDTDVDRSAAVDSSGREFNRNRLIALLSAIVLEEHPGTTIVTDSVTS  404

Query  939   MGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDG  763
              GLT FI  + GG+H  ++ GY+NVID+ + LN  G E+HL +ETSGHGALKEN++LDDG
Sbjct  405   DGLTSFIEKKLGGKHHRFKRGYKNVIDEAIRLNSTGEESHLAIETSGHGALKENHWLDDG  464

Query  762   AYMVVKIIIEMVKMKLEGSEEGIGS-----LIKDLEEPLETAELRMDVLSEPRHAKAKAV  598
             AY++VKI+ ++   +  G  EG GS     L++ LEEP    ELR+ +  +  H+  +  
Sbjct  465   AYLMVKILNKLASARAAG--EGSGSKVLTDLVEGLEEPKVALELRLKI--DKNHSDLEG-  519

Query  597   EAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEH  418
                   R + E G +   +        VS     + N   A+++    R       +G  
Sbjct  520   ------RDFREYGEMVLQQ--------VSNSIETNPNLKKASVNYEGIRV------SGFG  559

Query  417   GWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKF--LDISQIDEFARN  244
             GW  LR S+H+P + +N+++      QS    ++   ++A  + +F  LD S +    R+
Sbjct  560   GWFLLRLSLHDPVLPLNIEA------QSEDDAVKLGLVVANAVKEFNALDTSALSSLTRS  613



>emb|CAC01897.1| phosphoglucomutase-like protein [Arabidopsis thaliana]
Length=570

 Score =   404 bits (1037),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 238/556 (43%), Positives = 330/556 (59%), Gaps = 44/556 (8%)
 Frame = -1

Query  1986  AQSFPKIKLSLRVESSLTANKHNEVAVDEEMEK--IRRLQNGSDVRGVALQGEKGRSVDL  1813
             A +  K +  L  + +   N  +  A    ++K    +LQNGSD+RGVA+ G +G  V L
Sbjct  11    AHTLSKYQFVLSKQRTFYCNATSSSATVPSLDKNDFLKLQNGSDIRGVAVTGVEGEPVSL  70

Query  1812  TPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGC  1633
               P  EAIA +FG+W++   ++E        +RVS+G D RIS ++L  AV  GLG +G 
Sbjct  71    PEPVTEAIAAAFGQWLLHKKKAES-----RRLRVSVGHDSRISAQTLLEAVSRGLGVSGL  125

Query  1632  LVFDMGLATTPACFMSTVLPPFQY----DASIMMTASHLPYTRNGLKFFTKKGGLTSTEV  1465
              V   GLA+TPA F ST+     +    D +IM+TASHLPY RNG KFFT  GGL   ++
Sbjct  126   DVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITASHLPYNRNGFKFFTSDGGLGKVDI  185

Query  1464  EAICDKAA---RKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPL  1294
             + I ++AA   +K ++   + S    +  +KVD+MS Y   L   +++        + PL
Sbjct  186   KNILERAADIYKKLSDENLRKSQRESSSITKVDYMSVYTSGLVKAVRKAAGD---LEKPL  242

Query  1293  QGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAA  1114
             +GF I+V+AGNG+GGFF   VL+ LGA T GS  L PDGMFPNHIPNPEDK AM     A
Sbjct  243   EGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLEPDGMFPNHIPNPEDKAAMEAITKA  302

Query  1113  VLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMG  934
             VL N ADLG++FDTDVDRS  VD SG   N +RLIAL+SAIVL+EHPGTT+VTD+ TS G
Sbjct  303   VLDNKADLGIIFDTDVDRSAAVDSSGREFNRNRLIALLSAIVLEEHPGTTIVTDSVTSDG  362

Query  933   LTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAY  757
             LT FI  + GG+H  ++ GY+NVID+ + LN  G E+HL +ETSGHGALKEN++LDDGAY
Sbjct  363   LTSFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEESHLAIETSGHGALKENHWLDDGAY  422

Query  756   MVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIE  586
             ++VKI+ ++   +  G   G   +  L++ LEEP    ELR+ +  +  H   +  +   
Sbjct  423   LMVKILNKLAAARAAGQGSGSKVLTDLVEGLEEPKVALELRLKI--DKNHPDLEGSD---  477

Query  585   SFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVH  406
              FR Y EK       L    +        ++TN +           +VS    G  GW  
Sbjct  478   -FREYGEK------VLQHVSNS-------IETNPNLIIAPVNYEGIRVS----GFGGWFL  519

Query  405   LRQSIHNPNIAVNLQS  358
             LR S+H+P + +N+++
Sbjct  520   LRLSLHDPVLPLNIEA  535



>ref|XP_006287303.1| hypothetical protein CARUB_v10000496mg [Capsella rubella]
 gb|EOA20201.1| hypothetical protein CARUB_v10000496mg [Capsella rubella]
Length=613

 Score =   405 bits (1041),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 242/561 (43%), Positives = 334/561 (60%), Gaps = 54/561 (10%)
 Frame = -1

Query  1986  AQSFPKIKLSLRVESSLTANKHNEVAVDEEMEKI--RRLQNGSDVRGVALQGEKGRSVDL  1813
             A SF K + ++  +++   N  +  A    ++KI   +LQNGSD+RGVA+ G +G  V L
Sbjct  55    AHSFSKYQSAIPKQTTFYCNAASSSATAPSLDKIDFMKLQNGSDIRGVAVPGVEGEPVSL  114

Query  1812  TPPAVEAIAESFGEWVI--SGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQA  1639
               P  EAIA +FG+W++    +ES R       +RVS+G D RIS ++L  AV  GLG +
Sbjct  115   PEPVTEAIAAAFGQWLLHKKKVESRR-------LRVSVGHDSRISAQTLLEAVSRGLGVS  167

Query  1638  GCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTASHLPYTRNGLKFFTKKGGLTST  1471
             G  V   GLA+TPA F ST+     +    D +IM+TASHLPY RNG KFFT  GGL   
Sbjct  168   GLDVVQFGLASTPAMFNSTLTEDESFLCPSDGAIMITASHLPYNRNGFKFFTSDGGLGKV  227

Query  1470  EVEAICDKAA---RKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDT  1300
             +++ I ++AA   +K+++   + S    +   KVD+MS Y   L   +K         + 
Sbjct  228   DIKNILERAADIYKKFSDENLRKSQREISSIKKVDYMSVYTSGL---VKAVQRAAGGLEK  284

Query  1299  PLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTR  1120
             PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L PDGMFPNHIPNPEDK+AM    
Sbjct  285   PLEGFHIVVDAGNGAGGFFAAKVLEPLGAITLGSQFLEPDGMFPNHIPNPEDKSAMEAIT  344

Query  1119  AAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTS  940
              AVL N ADLG++FDTDVDR   VD +G   N +RLIAL+SAIVL+EHPGTT+VTD+ TS
Sbjct  345   KAVLDNKADLGIIFDTDVDRCAAVDSTGREFNRNRLIALLSAIVLEEHPGTTIVTDSVTS  404

Query  939   MGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDG  763
              GLT FI  + GG+H  ++ GY+NVID+ + LN +G E+HL +ETSGHGALKEN++LDDG
Sbjct  405   DGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSNGEESHLAIETSGHGALKENHWLDDG  464

Query  762   AYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEA  592
             AY++VKI+ ++   +  G   G   +  L+  LEEP    ELR+ +  +  H   +    
Sbjct  465   AYLMVKILNKLAAARAAGQGNGSKVLTDLVDGLEEPRVALELRLKI--DKNHPDLEG---  519

Query  591   IESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEE---NGE  421
                FR Y EK               V +        +P      + RA V+ E    +G 
Sbjct  520   -RDFREYGEK---------------VLQHLSNSIESNPN-----LKRAPVNYEGIRVSGF  558

Query  420   HGWVHLRQSIHNPNIAVNLQS  358
              GW  LR S+H+P + +N+++
Sbjct  559   GGWFLLRLSLHDPVLPLNIEA  579



>ref|WP_026506459.1| phosphoglucomutase [Butyrivibrio sp. MC2013]
Length=504

 Score =   401 bits (1031),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 229/545 (42%), Positives = 326/545 (60%), Gaps = 47/545 (9%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNGSD+RG+A++ +KG +V++T  A E +A +F    +  L++  G    ES +V++G 
Sbjct  6     LQNGSDIRGIAMENDKGYAVNMTEKASEDLARAF----VRRLKAITG---EESPKVAVGR  58

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYT  1519
             D R+SG++L  A   G+   G    D  LA+TPA FM+TVL    Y  SIM+TASHLP+ 
Sbjct  59    DSRLSGEALLKAAVRGIKAEGAEAIDFELASTPAMFMATVLE--NYTGSIMITASHLPWF  116

Query  1518  RNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDI  1339
             RNG+KFF + GGL   +++ + + A +  AN    +   +     KVDFM  YA  LR  
Sbjct  117   RNGMKFFDRDGGLEKEDIKELVEAADQIAANET--MPEGIDDSAVKVDFMETYAAFLR--  172

Query  1338  IKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHI  1159
              K+ ++   + D PL+G  IIV+AGNG+GGF+   VL+ LGA+T GS  L PDG FPNH+
Sbjct  173   -KKIIDGAGNGDRPLEGRHIIVDAGNGAGGFYVTRVLEPLGANTEGSQFLEPDGHFPNHV  231

Query  1158  PNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKE  979
             PNPEDK A    + A   + ADLG++FDTDVDR+G +  SG  +  + LIA++S+IVL+E
Sbjct  232   PNPEDKEAAESAQKATFDSGADLGIIFDTDVDRAGAILPSGKKLVRNELIAIISSIVLRE  291

Query  978   HPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGH  799
             HPGTT+VTD+ TS GL  FIT RGGQH  ++ GYRNVID+ + LN  G+++ L +ETSGH
Sbjct  292   HPGTTIVTDSITSDGLHEFITSRGGQHIRFKRGYRNVIDESIRLNNAGIDSQLAIETSGH  351

Query  798   GALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEPR  619
             GALKEN+FLDDGAY++VKI+IEM      G  E +  +I DL+ P E+ E+R  V +E  
Sbjct  352   GALKENFFLDDGAYLMVKILIEM------GKGEDLDKMISDLDTPAESVEIRFPVKTELL  405

Query  618   HAKAKAVEAIESFRHYIEKGN-LPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKV  442
               K+           + E  + + GW L+        EG   +TN               
Sbjct  406   EGKSLQENGDRVLDFFKEAADEIEGWFLEEEN----YEGVRFNTNVSHGG----------  451

Query  441   SNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLDISQI  262
                     GW+ LR+S+H P + +N++S+  GG   MA+ L    L      + LD++ +
Sbjct  452   --------GWLLLRKSLHEPIMPLNIESSFDGGSLLMAKQL----LQVLSREETLDVTPL  499

Query  261   DEFAR  247
             +EF R
Sbjct  500   EEFIR  504



>ref|NP_568350.1| phosphoglucosamine mutase family protein [Arabidopsis thaliana]
 ref|NP_850839.1| phosphoglucosamine mutase family protein [Arabidopsis thaliana]
 gb|AAL31254.1| AT5g17530/K10A8_10 [Arabidopsis thaliana]
 gb|AAM91053.1| AT5g17530/K10A8_10 [Arabidopsis thaliana]
 gb|AED92438.1| phosphoglucosamine mutase family protein [Arabidopsis thaliana]
 gb|AED92439.1| phosphoglucosamine mutase family protein [Arabidopsis thaliana]
Length=581

 Score =   404 bits (1037),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 238/556 (43%), Positives = 330/556 (59%), Gaps = 44/556 (8%)
 Frame = -1

Query  1986  AQSFPKIKLSLRVESSLTANKHNEVAVDEEMEK--IRRLQNGSDVRGVALQGEKGRSVDL  1813
             A +  K +  L  + +   N  +  A    ++K    +LQNGSD+RGVA+ G +G  V L
Sbjct  22    AHTLSKYQFVLSKQRTFYCNATSSSATVPSLDKNDFLKLQNGSDIRGVAVTGVEGEPVSL  81

Query  1812  TPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGC  1633
               P  EAIA +FG+W++   ++E        +RVS+G D RIS ++L  AV  GLG +G 
Sbjct  82    PEPVTEAIAAAFGQWLLHKKKAES-----RRLRVSVGHDSRISAQTLLEAVSRGLGVSGL  136

Query  1632  LVFDMGLATTPACFMSTVLPPFQY----DASIMMTASHLPYTRNGLKFFTKKGGLTSTEV  1465
              V   GLA+TPA F ST+     +    D +IM+TASHLPY RNG KFFT  GGL   ++
Sbjct  137   DVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITASHLPYNRNGFKFFTSDGGLGKVDI  196

Query  1464  EAICDKAA---RKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPL  1294
             + I ++AA   +K ++   + S    +  +KVD+MS Y   L   +++        + PL
Sbjct  197   KNILERAADIYKKLSDENLRKSQRESSSITKVDYMSVYTSGLVKAVRKAAGD---LEKPL  253

Query  1293  QGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAA  1114
             +GF I+V+AGNG+GGFF   VL+ LGA T GS  L PDGMFPNHIPNPEDK AM     A
Sbjct  254   EGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLEPDGMFPNHIPNPEDKAAMEAITKA  313

Query  1113  VLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMG  934
             VL N ADLG++FDTDVDRS  VD SG   N +RLIAL+SAIVL+EHPGTT+VTD+ TS G
Sbjct  314   VLDNKADLGIIFDTDVDRSAAVDSSGREFNRNRLIALLSAIVLEEHPGTTIVTDSVTSDG  373

Query  933   LTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAY  757
             LT FI  + GG+H  ++ GY+NVID+ + LN  G E+HL +ETSGHGALKEN++LDDGAY
Sbjct  374   LTSFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEESHLAIETSGHGALKENHWLDDGAY  433

Query  756   MVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIE  586
             ++VKI+ ++   +  G   G   +  L++ LEEP    ELR+ +  +  H   +  +   
Sbjct  434   LMVKILNKLAAARAAGQGSGSKVLTDLVEGLEEPKVALELRLKI--DKNHPDLEGSD---  488

Query  585   SFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVH  406
              FR Y EK       L    +        ++TN +           +VS    G  GW  
Sbjct  489   -FREYGEK------VLQHVSNS-------IETNPNLIIAPVNYEGIRVS----GFGGWFL  530

Query  405   LRQSIHNPNIAVNLQS  358
             LR S+H+P + +N+++
Sbjct  531   LRLSLHDPVLPLNIEA  546



>ref|WP_027203240.1| phosphoglucomutase [Butyrivibrio fibrisolvens]
Length=514

 Score =   401 bits (1031),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 238/549 (43%), Positives = 332/549 (60%), Gaps = 50/549 (9%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNGSD+RG+A+  E G SV+LT  A + +A +F +W+    ++++       V+++LG 
Sbjct  6     LQNGSDIRGIAMDNETGASVNLTNKASKDLAGAFAKWLSKRNDNKK-------VKIALGR  58

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQ-----YDASIMMTAS  1534
             D R++G++L  A  AG+   G  V D G+A+TPA FMSTVL   +     +D SIM+TAS
Sbjct  59    DSRLTGEALLKAAAAGIIAQGHEVCDFGIASTPAMFMSTVLASDEDDAATFDGSIMITAS  118

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAK  1354
             HLPY RNGLKFFTK+GGL   +++ + + A +  A    K      A    ++FM  YA 
Sbjct  119   HLPYYRNGLKFFTKEGGLEKGDIKELTELADKILAENPEKSVDTSSADIKSINFMDTYAS  178

Query  1353  HLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGM  1174
             +L+  I++ V      D PL+G  IIV+AGNG+GGF+   VL+ LGADT GS  L PDG 
Sbjct  179   YLQKKIRDGVGKG---DKPLEGLHIIVDAGNGAGGFYVTKVLEPLGADTSGSQFLTPDGR  235

Query  1173  FPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSA  994
             FPNHIPNPE+K A    + A L + ADLG++FDTDVDR+G V  SG  +  + LIA++S 
Sbjct  236   FPNHIPNPENKEAAESIKKATLDSKADLGIIFDTDVDRAGAVLPSGKTLTRNDLIAVLSM  295

Query  993   IVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             I L EHPGTT+VTD+ TS GL  FI   GG+H  ++ GYRNVID+ + LN +G+++ L +
Sbjct  296   IALSEHPGTTIVTDSVTSDGLHDFIEAHGGKHKRFKRGYRNVIDESIRLNNEGIDSQLAI  355

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVK-MKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             ETSGHGA KENYFLDDGAY++VK++IEM K  KLE        +IKDL EP E+ E+R  
Sbjct  356   ETSGHGAFKENYFLDDGAYLMVKLLIEMGKGKKLE-------EMIKDLSEPCESDEIRFP  408

Query  636   VLSEPRHAKAKAVEAIESFRHYIE-KGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF  460
             V ++               +   E  G + GW L         EG  V+T          
Sbjct  409   VYADKIEGGDLQSNGDRILKMLEEAAGKVEGWSLPESN----YEGVRVNT----------  454

Query  459   MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKF  280
                    ++++G+ GW+ LR+S+H P + +N++SN  GG   MA  L++  +LAGE    
Sbjct  455   -------DKDHGD-GWLLLRKSLHEPIMPLNIESNTKGGNLIMATKLKE--ILAGE--DT  502

Query  279   LDISQIDEF  253
             LD S +D F
Sbjct  503   LDQSPLDAF  511



>gb|AHE97205.1| phosphoglucomutase [Thioalkalivibrio thiocyanoxidans ARh 4]
Length=517

 Score =   401 bits (1031),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 226/521 (43%), Positives = 315/521 (60%), Gaps = 43/521 (8%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNGSD+RG+A+    G   +LTP     +  +F  W+   L     G   E + V++G 
Sbjct  15    LQNGSDIRGIAM----GPRAELTPEVAHRLGRAFAAWLARSL-----GRAPERLTVAVGR  65

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYT  1519
             D R++G  L A++  GL + G  VFD+GLA+TPA FMSTV P    D ++M+TASHLP  
Sbjct  66    DSRLTGPELMASLMQGLARDGLRVFDLGLASTPAMFMSTVTPGCACDGAVMLTASHLPPD  125

Query  1518  RNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDI  1339
             RNG KFFT++GGL   +V  + + A  +  + +    T L  P   VDFM+ YA+ L + 
Sbjct  126   RNGCKFFTRQGGLNRDDVSVLLELA--ESGDFLPTPGTGLIMP---VDFMTVYARQLVER  180

Query  1338  IKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHI  1159
             I+  V+HP H + PLQG +I+V+AGNG+GGFF   VL  LGADT GS +L PDG FPNH+
Sbjct  181   IRSGVDHPEHPERPLQGLRIVVDAGNGAGGFFVDRVLQPLGADTTGSQYLEPDGSFPNHV  240

Query  1158  PNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKE  979
             PNPE   AMA  R AV    A+ G+VFD DVDR+  V+  G  IN +RL+AL +A+VL+E
Sbjct  241   PNPEHPDAMAALRRAVTAQRANFGIVFDPDVDRAAAVEADGRAINRNRLVALAAAMVLRE  300

Query  978   HPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSG  802
             HPG+TVVTD+ TS GLT FI    GG H  ++ GYRNVI++ + LN  G E  L +ETSG
Sbjct  301   HPGSTVVTDSITSDGLTDFIERELGGVHRRFKRGYRNVINEALRLNAAGQECWLAIETSG  360

Query  801   HGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEP  622
             H ALKEN+FLDDGAY++  ++IE+ + + EG    +G+LI  L EP E+AE+R  + ++ 
Sbjct  361   HAALKENHFLDDGAYLMAMLLIELARARSEG--RSLGTLIATLREPAESAEIR--IRNDD  416

Query  621   RHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKV  442
                +A   + I++ R     G  P W+L            + D ++            +V
Sbjct  417   ADFRASGNQVIDALR--ARAGVEPDWKL------------VPDNHEG----------VRV  452

Query  441   SNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
             +    GE GW  LR S+H+P +A+N++S  PGG   +A  L
Sbjct  453   ACRGAGERGWFLLRLSLHDPVLALNIESETPGGVGRIAHRL  493



>ref|WP_013710970.1| phosphoglucomutase [Carnobacterium sp. 17-4]
 ref|YP_004375044.1| phosphomannomutase/phosphoglucomutase [Carnobacterium sp. 17-4]
 gb|AEB30028.1| phosphomannomutase/phosphoglucomutase [Carnobacterium sp. 17-4]
Length=509

 Score =   400 bits (1029),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 228/533 (43%), Positives = 318/533 (60%), Gaps = 53/533 (10%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVIS----GLESERGGAVVESVRV  1711
             LQNGSD+RG+A++      + LT   +E IA  +  W+       +E E+     + V V
Sbjct  10    LQNGSDIRGIAIK-TSDHDITLTNENIEKIAYGYAVWLKEVKQLAIEDEK-----KPVTV  63

Query  1710  SLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASH  1531
             S+G D R+S   + A    GL  AG  V D+GL+TTPA FMST    ++ D ++M+TASH
Sbjct  64    SVGHDSRLSADRIKAVFIEGLNNAGIDVVDVGLSTTPAMFMSTQYDSYKCDGAVMITASH  123

Query  1530  LPYTRNGLKFFTKKGGLTSTEVEAICDKAARK---YANRMAKVSTALRAPPSKVDFMSAY  1360
             LP+  NGLKFFTK GG    +++ I  +A  +   + N   KVS    AP      ++ Y
Sbjct  124   LPFEYNGLKFFTKDGGAEHEDIDFILQQADWENVTWENNQGKVS---EAP-----LLNDY  175

Query  1359  AKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPD  1180
             AK L   I+  +N   HY+ PL G  I+V+AGNG+GGFF   VL  LGAD  GS +L+PD
Sbjct  176   AKDLVTKIRIGINDKDHYEKPLTGRHIVVDAGNGAGGFFAEKVLVPLGADISGSQYLDPD  235

Query  1179  GMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALM  1000
             G FPNHIPNP++K AM   + AVLQ  AD+GV+FDTDVDRS +VDR G+ +N + LIA++
Sbjct  236   GHFPNHIPNPDNKEAMKSIQEAVLQYKADMGVIFDTDVDRSALVDRKGDTLNRNNLIAVI  295

Query  999   SAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHL  820
             SAI++KE+P TT+VT + TS  L  FIT  GG+   Y  GYRNVI++ + LN++GV T L
Sbjct  296   SAILIKENPSTTIVTSSATSEHLKTFITSLGGKQDRYITGYRNVINRAIQLNKEGVTTSL  355

Query  819   MMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRM  640
              +ETSGH AL+ENYFLDDGAY+V KI++    +K EG +     LI  L++P+ET E+R 
Sbjct  356   AIETSGHAALQENYFLDDGAYLVAKILMADANLKKEGKD--FSDLITTLKQPVETDEVRF  413

Query  639   DVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF  460
              +L E  HA  K V  +E F  +IEK +    EL +       EG  V+T          
Sbjct  414   KILPEDIHATGKKV--MEDFSRFIEKESDLSIELANL------EGVRVNT----------  455

Query  459   MYRAKVSNEENGEH--GWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                       +G++  GW+ LR S+H P + +NL+S+  G  + +   ++D F
Sbjct  456   ----------SGQYGIGWMLLRMSLHEPLLVLNLESDQAGSIKKLREKMKDFF  498



>ref|WP_027207286.1| phosphoglucomutase [Butyrivibrio fibrisolvens]
Length=514

 Score =   401 bits (1030),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 238/549 (43%), Positives = 332/549 (60%), Gaps = 50/549 (9%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNGSD+RG+A+  E G SV+LT  A + +A +F +W+    ++++       V+++LG 
Sbjct  6     LQNGSDIRGIAMDNETGASVNLTNKASKDLAGAFAKWLSKRNDNKK-------VKIALGR  58

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQ-----YDASIMMTAS  1534
             D R++G++L  A  AG+   G  V D G+A+TPA FMSTVL   +     +D SIM+TAS
Sbjct  59    DSRLTGEALLKAAAAGIIAQGHEVCDFGIASTPAMFMSTVLASDEDDAATFDGSIMITAS  118

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAK  1354
             HLPY RNGLKFFTK+GGL   +++ + + A +  A    K      A    ++FM  YA 
Sbjct  119   HLPYYRNGLKFFTKEGGLEKGDIKELTELADKILAENPEKSVDTSSADIKSINFMDTYAS  178

Query  1353  HLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGM  1174
             +L+  I++ V      D PL+G  IIV+AGNG+GGF+   VL+ LGADT GS  L PDG 
Sbjct  179   YLQKKIRDGVGKG---DKPLEGLHIIVDAGNGAGGFYVTKVLEPLGADTSGSQFLTPDGR  235

Query  1173  FPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSA  994
             FPNHIPNPE+K A    + A L + ADLG++FDTDVDR+G V  SG  +  + LIA++S 
Sbjct  236   FPNHIPNPENKEAAESIKKATLDSKADLGIIFDTDVDRAGAVLPSGKTLTRNDLIAVLSM  295

Query  993   IVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             I L EHPGTT+VTD+ TS GL  FI   GG+H  ++ GYRNVID+ + LN +G+++ L +
Sbjct  296   IALSEHPGTTIVTDSVTSDGLHDFIEAHGGKHKRFKRGYRNVIDESIRLNNEGIDSQLAI  355

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVK-MKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             ETSGHGA KENYFLDDGAY++VK++IEM K  KLE        +IKDL EP E+ E+R  
Sbjct  356   ETSGHGAFKENYFLDDGAYLMVKLLIEMGKGKKLE-------EMIKDLSEPCESDEVRFP  408

Query  636   VLSEPRHAKAKAVEAIESFRHYIE-KGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF  460
             V ++               +   E  G + GW L         EG  V+T          
Sbjct  409   VYADKIEGGDLQSNGDRILKMLEEAAGKVEGWSLPESN----YEGVRVNT----------  454

Query  459   MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKF  280
                    ++++G+ GW+ LR+S+H P + +N++SN  GG   MA  L++  +LAGE    
Sbjct  455   -------DKDHGD-GWLLLRKSLHEPIMPLNIESNTKGGNLIMATKLKE--ILAGE--DT  502

Query  279   LDISQIDEF  253
             LD S +D F
Sbjct  503   LDQSPLDAF  511



>ref|XP_005844743.1| hypothetical protein CHLNCDRAFT_58837 [Chlorella variabilis]
 gb|EFN52641.1| hypothetical protein CHLNCDRAFT_58837 [Chlorella variabilis]
Length=467

 Score =   399 bits (1025),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 213/472 (45%), Positives = 303/472 (64%), Gaps = 40/472 (8%)
 Frame = -1

Query  1674  LSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYTRNGLKFFT  1495
             ++A++ AGL  AG  V   G  TTPA FMS +LP  +YD ++M+TASHLP  RNG KF T
Sbjct  1     MAASLAAGLADAGVSVARFGACTTPAMFMSCILPGHEYDGAVMITASHLPVNRNGAKFCT  60

Query  1494  KKGGLTSTEVEAICDKAAR-----------KYANRMAKVSTALRAPPS---KVDFMSAYA  1357
              +GGL   ++  +  +AA            +Y +    ++ AL+A  +    VDF+  YA
Sbjct  61    AEGGLEKKDITTLLMRAAELAVDAGQLPSDRYNDHAFVITAALQASSALVRVVDFLPEYA  120

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
              +LR++IK+ + +P H D+PL GF+I+VN GNG G F    VL  LGAD   S+++ PDG
Sbjct  121   AYLREVIKKAIANPEHPDSPLAGFKIVVNPGNGGGAFIADQVLGPLGADVSASINMEPDG  180

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNH PNPEDK A+  TR AVL+  ADLG++ DTDVDRSGVVD +GN IN +R IALMS
Sbjct  181   SFPNHTPNPEDKKAVQATRVAVLEAGADLGIMLDTDVDRSGVVDAAGNGINRNRYIALMS  240

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
             AI L+E+PG T+VTD+ TS GL  FI   GG+H  ++ GY+N+I+KGV LN+ GV + LM
Sbjct  241   AITLRENPGETIVTDSCTSNGLATFIQQLGGKHFRFKKGYKNIINKGVELNQAGVPSPLM  300

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             METSGHGA++ENYFLDDGAY  +KI++EMV+ +LEG+ + +G L+KDL EP+E  E+R+ 
Sbjct  301   METSGHGAMRENYFLDDGAYGALKIVVEMVRRQLEGAGD-VGDLLKDLREPVEAMEIRVA  359

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCG--DCWVSEGCLVDTNDHPAAIDA  463
             + +    ++   V A  +F+ +++ G         CG  D W  E         P   + 
Sbjct  360   IQASDVRSEGDLVTA--AFKQWVDAG---------CGGADHWQLE---------PENYEG  399

Query  462   FMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
               +R +V+ EE G+ GW+ LR S+H+P+I +N++S   GG +++   L + F
Sbjct  400   --WRVRVT-EEGGKEGWILLRPSLHDPDIVLNVESEHVGGMRAILHHLLEFF  448



>ref|XP_009344764.1| PREDICTED: uncharacterized protein LOC103936642 isoform X3 [Pyrus 
x bretschneideri]
Length=544

 Score =   402 bits (1032),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 240/560 (43%), Positives = 333/560 (59%), Gaps = 52/560 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  + LT P  EAI  +F  W++   +++      + +R+S+G
Sbjct  20    KLQNGSDIRGVAVAGVEGEPISLTEPVSEAIGAAFAAWLVEKKKADGS----QRLRISVG  75

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS K L  A+  G+  AG  V   GLA+TPA F ST+     +    D SIM+TAS
Sbjct  76    HDSRISAKKLEDAISRGIASAGLDVVQYGLASTPAMFNSTITEDESFLCPSDGSIMITAS  135

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALR----APPSKVDFMS  1366
             HLPY RNG KFFT  GGL   +++ I ++AA  Y     +  T+ +    A   +VD+MS
Sbjct  136   HLPYNRNGFKFFTNSGGLGKPDIKNILERAADVYDKFTVEGLTSSKEKVLASVKRVDYMS  195

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L 
Sbjct  196   VYTS---DLVKAVRKAAGNIEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAVTTGSQFLE  252

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD +G   N +RLIA
Sbjct  253   PDGMFPNHIPNPEDKTAMKAITQAVLDNKADLGIIFDTDVDRSAAVDSTGLEFNRNRLIA  312

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G E
Sbjct  313   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEE  372

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLE  658
             +HL +ETSGHGALKEN++LDDGAY++VKI+ ++   +  G   G   +  L++ LEEP  
Sbjct  373   SHLAIETSGHGALKENHWLDDGAYLMVKILNKLASARASGQVGGSKVLTGLLEGLEEPGF  432

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
             + ELR+ +     H   K      SFR Y                    E  L    ++ 
Sbjct  433   SVELRLKI--NQSHPDLKG----GSFRDY-------------------GEAVLKHLENYI  467

Query  477   AAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
              + D  + +A V+ E    +G  GW  LR S+H+P + +N+++  P   ++++  L +  
Sbjct  468   NS-DPKLKKAPVNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEA--PSNNEAVS--LGNIV  522

Query  306   LLAGEMAKFLDISQIDEFAR  247
             L A +    LD S +D+F +
Sbjct  523   LAAVKEFPALDTSALDKFVQ  542



>ref|XP_006363535.1| PREDICTED: uncharacterized protein LOC102592762 isoform X1 [Solanum 
tuberosum]
Length=613

 Score =   404 bits (1038),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 235/542 (43%), Positives = 326/542 (60%), Gaps = 48/542 (9%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E     +LQNGSD+RGVA+ G +G  + LT    EAIA  F  W+++    ++     + 
Sbjct  84    EKSNFLKLQNGSDIRGVAVDGVEGEPLTLTETVTEAIAAGFSGWLLA----KKKNVSSKC  139

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DAS  1552
             +RVS+G D RIS + L  AV  GL +AG  V   GLA+TPA F ST+    ++    D S
Sbjct  140   LRVSIGHDSRISAQKLQDAVSRGLARAGVEVIQYGLASTPAMFNSTLTENEEFSCPVDGS  199

Query  1551  IMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKY---ANRMAK-VSTALRAPPS  1384
             IM+TASHLPY RNG KFFT  GGL   +++ I ++AA  Y   AN  +K   TA      
Sbjct  200   IMITASHLPYNRNGFKFFTSAGGLGKPDIKDILERAADIYKNIANDDSKGAETAASLDVK  259

Query  1383  KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTF  1204
             +VD+MS YA +L   +++   +    + PL+GF I+V+AGNG+GGFF   VL+ LGA T 
Sbjct  260   RVDYMSVYASNLVAAVRKAAGN---IEKPLEGFHIVVDAGNGAGGFFVGKVLEPLGAITS  316

Query  1203  GSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPIN  1024
             GS  L PDG+FPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD SG   N
Sbjct  317   GSQFLEPDGLFPNHIPNPEDKTAMKAITKAVLDNRADLGIIFDTDVDRSAAVDSSGREFN  376

Query  1023  GDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHL  847
              +RLIALMSAI+L+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + L
Sbjct  377   RNRLIALMSAIILEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRL  436

Query  846   NEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMK---LEGSEEGIGSLIKD  676
             N  G E HL +ETSGHGALKEN++LDDGAY++VK++ ++   +   L G  + +  +++ 
Sbjct  437   NSVGEEAHLAIETSGHGALKENHWLDDGAYLMVKLLNKLASARTSGLGGGSKVLTDMVEG  496

Query  675   LEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLV  496
             LEEP    ELR+ +  +  H   +      SFR Y E                     ++
Sbjct  497   LEEPAVAVELRLKI--DQNHPDLQG----GSFRDYGE--------------------AVL  530

Query  495   DTNDHPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMAR  325
                ++   +DA + +A V+ E    +G  GW  LR S+H+P + +N+++        +A 
Sbjct  531   KQLENTVELDAKLLKAPVNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEAPSKEDAVKLAH  590

Query  324   DL  319
             D+
Sbjct  591   DV  592



>ref|WP_036764547.1| phosphoglucomutase [Peptostreptococcus sp. MV1]
 gb|KGF12182.1| phosphoglucomutase [Peptostreptococcus sp. MV1]
Length=490

 Score =   400 bits (1027),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 217/527 (41%), Positives = 311/527 (59%), Gaps = 43/527 (8%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGR-SVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             M+K+  LQNG+D+RGVA + +K    + LT   V+ +   F  W+I   + +        
Sbjct  1     MDKLYSLQNGTDIRGVAYKDDKSDLDITLTREDVKTLVRGFATWIIDKDKKDH-------  53

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMT  1540
             + +S+G D R++G     A    L + G  V D G+ATTPA FMST++  ++ D +IM T
Sbjct  54    ISISIGTDSRLTGPDFREACVEALTEIGVDVVDCGMATTPAMFMSTIIDGYKCDGAIMFT  113

Query  1539  ASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAY  1360
             ASH+PY  NGLK FT KG L  ++++ + D            V +  ++   K + +  Y
Sbjct  114   ASHMPYVYNGLKMFTNKGCLEKSDLKDVIDICVSGNF-----VESRSKSSLVKKNLIDDY  168

Query  1359  AKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPD  1180
             A  L + I+  V+    YD PL G ++IV+AGNG+GGFF   VL +LGADT GS  LNPD
Sbjct  169   ADILVEKIRAGVSSSDDYDRPLAGMKVIVDAGNGAGGFFADKVLARLGADTEGSQFLNPD  228

Query  1179  GMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALM  1000
             GMFPNHIPNPE+K AMA    A L N ADLG++FDTDVDR+ +V   G  IN + LIA++
Sbjct  229   GMFPNHIPNPENKEAMASICQATLDNKADLGIIFDTDVDRAAIVGSDGKSINKNALIAVI  288

Query  999   SAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHL  820
             S+I+L+EHP TT+VTD+ TS GL  FI  RGG H  ++ GY+NVI++ + LNE+G E+HL
Sbjct  289   SSIILEEHPSTTIVTDSVTSNGLADFIRSRGGIHHRFKRGYKNVINEAIRLNEEGRESHL  348

Query  819   MMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRM  640
              +ETSGH A+KENYFLDDGAY++ KI+++  K+  +  +  IG LI+DL E LE  E+R+
Sbjct  349   AIETSGHAAIKENYFLDDGAYLISKILVKAAKLFRKSKD--IGQLIEDLHESLEDKEIRI  406

Query  639   DVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF  460
              +  +    K  A   I+S    ++  ++ GW  D   + +  EG  V+  D        
Sbjct  407   KI--QESDFKTYANNTIKSLSEKVK--SIEGW--DEVSENY--EGIRVNCKD--------  450

Query  459   MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
                         E GW  +R S+H P + +N +S+I GGC  +   L
Sbjct  451   ------------EKGWFLMRSSLHEPLLVINFESDIQGGCDMIHNKL  485



>ref|WP_034857094.1| phosphoglucomutase [Clostridium intestinale]
Length=487

 Score =   399 bits (1026),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 221/520 (43%), Positives = 321/520 (62%), Gaps = 45/520 (9%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             ++NG+D+RG+A++ E+ +   L+P  V+ +   F +++ +   ++      ++++V+LGM
Sbjct  1     MKNGTDIRGIAIETEEYKET-LSPEIVKLLGVGFAKFLKNKSNNK------DNIKVALGM  53

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYT  1519
             D R+SG SL +A+   L + G  V D G+ TTP+ FM+TVL  ++ D SIM+TASHLPY 
Sbjct  54    DSRLSGPSLKSALTEYLTKVGVNVDDCGITTTPSMFMTTVLEDYKCDGSIMITASHLPYY  113

Query  1518  RNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDI  1339
              NGLKFFT  GG    +++ I + A     + +  VS   +   S++D +  Y+K L D 
Sbjct  114   YNGLKFFTPLGGCEKEDIDEIINLALEDNEDYIV-VS---QGTVSEIDLVKDYSKLLVD-  168

Query  1338  IKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHI  1159
                +V +    + PL G +IIV+AGNG+GGFF   VL +LGAD  GS  L+PDG FPNHI
Sbjct  169   ---KVRNAVGTEKPLAGSKIIVDAGNGAGGFFADKVLKELGADIEGSQFLDPDGTFPNHI  225

Query  1158  PNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKE  979
             PNPE+K AM   + AVL + ADLG++FDTDVDRS +V ++G  IN + LIAL+S+IVLKE
Sbjct  226   PNPENKEAMESIKNAVLNSKADLGIIFDTDVDRSAIVAKTGEEINKNALIALISSIVLKE  285

Query  978   HPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGH  799
             + G T+VTD+ TS GL  FIT  GG H  ++ GY+NVI++   LNE+G+ + L +ETSGH
Sbjct  286   NEGATIVTDSITSTGLAEFITNLGGVHHRFKRGYKNVINEAKRLNEEGIVSPLAIETSGH  345

Query  798   GALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSEPR  619
              ALKENYFLDDGAY++VKI+IEM K+K EG +  I SLIKDL+ PLET E R+ +  E  
Sbjct  346   AALKENYFLDDGAYLIVKILIEMSKLKKEGKD--IDSLIKDLKHPLETEEKRIKIKCEDF  403

Query  618   HAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVS  439
                 ++V  IE  +  +    + GW ++      +   CL                    
Sbjct  404   RPYGQSV--IEDLKESV--STIEGWSIEPKNYEGIKINCL--------------------  439

Query  438   NEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
                  E GW  LR S+H P +A+N++S++ GG + +   L
Sbjct  440   ----KEQGWFLLRLSLHEPLLALNIESDLTGGAKDIYSKL  475



>ref|WP_027215134.1| phosphoglucomutase [Butyrivibrio fibrisolvens]
Length=514

 Score =   400 bits (1028),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 241/552 (44%), Positives = 335/552 (61%), Gaps = 56/552 (10%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNGSD+RG+A+  E G SV+LT  A + +A +F +W+    ++++       V+++LG 
Sbjct  6     LQNGSDIRGIAMDNETGASVNLTNKASKDLAGAFAKWLSKRNDNKK-------VKIALGR  58

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQ-----YDASIMMTAS  1534
             D R++G++L  A  AG+   G  V D G+A+TPA FMSTVL   +     +D SIM+TAS
Sbjct  59    DSRLTGEALLKAAAAGIIAQGHEVCDFGIASTPAMFMSTVLASDEDDAATFDGSIMITAS  118

Query  1533  HLPYTRNGLKFFTKKGGLTS---TEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSA  1363
             HLPY RNGLKFFTK+GGL      E+  + DK   +Y +    VS+A       ++FM  
Sbjct  119   HLPYYRNGLKFFTKEGGLEKGDIKELTELADKILAEYPDDSVDVSSA---DIKSINFMDT  175

Query  1362  YAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNP  1183
             YA +L+  I++ V      D PL+G  IIV+AGNG+GGF+   VL+ LGADT GS  L P
Sbjct  176   YASYLQKKIRDGVGKG---DKPLEGLHIIVDAGNGAGGFYVTKVLEPLGADTSGSQFLTP  232

Query  1182  DGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIAL  1003
             DG FPNHIPNPE+K A    + A L + ADLG++FDTDVDR+G V  SG  +  + LIA+
Sbjct  233   DGRFPNHIPNPENKEAAESIKNATLDSKADLGIIFDTDVDRAGAVLPSGKTLTRNDLIAV  292

Query  1002  MSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETH  823
             +S I L EHPGTT+VTD+ TS GL  FI   GG+H  ++ GYRNVID+ + LN +G+++ 
Sbjct  293   LSMIALSEHPGTTIVTDSVTSDGLHDFIEAHGGKHKRFKRGYRNVIDESIRLNGEGIDSQ  352

Query  822   LMMETSGHGALKENYFLDDGAYMVVKIIIEMVK-MKLEGSEEGIGSLIKDLEEPLETAEL  646
             L +ETSGHGA KENYFLDDGAY++VK++IEM K  KLE        +IKDL EP E+ E+
Sbjct  353   LAIETSGHGAFKENYFLDDGAYLMVKLLIEMGKGKKLE-------EMIKDLSEPCESDEV  405

Query  645   RMDVLSEPRHAKAKAVEAIESFRHYIE-KGNLPGWELDSCGDCWVSEGCLVDTNDHPAAI  469
             R  V ++        +      +   E  G + GW L         EG  V+T       
Sbjct  406   RFPVYADKIEGGDLQLNGDRILKMLEEAAGKVEGWSLPESN----YEGVRVNT-------  454

Query  468   DAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEM  289
                       ++++G+ GW+ LR+S+H P + +N++SN  GG   MA  L++  +LAGE 
Sbjct  455   ----------DKDHGD-GWLLLRKSLHEPIMPLNIESNTKGGNLIMATKLKE--ILAGE-  500

Query  288   AKFLDISQIDEF  253
                LD S +D F
Sbjct  501   -DTLDQSPLDAF  511



>ref|NP_001190326.1| phosphoglucosamine mutase family protein [Arabidopsis thaliana]
 gb|AED92440.1| phosphoglucosamine mutase family protein [Arabidopsis thaliana]
Length=614

 Score =   403 bits (1036),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 238/556 (43%), Positives = 330/556 (59%), Gaps = 44/556 (8%)
 Frame = -1

Query  1986  AQSFPKIKLSLRVESSLTANKHNEVAVDEEMEK--IRRLQNGSDVRGVALQGEKGRSVDL  1813
             A +  K +  L  + +   N  +  A    ++K    +LQNGSD+RGVA+ G +G  V L
Sbjct  55    AHTLSKYQFVLSKQRTFYCNATSSSATVPSLDKNDFLKLQNGSDIRGVAVTGVEGEPVSL  114

Query  1812  TPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGC  1633
               P  EAIA +FG+W++   ++E        +RVS+G D RIS ++L  AV  GLG +G 
Sbjct  115   PEPVTEAIAAAFGQWLLHKKKAES-----RRLRVSVGHDSRISAQTLLEAVSRGLGVSGL  169

Query  1632  LVFDMGLATTPACFMSTVLPPFQY----DASIMMTASHLPYTRNGLKFFTKKGGLTSTEV  1465
              V   GLA+TPA F ST+     +    D +IM+TASHLPY RNG KFFT  GGL   ++
Sbjct  170   DVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITASHLPYNRNGFKFFTSDGGLGKVDI  229

Query  1464  EAICDKAA---RKYANRMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPL  1294
             + I ++AA   +K ++   + S    +  +KVD+MS Y   L   +++        + PL
Sbjct  230   KNILERAADIYKKLSDENLRKSQRESSSITKVDYMSVYTSGLVKAVRKAAGD---LEKPL  286

Query  1293  QGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAA  1114
             +GF I+V+AGNG+GGFF   VL+ LGA T GS  L PDGMFPNHIPNPEDK AM     A
Sbjct  287   EGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLEPDGMFPNHIPNPEDKAAMEAITKA  346

Query  1113  VLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMG  934
             VL N ADLG++FDTDVDRS  VD SG   N +RLIAL+SAIVL+EHPGTT+VTD+ TS G
Sbjct  347   VLDNKADLGIIFDTDVDRSAAVDSSGREFNRNRLIALLSAIVLEEHPGTTIVTDSVTSDG  406

Query  933   LTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAY  757
             LT FI  + GG+H  ++ GY+NVID+ + LN  G E+HL +ETSGHGALKEN++LDDGAY
Sbjct  407   LTSFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEESHLAIETSGHGALKENHWLDDGAY  466

Query  756   MVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIE  586
             ++VKI+ ++   +  G   G   +  L++ LEEP    ELR+ +  +  H   +  +   
Sbjct  467   LMVKILNKLAAARAAGQGSGSKVLTDLVEGLEEPKVALELRLKI--DKNHPDLEGSD---  521

Query  585   SFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVH  406
              FR Y EK       L    +        ++TN +           +VS    G  GW  
Sbjct  522   -FREYGEK------VLQHVSNS-------IETNPNLIIAPVNYEGIRVS----GFGGWFL  563

Query  405   LRQSIHNPNIAVNLQS  358
             LR S+H+P + +N+++
Sbjct  564   LRLSLHDPVLPLNIEA  579



>emb|CDX85448.1| BnaA02g03650D [Brassica napus]
Length=639

 Score =   404 bits (1038),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 242/560 (43%), Positives = 331/560 (59%), Gaps = 53/560 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V L  P  EAIA +FG+W++      +  A    +RVS+G
Sbjct  119   KLQNGSDIRGVAVPGVEGEPVSLPEPVTEAIAAAFGQWLL-----HKKNAGSRKLRVSVG  173

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS  +L  AV  GLG +G  V   GLA+TPA F ST+     +    D +IM+TAS
Sbjct  174   HDSRISAPTLLEAVSRGLGVSGVDVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITAS  233

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAK--VSTALRAPPSKVDFMSAY  1360
             HLPY RNG KFFT  GGL   +++ I ++AA  Y N   +  + +       KVD+M+ Y
Sbjct  234   HLPYNRNGFKFFTSDGGLGKVDIKNILERAADIYQNLSDENLMKSQREVSIKKVDYMAVY  293

Query  1359  AKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPD  1180
                L + +++        + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L PD
Sbjct  294   TSGLVNAVRKAAGG---LEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLEPD  350

Query  1179  GMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALM  1000
             GMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD SG   N +RLIAL+
Sbjct  351   GMFPNHIPNPEDKTAMQAITKAVLDNKADLGIIFDTDVDRSAAVDSSGREFNRNRLIALL  410

Query  999   SAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETH  823
             SAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G ETH
Sbjct  411   SAIVLEEHPGTTIVTDSVTSDGLTSFIEKKLGGKHHRFKRGYKNVIDEAIRLNSTGEETH  470

Query  822   LMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGS-----LIKDLEEPLE  658
             L +ETSGHGALKEN++LDDGAY++VKI+ ++   +  G  EG GS     L++ L+EP  
Sbjct  471   LAIETSGHGALKENHWLDDGAYLMVKILNKLASARAAG--EGSGSKVLTDLVEGLDEPKV  528

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
               ELR+ +  +  H+  +       FR Y E                VS     + N   
Sbjct  529   ALELRLKI--DKNHSDLEG----RDFREYGE-----------TVLQQVSNSIETNPNLKK  571

Query  477   AAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLA  298
             A+++    R       +G  GW  LR S+H+P + +N+++      QS    ++   ++A
Sbjct  572   ASVNYEGIRV------SGFGGWFLLRLSLHDPVLPLNIEA------QSEDDAVKLGLVVA  619

Query  297   GEMAKF--LDISQIDEFARN  244
               + +F  LD S +    R+
Sbjct  620   NAVKEFNALDTSALSSLTRS  639



>ref|XP_002274127.2| PREDICTED: uncharacterized protein LOC100244432 isoform X1 [Vitis 
vinifera]
 emb|CBI31454.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   403 bits (1036),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 233/530 (44%), Positives = 326/530 (62%), Gaps = 50/530 (9%)
 Frame = -1

Query  1896  MEKIR--RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVE  1723
             +EK+   +LQNGSD+RGVA+ G +G  V LT P  EAIA +FG W+   LE ++      
Sbjct  88    LEKVDFLKLQNGSDIRGVAVAGVEGEPVTLTEPVTEAIAAAFGAWL---LEKKKADGS-R  143

Query  1722  SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DA  1555
              +RVS+G D RIS + L  AV  G+  AG  V   GLA+TPA F ST+    Q+    D 
Sbjct  144   RLRVSIGHDSRISAQKLQEAVSLGIASAGLEVVQYGLASTPAMFNSTLTEGEQFLCPADG  203

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAK--VSTALRAPPS-  1384
             SIM+TASHLPY RNG KFFT  GGL   +++ I ++AA  Y+N   +  V++  +A  S 
Sbjct  204   SIMITASHLPYNRNGFKFFTNAGGLGKADIKDILERAASIYSNFAVEGLVNSERKASVSI  263

Query  1383  -KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VD+M+ Y  +L + ++    +    + PL+G  I+V+AGNG+GGFF   VL+ LGA T
Sbjct  264   KRVDYMALYTSYLVEAVRRAAGN---IERPLEGLHIVVDAGNGAGGFFAEKVLEPLGAIT  320

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
              GS  L PDG+FPNHIPNPEDK AM     AVL N ADLG++FDTDVDRS  VD +G  +
Sbjct  321   TGSQFLEPDGLFPNHIPNPEDKEAMKAITQAVLANQADLGIIFDTDVDRSAAVDSTGREL  380

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVH  850
             N +RLIALMSAIVL++HPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + 
Sbjct  381   NRNRLIALMSAIVLEKHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIR  440

Query  849   LNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMK---LEGSEEGIGSLIK  679
             LN  G E+HL +ETSGHGALKEN++LDDGAY++VK++ ++   +   + G  E +  L++
Sbjct  441   LNSVGEESHLAIETSGHGALKENHWLDDGAYLMVKLLNKLASARASGIGGGSEVLTDLVE  500

Query  678   DLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCL  499
              L+EP    ELR+ +  +  H   K      SFR Y E                     +
Sbjct  501   GLQEPAAAVELRLKI--DKSHEDLKG----GSFREYGE--------------------AV  534

Query  498   VDTNDHPAAIDAFMYRAKVSNE---ENGEHGWVHLRQSIHNPNIAVNLQS  358
             +   ++    D  + +A V+ E    +G  GW  LR S+H+P + +N+++
Sbjct  535   LKLLENLTDSDPKLQKAPVNYEGVRASGFGGWFLLRLSLHDPVLPLNIEA  584



>ref|XP_009344763.1| PREDICTED: uncharacterized protein LOC103936642 isoform X2 [Pyrus 
x bretschneideri]
Length=579

 Score =   402 bits (1032),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 240/560 (43%), Positives = 333/560 (59%), Gaps = 52/560 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  + LT P  EAI  +F  W++   +++      + +R+S+G
Sbjct  55    KLQNGSDIRGVAVAGVEGEPISLTEPVSEAIGAAFAAWLVEKKKADGS----QRLRISVG  110

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS K L  A+  G+  AG  V   GLA+TPA F ST+     +    D SIM+TAS
Sbjct  111   HDSRISAKKLEDAISRGIASAGLDVVQYGLASTPAMFNSTITEDESFLCPSDGSIMITAS  170

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALR----APPSKVDFMS  1366
             HLPY RNG KFFT  GGL   +++ I ++AA  Y     +  T+ +    A   +VD+MS
Sbjct  171   HLPYNRNGFKFFTNSGGLGKPDIKNILERAADVYDKFTVEGLTSSKEKVLASVKRVDYMS  230

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L 
Sbjct  231   VYTS---DLVKAVRKAAGNIEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAVTTGSQFLE  287

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD +G   N +RLIA
Sbjct  288   PDGMFPNHIPNPEDKTAMKAITQAVLDNKADLGIIFDTDVDRSAAVDSTGLEFNRNRLIA  347

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G E
Sbjct  348   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEE  407

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLE  658
             +HL +ETSGHGALKEN++LDDGAY++VKI+ ++   +  G   G   +  L++ LEEP  
Sbjct  408   SHLAIETSGHGALKENHWLDDGAYLMVKILNKLASARASGQVGGSKVLTGLLEGLEEPGF  467

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
             + ELR+ +     H   K      SFR Y                    E  L    ++ 
Sbjct  468   SVELRLKI--NQSHPDLKG----GSFRDY-------------------GEAVLKHLENYI  502

Query  477   AAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
              + D  + +A V+ E    +G  GW  LR S+H+P + +N+++  P   ++++  L +  
Sbjct  503   NS-DPKLKKAPVNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEA--PSNNEAVS--LGNIV  557

Query  306   LLAGEMAKFLDISQIDEFAR  247
             L A +    LD S +D+F +
Sbjct  558   LAAVKEFPALDTSALDKFVQ  577



>ref|XP_010420479.1| PREDICTED: uncharacterized protein LOC104706050 isoform X1 [Camelina 
sativa]
Length=608

 Score =   402 bits (1034),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 238/562 (42%), Positives = 334/562 (59%), Gaps = 57/562 (10%)
 Frame = -1

Query  1986  AQSFPKIKLSLRVESSLTANKHNEVAVDEEMEKIR--RLQNGSDVRGVALQGEKGRSVDL  1813
             + +F K   ++  +++   N     A    ++KI   +LQNGSD+RGVA+ G +G  V L
Sbjct  51    SHTFSKYHSAISKQTTFYCNAATSSATAPSLDKIDFLKLQNGSDIRGVAVPGVEGEPVSL  110

Query  1812  TPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGC  1633
               P  EAIA +FG+W+       +  A    +RVS+G D RIS ++L  AV  GLG +G 
Sbjct  111   PEPVSEAIAAAFGQWL-----QHKKKAESRRLRVSIGHDSRISAQTLLEAVSRGLGVSGL  165

Query  1632  LVFDMGLATTPACFMSTVLPPFQY----DASIMMTASHLPYTRNGLKFFTKKGGLTSTEV  1465
              V   GLA+TPA F ST+     +    D +IM+TASHLPY RNG KFFT  GGL   ++
Sbjct  166   DVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITASHLPYNRNGFKFFTSDGGLGKVDI  225

Query  1464  EAICDKAARKYAN------RMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYD  1303
             + I ++AA  Y        + ++  T+++    KVD+MS Y   L   ++         +
Sbjct  226   KNILERAADIYKKVSDENLKKSQKETSIK----KVDYMSVYTSGLVKAVRRAAGD---LE  278

Query  1302  TPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMT  1123
              PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L PDGMFPNHIPNPEDK+AM   
Sbjct  279   KPLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLEPDGMFPNHIPNPEDKSAMEAI  338

Query  1122  RAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDART  943
               AVL N ADLG++FDTDVDRS  VD +G   N +RLIAL+SAIVL+EHPGTT+VTD+ T
Sbjct  339   IKAVLDNKADLGIIFDTDVDRSAAVDSTGREFNRNRLIALLSAIVLEEHPGTTIVTDSVT  398

Query  942   SMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDD  766
             S GLT FI  + GG+H  ++ GY+NVID+ + LN +G E+HL +ETSGHGALKEN++LDD
Sbjct  399   SDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSNGEESHLAIETSGHGALKENHWLDD  458

Query  765   GAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVE  595
             GAY++VK++ ++   +  G   G   +  L++ LEEP    ELR+ +  +  H   +   
Sbjct  459   GAYLMVKLLNKLAAARAAGQGSGSKVLTDLVEGLEEPRVALELRLKI--DKNHPDLEG--  514

Query  594   AIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEE---NG  424
                 FR Y EK       L    +        ++TN +       + RA V+ E    +G
Sbjct  515   --RDFREYGEK------VLQHLSNS-------IETNPN-------LKRAPVNYEGIRVSG  552

Query  423   EHGWVHLRQSIHNPNIAVNLQS  358
               GW  LR S+H+P + +N+++
Sbjct  553   FGGWFLLRLSLHDPVLPLNIEA  574



>ref|XP_010658400.1| PREDICTED: uncharacterized protein LOC100244432 isoform X2 [Vitis 
vinifera]
Length=618

 Score =   403 bits (1035),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 233/530 (44%), Positives = 326/530 (62%), Gaps = 50/530 (9%)
 Frame = -1

Query  1896  MEKIR--RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVE  1723
             +EK+   +LQNGSD+RGVA+ G +G  V LT P  EAIA +FG W+   LE ++      
Sbjct  87    LEKVDFLKLQNGSDIRGVAVAGVEGEPVTLTEPVTEAIAAAFGAWL---LEKKKADGS-R  142

Query  1722  SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DA  1555
              +RVS+G D RIS + L  AV  G+  AG  V   GLA+TPA F ST+    Q+    D 
Sbjct  143   RLRVSIGHDSRISAQKLQEAVSLGIASAGLEVVQYGLASTPAMFNSTLTEGEQFLCPADG  202

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAK--VSTALRAPPS-  1384
             SIM+TASHLPY RNG KFFT  GGL   +++ I ++AA  Y+N   +  V++  +A  S 
Sbjct  203   SIMITASHLPYNRNGFKFFTNAGGLGKADIKDILERAASIYSNFAVEGLVNSERKASVSI  262

Query  1383  -KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VD+M+ Y  +L + ++    +    + PL+G  I+V+AGNG+GGFF   VL+ LGA T
Sbjct  263   KRVDYMALYTSYLVEAVRRAAGN---IERPLEGLHIVVDAGNGAGGFFAEKVLEPLGAIT  319

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
              GS  L PDG+FPNHIPNPEDK AM     AVL N ADLG++FDTDVDRS  VD +G  +
Sbjct  320   TGSQFLEPDGLFPNHIPNPEDKEAMKAITQAVLANQADLGIIFDTDVDRSAAVDSTGREL  379

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVH  850
             N +RLIALMSAIVL++HPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + 
Sbjct  380   NRNRLIALMSAIVLEKHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIR  439

Query  849   LNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMK---LEGSEEGIGSLIK  679
             LN  G E+HL +ETSGHGALKEN++LDDGAY++VK++ ++   +   + G  E +  L++
Sbjct  440   LNSVGEESHLAIETSGHGALKENHWLDDGAYLMVKLLNKLASARASGIGGGSEVLTDLVE  499

Query  678   DLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCL  499
              L+EP    ELR+ +  +  H   K      SFR Y E                     +
Sbjct  500   GLQEPAAAVELRLKI--DKSHEDLKG----GSFREYGE--------------------AV  533

Query  498   VDTNDHPAAIDAFMYRAKVSNE---ENGEHGWVHLRQSIHNPNIAVNLQS  358
             +   ++    D  + +A V+ E    +G  GW  LR S+H+P + +N+++
Sbjct  534   LKLLENLTDSDPKLQKAPVNYEGVRASGFGGWFLLRLSLHDPVLPLNIEA  583



>ref|WP_038299109.1| phosphoglucomutase [[Clostridium] mangenotii]
Length=506

 Score =   399 bits (1025),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 223/533 (42%), Positives = 318/533 (60%), Gaps = 44/533 (8%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RG+A   ++ R V+LT   VE I  +F  W+      ++       V +++G
Sbjct  3     KLQNGSDIRGIAYPNDE-REVNLTKDVVEKIFTAFHIWLKKKTNKDK-------VSIAIG  54

Query  1701  MDPRISGKSLSAAVFAGLGQAG--CLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHL  1528
              D RI+G+         L +    C V D  +ATTPA FM+T++  +  D S+M+TASHL
Sbjct  55    TDSRITGEEFRDIAIDVLKKKNKDCDVLDCKMATTPAMFMTTIMDGYDCDGSVMITASHL  114

Query  1527  PYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRA--PPSKVDF---MSA  1363
             PY  NG KFFTK GGL    ++ I D A+    ++       ++      KV +   +  
Sbjct  115   PYYHNGFKFFTKDGGLEKGNIKEILDIASELIQDKADDTLDNIKENIKEGKVTYPKLIED  174

Query  1362  YAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNP  1183
             Y+  L + I+E V+   +Y+ PL+G +I+V+AGNG+GGFF   +L+KLGADT GS  L+P
Sbjct  175   YSHILVEKIREGVSSKENYEKPLEGIKILVDAGNGAGGFFVDQILNKLGADTTGSQFLDP  234

Query  1182  DGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIAL  1003
             DGMFPNHIPNPE+K AM     +V++N +DLG++FDTDVDR+ +V + G PIN + LIAL
Sbjct  235   DGMFPNHIPNPENKEAMKSICDSVIKNKSDLGIIFDTDVDRAALVGKGGKPINKNALIAL  294

Query  1002  MSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETH  823
             +S IVL EHP TT+VTD+ TS GLT+FI   GG H  ++ GY+NVI++ V LNE+G E H
Sbjct  295   ISKIVLNEHPNTTIVTDSITSDGLTKFIDNIGGIHHRFKRGYKNVINEAVRLNEEGKECH  354

Query  822   LMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELR  643
             + +ETSGH ALKENYFLDDG+Y++ KI+IE+ K++L G    +  L+KDLEE  E  E R
Sbjct  355   IAIETSGHAALKENYFLDDGSYLIAKILIEVAKLRLNGMT--VDDLLKDLEEAKEDGEFR  412

Query  642   MDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDA  463
             + +  +    K  A + I+    YI   NL GW +       +   C             
Sbjct  413   IKI--DVEDFKPYAEDIIKDLEEYIL--NLDGWSVVPKNYEGIRVNC-------------  455

Query  462   FMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFL  304
                     ++ENG+ GW  LR S+H P + +N++SN  GG   +   L +KFL
Sbjct  456   --------DKENGD-GWFLLRISLHEPLLVLNIESNKIGGIDVIYAKL-EKFL  498



>ref|XP_010453951.1| PREDICTED: uncharacterized protein LOC104735795 isoform X1 [Camelina 
sativa]
Length=609

 Score =   402 bits (1033),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 251/608 (41%), Positives = 345/608 (57%), Gaps = 52/608 (9%)
 Frame = -1

Query  2121  NPNFPQKSFTMASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVES  1942
             N N  Q  F       T    QT A  P +P   +   L  S+  + +F K   ++  ++
Sbjct  8     NFNVVQSCFLQNKQFKTRFQSQTSALLP-YPRGKLSLHLSSSMR-SHTFSKYLSAISKQT  65

Query  1941  SLTANKHNEVAVDEEMEKIR--RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEW  1768
             +   N     A    + KI   +LQNGSD+RG+A+ G +G  + L  P  EAIA +FG+W
Sbjct  66    TFYCNAATSSATAPSLGKIDFLKLQNGSDIRGLAVPGVEGEPLSLPEPVSEAIAAAFGQW  125

Query  1767  VISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFM  1588
             +       +  A    +RVS+G D RIS ++L  AV  GLG +G  V   GLA+TPA F 
Sbjct  126   L-----QHKKKAESRRLRVSIGHDSRISAQTLLEAVSRGLGVSGLDVVQFGLASTPAMFN  180

Query  1587  STVLPPFQY----DASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN--  1426
             ST+     +    D +IM+TASHLPY RNG KFFT  GGL   +++ I ++AA  Y N  
Sbjct  181   STLTEDESFLCPADGAIMITASHLPYNRNGFKFFTSDGGLGKVDIKNILERAADIYKNVS  240

Query  1425  -RMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGG  1249
                 K S    +   KVD+MS Y   L   ++         + PL+GF I+V+AGNG+GG
Sbjct  241   DENLKKSQRETSSIKKVDYMSVYTSGLVKAVRRAAGD---LEKPLEGFHIVVDAGNGAGG  297

Query  1248  FFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTD  1069
             FF   VL+ LGA T GS  L PDGMFPNHIPNPEDK+AM     AVL N ADLG++FDTD
Sbjct  298   FFAAKVLEPLGAITSGSQFLEPDGMFPNHIPNPEDKSAMEAIIKAVLDNKADLGIIFDTD  357

Query  1068  VDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCL  892
             VDRS  VD +G   N +RLIAL+SAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  
Sbjct  358   VDRSAAVDSTGREFNRNRLIALLSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHR  417

Query  891   YRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLE  712
             ++ GY+NVID+ + LN +G E+HL +ETSGHGALKEN++LDDGAY++VK++ ++   +  
Sbjct  418   FKRGYKNVIDEAIRLNSNGEESHLAIETSGHGALKENHWLDDGAYLMVKLLNKLAAARAA  477

Query  711   GSEEG---IGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWE  541
             G   G   +  L++ LEEP    ELR+ +     H   +       FR Y EK       
Sbjct  478   GQGSGSKVLTDLVEGLEEPRVALELRLKI--NKNHPDLEG----RDFREYGEK------V  525

Query  540   LDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAV  370
             L    +        ++TN +       + RA V+ E    +G  GW  LR S+H+P + +
Sbjct  526   LQHLSNS-------IETNPN-------LKRAPVNYEGIRVSGFGGWFLLRLSLHDPVLPL  571

Query  369   NLQSNIPG  346
             N+++   G
Sbjct  572   NIEAQSEG  579



>ref|WP_027208029.1| phosphoglucomutase [Butyrivibrio fibrisolvens]
Length=514

 Score =   399 bits (1025),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 237/549 (43%), Positives = 328/549 (60%), Gaps = 50/549 (9%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNGSD+RG+A+  E G SV+LT  A + +A +F +W+    ++++       V+++LG 
Sbjct  6     LQNGSDIRGIAMDNETGASVNLTNKASKDLAGAFAKWLSKRNDNKK-------VKIALGR  58

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQ-----YDASIMMTAS  1534
             D R++G++L  A  AG+   G  V D G+A+TPA FMSTVL   +     +D SIM+TAS
Sbjct  59    DSRLTGEALLKAAAAGIIAQGHEVCDFGIASTPAMFMSTVLASDEDDAATFDGSIMITAS  118

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAK  1354
             HLPY RNGLKFFTK+GGL   +++ + + A +  A           A    ++FM  YA 
Sbjct  119   HLPYYRNGLKFFTKEGGLEKGDIKELTELADKILAEDPDDSVDVSSADIKSINFMDTYAS  178

Query  1353  HLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGM  1174
             +L+  I++ V      D PL+G  IIV+AGNG+GGF+   VL+ LGADT GS  L PDG 
Sbjct  179   YLQKKIRDGVGKG---DKPLEGLHIIVDAGNGAGGFYVTKVLEPLGADTSGSQFLTPDGR  235

Query  1173  FPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSA  994
             FPNHIPNPE+K A    + A L + ADLG++FDTDVDR+G V  SG  +  + LIA++S 
Sbjct  236   FPNHIPNPENKEAAESIKKATLDSKADLGIIFDTDVDRAGAVLPSGKTLTRNDLIAVLSM  295

Query  993   IVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             I L EHPGTT+VTD+ TS GL  FI   GG+H  ++ GYRNVID+ + LN +G+++ L +
Sbjct  296   IALSEHPGTTIVTDSVTSDGLHDFIEAHGGKHKRFKRGYRNVIDESIRLNNEGIDSQLAI  355

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVK-MKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             ETSGHGA KENYFLDDGAY++VK++IEM K  KLE        +IKDL EP E+ E+R  
Sbjct  356   ETSGHGAFKENYFLDDGAYLMVKLLIEMGKGKKLE-------EMIKDLSEPCESDEVRFP  408

Query  636   VLSEPRHAKAKAVEAIESFRHYIE-KGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF  460
             V ++               +   E  G + GW L         EG  V+T          
Sbjct  409   VYADKIEGGDLQSNGDRILKMLEEAAGKVEGWSLPESN----YEGVRVNT----------  454

Query  459   MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKF  280
                     ++N   GW+ LR+S+H P + +N++SN  GG   MA  L++  +LAGE    
Sbjct  455   --------DKNHGDGWLLLRKSLHEPIMPLNIESNTKGGNLIMATKLKE--ILAGE--DT  502

Query  279   LDISQIDEF  253
             LD S +D F
Sbjct  503   LDQSPLDAF  511



>ref|WP_016778576.1| phosphoglucomutase [Anaerophaga thermohalophila]
Length=510

 Score =   399 bits (1024),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 226/528 (43%), Positives = 315/528 (60%), Gaps = 41/528 (8%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
              + L NGSD+RG+A +G +G  V+  P  VE +  +F  W+ +    +      + +R+S
Sbjct  6     FKALHNGSDIRGIARKGLQGEQVNFGPEVVEKLGRAFVIWLQTYFSGK------DKLRIS  59

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHL  1528
             +G D R SG  LS A+  GL  AG  V D GLA+TPA FMST L     DA IM+T SH 
Sbjct  60    VGRDCRHSGAELSEALCNGLTMAGADVVDFGLASTPAMFMSTQLGENPVDAGIMITGSHA  119

Query  1527  PYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
             P  RNGLKFFT +GGL   ++  I D  A    +++ +  + +R      DFM  Y+++L
Sbjct  120   PQNRNGLKFFTSEGGLDKDDITEILD-LAENNPHKVRRKGSIIRQ-----DFMKTYSQYL  173

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
              +++K+ V H   +D PL+G +I+V+AGNG GGFF  +VL  LGAD   S  L PDG FP
Sbjct  174   SEVVKKGVKHAEVHDKPLKGLKIVVDAGNGCGGFFATEVLQPLGADVSESQFLEPDGNFP  233

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NH  +PED TA+      V ++ ADLGV+FDTDVDR+G VD +G P+N + LIALMSAIV
Sbjct  234   NHASDPEDTTAIVSLSNKVKESKADLGVIFDTDVDRTGFVDDTGKPVNRNSLIALMSAIV  293

Query  987   LKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMME  811
             LKEHPG+T+VTD+ TS GL+ FI    GG+H  Y+ GY+NVI++ V LN  G ET L +E
Sbjct  294   LKEHPGSTIVTDSITSDGLSWFINEHLGGKHHRYQRGYKNVINEAVRLNGIGQETWLAIE  353

Query  810   TSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVL  631
             TSGH A KENYFLDDGAY   K+II +  ++ +G    +  LIKDL +P+++ E+R+ + 
Sbjct  354   TSGHAAFKENYFLDDGAYTATKMIITLANLRSQGKR--LNELIKDLPDPVDSCEVRLKI-  410

Query  630   SEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYR  451
                            +F  YI+ G+      D   +  +  G   + +  P   +    R
Sbjct  411   ---------------NFPDYIQAGS------DIISEVGIMAGNKSNWDLLPENYEGV--R  447

Query  450   AKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
              K S    G+ GW  LR S+H+P +A+N++SN  GG Q +A +L D F
Sbjct  448   VKCSGP--GQDGWFLLRLSLHDPVLALNIESNESGGVQKIAEELYDFF  493



>ref|XP_010492710.1| PREDICTED: probable phosphoglucomutase-2 isoform X2 [Camelina 
sativa]
Length=540

 Score =   399 bits (1026),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 233/525 (44%), Positives = 319/525 (61%), Gaps = 55/525 (10%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V L  P  EAIA +FG+W+       +  A    +RVS+G
Sbjct  20    KLQNGSDIRGVAVLGVEGEPVSLPEPVSEAIAAAFGQWL-----QHKKKAESRRLRVSVG  74

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS ++L  AV  GLG +G  V   GLA+TPA F ST+     +    D +IM+TAS
Sbjct  75    HDSRISAQTLLEAVSRGLGVSGLDVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITAS  134

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN------RMAKVSTALRAPPSKVDF  1372
             HLPY RNG KFFT  GGL   +++ I ++AA  Y N      + ++  T+++    KVD+
Sbjct  135   HLPYNRNGFKFFTSDGGLGKVDIKNILERAADIYKNVSDENLKKSQKQTSIK----KVDY  190

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             MS Y   L   ++         + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  
Sbjct  191   MSVYTSGLVKAVRRAAGD---LEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQF  247

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             L PDGMFPNHIPNPEDK+AM     AVL N  DLG++FDTDVDRS  VD +G   N +RL
Sbjct  248   LEPDGMFPNHIPNPEDKSAMEAIIKAVLDNKTDLGIIFDTDVDRSAAVDSAGREFNRNRL  307

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDG  835
             IAL+SAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN +G
Sbjct  308   IALLSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSNG  367

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEP  664
              E+HL +ETSGHGALKEN++LDDGAY++VK++ ++   +  G   G   +  L++ LEEP
Sbjct  368   EESHLAIETSGHGALKENHWLDDGAYLMVKLLNKLAAARAAGQGSGSKVLTDLVEGLEEP  427

Query  663   LETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTND  484
                 ELR+ +     HA  +       FR Y EK       L    +        ++TN 
Sbjct  428   RVALELRLKI--NKNHADLEG----RDFREYGEK------VLQHLSNS-------IETNP  468

Query  483   HPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQS  358
             +       + RA V+ E    +G  GW  LR S+H+P + +N+++
Sbjct  469   N-------LKRAPVNYEGIRVSGFGGWFLLRLSLHDPVLPLNIEA  506



>ref|WP_034548816.1| phosphoglucomutase [Carnobacterium alterfunditum]
Length=508

 Score =   398 bits (1023),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 226/529 (43%), Positives = 314/529 (59%), Gaps = 45/529 (9%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWV--ISGLESERGGAVVESVRVSL  1705
             LQNGSD+RG+A++  +   + LT   VE IA  F  W+  +  L +E      + ++VS+
Sbjct  9     LQNGSDIRGIAIRTPE-HEITLTDERVEKIAYGFAVWLKEVKKLATEDEN---KPLKVSV  64

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+S + +  A   GL  AG  V D+GL+TTPA FMST    +  D ++M+TASHLP
Sbjct  65    GHDSRLSAERIKTAFTRGLTNAGINVIDVGLSTTPAMFMSTKYDSYACDGAVMVTASHLP  124

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARK---YANRMAKVSTALRAPPSKVDFMSAYAK  1354
             +  NGLKFFTK GG    +++ I   A RK   + N   KVS            ++ YAK
Sbjct  125   FEYNGLKFFTKDGGAEHEDIDFILQHADRKNIMWENNQGKVSAR--------SLLNEYAK  176

Query  1353  HLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGM  1174
              L D I+  +NH  HY+ PL G  I+V+AGNG+GGFF   VL  LG++  GS +L PDG 
Sbjct  177   DLVDKIRVGINHKDHYEKPLTGRHIVVDAGNGAGGFFAEKVLVPLGSNIQGSQYLEPDGN  236

Query  1173  FPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSA  994
             FPNHIPNP++K AM   + AVL+N AD+GV+FDTDVDRS +VD  G P+N + LI ++SA
Sbjct  237   FPNHIPNPDNKEAMKSIQEAVLKNKADIGVIFDTDVDRSALVDSKGEPLNRNNLIGVISA  296

Query  993   IVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             I++KE+PGTT+VT + TS  L  FIT  GG+   Y  GYRNVI++ + LN++G+ T L +
Sbjct  297   ILIKENPGTTIVTSSATSEHLKTFITSLGGKQDRYITGYRNVINRAIQLNKEGIPTSLAI  356

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDV  634
             ETSGH ALKENYFLDDGAY+V KI++    ++ EG  +    LI  L +P+ET E+R  +
Sbjct  357   ETSGHAALKENYFLDDGAYLVAKILMADADLQKEG--KSFSDLITSLNQPVETDEVRFKI  414

Query  633   LSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMY  454
             L  P   +    + +ESF+ +IEK      E D   +    EG  V+T        A  Y
Sbjct  415   L--PEDIRTTGAKVMESFQSFIEK------ESDLSVEPANLEGVRVNT--------AGKY  458

Query  453   RAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                         GW+ LR S+H P + +NL+S+  G  + +   L+  F
Sbjct  459   GT----------GWMLLRMSLHEPLLVLNLESDQEGSIKILRERLKTFF  497



>ref|XP_011031738.1| PREDICTED: uncharacterized protein LOC105130769 isoform X4 [Populus 
euphratica]
Length=525

 Score =   399 bits (1025),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 234/523 (45%), Positives = 314/523 (60%), Gaps = 48/523 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V LT P  EAIA +F  W+   LE +R  A  + +RVS+G
Sbjct  2     KLQNGSDIRGVAVDGVEGEPVTLTEPVTEAIAAAFSAWL---LEMKRADAS-KPLRVSVG  57

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS + L  AV  G+  AG  V   GLA+TPA F ST+     +    D +IM+TAS
Sbjct  58    HDSRISAQVLQDAVSQGIAVAGLDVVQYGLASTPAMFNSTLTEDEAFLCPVDGAIMITAS  117

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN----RMAKVSTALRAPPSKVDFMS  1366
             HLPY RNG KFFT  GGL   +++ I ++AA  Y +     + K          +VD+M+
Sbjct  118   HLPYNRNGFKFFTNAGGLGKADIKIILERAADIYKSFTDQGLMKSKQKASESIKRVDYMT  177

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL  LGA T GS  L 
Sbjct  178   VYTS---DLVKAVRKAAENIEKPLEGFHIVVDAGNGAGGFFAEKVLQPLGAITSGSQFLE  234

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNHIPNPEDKTAM     AVL+N ADLG++FDTDVDRS  VD  G   N +RLIA
Sbjct  235   PDGMFPNHIPNPEDKTAMKAITQAVLENKADLGIIFDTDVDRSAAVDSIGREFNRNRLIA  294

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ V LN  G E
Sbjct  295   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAVRLNSVGEE  354

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLE  658
             +HL +ETSGHGAL+EN++LDDGAY++VK++ ++   +  G   G   +  L++ L+EP  
Sbjct  355   SHLAIETSGHGALRENHWLDDGAYLMVKVLNKLASARASGIAGGSKVLTDLVEGLQEPGV  414

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
               ELR+ +  +  H   K      SFR Y                    E  L    +H 
Sbjct  415   AVELRLKI--DQNHPDLKG----GSFREY-------------------GEAVLQLLENHI  449

Query  477   AAIDAFMYRAKVSNE---ENGEHGWVHLRQSIHNPNIAVNLQS  358
              + D  + +A V+ E    +G  GW  LR S+H+P + +N+++
Sbjct  450   ES-DPKLQKAPVNYEGVRASGFDGWFLLRLSLHDPVLPLNIEA  491



>ref|NP_001059541.1| Os07g0447800 [Oryza sativa Japonica Group]
 dbj|BAC79968.1| putative phosphoglucomutase precursor, chloroplast [Oryza sativa 
Japonica Group]
 dbj|BAF21455.1| Os07g0447800 [Oryza sativa Japonica Group]
 dbj|BAG89249.1| unnamed protein product [Oryza sativa Japonica Group]
Length=543

 Score =   399 bits (1026),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 230/523 (44%), Positives = 319/523 (61%), Gaps = 48/523 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V+LT P  EAIA +F  W+++  +++        +R+S+G
Sbjct  20    KLQNGSDIRGVAVGGVEGEPVNLTEPVTEAIASAFAAWLLNKKKADGW----RRLRISVG  75

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV----LPPFQYDASIMMTAS  1534
              D RIS   L  AV  G+  AG  V   GLA+TPA F ST+    +     D +IM+TAS
Sbjct  76    HDSRISAHKLQDAVTLGITTAGHDVLQFGLASTPAMFNSTLTEDEINHCPVDGAIMITAS  135

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANR----MAKVSTALRAPPSKVDFMS  1366
             HLPY RNGLKFFT  GGL   +++ I ++A+R Y +       ++  A +   S VD+MS
Sbjct  136   HLPYNRNGLKFFTSAGGLNKADIKDILERASRIYEDSSHGSTQELEQASKGEVSNVDYMS  195

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              YA    D++K       + + PL+G  I+V+AGNG+GGFF   VL  LGA T GS  L 
Sbjct  196   IYAS---DLVKAVRKSAGNKEKPLEGLHIVVDAGNGAGGFFVDKVLKPLGAITTGSQFLE  252

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNHIPNPEDKTAM     AV  N ADLG++FDTDVDRS  VD SG  +N +RLIA
Sbjct  253   PDGMFPNHIPNPEDKTAMKAITQAVADNKADLGIIFDTDVDRSAAVDSSGRELNRNRLIA  312

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G E
Sbjct  313   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIENKLGGKHHRFKRGYKNVIDEAIRLNTIGEE  372

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLE  658
             +HL METSGHGALKEN++LDDGAY++VK++ ++   ++     G   +  L++ LEE   
Sbjct  373   SHLAMETSGHGALKENHWLDDGAYLMVKLLNKLAAARILNPNVGSKVLTDLVEGLEEASV  432

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
             T E+R+ +  +  HA  K      SFR Y E                     ++   ++ 
Sbjct  433   TVEIRLKI--DQNHADLKG----GSFRDYGE--------------------AVLKHLENA  466

Query  477   AAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQS  358
              + D ++ +A  + E    +G  GW  LR S+H+P + +N+++
Sbjct  467   ISKDEYLCKAPKNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEA  509



>ref|XP_011031737.1| PREDICTED: uncharacterized protein LOC105130769 isoform X3 [Populus 
euphratica]
Length=543

 Score =   399 bits (1025),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 236/530 (45%), Positives = 318/530 (60%), Gaps = 50/530 (9%)
 Frame = -1

Query  1896  MEKI--RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVE  1723
             +EK+   +LQNGSD+RGVA+ G +G  V LT P  EAIA +F  W+   LE +R  A  +
Sbjct  13    LEKVDFMKLQNGSDIRGVAVDGVEGEPVTLTEPVTEAIAAAFSAWL---LEMKRADAS-K  68

Query  1722  SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DA  1555
              +RVS+G D RIS + L  AV  G+  AG  V   GLA+TPA F ST+     +    D 
Sbjct  69    PLRVSVGHDSRISAQVLQDAVSQGIAVAGLDVVQYGLASTPAMFNSTLTEDEAFLCPVDG  128

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN----RMAKVSTALRAPP  1387
             +IM+TASHLPY RNG KFFT  GGL   +++ I ++AA  Y +     + K         
Sbjct  129   AIMITASHLPYNRNGFKFFTNAGGLGKADIKIILERAADIYKSFTDQGLMKSKQKASESI  188

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VD+M+ Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL  LGA T
Sbjct  189   KRVDYMTVYTS---DLVKAVRKAAENIEKPLEGFHIVVDAGNGAGGFFAEKVLQPLGAIT  245

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
              GS  L PDGMFPNHIPNPEDKTAM     AVL+N ADLG++FDTDVDRS  VD  G   
Sbjct  246   SGSQFLEPDGMFPNHIPNPEDKTAMKAITQAVLENKADLGIIFDTDVDRSAAVDSIGREF  305

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVH  850
             N +RLIALMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ V 
Sbjct  306   NRNRLIALMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAVR  365

Query  849   LNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIK  679
             LN  G E+HL +ETSGHGAL+EN++LDDGAY++VK++ ++   +  G   G   +  L++
Sbjct  366   LNSVGEESHLAIETSGHGALRENHWLDDGAYLMVKVLNKLASARASGIAGGSKVLTDLVE  425

Query  678   DLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCL  499
              L+EP    ELR+ +  +  H   K      SFR Y                    E  L
Sbjct  426   GLQEPGVAVELRLKI--DQNHPDLKG----GSFREY-------------------GEAVL  460

Query  498   VDTNDHPAAIDAFMYRAKVSNE---ENGEHGWVHLRQSIHNPNIAVNLQS  358
                 +H  + D  + +A V+ E    +G  GW  LR S+H+P + +N+++
Sbjct  461   QLLENHIES-DPKLQKAPVNYEGVRASGFDGWFLLRLSLHDPVLPLNIEA  509



>ref|XP_010492709.1| PREDICTED: uncharacterized protein LOC104770060 isoform X1 [Camelina 
sativa]
Length=612

 Score =   401 bits (1031),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 239/562 (43%), Positives = 335/562 (60%), Gaps = 57/562 (10%)
 Frame = -1

Query  1986  AQSFPKIKLSLRVESSLTANKHNEVAVDEEMEKIR--RLQNGSDVRGVALQGEKGRSVDL  1813
             + +F K + ++  +++   N  +  A    + KI   +LQNGSD+RGVA+ G +G  V L
Sbjct  55    SHTFSKYQPAISKQTTFYCNAASSSATAPSLGKIDFLKLQNGSDIRGVAVLGVEGEPVSL  114

Query  1812  TPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGC  1633
               P  EAIA +FG+W+       +  A    +RVS+G D RIS ++L  AV  GLG +G 
Sbjct  115   PEPVSEAIAAAFGQWL-----QHKKKAESRRLRVSVGHDSRISAQTLLEAVSRGLGVSGL  169

Query  1632  LVFDMGLATTPACFMSTVLPPFQY----DASIMMTASHLPYTRNGLKFFTKKGGLTSTEV  1465
              V   GLA+TPA F ST+     +    D +IM+TASHLPY RNG KFFT  GGL   ++
Sbjct  170   DVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITASHLPYNRNGFKFFTSDGGLGKVDI  229

Query  1464  EAICDKAARKYAN------RMAKVSTALRAPPSKVDFMSAYAKHLRDIIKERVNHPTHYD  1303
             + I ++AA  Y N      + ++  T+++    KVD+MS Y   L   ++         +
Sbjct  230   KNILERAADIYKNVSDENLKKSQKQTSIK----KVDYMSVYTSGLVKAVRRAAGD---LE  282

Query  1302  TPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMT  1123
              PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L PDGMFPNHIPNPEDK+AM   
Sbjct  283   KPLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLEPDGMFPNHIPNPEDKSAMEAI  342

Query  1122  RAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDART  943
               AVL N  DLG++FDTDVDRS  VD +G   N +RLIAL+SAIVL+EHPGTT+VTD+ T
Sbjct  343   IKAVLDNKTDLGIIFDTDVDRSAAVDSAGREFNRNRLIALLSAIVLEEHPGTTIVTDSVT  402

Query  942   SMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDD  766
             S GLT FI  + GG+H  ++ GY+NVID+ + LN +G E+HL +ETSGHGALKEN++LDD
Sbjct  403   SDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSNGEESHLAIETSGHGALKENHWLDD  462

Query  765   GAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVE  595
             GAY++VK++ ++   +  G   G   +  L++ LEEP    ELR+ +     HA  +   
Sbjct  463   GAYLMVKLLNKLAAARAAGQGSGSKVLTDLVEGLEEPRVALELRLKI--NKNHADLEG--  518

Query  594   AIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEE---NG  424
                 FR Y EK       L    +        ++TN +       + RA V+ E    +G
Sbjct  519   --RDFREYGEK------VLQHLSNS-------IETNPN-------LKRAPVNYEGIRVSG  556

Query  423   EHGWVHLRQSIHNPNIAVNLQS  358
               GW  LR S+H+P + +N+++
Sbjct  557   FGGWFLLRLSLHDPVLPLNIEA  578



>gb|EEE67095.1| hypothetical protein OsJ_24083 [Oryza sativa Japonica Group]
Length=568

 Score =   400 bits (1027),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 230/523 (44%), Positives = 319/523 (61%), Gaps = 48/523 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V+LT P  EAIA +F  W+++  +++        +R+S+G
Sbjct  45    KLQNGSDIRGVAVGGVEGEPVNLTEPVTEAIASAFAAWLLNKKKADGW----RRLRISVG  100

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV----LPPFQYDASIMMTAS  1534
              D RIS   L  AV  G+  AG  V   GLA+TPA F ST+    +     D +IM+TAS
Sbjct  101   HDSRISAHKLQDAVTLGITTAGHDVLQFGLASTPAMFNSTLTEDEINHCPVDGAIMITAS  160

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANR----MAKVSTALRAPPSKVDFMS  1366
             HLPY RNGLKFFT  GGL   +++ I ++A+R Y +       ++  A +   S VD+MS
Sbjct  161   HLPYNRNGLKFFTSAGGLNKADIKDILERASRIYEDSSHGSTQELEQASKGEVSNVDYMS  220

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              YA    D++K       + + PL+G  I+V+AGNG+GGFF   VL  LGA T GS  L 
Sbjct  221   IYAS---DLVKAVRKSAGNKEKPLEGLHIVVDAGNGAGGFFVDKVLKPLGAITTGSQFLE  277

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNHIPNPEDKTAM     AV  N ADLG++FDTDVDRS  VD SG  +N +RLIA
Sbjct  278   PDGMFPNHIPNPEDKTAMKAITQAVADNKADLGIIFDTDVDRSAAVDSSGRELNRNRLIA  337

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G E
Sbjct  338   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIENKLGGKHHRFKRGYKNVIDEAIRLNTIGEE  397

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLE  658
             +HL METSGHGALKEN++LDDGAY++VK++ ++   ++     G   +  L++ LEE   
Sbjct  398   SHLAMETSGHGALKENHWLDDGAYLMVKLLNKLAAARILNPNVGSKVLTDLVEGLEEASV  457

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
             T E+R+ +  +  HA  K      SFR Y E                     ++   ++ 
Sbjct  458   TVEIRLKI--DQNHADLKG----GSFRDYGE--------------------AVLKHLENA  491

Query  477   AAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQS  358
              + D ++ +A  + E    +G  GW  LR S+H+P + +N+++
Sbjct  492   ISKDEYLCKAPKNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEA  534



>ref|XP_010453952.1| PREDICTED: probable phosphoglucomutase-2 isoform X2 [Camelina 
sativa]
Length=541

 Score =   399 bits (1025),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 233/526 (44%), Positives = 316/526 (60%), Gaps = 48/526 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RG+A+ G +G  + L  P  EAIA +FG+W+       +  A    +RVS+G
Sbjct  20    KLQNGSDIRGLAVPGVEGEPLSLPEPVSEAIAAAFGQWL-----QHKKKAESRRLRVSIG  74

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS ++L  AV  GLG +G  V   GLA+TPA F ST+     +    D +IM+TAS
Sbjct  75    HDSRISAQTLLEAVSRGLGVSGLDVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITAS  134

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN---RMAKVSTALRAPPSKVDFMSA  1363
             HLPY RNG KFFT  GGL   +++ I ++AA  Y N      K S    +   KVD+MS 
Sbjct  135   HLPYNRNGFKFFTSDGGLGKVDIKNILERAADIYKNVSDENLKKSQRETSSIKKVDYMSV  194

Query  1362  YAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNP  1183
             Y   L   ++         + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L P
Sbjct  195   YTSGLVKAVRRAAGD---LEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLEP  251

Query  1182  DGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIAL  1003
             DGMFPNHIPNPEDK+AM     AVL N ADLG++FDTDVDRS  VD +G   N +RLIAL
Sbjct  252   DGMFPNHIPNPEDKSAMEAIIKAVLDNKADLGIIFDTDVDRSAAVDSTGREFNRNRLIAL  311

Query  1002  MSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVET  826
             +SAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN +G E+
Sbjct  312   LSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSNGEES  371

Query  825   HLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLET  655
             HL +ETSGHGALKEN++LDDGAY++VK++ ++   +  G   G   +  L++ LEEP   
Sbjct  372   HLAIETSGHGALKENHWLDDGAYLMVKLLNKLAAARAAGQGSGSKVLTDLVEGLEEPRVA  431

Query  654   AELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPA  475
              ELR+ +     H   +       FR Y EK       L    +        ++TN +  
Sbjct  432   LELRLKI--NKNHPDLEG----RDFREYGEK------VLQHLSNS-------IETNPN--  470

Query  474   AIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPG  346
                  + RA V+ E    +G  GW  LR S+H+P + +N+++   G
Sbjct  471   -----LKRAPVNYEGIRVSGFGGWFLLRLSLHDPVLPLNIEAQSEG  511



>ref|XP_009344762.1| PREDICTED: uncharacterized protein LOC103936642 isoform X1 [Pyrus 
x bretschneideri]
Length=619

 Score =   401 bits (1031),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 240/560 (43%), Positives = 333/560 (59%), Gaps = 52/560 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  + LT P  EAI  +F  W++   +++      + +R+S+G
Sbjct  95    KLQNGSDIRGVAVAGVEGEPISLTEPVSEAIGAAFAAWLVEKKKADGS----QRLRISVG  150

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS K L  A+  G+  AG  V   GLA+TPA F ST+     +    D SIM+TAS
Sbjct  151   HDSRISAKKLEDAISRGIASAGLDVVQYGLASTPAMFNSTITEDESFLCPSDGSIMITAS  210

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALR----APPSKVDFMS  1366
             HLPY RNG KFFT  GGL   +++ I ++AA  Y     +  T+ +    A   +VD+MS
Sbjct  211   HLPYNRNGFKFFTNSGGLGKPDIKNILERAADVYDKFTVEGLTSSKEKVLASVKRVDYMS  270

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L 
Sbjct  271   VYTS---DLVKAVRKAAGNIEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAVTTGSQFLE  327

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD +G   N +RLIA
Sbjct  328   PDGMFPNHIPNPEDKTAMKAITQAVLDNKADLGIIFDTDVDRSAAVDSTGLEFNRNRLIA  387

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G E
Sbjct  388   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEE  447

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLE  658
             +HL +ETSGHGALKEN++LDDGAY++VKI+ ++   +  G   G   +  L++ LEEP  
Sbjct  448   SHLAIETSGHGALKENHWLDDGAYLMVKILNKLASARASGQVGGSKVLTGLLEGLEEPGF  507

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
             + ELR+ +     H   K      SFR Y                    E  L    ++ 
Sbjct  508   SVELRLKI--NQSHPDLKG----GSFRDY-------------------GEAVLKHLENYI  542

Query  477   AAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
              + D  + +A V+ E    +G  GW  LR S+H+P + +N+++  P   ++++  L +  
Sbjct  543   NS-DPKLKKAPVNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEA--PSNNEAVS--LGNIV  597

Query  306   LLAGEMAKFLDISQIDEFAR  247
             L A +    LD S +D+F +
Sbjct  598   LAAVKEFPALDTSALDKFVQ  617



>gb|KFK25970.1| hypothetical protein AALP_AA8G186700 [Arabis alpina]
Length=542

 Score =   399 bits (1024),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 234/523 (45%), Positives = 316/523 (60%), Gaps = 48/523 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V L  P  EAIA +FG+W+   L  ++ G+    +RVS+G
Sbjct  20    KLQNGSDIRGVAVTGVEGEPVSLPEPVTEAIAAAFGQWL---LHKKKAGS--RQLRVSVG  74

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS ++L  AV  GLG +G  V   GLA+TPA F ST+     +    D +IM+TAS
Sbjct  75    HDSRISAQTLLEAVSRGLGVSGLDVVQFGLASTPAMFNSTLTEDEAFLCPADGAIMITAS  134

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN---RMAKVSTALRAPPSKVDFMSA  1363
             HLPY RNG KFFT  GGL   +++ I ++AA  Y N      + S    +   K+D+M  
Sbjct  135   HLPYNRNGFKFFTCDGGLGKVDIKDILERAADIYKNVSDENLRKSQRETSSIKKIDYMGV  194

Query  1362  YAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNP  1183
             Y   L   ++           PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L P
Sbjct  195   YTSGLVKAVQRAAGDLVK---PLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQFLEP  251

Query  1182  DGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIAL  1003
             DGMFPNHIPNPEDK+AM     AVL N ADLG++FDTDVDRS  VD +G   N +RLIAL
Sbjct  252   DGMFPNHIPNPEDKSAMEAITKAVLDNKADLGIIFDTDVDRSAAVDSTGREFNRNRLIAL  311

Query  1002  MSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVET  826
             +SAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G ET
Sbjct  312   LSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEET  371

Query  825   HLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLET  655
             HL +ETSGHGALKEN++LDDGAY++VKI+ ++   +  G   G   +  L+  LEEP   
Sbjct  372   HLAIETSGHGALKENHWLDDGAYLMVKILNKLASARAAGKGSGSKVLTDLVDGLEEPRVA  431

Query  654   AELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPA  475
              ELR+ +  +  H   + ++    FR Y EK       L    +        ++TN    
Sbjct  432   LELRLKI--DKNHPDLEGID----FREYGEK------VLQHVSNS-------IETNPD--  470

Query  474   AIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSN  355
                  + RA V+ E    +G  GW  LR S+H+P + +N+++ 
Sbjct  471   -----LKRAPVNFEGIRVSGFGGWFLLRLSLHDPVLPLNIEAQ  508



>ref|WP_015260295.1| Phosphomannomutase [Thioalkalivibrio nitratireducens]
 ref|YP_007218681.1| Phosphomannomutase [Thioalkalivibrio nitratireducens DSM 14787]
 gb|AGA35200.1| Phosphomannomutase [Thioalkalivibrio nitratireducens DSM 14787]
Length=518

 Score =   398 bits (1022),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 225/525 (43%), Positives = 312/525 (59%), Gaps = 51/525 (10%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM  1699
             LQNGSD+RG+A+    G   +LTP     +  +F  W+   LE        E + V++G 
Sbjct  16    LQNGSDIRGIAM----GPRAELTPEVAHRLGRAFAAWLARSLER-----APEGLTVAVGR  66

Query  1698  DPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLPYT  1519
             D R++G  L +++  GL + G  VFD+GLA+TPA FMSTV P +  D ++M+TASHLP  
Sbjct  67    DSRLTGPDLMSSLMQGLARDGLRVFDLGLASTPAMFMSTVTPGYACDGAVMLTASHLPPD  126

Query  1518  RNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPS----KVDFMSAYAKH  1351
             RNG KFFT++GGL   +V  + +         +A+    L AP +     VDFM+ YA+ 
Sbjct  127   RNGCKFFTRQGGLNRDDVSVLLE---------LAESGDFLSAPGTGAIMPVDFMTVYARQ  177

Query  1350  LRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMF  1171
             L + I+  V HP H + PLQG +I+V+AGNG+ GFF   VL  LGADT GS +L PDG F
Sbjct  178   LVERIRNGVAHPEHPERPLQGLRIVVDAGNGAAGFFVDRVLQPLGADTTGSQYLEPDGTF  237

Query  1170  PNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAI  991
             PNH+PNPE   AMA    AV     D G+VFD DVDR+  VD  G  IN +RL+AL +A+
Sbjct  238   PNHVPNPEHPDAMAALTQAVTAQRVDFGIVFDPDVDRAAAVDSDGRAINRNRLVALAAAM  297

Query  990   VLKEHPGTTVVTDARTSMGLTRFI-TGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             VL+EHPG+TVVTD+ TS GLT FI    GG H  ++ GYRNVI++ + LN  G E  L +
Sbjct  298   VLREHPGSTVVTDSITSDGLTDFIERDLGGVHRRFKRGYRNVINEALRLNAAGQECWLAI  357

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDV  634
             ETSGH ALKEN+FLDDGAY++  ++IE+ + + EG    +G+LI  L EP E+AE+R+  
Sbjct  358   ETSGHAALKENHFLDDGAYLMAMLLIELARARREG--RSLGTLIATLREPAESAEIRIG-  414

Query  633   LSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMY  454
              ++ R  +    + I++ R     G  P W++    D +  EG                 
Sbjct  415   -NDDRDFRTSGNQVIDALR--ARAGVEPDWKV--VPDNY--EGV----------------  451

Query  453   RAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
               +V+    GE GW  LR S+H+P +A+N++S  PGG   +A  L
Sbjct  452   --RVACRGAGERGWFLLRLSLHDPVLALNIESETPGGAGRIAHRL  494



>ref|WP_007050789.1| phosphoglucomutase [Anaerofustis stercorihominis]
 gb|EDS72319.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
II [Anaerofustis stercorihominis DSM 17244]
Length=492

 Score =   397 bits (1020),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 224/525 (43%), Positives = 321/525 (61%), Gaps = 48/525 (9%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             +R+LQNGSDVRG+AL+G KG +V+LT  A   I+++F +W+   L  +       +++++
Sbjct  3     LRKLQNGSDVRGIALEGIKGENVNLTNEASYKISKAFVKWLKKRLNKD-------NIKIT  55

Query  1707  LGMDPRISGKSLSAAVFAGLG-QAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASH  1531
             +G D R+SG  L+ +V  GL  +    V    L TTPA FMS V      D +IM+TASH
Sbjct  56    IGRDSRLSGPDLAESVMKGLSSEDNVEVVYFDLCTTPAMFMSCVNGEVNADGAIMITASH  115

Query  1530  LPYTRNGLKFFTKKGGLTSTEVEAICDKAAR-KYANRMAKVSTALRAPPSKVDFMSAYAK  1354
             LP+ RNGLKFFTK GG    +++AI + A   +Y+   AK  T        +DF+S YA 
Sbjct  116   LPFNRNGLKFFTKDGGAEKEDIKAILEIANEMEYSENEAKYQT--------LDFLSMYAS  167

Query  1353  HLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGM  1174
             +L  II+E+    T  + P +G +IIV+AGNG+GGFF   VLD LGADT GS++L PDG 
Sbjct  168   NLVKIIREK----TGEERPFEGKKIIVDAGNGAGGFFAHKVLDVLGADTRGSVYLEPDGK  223

Query  1173  FPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSA  994
             FPNH+PNPE K  M      V++  ADLG++FDTDVDR+  VD+SG  I+ ++L+ALM++
Sbjct  224   FPNHVPNPELKDVMDSFSEVVVKEKADLGIIFDTDVDRAAAVDKSGEEISRNKLVALMAS  283

Query  993   IVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             I L+E  G+ +VTD+ TS GL  FI  +GG H  ++ GY+NVI++G+ LN+DG E  L +
Sbjct  284   ICLQEAKGSYIVTDSVTSSGLKEFIEEKGGVHHRFKRGYKNVINEGIRLNKDGKECLLAI  343

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDV  634
             ETSGH AL+ENYFLDDGAYMVVKI+I+   +  EG  +    LI  L+EP E AELR   
Sbjct  344   ETSGHCALRENYFLDDGAYMVVKILIKFYDLAKEG--KTFADLIGSLKEPKEEAELRATF  401

Query  633   LSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMY  454
             L+     K    + +E F+ Y+ K  + G   +        EG                 
Sbjct  402   LA--ADFKDYGAKLLEDFKVYV-KEEMKGASFEEPN----FEGV----------------  438

Query  453   RAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
               +V+ E +G  GWV LR S+H+P + +N++S   GG +++ +++
Sbjct  439   --RVNVERDGIKGWVLLRLSLHDPVLPINIESESEGGVENIKKEI  481



>ref|XP_006400293.1| hypothetical protein EUTSA_v10012819mg [Eutrema salsugineum]
 gb|ESQ41746.1| hypothetical protein EUTSA_v10012819mg [Eutrema salsugineum]
Length=706

 Score =   404 bits (1037),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 235/522 (45%), Positives = 317/522 (61%), Gaps = 48/522 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V L  P  EAIA +FG+W++   ++E        +RVS+G
Sbjct  184   KLQNGSDIRGVAVPGVEGEPVSLHEPVTEAIAAAFGQWLLHKKKAES-----RRLRVSVG  238

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS ++L  AV  GLG +G  V   GLA+TPA F ST+     +    D +IM+TAS
Sbjct  239   HDSRISAQTLLEAVSRGLGVSGLDVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITAS  298

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN---RMAKVSTALRAPPSKVDFMSA  1363
             HLPY RNG KFFT  GGL   +++ I ++AA  Y N      + S    +   KVD+M+ 
Sbjct  299   HLPYNRNGFKFFTSDGGLGKVDIKNILERAADIYKNISDENLRKSQTGNSSTKKVDYMAV  358

Query  1362  YAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNP  1183
             Y   L   ++         + PL GF I+V+AGNG+GGFF   VL+ LGA T GS  L P
Sbjct  359   YTSGLVKAVRRAAGD---LEKPLVGFHIVVDAGNGAGGFFAAKVLEPLGAITTGSQFLEP  415

Query  1182  DGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIAL  1003
             DGMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD +G   N +RLIAL
Sbjct  416   DGMFPNHIPNPEDKTAMEAITKAVLDNKADLGIIFDTDVDRSAAVDSTGREFNRNRLIAL  475

Query  1002  MSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVET  826
             +SAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G ET
Sbjct  476   LSAIVLEEHPGTTIVTDSVTSDGLTSFIEKKLGGKHHRFKRGYKNVIDEAIRLNSSGEET  535

Query  825   HLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLET  655
             HL +ETSGHGALKEN++LDDGAY++VKI+ ++   +  GS  G   +  L++ LEEP   
Sbjct  536   HLAIETSGHGALKENHWLDDGAYLMVKILNKLASARAAGSGSGSEVLTDLVEGLEEPKVA  595

Query  654   AELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPA  475
              ELR+ +  +  H   +     + FR Y E        L    +        ++TN +  
Sbjct  596   LELRLKI--DKNHPDLEG----KDFREYGET------VLQHLSNS-------IETNPN--  634

Query  474   AIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQS  358
                  + RA V+ E    +G  GW  LR S+H+P + +N+++
Sbjct  635   -----LKRAPVNYEGIRVSGFGGWFLLRLSLHDPVLPLNIEA  671



>ref|XP_008368102.1| PREDICTED: uncharacterized protein LOC103431559 isoform X3 [Malus 
domestica]
Length=544

 Score =   398 bits (1023),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 239/560 (43%), Positives = 332/560 (59%), Gaps = 52/560 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  + LT P  EAI  +F  W++   +++      + +R+S+G
Sbjct  20    KLQNGSDIRGVAVAGVEGEPISLTEPVSEAIGAAFAAWLVEKKKADGS----QHLRISVG  75

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS K L  A+  G+  AG  V   GLA+TPA F ST+     +    D SIM+TAS
Sbjct  76    HDSRISAKKLEDAISRGIASAGLDVVQYGLASTPAMFNSTITEDDSFLCPSDGSIMITAS  135

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALR----APPSKVDFMS  1366
             HLPY RNG KFFT  GGL   +++ I ++AA  Y     +  T+ +    A   +VD+MS
Sbjct  136   HLPYNRNGFKFFTNSGGLGKPDIKNILERAADIYDKFTVEGLTSSKEKVLASVKRVDYMS  195

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L 
Sbjct  196   VYTS---DLVKAVRKAAGNIEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAVTTGSQFLE  252

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD +G   N +RLIA
Sbjct  253   PDGMFPNHIPNPEDKTAMKAITQAVLDNKADLGIIFDTDVDRSAAVDSTGLEFNRNRLIA  312

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G E
Sbjct  313   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEE  372

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLE  658
             +HL +ETSGHGALKEN++LDDGAY++VKI+ ++   +  G   G   +  L++ LEEP  
Sbjct  373   SHLAIETSGHGALKENHWLDDGAYLMVKILNKLASARASGQVGGSKVLTGLLEGLEEPGF  432

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
             + ELR+ +     H   K       FR Y                    E  L    ++ 
Sbjct  433   SVELRLKI--NQSHPDLKG----GFFRDY-------------------GEAVLKHLENYI  467

Query  477   AAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
              + D  + +A V++E    +G  GW  LR S+H+P + +N+++  P    +++  L +  
Sbjct  468   DS-DPKLKKAPVNHEGVRVSGYGGWFLLRLSLHDPVLPLNIEA--PSNNDAVS--LGNIV  522

Query  306   LLAGEMAKFLDISQIDEFAR  247
             L A +    LD S +D+F +
Sbjct  523   LAAVKEFPALDTSALDKFVQ  542



>ref|XP_010420480.1| PREDICTED: probable phosphoglucomutase-2 isoform X2 [Camelina 
sativa]
Length=540

 Score =   398 bits (1022),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 232/526 (44%), Positives = 319/526 (61%), Gaps = 55/526 (10%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V L  P  EAIA +FG+W+       +  A    +RVS+G
Sbjct  20    KLQNGSDIRGVAVPGVEGEPVSLPEPVSEAIAAAFGQWL-----QHKKKAESRRLRVSIG  74

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS ++L  AV  GLG +G  V   GLA+TPA F ST+     +    D +IM+TAS
Sbjct  75    HDSRISAQTLLEAVSRGLGVSGLDVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITAS  134

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN------RMAKVSTALRAPPSKVDF  1372
             HLPY RNG KFFT  GGL   +++ I ++AA  Y        + ++  T+++    KVD+
Sbjct  135   HLPYNRNGFKFFTSDGGLGKVDIKNILERAADIYKKVSDENLKKSQKETSIK----KVDY  190

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             MS Y   L   ++         + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  
Sbjct  191   MSVYTSGLVKAVRRAAGD---LEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQF  247

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             L PDGMFPNHIPNPEDK+AM     AVL N ADLG++FDTDVDRS  VD +G   N +RL
Sbjct  248   LEPDGMFPNHIPNPEDKSAMEAIIKAVLDNKADLGIIFDTDVDRSAAVDSTGREFNRNRL  307

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDG  835
             IAL+SAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN +G
Sbjct  308   IALLSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSNG  367

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEP  664
              E+HL +ETSGHGALKEN++LDDGAY++VK++ ++   +  G   G   +  L++ LEEP
Sbjct  368   EESHLAIETSGHGALKENHWLDDGAYLMVKLLNKLAAARAAGQGSGSKVLTDLVEGLEEP  427

Query  663   LETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTND  484
                 ELR+ +  +  H   +       FR Y EK       L    +        ++TN 
Sbjct  428   RVALELRLKI--DKNHPDLEG----RDFREYGEK------VLQHLSNS-------IETNP  468

Query  483   HPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSN  355
             +       + RA V+ E    +G  GW  LR S+H+P + +N+++ 
Sbjct  469   N-------LKRAPVNYEGIRVSGFGGWFLLRLSLHDPVLPLNIEAQ  507



>ref|XP_003591896.1| Phosphoglucosamine mutase [Medicago truncatula]
 gb|AES62147.1| phosphoglucomutase/phosphomannomutase family protein [Medicago 
truncatula]
Length=543

 Score =   397 bits (1021),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 233/526 (44%), Positives = 320/526 (61%), Gaps = 48/526 (9%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
              ++LQNGSD+RGVAL G +G  V+LT P  EAI  +F  W++   E ++  A  + +RVS
Sbjct  18    FQKLQNGSDIRGVALDGVEGEGVNLTEPVAEAIGAAFAGWLV---EKKKADAS-QHLRVS  73

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMT  1540
             +G D RIS K L  A+  GL  AG  V   GLA+TPA F ST+     +    D SIM+T
Sbjct  74    IGHDSRISAKLLQNAISRGLAGAGLEVVHYGLASTPAMFNSTLTKDEAFLCPVDGSIMIT  133

Query  1539  ASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAAR---KYANRMAKVSTALRAPPSK-VDF  1372
             ASHLP+ RNG KFFT  GGL   +++ I ++AA    ++ +   K S  + +   K VD+
Sbjct  134   ASHLPFNRNGFKFFTNAGGLGKPDIKDILERAANIYNQFTDESLKNSEIMASLSIKIVDY  193

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             M+ Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  
Sbjct  194   MTVYTS---DLVKAVRKAAGNIEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQF  250

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             L PDG+FPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD +G   N +RL
Sbjct  251   LEPDGLFPNHIPNPEDKTAMKAITKAVLDNKADLGIIFDTDVDRSAAVDSTGREFNRNRL  310

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDG  835
             IALM+AIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G
Sbjct  311   IALMAAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSIG  370

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEP  664
              E+HL +ETSGHGALKEN +LDDGAY++VKI+ ++   +  G   G   +  LI+ L+EP
Sbjct  371   EESHLAIETSGHGALKENNWLDDGAYLMVKILNKLASARASGVGGGSNVLTGLIEGLQEP  430

Query  663   LETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTND  484
                AELR+ +     H   K      SFR Y E                     ++   +
Sbjct  431   AFAAELRLKI--NQNHPDLKG----GSFREYGE--------------------TVLKHLE  464

Query  483   HPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSN  355
             +  + D  + +A V+ E    +G  GW  LR S+H+P + +N++++
Sbjct  465   NSISSDPNLQKAPVNYEGIRVSGYGGWFLLRLSLHDPVLPLNIEAS  510



>ref|XP_008368039.1| PREDICTED: uncharacterized protein LOC103431559 isoform X2 [Malus 
domestica]
Length=579

 Score =   398 bits (1023),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 239/560 (43%), Positives = 332/560 (59%), Gaps = 52/560 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  + LT P  EAI  +F  W++   +++      + +R+S+G
Sbjct  55    KLQNGSDIRGVAVAGVEGEPISLTEPVSEAIGAAFAAWLVEKKKADGS----QHLRISVG  110

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS K L  A+  G+  AG  V   GLA+TPA F ST+     +    D SIM+TAS
Sbjct  111   HDSRISAKKLEDAISRGIASAGLDVVQYGLASTPAMFNSTITEDDSFLCPSDGSIMITAS  170

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALR----APPSKVDFMS  1366
             HLPY RNG KFFT  GGL   +++ I ++AA  Y     +  T+ +    A   +VD+MS
Sbjct  171   HLPYNRNGFKFFTNSGGLGKPDIKNILERAADIYDKFTVEGLTSSKEKVLASVKRVDYMS  230

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L 
Sbjct  231   VYTS---DLVKAVRKAAGNIEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAVTTGSQFLE  287

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD +G   N +RLIA
Sbjct  288   PDGMFPNHIPNPEDKTAMKAITQAVLDNKADLGIIFDTDVDRSAAVDSTGLEFNRNRLIA  347

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G E
Sbjct  348   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEE  407

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLE  658
             +HL +ETSGHGALKEN++LDDGAY++VKI+ ++   +  G   G   +  L++ LEEP  
Sbjct  408   SHLAIETSGHGALKENHWLDDGAYLMVKILNKLASARASGQVGGSKVLTGLLEGLEEPGF  467

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
             + ELR+ +     H   K       FR Y                    E  L    ++ 
Sbjct  468   SVELRLKI--NQSHPDLKG----GFFRDY-------------------GEAVLKHLENYI  502

Query  477   AAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
              + D  + +A V++E    +G  GW  LR S+H+P + +N+++  P    +++  L +  
Sbjct  503   DS-DPKLKKAPVNHEGVRVSGYGGWFLLRLSLHDPVLPLNIEA--PSNNDAVS--LGNIV  557

Query  306   LLAGEMAKFLDISQIDEFAR  247
             L A +    LD S +D+F +
Sbjct  558   LAAVKEFPALDTSALDKFVQ  577



>ref|WP_007960599.1| phosphoglucomutase [Pelosinus fermentans]
 gb|EIW46935.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Pelosinus fermentans JBW45]
Length=501

 Score =   395 bits (1016),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 214/522 (41%), Positives = 318/522 (61%), Gaps = 39/522 (7%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             ME  +RLQNG+D+RG+A+   +  +V LT   V AI   F +W++     E       S 
Sbjct  2     MENWKRLQNGTDIRGIAIATPE-NAVTLTSTMVRAIGSGFRQWLL-----EVKNIQAASC  55

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
             ++++GMD R+SG  L  A+   L + GC V+D G++TTPA FM+T+L  +Q D ++M+TA
Sbjct  56    KIAIGMDSRLSGPELKTALIERLAELGCDVYDCGMSTTPAMFMTTILDNYQCDGAVMITA  115

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYA  1357
             SHLP+  NGLK FTK+GG    ++ AI + A++  +     + +  +    + D ++ Y+
Sbjct  116   SHLPFYHNGLKLFTKEGGCEKEDIAAILENASQADS-----ICSERKGVVYEKDLIAEYS  170

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
             + L   I++ VN   +Y+ PLQG  IIV+AGNG+GGFF   VL+ LGADT GS  L PDG
Sbjct  171   ELLVHTIRKGVNSQQNYEKPLQGCHIIVDAGNGAGGFFAAKVLEPLGADTMGSQFLEPDG  230

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
              FPNH PNPE++ AM   +AAVL   ADLG++FD DVDR+ +V  +G  IN + LIAL+S
Sbjct  231   TFPNHSPNPENQAAMDSLKAAVLGTKADLGIIFDADVDRAAIVSSNGVEINRNALIALLS  290

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
              IVL EHP + +VTD+ TS GL +FI  +GG+   ++ GY+NVI++   LN  G   HL 
Sbjct  291   VIVLAEHPQSVIVTDSITSTGLRKFIEEQGGRQRRFKRGYKNVINEAKRLNAAGEACHLA  350

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGH A KENYFLDDGAY++ KI+I+M  ++ +  E  I S+I+ L+ P E+ E+R+ 
Sbjct  351   IETSGHAACKENYFLDDGAYLIAKILIKMAILRQDNKE--IQSVIETLQMPYESDEVRIP  408

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFM  457
             +L +   A   A+  +E     +++  + GW L       V+E             D   
Sbjct  409   ILDKEFRACGTAI--LEDIEKQVQE--IQGWNL-------VAEN-----------YDGI-  445

Query  456   YRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSM  331
                +V+ +E   +GW  LR S+H P + +N++S+  GG +SM
Sbjct  446   ---RVAADEFRGNGWFMLRISLHEPLLVLNIESDAEGGIKSM  484



>ref|WP_026395081.1| phosphoglucomutase [Acetobacterium dehalogenans]
Length=494

 Score =   395 bits (1015),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 216/522 (41%), Positives = 312/522 (60%), Gaps = 51/522 (10%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E++ IR+LQNGSDVRGVAL G  G  V+ T      IA +F  W+   LE          
Sbjct  2     EIKDIRKLQNGSDVRGVALAGIPGEDVNFTQDMAMKIAFAFATWLEEKLEKT-------P  54

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMT  1540
             +  ++G D R+SG  L+ AV  GL   G  V+  G++TTPA FM+T+ P  Q D ++M+T
Sbjct  55    LTFAIGQDSRLSGPHLAQAVALGLVSKGNQVYQCGISTTPAMFMTTIDPVLQADGAVMVT  114

Query  1539  ASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKV---DFM  1369
             ASHLP+ RNGLKFFTK GGL   ++ AI +         MA+       P  +    DF+
Sbjct  115   ASHLPFNRNGLKFFTKDGGLNKEDISAILE---------MAETIETGFTPGGQALDYDFL  165

Query  1368  SAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHL  1189
              +Y++++ +II+ +    T  D PL G +I+V+AGNG+GGFF   VL  LGA+T GS +L
Sbjct  166   PSYSQNILNIIRSK----TGTDQPLAGAKIVVDAGNGAGGFFVDQVLRPLGAETTGSQYL  221

Query  1188  NPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLI  1009
             +PDG FPNH+PNPED  A+     AV  N ADLG++FDTDVDR+ ++D  GN IN +  I
Sbjct  222   DPDGNFPNHVPNPEDAVAIEHVTKAVRDNQADLGIIFDTDVDRAAIIDEKGNAINRNGFI  281

Query  1008  ALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             A +++++L E+PG+T+VTD+ TS GLT +I  RGG+H  ++ GY+NVI++ + LN  G+E
Sbjct  282   AFIASMLLVEYPGSTIVTDSITSTGLTEYIESRGGKHHRFKRGYKNVINEAIRLNNAGIE  341

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAE  649
             THL METSGHGA+K NYFLDDGAY+V   +I+  ++   G    I S ++ L+EP+E  E
Sbjct  342   THLAMETSGHGAIKANYFLDDGAYLVTMALIKFAELHKAGKP--ISSFLEGLKEPVEAKE  399

Query  648   LRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAI  469
             +R+ + +E   +  + V A   F  +    + PGW              +V  N      
Sbjct  400   IRLKIAAEDFKSYGEKVLA--EFEQF--AASQPGW-------------TVVRPN------  436

Query  468   DAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGG  343
                    +VS +    +GW  LR S+H+P + +N++S+  GG
Sbjct  437   ---YEGVRVSCDATAGNGWCLLRMSLHDPIMPLNIESDTVGG  475



>ref|XP_008233321.1| PREDICTED: uncharacterized protein LOC103332366 isoform X3 [Prunus 
mume]
Length=544

 Score =   397 bits (1019),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 234/523 (45%), Positives = 317/523 (61%), Gaps = 48/523 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  ++LT P  EAIA  F  W+   LE ++       + +S+G
Sbjct  20    KLQNGSDIRGVAVAGVEGEPLNLTEPVSEAIAAGFAAWL---LEKKKADGS-RRLSISVG  75

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS K L  A+  G+  AG  V   GLA+TPA F STV     +    D SIM+TAS
Sbjct  76    HDSRISAKKLEDAISRGIAGAGLDVVQYGLASTPAMFNSTVTEDDAFLCPVDGSIMITAS  135

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALR----APPSKVDFMS  1366
             HLPY RNG KFFT  GGL   +++ I ++AA  Y    A+  T+ +    A   +VD+M+
Sbjct  136   HLPYNRNGFKFFTNAGGLGKADIKNILERAADIYNKFTAEGLTSSKGKALASVKRVDYMN  195

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L 
Sbjct  196   VYTS---DLVKAVRKAAGNIEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAVTSGSQFLE  252

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD +G   N +RLIA
Sbjct  253   PDGMFPNHIPNPEDKTAMKAITQAVLDNKADLGIIFDTDVDRSAAVDSTGLEFNRNRLIA  312

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G E
Sbjct  313   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEE  372

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMK---LEGSEEGIGSLIKDLEEPLE  658
             +HL +ETSGHGALKEN++LDDGAY++VKI+ ++   +   L G  + +  L++ L+EP  
Sbjct  373   SHLAIETSGHGALKENHWLDDGAYLMVKILNKIASARASGLTGGSKVLTGLLEGLQEPAF  432

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
             + ELR+ +    +  K        SFR Y E   L   E              +D+N   
Sbjct  433   SVELRLKINQSHQDLKGG------SFRDYGE-AVLKHLE------------NYIDSNPK-  472

Query  477   AAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQS  358
                   + +A V+ E    +G  GW  LR S+H+P + +N+++
Sbjct  473   ------LQKAPVNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEA  509



>ref|XP_011031735.1| PREDICTED: uncharacterized protein LOC105130769 isoform X1 [Populus 
euphratica]
Length=609

 Score =   398 bits (1023),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 236/530 (45%), Positives = 318/530 (60%), Gaps = 50/530 (9%)
 Frame = -1

Query  1896  MEKI--RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVE  1723
             +EK+   +LQNGSD+RGVA+ G +G  V LT P  EAIA +F  W+   LE +R  A  +
Sbjct  79    LEKVDFMKLQNGSDIRGVAVDGVEGEPVTLTEPVTEAIAAAFSAWL---LEMKRADAS-K  134

Query  1722  SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DA  1555
              +RVS+G D RIS + L  AV  G+  AG  V   GLA+TPA F ST+     +    D 
Sbjct  135   PLRVSVGHDSRISAQVLQDAVSQGIAVAGLDVVQYGLASTPAMFNSTLTEDEAFLCPVDG  194

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN----RMAKVSTALRAPP  1387
             +IM+TASHLPY RNG KFFT  GGL   +++ I ++AA  Y +     + K         
Sbjct  195   AIMITASHLPYNRNGFKFFTNAGGLGKADIKIILERAADIYKSFTDQGLMKSKQKASESI  254

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VD+M+ Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL  LGA T
Sbjct  255   KRVDYMTVYTS---DLVKAVRKAAENIEKPLEGFHIVVDAGNGAGGFFAEKVLQPLGAIT  311

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
              GS  L PDGMFPNHIPNPEDKTAM     AVL+N ADLG++FDTDVDRS  VD  G   
Sbjct  312   SGSQFLEPDGMFPNHIPNPEDKTAMKAITQAVLENKADLGIIFDTDVDRSAAVDSIGREF  371

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVH  850
             N +RLIALMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ V 
Sbjct  372   NRNRLIALMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAVR  431

Query  849   LNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIK  679
             LN  G E+HL +ETSGHGAL+EN++LDDGAY++VK++ ++   +  G   G   +  L++
Sbjct  432   LNSVGEESHLAIETSGHGALRENHWLDDGAYLMVKVLNKLASARASGIAGGSKVLTDLVE  491

Query  678   DLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCL  499
              L+EP    ELR+ +  +  H   K      SFR Y                    E  L
Sbjct  492   GLQEPGVAVELRLKI--DQNHPDLKG----GSFREY-------------------GEAVL  526

Query  498   VDTNDHPAAIDAFMYRAKVSNE---ENGEHGWVHLRQSIHNPNIAVNLQS  358
                 +H  + D  + +A V+ E    +G  GW  LR S+H+P + +N+++
Sbjct  527   QLLENHIES-DPKLQKAPVNYEGVRASGFDGWFLLRLSLHDPVLPLNIEA  575



>ref|WP_007724190.1| phosphoglucomutase [Carnobacterium sp. AT7]
 gb|EDP67823.1| phosphoglucomutase/phosphomannomutase family protein [Carnobacterium 
sp. AT7]
Length=508

 Score =   395 bits (1014),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 223/535 (42%), Positives = 317/535 (59%), Gaps = 49/535 (9%)
 Frame = -1

Query  1890  KIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVIS----GLESERGGAVVE  1723
             K+  LQNGSD+RG+A++  + + + LT   +E IA  F  W+      G+E+E      +
Sbjct  5     KLASLQNGSDIRGIAIETAEHK-LTLTDERIENIAYGFAAWLKEVKQLGVENEN-----K  58

Query  1722  SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMM  1543
              + VS+G D R+S + +  A   GL  AG  V D+GL+TTPA FMST    ++ D ++M+
Sbjct  59    PLTVSVGHDSRLSAERIKTAFIKGLTNAGIDVIDVGLSTTPAMFMSTKYDAYKCDGAVMV  118

Query  1542  TASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARK---YANRMAKVSTALRAPPSKVDF  1372
             TASHLP+  NGLKFFTK GG    +++ I + A+ +   + N   K++T           
Sbjct  119   TASHLPFEYNGLKFFTKDGGAEHEDIDYILNHASWETITWDNNQGKITTG--------SL  170

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             +  YAK L   I+  +N   +Y+ PL    I+V+AGNG+GGFF   VL  LGA+  GS  
Sbjct  171   LDEYAKDLVTKIRVGINDKDYYEQPLASRHIVVDAGNGAGGFFAEKVLLPLGANISGSQF  230

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             L PDG FPNHIPNP++K AM   + AVL N AD+GV+FDTDVDRS +VDR G+ +N + L
Sbjct  231   LEPDGNFPNHIPNPDNKEAMKSIQEAVLMNKADMGVIFDTDVDRSALVDRKGDTLNRNNL  290

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGV  832
             IA++SAI++KE+PGTT+VT + TS  L  FIT  GG+   Y  GYRNVI++G+ LN +GV
Sbjct  291   IAVISAILIKENPGTTIVTSSATSEHLKTFITSLGGKQDRYITGYRNVINRGIQLNNEGV  350

Query  831   ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETA  652
              T L +ETSGH AL+ENYFLDDGAY+V KI+  M    L+ + +    LI  L++P+ET 
Sbjct  351   PTSLAIETSGHAALEENYFLDDGAYLVAKIL--MADATLQKAGKDFSDLITSLKQPIETD  408

Query  651   ELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAA  472
             E+R  +LSE    +A   + +E+F  +IEK +      D   +    EG  V+T  H   
Sbjct  409   EVRFKILSE--DTRATGAKVMEAFTLFIEKTS------DLSIEPANLEGVRVNTTGHYGT  460

Query  471   IDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                               GW+ LR S+H P + +NL+S+  G  Q +   ++D F
Sbjct  461   ------------------GWMLLRMSLHEPLLVLNLESDQAGSIQLLRETIKDFF  497



>ref|XP_008367977.1| PREDICTED: uncharacterized protein LOC103431559 isoform X1 [Malus 
domestica]
Length=619

 Score =   399 bits (1024),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 239/560 (43%), Positives = 332/560 (59%), Gaps = 52/560 (9%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  + LT P  EAI  +F  W++   +++      + +R+S+G
Sbjct  95    KLQNGSDIRGVAVAGVEGEPISLTEPVSEAIGAAFAAWLVEKKKADGS----QHLRISVG  150

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS K L  A+  G+  AG  V   GLA+TPA F ST+     +    D SIM+TAS
Sbjct  151   HDSRISAKKLEDAISRGIASAGLDVVQYGLASTPAMFNSTITEDDSFLCPSDGSIMITAS  210

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALR----APPSKVDFMS  1366
             HLPY RNG KFFT  GGL   +++ I ++AA  Y     +  T+ +    A   +VD+MS
Sbjct  211   HLPYNRNGFKFFTNSGGLGKPDIKNILERAADIYDKFTVEGLTSSKEKVLASVKRVDYMS  270

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L 
Sbjct  271   VYTS---DLVKAVRKAAGNIEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAVTTGSQFLE  327

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD +G   N +RLIA
Sbjct  328   PDGMFPNHIPNPEDKTAMKAITQAVLDNKADLGIIFDTDVDRSAAVDSTGLEFNRNRLIA  387

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G E
Sbjct  388   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEE  447

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLE  658
             +HL +ETSGHGALKEN++LDDGAY++VKI+ ++   +  G   G   +  L++ LEEP  
Sbjct  448   SHLAIETSGHGALKENHWLDDGAYLMVKILNKLASARASGQVGGSKVLTGLLEGLEEPGF  507

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
             + ELR+ +     H   K       FR Y                    E  L    ++ 
Sbjct  508   SVELRLKI--NQSHPDLKG----GFFRDY-------------------GEAVLKHLENYI  542

Query  477   AAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
              + D  + +A V++E    +G  GW  LR S+H+P + +N+++  P    +++  L +  
Sbjct  543   DS-DPKLKKAPVNHEGVRVSGYGGWFLLRLSLHDPVLPLNIEA--PSNNDAVS--LGNIV  597

Query  306   LLAGEMAKFLDISQIDEFAR  247
             L A +    LD S +D+F +
Sbjct  598   LAAVKEFPALDTSALDKFVQ  617



>ref|WP_036100422.1| phosphoglucomutase [Listeria riparia]
 gb|EUJ45730.1| hypothetical protein PRIP_07798 [Listeria riparia FSL S10-1204]
Length=500

 Score =   394 bits (1012),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 215/527 (41%), Positives = 321/527 (61%), Gaps = 42/527 (8%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             ++ LQNGSD+RG+A++ +K   V LT   V AIA  F  W    L   +G +  +  RV+
Sbjct  3     LKDLQNGSDIRGIAIETDK-YQVTLTDEHVAAIATGFAAW----LRDVKGAS--DKARVA  55

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHL  1528
             +G D R+S   +   + A L ++G  V D+GLATTPA FM+T    ++ DA+IM+TASHL
Sbjct  56    IGHDSRLSAGRIKDVLTASLTRSGLDVVDVGLATTPAMFMATQYDGYKCDAAIMITASHL  115

Query  1527  PYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
             PY  NGLK FT+ GG    +++ I + A + +   +AKV+ ++   P     +  YA  L
Sbjct  116   PYFYNGLKLFTRDGGAEHEDIDYIVENAGQVF---VAKVAGSVTEKP----LLQDYAADL  168

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
                I+  ++  T+Y+ PL G  I+V+AGNG+GGFF  DVL +LGAD  GS  L+PDG FP
Sbjct  169   VGKIRVGIDDATNYERPLAGSHIVVDAGNGAGGFFATDVLAELGADITGSQFLDPDGNFP  228

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NHIPNP++  AMA  + AV  N ADLGV+FDTDVDR+ +VD+ G  +N + LIA++SAIV
Sbjct  229   NHIPNPDNNEAMASLKEAVATNKADLGVIFDTDVDRAAIVDKDGESLNRNPLIAVISAIV  288

Query  987   LKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             L+EHPGTT+VTD+ TS  L  FI   GG+   ++ GYRNVI++ + LNE G ++ + +E 
Sbjct  289   LEEHPGTTIVTDSTTSTHLEHFIANLGGKQHRFKRGYRNVINEAIRLNEAGTQSEIAIEV  348

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGH ALKENYFLDDGAY++ KI++   K++ EG +  +  L +DL+ P +  E+R+ +L+
Sbjct  349   SGHAALKENYFLDDGAYLIAKILMRYAKLRKEGKD--LADLTRDLQVPADNDEIRLSILA  406

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             E  + K   +  ++ F  ++EK                ++G  ++  +            
Sbjct  407   E--NFKTYGLAVLKDFEAFVEK----------------TDGLAIEPANQEG--------V  440

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
             +V+ E +  +GW  LR S+H P + VNL+S+  GG   +   L++ F
Sbjct  441   RVNTEGSFGNGWFLLRMSLHEPVMPVNLESDEIGGTGKIKAALQEFF  487



>ref|WP_036073068.1| phosphoglucomutase [Listeria rocourtiae]
 gb|EUJ43951.1| hypothetical protein PROCOU_14528 [Listeria rocourtiae FSL F6-920]
Length=503

 Score =   394 bits (1013),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 221/527 (42%), Positives = 318/527 (60%), Gaps = 42/527 (8%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             ++ LQNGSD+RGVA++ EK   V LT   V AIA  F  W+    + ++ G   E   V+
Sbjct  3     LKDLQNGSDIRGVAIETEK-HDVTLTDEHVSAIAIGFAAWL---RDVKKTG---ERATVA  55

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHL  1528
             +G D R+S + +   + A L ++G  V D+GLATTPA FM+T    +Q DA+IM+TASHL
Sbjct  56    IGHDSRLSAERVKDVLVASLTRSGIDVVDVGLATTPAMFMATQYEDYQCDAAIMITASHL  115

Query  1527  PYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
             PY  NGLK FT+ GG    +++ I + A   +   +A V+ A+   P     +  YA  L
Sbjct  116   PYFYNGLKLFTRDGGAEHEDIDYIMEHADAVF---VASVAGAVMHKP----LLETYAADL  168

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
                I+  +N    Y+ PL G  I+V+AGNG+GGFF  +VL KLGAD  GS  L+PDG FP
Sbjct  169   VGKIRAGINDEVLYEEPLDGSHIVVDAGNGAGGFFATEVLAKLGADITGSQFLDPDGNFP  228

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NHIPNP++  AMA  + AVL N ADLGV+FDTDVDR+ +VDR G  +N + LIA++SAI+
Sbjct  229   NHIPNPDNNEAMASLKEAVLANKADLGVIFDTDVDRAAIVDRDGESLNRNPLIAVISAII  288

Query  987   LKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             L EHPGTT+VTD+ TS  L  FI   GG+   ++ GYRNVI++ + LNE G ++ + +E 
Sbjct  289   LDEHPGTTIVTDSTTSTHLEEFIEALGGKQHRFKRGYRNVINEAIRLNEAGTQSEIAIEV  348

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGH ALKENYFLDDGAY++ KI++   K++ EG +  +  L ++L+ P +  E+R+ +L+
Sbjct  349   SGHAALKENYFLDDGAYLIAKILMRYAKLRKEGKD--LADLTRNLKVPADNDEIRLSILA  406

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
                + K+  + A+E F+ ++ K +  G EL+        EG  V+T+             
Sbjct  407   --NNFKSYGLAALEDFKEFVAKTD--GLELEPVN----QEGVRVNTSGTFG---------  449

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                      +GW  LR S+H P + VNL+S+  GG   +   L+  F
Sbjct  450   ---------NGWFLLRMSLHEPVMPVNLESDEVGGVDKIKAVLQKFF  487



>ref|WP_035052524.1| phosphoglucomutase [Carnobacterium pleistocenium]
Length=508

 Score =   394 bits (1013),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 220/535 (41%), Positives = 316/535 (59%), Gaps = 45/535 (8%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWV--ISGLESERGGAVVESVRVSL  1705
             LQNGSD+RG+A++  +   + LT   VE IA  F  W+  +  L+ +      + ++VS+
Sbjct  9     LQNGSDIRGIAIKTAE-HELTLTDERVEKIAYGFAIWLKEVKQLDIQNES---KPLKVSV  64

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+S + +      GL  AG  V D+GL+TTPA FMST+   +  D ++M+TASHLP
Sbjct  65    GHDSRLSAERIKKVFTKGLTHAGIDVIDVGLSTTPAMFMSTIYDSYASDGAVMITASHLP  124

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARK---YANRMAKVSTALRAPPSKVDFMSAYAK  1354
             +  NGLKFFTK GG    +++ I   A R+   + N+   V+            ++ YAK
Sbjct  125   FEYNGLKFFTKDGGAEHEDIDFILQHADREKITWENKQGNVTVR--------SLLNEYAK  176

Query  1353  HLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGM  1174
              L D I+  +N    Y+ PL G  I+V+AGNG+GGFF   VL  LGADT GS +L+PDG 
Sbjct  177   DLVDKIRIGINDKDQYEKPLTGRHIVVDAGNGAGGFFAEKVLIPLGADTRGSQYLDPDGN  236

Query  1173  FPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSA  994
             FPNHIPNP++K AM   + AVL+N AD+GV+FDTDVDRS +VD +G+ +N + LI ++S+
Sbjct  237   FPNHIPNPDNKEAMKSIQEAVLRNKADIGVIFDTDVDRSALVDNNGDTLNRNNLIGVISS  296

Query  993   IVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             I++K++PGTT+VT + TS  L  FI+  GG+   Y  GYRNVI++ + LN++G  T L +
Sbjct  297   ILIKDNPGTTIVTSSATSEHLKTFISSLGGKQDRYITGYRNVINRAIQLNKEGTPTSLAI  356

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDV  634
             ETSGH AL+ENYFLDDGAY+V KI+I    ++ EG  +    LI  L +P+ET E+R  +
Sbjct  357   ETSGHAALEENYFLDDGAYLVAKILIADADLRKEG--KSFSDLITSLNQPVETDEVRFKI  414

Query  633   LSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMY  454
             L  P   +A   + +ESF+ YIEK      E D   +    EG  V+T            
Sbjct  415   L--PEDVQATGEKVMESFKKYIEK------EADLSIEPTNLEGVRVNTTGQYGI------  460

Query  453   RAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEM  289
                         GW+ LR S+H P + +NL+S+  G  + +   L+D F    E+
Sbjct  461   ------------GWMLLRMSLHEPLLVLNLESDQEGSIKILREKLKDFFYNQTEL  503



>ref|XP_011031736.1| PREDICTED: uncharacterized protein LOC105130769 isoform X2 [Populus 
euphratica]
Length=608

 Score =   398 bits (1022),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 236/530 (45%), Positives = 318/530 (60%), Gaps = 50/530 (9%)
 Frame = -1

Query  1896  MEKI--RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVE  1723
             +EK+   +LQNGSD+RGVA+ G +G  V LT P  EAIA +F  W+   LE +R  A  +
Sbjct  78    LEKVDFMKLQNGSDIRGVAVDGVEGEPVTLTEPVTEAIAAAFSAWL---LEMKRADAS-K  133

Query  1722  SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DA  1555
              +RVS+G D RIS + L  AV  G+  AG  V   GLA+TPA F ST+     +    D 
Sbjct  134   PLRVSVGHDSRISAQVLQDAVSQGIAVAGLDVVQYGLASTPAMFNSTLTEDEAFLCPVDG  193

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN----RMAKVSTALRAPP  1387
             +IM+TASHLPY RNG KFFT  GGL   +++ I ++AA  Y +     + K         
Sbjct  194   AIMITASHLPYNRNGFKFFTNAGGLGKADIKIILERAADIYKSFTDQGLMKSKQKASESI  253

Query  1386  SKVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VD+M+ Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL  LGA T
Sbjct  254   KRVDYMTVYTS---DLVKAVRKAAENIEKPLEGFHIVVDAGNGAGGFFAEKVLQPLGAIT  310

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
              GS  L PDGMFPNHIPNPEDKTAM     AVL+N ADLG++FDTDVDRS  VD  G   
Sbjct  311   SGSQFLEPDGMFPNHIPNPEDKTAMKAITQAVLENKADLGIIFDTDVDRSAAVDSIGREF  370

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVH  850
             N +RLIALMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ V 
Sbjct  371   NRNRLIALMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAVR  430

Query  849   LNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIK  679
             LN  G E+HL +ETSGHGAL+EN++LDDGAY++VK++ ++   +  G   G   +  L++
Sbjct  431   LNSVGEESHLAIETSGHGALRENHWLDDGAYLMVKVLNKLASARASGIAGGSKVLTDLVE  490

Query  678   DLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCL  499
              L+EP    ELR+ +  +  H   K      SFR Y                    E  L
Sbjct  491   GLQEPGVAVELRLKI--DQNHPDLKG----GSFREY-------------------GEAVL  525

Query  498   VDTNDHPAAIDAFMYRAKVSNE---ENGEHGWVHLRQSIHNPNIAVNLQS  358
                 +H  + D  + +A V+ E    +G  GW  LR S+H+P + +N+++
Sbjct  526   QLLENHIES-DPKLQKAPVNYEGVRASGFDGWFLLRLSLHDPVLPLNIEA  574



>ref|XP_003591897.1| Phosphoglucosamine mutase [Medicago truncatula]
 gb|AES62148.1| phosphoglucomutase/phosphomannomutase family protein [Medicago 
truncatula]
Length=615

 Score =   398 bits (1022),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 233/526 (44%), Positives = 320/526 (61%), Gaps = 48/526 (9%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
              ++LQNGSD+RGVAL G +G  V+LT P  EAI  +F  W++   E ++  A  + +RVS
Sbjct  90    FQKLQNGSDIRGVALDGVEGEGVNLTEPVAEAIGAAFAGWLV---EKKKADAS-QHLRVS  145

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMT  1540
             +G D RIS K L  A+  GL  AG  V   GLA+TPA F ST+     +    D SIM+T
Sbjct  146   IGHDSRISAKLLQNAISRGLAGAGLEVVHYGLASTPAMFNSTLTKDEAFLCPVDGSIMIT  205

Query  1539  ASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAAR---KYANRMAKVSTALRAPPSK-VDF  1372
             ASHLP+ RNG KFFT  GGL   +++ I ++AA    ++ +   K S  + +   K VD+
Sbjct  206   ASHLPFNRNGFKFFTNAGGLGKPDIKDILERAANIYNQFTDESLKNSEIMASLSIKIVDY  265

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             M+ Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  
Sbjct  266   MTVYTS---DLVKAVRKAAGNIEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAITSGSQF  322

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             L PDG+FPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD +G   N +RL
Sbjct  323   LEPDGLFPNHIPNPEDKTAMKAITKAVLDNKADLGIIFDTDVDRSAAVDSTGREFNRNRL  382

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDG  835
             IALM+AIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G
Sbjct  383   IALMAAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSIG  442

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEP  664
              E+HL +ETSGHGALKEN +LDDGAY++VKI+ ++   +  G   G   +  LI+ L+EP
Sbjct  443   EESHLAIETSGHGALKENNWLDDGAYLMVKILNKLASARASGVGGGSNVLTGLIEGLQEP  502

Query  663   LETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTND  484
                AELR+ +     H   K      SFR Y E                     ++   +
Sbjct  503   AFAAELRLKI--NQNHPDLKG----GSFREYGE--------------------TVLKHLE  536

Query  483   HPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSN  355
             +  + D  + +A V+ E    +G  GW  LR S+H+P + +N++++
Sbjct  537   NSISSDPNLQKAPVNYEGIRVSGYGGWFLLRLSLHDPVLPLNIEAS  582



>ref|XP_002311090.1| phosphoglucosamine mutase family protein [Populus trichocarpa]
 gb|EEE88457.1| phosphoglucosamine mutase family protein [Populus trichocarpa]
Length=609

 Score =   397 bits (1021),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 237/530 (45%), Positives = 322/530 (61%), Gaps = 50/530 (9%)
 Frame = -1

Query  1896  MEKI--RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVE  1723
             +EK+   +LQNGSD+RGVA+ G +G  V LT P  EAIA +F  W+   LE +R  A  +
Sbjct  79    LEKVDFMKLQNGSDIRGVAVAGVEGEPVTLTEPVTEAIAAAFSAWL---LEMKRADAS-K  134

Query  1722  SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DA  1555
              +RVS+G D RIS + L  AV  G+  AG  V   GLA+TPA F ST+     +    D 
Sbjct  135   PLRVSVGHDSRISAQVLQDAVSQGIAGAGLDVVQYGLASTPAMFNSTLTEDEAFLCPVDG  194

Query  1554  SIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAK--VSTALRAPPS-  1384
             +IM+TASHLPY RNG KFFT  GGL   +++ I ++AA  Y +   +  + +  +A  S 
Sbjct  195   AIMITASHLPYNRNGFKFFTNAGGLGKADIKIILERAADIYKSFTDQGLMKSKRKASESI  254

Query  1383  -KVDFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADT  1207
              +VD+M+ Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL  LGA T
Sbjct  255   KRVDYMTVYTS---DLVKAVRKAAENIEKPLEGFHIVVDAGNGAGGFFAEKVLQPLGAIT  311

Query  1206  FGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPI  1027
              GS  L PDGMFPNHIPNPEDKTAM     AVL+N ADLG++FDTDVDRS  VD  G   
Sbjct  312   SGSQFLEPDGMFPNHIPNPEDKTAMKAITQAVLENKADLGIIFDTDVDRSAAVDSIGREF  371

Query  1026  NGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVH  850
             N +RLIALMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ V 
Sbjct  372   NRNRLIALMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAVR  431

Query  849   LNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIK  679
             LN  G E+HL +ETSGHGAL+EN++LDDGAY++VK++ ++   +  G   G   +  L++
Sbjct  432   LNSVGEESHLAIETSGHGALRENHWLDDGAYLMVKVLNKLASARASGIAGGSKVLTDLVE  491

Query  678   DLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCL  499
              L+EP    ELR+ +  +  H   K      SFR Y                    E  L
Sbjct  492   GLQEPGVAVELRLKI--DQNHPDLKG----GSFREY-------------------GEAVL  526

Query  498   VDTNDHPAAIDAFMYRAKVSNE---ENGEHGWVHLRQSIHNPNIAVNLQS  358
                 +H  + D  + +A V+ E    +G  GW  LR S+H+P + +N+++
Sbjct  527   QLLENHIES-DPKLQKAPVNYEGVRASGFGGWFLLRLSLHDPVLPLNIEA  575



>ref|WP_011989366.1| phosphoglucomutase [Clostridium kluyveri]
 ref|YP_001394199.1| protein Pgm1 [Clostridium kluyveri DSM 555]
 gb|EDK32851.1| Pgm1 [Clostridium kluyveri DSM 555]
Length=506

 Score =   394 bits (1012),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 220/544 (40%), Positives = 325/544 (60%), Gaps = 43/544 (8%)
 Frame = -1

Query  1893  EKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVR  1714
             E++ +LQNG+D+RG+A +  + + V+LT   V+ I   F +W+       +       ++
Sbjct  3     EQLYKLQNGTDIRGIATKNPE-KEVNLTVERVKLITRGFIKWI-----KNKKNLENNKIK  56

Query  1713  VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTAS  1534
             +++G+D R+SG      +   L   GC V+D GL TTPA FM+TV   ++   +IM+T S
Sbjct  57    IAIGIDSRLSGLEFKRCICEELLNLGCYVYDCGLCTTPAMFMTTVTGSYRCHGAIMITGS  116

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAK  1354
             HLPY  NGLKFFT+ GG    +++ I ++A  KY N     S   R    K+DF+  Y+ 
Sbjct  117   HLPYYYNGLKFFTESGGCEKEDIKYILNRALNKYDN-----SVHSRGNIFKIDFIDEYSG  171

Query  1353  HLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGM  1174
              L   I+E +N   +Y+ PL   +IIV+AGNG+GGFF   VL+ LGA   GS  + PDG 
Sbjct  172   ILVKKIREGINSKVNYNRPLSELKIIVDAGNGAGGFFANKVLEPLGAKIEGSQFIIPDGK  231

Query  1173  FPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSA  994
             FPNH+PNPEDK AM   + AV++N ADLG++FD DVDR+ +VD SG  IN + LIAL+S 
Sbjct  232   FPNHLPNPEDKEAMHSIKEAVIKNKADLGIIFDADVDRAAIVDCSGREINRNALIALIST  291

Query  993   IVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             IVL+E+PGTT+VTD+ TS GL+ FI   GG+H  ++ GYRNVI++G+ LN      +L +
Sbjct  292   IVLEEYPGTTIVTDSVTSDGLSEFIQELGGKHHRFKRGYRNVINEGIRLNNQNEGCYLAI  351

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDV  634
             ETSGH A KENYFLDDGAY++ K++I+M ++K EG  + I  LI++++ P+E+ E R D+
Sbjct  352   ETSGHAAFKENYFLDDGAYLIAKVLIKMARLKSEG--KSIEDLIQNMKMPVESLEFRFDI  409

Query  633   LSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMY  454
             L E  + K    + +E  + YIEK  + GW          SE   V  N     I+   +
Sbjct  410   LDE--NFKEYGDKILEELKLYIEK--VEGW----------SE---VSPNYEGIRINCCSF  452

Query  453   RAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEMAKFLD  274
             +           GW+ LR S+H P + +N++ ++ G    +   L+  FL+     K LD
Sbjct  453   KGS---------GWLLLRLSLHEPVLCLNIECDLSGYSNIIIDKLKS-FLIE---YKELD  499

Query  273   ISQI  262
             I+ +
Sbjct  500   ITSL  503



>ref|WP_036067048.1| phosphoglucomutase [Listeria grandensis]
 gb|EUJ22824.1| phosphoglucomutase/phosphomannomutase family protein [Listeria 
grandensis FSL F6-971]
Length=500

 Score =   394 bits (1011),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 223/533 (42%), Positives = 322/533 (60%), Gaps = 42/533 (8%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             ++ LQNGSD+RG+A++ +K   V LT   V AIA  F  W+      ++ G   E V V+
Sbjct  3     LKDLQNGSDIRGIAIETDK-HDVTLTDEYVSAIAIGFAAWL---RHVKKAG---ERVSVA  55

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHL  1528
             +G D R+S   +   + A L ++G  V D+GLATTPA FM+T    +  DA+IM+TASHL
Sbjct  56    IGHDSRLSAGRIKDVLTASLTRSGIDVVDVGLATTPAMFMATQYDGYTCDAAIMITASHL  115

Query  1527  PYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
             PY  NGLK FT+ GG    +++ I + A    A  +AK +  +   P     +  YA  L
Sbjct  116   PYFYNGLKLFTRDGGAEHEDIDYIVENAD---AVVVAKTAGTVTQKP----LLQKYAADL  168

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
              D I+  +   T ++ PL G  I+V+AGNG+GGFF  +VL KLGAD  GS  L PDG FP
Sbjct  169   VDKIRAGIQDATDFENPLAGSHIVVDAGNGAGGFFATEVLAKLGADVTGSQFLEPDGRFP  228

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NHIPNP++  AMA  + AVL N ADLGV+FDTDVDR+ +VDR G  +N + LIA++SAIV
Sbjct  229   NHIPNPDNNEAMASLKEAVLANKADLGVIFDTDVDRAAIVDRDGESLNRNPLIAVISAIV  288

Query  987   LKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             L+E+PGTT+VTD+ TS  L +FI   GG+   ++ GYRNVI++ + LN+ G  + L +E 
Sbjct  289   LEEYPGTTIVTDSTTSTHLEKFIADLGGKQHRFKRGYRNVINEAIRLNDTGTPSELAIEV  348

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGH ALKENYFLDDGAY++ KI++   K++ EG +  +  L +DL+ P +  E+R+ +L+
Sbjct  349   SGHAALKENYFLDDGAYLIAKILMRYAKLRKEGKD--LADLTRDLKVPADNDEIRLSILA  406

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
                + KA  + A+E F+ ++ K +  G EL+        EG  ++T+       AF    
Sbjct  407   S--NFKAYGLAALEDFKGFVAKTD--GLELEPVN----QEGVRINTS------GAF----  448

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGEM  289
                      +GW  LR S+H P + VNL+S+  GG + +   L + F+   E+
Sbjct  449   --------GNGWFLLRMSLHEPVMPVNLESDEVGGVEKIKAVLEEFFVGYAEI  493



>ref|WP_029276447.1| phosphoglucomutase [Carnobacterium jeotgali]
Length=508

 Score =   394 bits (1012),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 222/535 (41%), Positives = 317/535 (59%), Gaps = 49/535 (9%)
 Frame = -1

Query  1890  KIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVIS----GLESERGGAVVE  1723
             K+  LQNGSD+RG+A++  + + + LT   +E IA  F  W+      G+E+E      +
Sbjct  5     KLASLQNGSDIRGIAIETAEHK-LTLTDERIENIAYGFAAWLKEVKQLGVENEN-----K  58

Query  1722  SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMM  1543
              + VS+G D R+S + +  A   GL  AG  V D+GL+TTPA FMST    ++ D ++M+
Sbjct  59    PLTVSVGHDSRLSAERIKTAFIKGLTNAGIDVIDVGLSTTPAMFMSTKYDAYKCDGAVMV  118

Query  1542  TASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARK---YANRMAKVSTALRAPPSKVDF  1372
             TASHLP+  NGLKFFTK GG    +++ I + A+ +   + N   K++T           
Sbjct  119   TASHLPFEYNGLKFFTKDGGAEHEDIDYILNHASWETITWDNNQGKITTG--------SL  170

Query  1371  MSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLH  1192
             +  YAK L   I+  +N   +Y+ PL    I+V+AGNG+GGFF   VL  LGA+  GS  
Sbjct  171   LDEYAKDLVTKIRVGINDKDYYEQPLASRHIVVDAGNGAGGFFAEKVLLPLGANISGSQF  230

Query  1191  LNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRL  1012
             L PDG FPNHIPNP++K AM   + AVL N AD+GV+FDTDVDRS +VDR G+ +N + L
Sbjct  231   LEPDGNFPNHIPNPDNKEAMKSIQEAVLMNKADMGVIFDTDVDRSALVDRKGDTLNRNNL  290

Query  1011  IALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGV  832
             IA++SAI++KE+PGTT+VT + TS  L  FIT  GG+   Y  GYRNVI++G+ LN +G+
Sbjct  291   IAVISAILIKENPGTTIVTSSATSEHLKTFITSLGGKQDRYITGYRNVINRGIQLNNEGI  350

Query  831   ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETA  652
              T L +ETSGH AL+ENYFLDDGAY+V KI+  M    L+ + +    LI  L++P+ET 
Sbjct  351   LTSLAIETSGHAALEENYFLDDGAYLVAKIL--MADATLQKAGKDFSDLITSLKQPIETD  408

Query  651   ELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAA  472
             E+R  +LSE    +A   + +E+F  +IEK +      D   +    EG  V+T  H   
Sbjct  409   EVRFKILSED--TRATGAKVMEAFTLFIEKTS------DLSIEPANLEGVRVNTTGHYGT  460

Query  471   IDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                               GW+ LR S+H P + +NL+S+  G  Q +   ++D F
Sbjct  461   ------------------GWMLLRMSLHEPLLVLNLESDQAGSIQLLRETIKDFF  497



>ref|XP_007220543.1| hypothetical protein PRUPE_ppa002945mg [Prunus persica]
 gb|EMJ21742.1| hypothetical protein PRUPE_ppa002945mg [Prunus persica]
Length=619

 Score =   398 bits (1022),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 238/559 (43%), Positives = 329/559 (59%), Gaps = 50/559 (9%)
 Frame = -1

Query  1983  QSFPKIKLSLRVESSLTANKHNEVAVDEEMEKIR--RLQNGSDVRGVALQGEKGRSVDLT  1810
             ++F K + S     ++  N     A    ++K+   +LQNGSD+RGVA+ G +G  ++LT
Sbjct  59    RNFAKYQSSFVNRRTVHCNAAPSTAAVPNLDKVDFLKLQNGSDIRGVAVAGVEGEPLNLT  118

Query  1809  PPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCL  1630
              P  EAIA  F  W+   LE ++       + +S+G D RIS K L  A+  G+  AG  
Sbjct  119   EPVSEAIAAGFAAWL---LEKKKADGS-RRLSISVGHDSRISAKKLEDAISRGIAGAGLD  174

Query  1629  VFDMGLATTPACFMSTVLPPFQY----DASIMMTASHLPYTRNGLKFFTKKGGLTSTEVE  1462
             V   GLA+TPA F STV     +    D SIM+TASHLPY RNG KFFT  GGL   +++
Sbjct  175   VVQYGLASTPAMFNSTVTEDDAFLCPVDGSIMITASHLPYNRNGFKFFTNAGGLGKADIK  234

Query  1461  AICDKAARKYANRMAKVSTALR----APPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPL  1294
              I ++AA  Y    A+  T+ +    A   +VD+M+ Y     D++K       + + PL
Sbjct  235   NILERAADIYNKFTAEGLTSSKGKAVASVKRVDYMNVYTS---DLVKAVRKAAGNIEKPL  291

Query  1293  QGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAA  1114
             +GF I+V+AGNG+GGFF   VL+ LGA T GS  L PDGMFPNHIPNPEDKTAM     A
Sbjct  292   EGFHIVVDAGNGAGGFFAAKVLEPLGAVTSGSQFLEPDGMFPNHIPNPEDKTAMKAITQA  351

Query  1113  VLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMG  934
             VL N ADLG++FDTDVDRS  VD +G   N +RLIALMSAIVL+EHPGTT+VTD+ TS G
Sbjct  352   VLDNKADLGIIFDTDVDRSAAVDSTGLEFNRNRLIALMSAIVLEEHPGTTIVTDSVTSDG  411

Query  933   LTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAY  757
             LT FI  + GG+H  ++ GY+NVID+ + LN  G E+HL +ETSGHGALKEN++LDDGAY
Sbjct  412   LTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEESHLAIETSGHGALKENHWLDDGAY  471

Query  756   MVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIE  586
             ++VKI+ ++   +  G   G   +  L++ L+EP  + ELR+ +    +  K        
Sbjct  472   LMVKILNKIASARASGQTGGSKVLTGLLEGLQEPAFSVELRLKINQSHQDLKGG------  525

Query  585   SFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEE---NGEHG  415
             SFR Y                    E  L    ++  + D  + +A V+ E    +G  G
Sbjct  526   SFRDY-------------------GEAVLKHLENYIDS-DPKLQKAPVNYEGVRVSGYGG  565

Query  414   WVHLRQSIHNPNIAVNLQS  358
             W  LR S+H+P + +N+++
Sbjct  566   WFLLRLSLHDPVLPLNIEA  584



>ref|WP_036084964.1| phosphoglucomutase [Listeriaceae bacterium FSL A5-0281]
 gb|KGL42986.1| phosphoglucomutase [Listeriaceae bacterium FSL A5-0281]
Length=500

 Score =   394 bits (1011),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 221/527 (42%), Positives = 319/527 (61%), Gaps = 42/527 (8%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             ++ LQNGSD+RG+A++ +K   V LT   V AIA  F  W    L   +G    E+  V+
Sbjct  3     LKDLQNGSDIRGIAIETDK-YQVTLTDEHVAAIAIGFAAW----LRDVKGAG--ETATVA  55

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHL  1528
             +G D R+S   +   + A L ++G  V D+GLATTPA FM+T    +  DA+IM+TASHL
Sbjct  56    IGHDSRLSAGRIKDVLTASLTRSGLDVVDVGLATTPAMFMATQYDGYTCDAAIMITASHL  115

Query  1527  PYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHL  1348
             PY  NGLK FT+ GG    +++ I + A + +   +AKV+  +   P     +  YA  L
Sbjct  116   PYFYNGLKLFTRDGGAEHEDIDYIVENAGQVF---VAKVAGTVTEKP----LLQDYAADL  168

Query  1347  RDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFP  1168
                I+  ++  T+Y+ PL G  I+V+AGNG+GGFF  DVL +LGAD  GS  L+PDG FP
Sbjct  169   VGKIRAGIDDATNYERPLAGSHIVVDAGNGAGGFFATDVLAELGADITGSQFLDPDGNFP  228

Query  1167  NHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIV  988
             NHIPNP++  AMA  + AV  N ADLGV+FDTDVDR+ +VD+ G  +N + LIA++SAIV
Sbjct  229   NHIPNPDNNEAMASLKEAVAANKADLGVIFDTDVDRAAIVDKDGESLNRNPLIAVISAIV  288

Query  987   LKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMET  808
             L+EHPGTT+VTD+ TS  L  FI   GG+   ++ GYRNVI++ + LNE G ++ + +E 
Sbjct  289   LEEHPGTTIVTDSTTSTHLEHFIANLGGKQHRFKRGYRNVINEAIRLNEAGTQSEIAIEV  348

Query  807   SGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLS  628
             SGH ALKENYFLDDGAY++ KI++   K++ EG +  +  L +DL+ P +  E+R+ +L+
Sbjct  349   SGHAALKENYFLDDGAYLIAKILMRYAKLRKEGKD--LADLTRDLQVPADNDEVRLSILA  406

Query  627   EPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRA  448
             E       AV  ++ F  ++EK +  G  ++        EG  V+T+       AF    
Sbjct  407   EDFKTYGLAV--LKDFEAFVEKTD--GLAIEPAN----QEGVRVNTD------GAF----  448

Query  447   KVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                      +GW  LR S+H P + VNL+S+  GG + +   LR+ F
Sbjct  449   --------GNGWFLLRMSLHEPVMPVNLESDEIGGTEKIKAALREFF  487



>ref|XP_002974017.1| hypothetical protein SELMODRAFT_100482 [Selaginella moellendorffii]
 gb|EFJ24972.1| hypothetical protein SELMODRAFT_100482 [Selaginella moellendorffii]
Length=534

 Score =   395 bits (1014),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 243/575 (42%), Positives = 340/575 (59%), Gaps = 60/575 (10%)
 Frame = -1

Query  1932  ANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGL  1753
             A  +N   V E+++  R+LQNGSD+RGVA+ G +  +V+LT    +AI  +F +W    L
Sbjct  3     AGTYNASTVVEKID-FRKLQNGSDIRGVAVAGGE-EAVNLTVDVAKAIGAAFAQW----L  56

Query  1752  ESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV--  1579
               ++  +   ++RVS+G D RIS  SL  A+  G+G  G  V   GLA+TPA F STV  
Sbjct  57    ADKKKESTSSALRVSIGHDSRISASSLEQAIAQGIGDTGLDVVLYGLASTPAMFNSTVTE  116

Query  1578  ----LPPFQYDASIMMTASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKV  1411
                 L P   D +IM+TASHLPY RNG KFFT  GGL   ++  I  +AA+ ++   ++ 
Sbjct  117   REDLLCP--ADGAIMITASHLPYNRNGFKFFTNTGGLGKADISDILSRAAQIHSGSSSQG  174

Query  1410  STALRAPPSKVDFMSAYAKHLRDII-----KERVNHPTHYDTPLQGFQIIVNAGNGSGGF  1246
             +   +    +V++M  YA  L  I+     KER         PL+GF I+V+AGNG+GGF
Sbjct  175   NVTSK-DMKRVNYMDHYASDLVKIVQAAGGKER---------PLEGFHILVDAGNGAGGF  224

Query  1245  FTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDV  1066
             F   VL  LGADT GS  L PDGMFPNHIPNPEDK AM    +AVL++ ADLG++FDTDV
Sbjct  225   FAEKVLKPLGADTTGSQFLEPDGMFPNHIPNPEDKKAMEAVTSAVLKHKADLGIIFDTDV  284

Query  1065  DRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLY  889
             DRS  VD SG  +N +RLIAL+SAIVL EHPGTT+VTD+ TS GLT FI  + GG+H  +
Sbjct  285   DRSAAVDSSGRELNRNRLIALISAIVLAEHPGTTIVTDSITSDGLTEFIEKKLGGKHHRF  344

Query  888   RVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEG  709
             + GY+NVID+G+ LN  G E+HL +ETSGHGALKEN +LDDGAY++VK++I++   K  G
Sbjct  345   KRGYKNVIDEGIRLNSVGEESHLAIETSGHGALKENRWLDDGAYLMVKLLIKLAAGKAAG  404

Query  708   SEEG---IGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWEL  538
               EG   +  LI+ LEE     E R+ +    +   +K      +FR Y E+       L
Sbjct  405   EGEGSEVLTRLIESLEEAGFATEFRLKINESHQDVGSK------TFREYGEE------VL  452

Query  537   DSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQS  358
                 +   S+  L     +   +       +VS    G  GW  LR S+H+P + +N+++
Sbjct  453   RRLEESLSSDSNLTKAPKNYEGV-------RVS----GHGGWFLLRLSLHDPVLPLNIEA  501

Query  357   NIPGGCQSMARDLRDKFLLAGEMAKFLDISQIDEF  253
                   Q +   + +  +++G   K LD+S + +F
Sbjct  502   PTKDAAQKLGSFVME--VVSG--FKALDVSSLQKF  532



>ref|WP_010425044.1| phosphoglucomutase [Anaerophaga thermohalophila]
Length=510

 Score =   394 bits (1011),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 229/532 (43%), Positives = 314/532 (59%), Gaps = 41/532 (8%)
 Frame = -1

Query  1899  EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES  1720
             E    + L NGSD+RG+A +G KG  V+  P  +E +  +F  W+ +    +      + 
Sbjct  2     EQFNFKALHNGSDIRGIARKGLKGEQVNFGPEVIEKLGRAFVIWLQTYFSGK------DK  55

Query  1719  VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMT  1540
             +R+S+G D R SG  LS A+  GL  AG  V D GLA+TPA FMST L     DA IM+T
Sbjct  56    LRISVGRDCRHSGAELSEALCKGLTVAGADVVDFGLASTPAMFMSTQLGDNPVDAGIMIT  115

Query  1539  ASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAY  1360
              SH P   NGLKFFT +GGL   ++  I + A     N   KV    +    + DFM  Y
Sbjct  116   GSHAPQNHNGLKFFTSEGGLDKNDINEILELAE----NNPHKVRH--KGSIVREDFMKTY  169

Query  1359  AKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPD  1180
             +++L D++K+ V H   YD PL+G +I+V+AGNG GGFF  +VL  LGAD   S  L PD
Sbjct  170   SEYLSDVVKKGVKHAEVYDKPLEGLKIVVDAGNGCGGFFATEVLQSLGADVSESQFLEPD  229

Query  1179  GMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALM  1000
             G FPNH P+PED TA+      V ++ ADLGV+FDTDVDR+G VD +G P+N + LIALM
Sbjct  230   GDFPNHAPDPEDTTAIVSLSNKVKESNADLGVIFDTDVDRTGFVDDTGKPVNRNSLIALM  289

Query  999   SAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETH  823
             SAIVLKEHP +T+VTD+ TS GL+ FI    GG+H  Y+ GY+NVI++ V LN  G ET 
Sbjct  290   SAIVLKEHPESTIVTDSITSDGLSWFINEHLGGKHHRYQRGYKNVINEAVRLNGIGQETW  349

Query  822   LMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELR  643
             L +ETSGH A KENYFLDDGAY  +K+II +  ++ +G    +  LIKDL + +++ E+R
Sbjct  350   LAIETSGHAAFKENYFLDDGAYTAIKLIITLANLRSKGKR--LNELIKDLPDSVDSCEVR  407

Query  642   MDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDA  463
             + +++   + +A +    E+    I  GN   W+L                   P   + 
Sbjct  408   L-MITSSDYIQAGSDIISET---GIMAGNKSNWDL------------------LPENYEG  445

Query  462   FMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                R K S    G+ GW  LR S+H+P +A+N++SN  GG Q +A +L D F
Sbjct  446   V--RVKCSGP--GQDGWFLLRLSLHDPVLALNIESNESGGVQKIAEELFDFF  493



>ref|XP_008233320.1| PREDICTED: uncharacterized protein LOC103332366 isoform X2 [Prunus 
mume]
Length=579

 Score =   396 bits (1017),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 233/525 (44%), Positives = 318/525 (61%), Gaps = 52/525 (10%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  ++LT P  EAIA  F  W+   LE ++       + +S+G
Sbjct  55    KLQNGSDIRGVAVAGVEGEPLNLTEPVSEAIAAGFAAWL---LEKKKADGS-RRLSISVG  110

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS K L  A+  G+  AG  V   GLA+TPA F STV     +    D SIM+TAS
Sbjct  111   HDSRISAKKLEDAISRGIAGAGLDVVQYGLASTPAMFNSTVTEDDAFLCPVDGSIMITAS  170

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALR----APPSKVDFMS  1366
             HLPY RNG KFFT  GGL   +++ I ++AA  Y    A+  T+ +    A   +VD+M+
Sbjct  171   HLPYNRNGFKFFTNAGGLGKADIKNILERAADIYNKFTAEGLTSSKGKALASVKRVDYMN  230

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL+ LGA T GS  L 
Sbjct  231   VYTS---DLVKAVRKAAGNIEKPLEGFHIVVDAGNGAGGFFAAKVLEPLGAVTSGSQFLE  287

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDGMFPNHIPNPEDKTAM     AVL N ADLG++FDTDVDRS  VD +G   N +RLIA
Sbjct  288   PDGMFPNHIPNPEDKTAMKAITQAVLDNKADLGIIFDTDVDRSAAVDSTGLEFNRNRLIA  347

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G E
Sbjct  348   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEE  407

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMK---LEGSEEGIGSLIKDLEEPLE  658
             +HL +ETSGHGALKEN++LDDGAY++VKI+ ++   +   L G  + +  L++ L+EP  
Sbjct  408   SHLAIETSGHGALKENHWLDDGAYLMVKILNKIASARASGLTGGSKVLTGLLEGLQEPAF  467

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEK--GNLPGWELDSCGDCWVSEGCLVDTND  484
             + ELR+ +    +  K        SFR Y E    +L  +               +D+N 
Sbjct  468   SVELRLKINQSHQDLKGG------SFRDYGEAVLKHLENY---------------IDSNP  506

Query  483   HPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQS  358
                     + +A V+ E    +G  GW  LR S+H+P + +N+++
Sbjct  507   K-------LQKAPVNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEA  544



>ref|WP_034550417.1| phosphoglucomutase [Carnobacterium funditum]
Length=509

 Score =   393 bits (1010),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 224/525 (43%), Positives = 315/525 (60%), Gaps = 39/525 (7%)
 Frame = -1

Query  1887  IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS  1708
             +  LQNGSD+RG+A+Q  K     LT   +E I+     W+    + ++      S++V+
Sbjct  9     LTNLQNGSDIRGIAIQ-TKNNEQTLTDERIEQISYGLLVWL---KDIKKLNYQTNSIKVA  64

Query  1707  LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHL  1528
             +G D R+S   +       L + G  V D+GLATTPA FMST    F  DA++M+TASHL
Sbjct  65    IGYDSRLSANRIQKIAMNTLIKLGIDVVDVGLATTPAMFMSTQYKDFNCDAAVMITASHL  124

Query  1527  PYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTA-LRAPPSKVDFMSAYAKH  1351
             PY  NGLK FTK GG    ++E I   A  K      K++ A  +    K + +  YA  
Sbjct  125   PYEYNGLKIFTKDGGAEHEDIEFILKNADVK------KLTDAESKGTVKKANLLKVYAAD  178

Query  1350  LRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMF  1171
             LR+ IK  +N    ++ PL G  IIV+AGNG+GGFF  +VL+KLGA   GS  L+PDG F
Sbjct  179   LREKIKRGINDVKSHEKPLAGRHIIVDAGNGAGGFFATEVLEKLGATISGSQFLDPDGTF  238

Query  1170  PNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAI  991
             PNHIPNP++K AM   + AVL++ ADLG++FDTDVDRS +VD  G P+N + LIA++SAI
Sbjct  239   PNHIPNPDNKEAMTSIQKAVLKHQADLGIIFDTDVDRSALVDHEGVPLNRNNLIAVISAI  298

Query  990   VLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMME  811
             ++ E+PGTT+VT++ TS  L  FI   GG    Y  GYRNVI++ + LN +G+ T L +E
Sbjct  299   LIDENPGTTIVTNSATSEHLKTFIEELGGNQNRYLTGYRNVINQALKLNHEGIHTSLAIE  358

Query  810   TSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVL  631
             TSGH ALKENYFLDDGAY+V KI+I   +++ E  +  IGSLI+ LE+PLET E+R  +L
Sbjct  359   TSGHAALKENYFLDDGAYLVAKILIADARLRKENKK--IGSLIEALEQPLETDEVRFRIL  416

Query  630   SEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYR  451
             ++P   K   ++ IE F  +I KG +P   ++       SEG  V+T          +Y 
Sbjct  417   TQP--IKKIGLDTIEKFSKFI-KG-MPDLTIEPNN----SEGVRVNTEG--------IYG  460

Query  450   AKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLR  316
             A          GW  LR S+H P + +  +S+  G  +++ +DL+
Sbjct  461   A----------GWFLLRMSLHEPLLVLTFESDTIGKIKNLRQDLK  495



>ref|XP_008233319.1| PREDICTED: uncharacterized protein LOC103332366 isoform X1 [Prunus 
mume]
Length=619

 Score =   397 bits (1020),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 240/559 (43%), Positives = 331/559 (59%), Gaps = 50/559 (9%)
 Frame = -1

Query  1983  QSFPKIKLSLRVESSLTANKHNEVAVDEEMEKIR--RLQNGSDVRGVALQGEKGRSVDLT  1810
             ++F K + S     ++  N     A    ++K+   +LQNGSD+RGVA+ G +G  ++LT
Sbjct  59    RNFSKYQSSFVNRRTVHCNAAPSTAAVPNLDKVDFLKLQNGSDIRGVAVAGVEGEPLNLT  118

Query  1809  PPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCL  1630
              P  EAIA  F  W+   LE ++       + +S+G D RIS K L  A+  G+  AG  
Sbjct  119   EPVSEAIAAGFAAWL---LEKKKADGS-RRLSISVGHDSRISAKKLEDAISRGIAGAGLD  174

Query  1629  VFDMGLATTPACFMSTVLPPFQY----DASIMMTASHLPYTRNGLKFFTKKGGLTSTEVE  1462
             V   GLA+TPA F STV     +    D SIM+TASHLPY RNG KFFT  GGL   +++
Sbjct  175   VVQYGLASTPAMFNSTVTEDDAFLCPVDGSIMITASHLPYNRNGFKFFTNAGGLGKADIK  234

Query  1461  AICDKAARKYANRMAKVSTALR----APPSKVDFMSAYAKHLRDIIKERVNHPTHYDTPL  1294
              I ++AA  Y    A+  T+ +    A   +VD+M+ Y     D++K       + + PL
Sbjct  235   NILERAADIYNKFTAEGLTSSKGKALASVKRVDYMNVYTS---DLVKAVRKAAGNIEKPL  291

Query  1293  QGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPNHIPNPEDKTAMAMTRAA  1114
             +GF I+V+AGNG+GGFF   VL+ LGA T GS  L PDGMFPNHIPNPEDKTAM     A
Sbjct  292   EGFHIVVDAGNGAGGFFAAKVLEPLGAVTSGSQFLEPDGMFPNHIPNPEDKTAMKAITQA  351

Query  1113  VLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVLKEHPGTTVVTDARTSMG  934
             VL N ADLG++FDTDVDRS  VD +G   N +RLIALMSAIVL+EHPGTT+VTD+ TS G
Sbjct  352   VLDNKADLGIIFDTDVDRSAAVDSTGLEFNRNRLIALMSAIVLEEHPGTTIVTDSVTSDG  411

Query  933   LTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETSGHGALKENYFLDDGAY  757
             LT FI  + GG+H  ++ GY+NVID+ + LN  G E+HL +ETSGHGALKEN++LDDGAY
Sbjct  412   LTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEESHLAIETSGHGALKENHWLDDGAY  471

Query  756   MVVKIIIEMVKMK---LEGSEEGIGSLIKDLEEPLETAELRMDVLSEPRHAKAKAVEAIE  586
             ++VKI+ ++   +   L G  + +  L++ L+EP  + ELR+ +    +  K        
Sbjct  472   LMVKILNKIASARASGLTGGSKVLTGLLEGLQEPAFSVELRLKINQSHQDLKGG------  525

Query  585   SFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAKVSNEE---NGEHG  415
             SFR Y E   L   E              +D+N         + +A V+ E    +G  G
Sbjct  526   SFRDYGE-AVLKHLE------------NYIDSNPK-------LQKAPVNYEGVRVSGYGG  565

Query  414   WVHLRQSIHNPNIAVNLQS  358
             W  LR S+H+P + +N+++
Sbjct  566   WFLLRLSLHDPVLPLNIEA  584



>ref|WP_035023284.1| phosphoglucomutase [Carnobacterium sp. WN1374]
Length=509

 Score =   393 bits (1010),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 223/531 (42%), Positives = 315/531 (59%), Gaps = 49/531 (9%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVIS----GLESERGGAVVESVRV  1711
             LQNGSD+RG+A++      + LT   +E IA  +  W+       +E E+     + V V
Sbjct  10    LQNGSDIRGIAIK-TSDHDITLTDERIEKIAYGYAVWLKEVKQLAVEDEK-----KPVTV  63

Query  1710  SLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASH  1531
             S+G D R+S   + A    GL  AG  V D+GL+TTPA FMST    ++ D ++M+TASH
Sbjct  64    SVGHDSRLSADRIKAVFIEGLNNAGIDVVDVGLSTTPAMFMSTQYVSYKCDGAVMITASH  123

Query  1530  LPYTRNGLKFFTKKGGLTSTEVEAICDKAARK---YANRMAKVSTALRAPPSKVDFMSAY  1360
             LP+  NGLKFFTK GG    +++ I  K+  +   + N   KVS   +AP      ++ Y
Sbjct  124   LPFEYNGLKFFTKDGGAEHEDIDFILQKSDWENVTWENNQGKVS---KAP-----LLNDY  175

Query  1359  AKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPD  1180
             AK L + I+  +N    Y+ PL G  I+V+AGNG+GGFF   VL  LGAD  GS +L+P+
Sbjct  176   AKDLVNKIRIGINDKDMYEKPLTGRHIVVDAGNGAGGFFAEKVLVPLGADISGSQYLDPN  235

Query  1179  GMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALM  1000
             G FPNHIPNP++K AM   + AVLQ+ AD+GV+FDTDVDRS +VDR G+ +N + LIA++
Sbjct  236   GHFPNHIPNPDNKEAMKSIQKAVLQHEADMGVIFDTDVDRSALVDRKGDTLNRNNLIAVI  295

Query  999   SAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHL  820
             SAI++KE+P TT+VT + TS  L  FIT  GG+   Y  GYRNVI++ + LN++GV+T L
Sbjct  296   SAILIKENPNTTIVTSSATSEHLKTFITSLGGKQDRYITGYRNVINRAIQLNKEGVQTSL  355

Query  819   MMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRM  640
              +ETSGH AL+ENYFLDDGAY+V KI++    +K EG +     LI  L++P+ET E+R 
Sbjct  356   AIETSGHAALQENYFLDDGAYLVAKILMADANLKKEGKD--FSDLITTLKQPVETDEVRF  413

Query  639   DVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF  460
              +L E   A  K V  +E F  +IE       E D   +    EG  V+T+    A    
Sbjct  414   KILPEDIQATGKKV--MEDFSRFIEN------ETDLSIEPANLEGVRVNTSGQYGA----  461

Query  459   MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                           GW+ LR S+H P + +N +S+  G  + +   ++D F
Sbjct  462   --------------GWMLLRMSLHEPLLVLNFESDQAGSIKKLRETIKDFF  498



>ref|WP_013405673.1| phosphoglucomutase [Halanaerobium hydrogeniformans]
 ref|YP_003994944.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Halanaerobium hydrogeniformans]
 gb|ADQ14590.1| phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain 
I [Halanaerobium hydrogeniformans]
Length=511

 Score =   393 bits (1009),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 222/544 (41%), Positives = 315/544 (58%), Gaps = 42/544 (8%)
 Frame = -1

Query  1896  MEKIR--RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVE  1723
             M KI   +L +G+D+RG A+ G K   ++LT   V  I  SF  W+     +++    V+
Sbjct  1     MSKINWSKLLSGTDIRGKAV-GSKDSQIELTDQVVYGIGISFCTWL-----ADKKNKEVK  54

Query  1722  SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMM  1543
             ++ +++G D R+S + L  A+F GL      VFD GLA+TPA FM+TVL   QYD +IM+
Sbjct  55    NLTIAVGHDSRVSAQRLKDALFKGLSHYDARVFDAGLASTPAMFMATVLEGHQYDGAIMI  114

Query  1542  TASHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMA--KVSTALRAPPSKVDFM  1369
             TASHLP+ +NG KFF+++GGL   +V+ I   AA+   + +   K         +K++ +
Sbjct  115   TASHLPFDKNGFKFFSREGGLEKEDVKNILSFAAQNETDILENYKKEQLKEIKANKINLI  174

Query  1368  SAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHL  1189
             S Y  HL+ II+  +N     D PL G +IIV+AGNG+GGFF   +L  LGAD  GS  L
Sbjct  175   SDYCSHLKAIIRNELNKDIDKDKPLAGSKIIVDAGNGAGGFFADQILKDLGADIDGSQFL  234

Query  1188  NPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLI  1009
               DG FPNH PNPEDK A+   + AV++N ADLG++FDTDVDR+ VVD  G  IN ++LI
Sbjct  235   EADGYFPNHPPNPEDKEAIKSIKKAVVENDADLGIIFDTDVDRAAVVDGDGQAINRNKLI  294

Query  1008  ALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGV  832
             AL + IVL+++PGTT+VTD+ TS+GL +FI  + GG H  ++ GY+NVI++   L E+G 
Sbjct  295   ALAAKIVLEDYPGTTIVTDSVTSVGLNKFIENKLGGIHHRFKRGYKNVINEAKRLEEEGQ  354

Query  831   ETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETA  652
                L +ETSGH A KENYFLDDGAYMV K++I+M  +K EG    IG LI DLEE     
Sbjct  355   TVPLAIETSGHAAFKENYFLDDGAYMVAKVLIKMANLKAEGI-NNIGELISDLEEAEIKK  413

Query  651   ELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAA  472
             E RM +  E  H   + +  I++ ++YI+   +  WEL       +   C          
Sbjct  414   EYRMQIELEDFHQYGQDI--IDNLKNYIKV--IDNWELAPKNYQGIRVNC----------  459

Query  471   IDAFMYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKFLLAGE  292
                            G   W  LR S+H+P + +N++ +     + +   LR KFL   E
Sbjct  460   ---------------GNKDWFLLRMSLHDPVLVLNVECDDNSKLEYIKEQLR-KFLSNYE  503

Query  291   MAKF  280
               K 
Sbjct  504   KVKL  507



>ref|WP_021408503.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
III family protein [Peptoclostridium difficile]
 gb|EQH99229.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
III family protein [Clostridium difficile F314]
 emb|CCL34508.1| Putative phosphohexomutase [Peptoclostridium difficile T23]
Length=500

 Score =   392 bits (1008),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 217/543 (40%), Positives = 319/543 (59%), Gaps = 53/543 (10%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             M  + +LQNG+D+RG+A + +  + V+LT   V+ IA++F  W+    + ++       V
Sbjct  1     MGDLYKLQNGTDIRGIAYEND-SKEVNLTVEEVKKIAKAFHIWLKEKTKKDK-------V  52

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
              V++G D RI+G    + V   L    C V D  +ATTPA FM+T++  +  D +IM+TA
Sbjct  53    TVAIGTDSRITGSQFRSIVIETLTNDDCNVIDCEIATTPAMFMTTIMDGYNSDGAIMITA  112

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYA  1357
             SHLPY  NGLKFFT+ GGL  T+++ + D A +  +    +V+   +      + +  Y+
Sbjct  113   SHLPYYYNGLKFFTESGGLEKTDIKEMLDIAVKNDSVDYEEVNK--KGEVIVKNLIEDYS  170

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
               L D I++ VN   +Y+ P  G +I+V+AGNG+GGFF   VL  LGADT GS  LNPDG
Sbjct  171   NLLIDKIRKGVNSSKNYEKPFSGLKILVDAGNGAGGFFAEKVLHILGADTTGSQFLNPDG  230

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
             MFPNHIPNPE+K AM     AVL N +DLG++FDTDVDR+ +V ++GNPIN + LIA++S
Sbjct  231   MFPNHIPNPENKEAMESICKAVLDNNSDLGIIFDTDVDRAAIVGKNGNPINKNALIAVIS  290

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
             +IVL+EHP T +VTD+ TS GL +FI    G+H  ++ GY+NVI++ + LN +G E HL 
Sbjct  291   SIVLEEHPKTAIVTDSITSEGLAKFINELQGRHHRFKRGYKNVINEAIRLNSEGEECHLA  350

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGH ALKENYFLDDGAY++ KI+I++ K+ LEG          +  +  E  E+R+ 
Sbjct  351   IETSGHAALKENYFLDDGAYLIAKILIKVAKLSLEGKTIEELIENLEEAQ--EEKEVRIG  408

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF-  460
             +               E FR Y                   +E  L D + H  +ID + 
Sbjct  409   INK-------------EDFRPY-------------------AEDILKDLDSHVKSIDGWS  436

Query  459   -----MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLR---DKFL  304
                      +V+ +E+   GW  LR S+H P +A+N++SN  GG + +   L+   +K+ 
Sbjct  437   VAPNNFEGIRVNCDESNGDGWFLLRISLHEPLLALNIESNKIGGAEQIYSKLKLFLEKYD  496

Query  303   LAG  295
             L G
Sbjct  497   LKG  499



>ref|WP_003423133.1| phosphoglucomutase [Peptoclostridium difficile]
 gb|EFH07863.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
II [Clostridium difficile NAP08]
 gb|EFH16330.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
II [Clostridium difficile NAP07]
 emb|CCK87626.1| Putative phosphohexomutase [Peptoclostridium difficile T5]
 emb|CCK91081.1| Putative phosphohexomutase [Peptoclostridium difficile T20]
 emb|CCK94764.1| Putative phosphohexomutase [Peptoclostridium difficile E1]
 emb|CCK98721.1| Putative phosphohexomutase [Peptoclostridium difficile E10]
Length=500

 Score =   392 bits (1008),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 227/549 (41%), Positives = 326/549 (59%), Gaps = 65/549 (12%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             M  + +LQNG+D+RG+A + +  + V+LT   V  IA++F  W+    + ++       V
Sbjct  1     MGDLYKLQNGTDIRGIAYEND-SKEVNLTVEEVRKIAKAFHIWLKEKTKKDK-------V  52

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
              V++G D RI+G    +AV   L    C V D  +ATTPA FM+T++  +  D SIM+TA
Sbjct  53    TVAIGTDSRITGSQFRSAVIETLTNDDCNVIDCEIATTPAMFMTTIMDGYNSDGSIMITA  112

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAAR------KYANRMAKVSTALRAPPSKVD  1375
             SHLPY  NGLKFFT+ GGL   +++ + D A +      + AN+  KV +         +
Sbjct  113   SHLPYYYNGLKFFTESGGLEKADIKEMLDIADKNDSVDYEKANKKGKVISK--------N  164

Query  1374  FMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSL  1195
              +  Y+  L D I++ VN   +Y+ P  G +I+V+AGNG+GGFF   VL  LGADT GS 
Sbjct  165   LIEDYSNLLIDKIRKGVNSSKNYEKPFSGLKILVDAGNGAGGFFAEKVLHILGADTTGSQ  224

Query  1194  HLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDR  1015
              LNPDGMFPNHIPNPE+K AM     AVL N +DLG++FDTDVDR+ +V ++G PIN + 
Sbjct  225   FLNPDGMFPNHIPNPENKEAMESICKAVLDNKSDLGIIFDTDVDRAAIVGKNGKPINKNA  284

Query  1014  LIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDG  835
             LIA++S+IVL+EHP T +VTD+ TS GL +FI    G+H  Y+ GY+NVI++ + LN +G
Sbjct  285   LIAVISSIVLEEHPKTAIVTDSITSEGLAKFINELQGRHHRYKRGYKNVINEAIRLNSEG  344

Query  834   VETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLET  655
              E HL +ETSGH ALKENYFLDDGAY++ KI+I++ K+ LEG  + I  LI++LEE  E 
Sbjct  345   EECHLAIETSGHAALKENYFLDDGAYLIAKILIKVAKLSLEG--KTIEELIENLEEAREE  402

Query  654   AELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPA  475
              E+R+ +               E FR Y                   +E  L D + H  
Sbjct  403   KEVRIGINK-------------EDFRPY-------------------AEDILKDLDSHVR  430

Query  474   AIDAF------MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLR-  316
             +ID +          +V+ +E+   GW  LR S+H P +A+N++SN  GG + +   L+ 
Sbjct  431   SIDGWSVAPNNFEGIRVNCDESNGDGWFLLRISLHEPLLALNIESNKIGGAEQIYSKLKL  490

Query  315   --DKFLLAG  295
               +K+ L G
Sbjct  491   FLEKYDLRG  499



>ref|XP_002532751.1| phosphoglucomutase, putative [Ricinus communis]
 gb|EEF29628.1| phosphoglucomutase, putative [Ricinus communis]
Length=612

 Score =   396 bits (1017),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 241/562 (43%), Positives = 329/562 (59%), Gaps = 56/562 (10%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V LT P  EAIA  F  W+   LE ++  A  + +RVS+G
Sbjct  90    KLQNGSDIRGVAVAGVEGEPVTLTEPVTEAIAAGFAAWL---LEKKKADAP-KKLRVSIG  145

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS + L  AV  G+  A   V   GLA+TPA F ST+     +    D +IM+TAS
Sbjct  146   HDSRISAQILQDAVSRGIAGASLDVVQYGLASTPAMFNSTLTEDEAFLCPADGAIMITAS  205

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN----RMAKVSTALRAPPSKVDFMS  1366
             HLPY RNG KFFT  GGL   +++ I ++AA  Y N     + K      A   +VD+M+
Sbjct  206   HLPYNRNGFKFFTNSGGLGKADIKDILERAADIYKNFTDEGLMKSRREASASIKRVDYMT  265

Query  1365  AYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLN  1186
              Y   L   ++E   +    + PL+GF IIV+AGNG+GGFF   VL+ LGA T GS  L 
Sbjct  266   VYTSDLVKAVREAAGN---IEKPLEGFHIIVDAGNGAGGFFAAKVLEPLGAITSGSQFLE  322

Query  1185  PDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIA  1006
             PDG+FPNHIPNPEDK AM     AVLQN ADLG++FDTDVDRS  VD +G   N +RLIA
Sbjct  323   PDGLFPNHIPNPEDKAAMNAITQAVLQNKADLGIIFDTDVDRSAAVDSTGREFNRNRLIA  382

Query  1005  LMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVE  829
             LMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G E
Sbjct  383   LMSAIVLEEHPGTTIVTDSVTSDGLTTFIENKLGGKHHRFKRGYKNVIDEAIRLNSVGEE  442

Query  828   THLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLEEPLE  658
             +HL +ETSGHGALKEN++LDDGAY++VK++ ++   +  G   G   +  +++ L+EP  
Sbjct  443   SHLAIETSGHGALKENHWLDDGAYLMVKLLNKLASARASGVGGGSKVLTDMVEGLQEPAV  502

Query  657   TAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHP  478
               ELR+ +     H   K        R + E G      L +           VDT    
Sbjct  503   AVELRLKI--NQNHPDLKG-------RSFWEYGEAVLQHLKNS----------VDT----  539

Query  477   AAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                D  + +A V+ E    +G  GW  LR S+H+P + +N+++       +    L+   
Sbjct  540   ---DIKLQKAPVNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEA------PNKEDALKLGL  590

Query  306   LLAGEMAKF--LDISQIDEFAR  247
              +A  + +F  LD S +D+F +
Sbjct  591   AVASAVKEFHALDTSALDKFVQ  612



>ref|XP_002316369.2| hypothetical protein POPTR_0010s22980g [Populus trichocarpa]
 gb|EEF02540.2| hypothetical protein POPTR_0010s22980g [Populus trichocarpa]
Length=624

 Score =   396 bits (1018),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 241/564 (43%), Positives = 330/564 (59%), Gaps = 64/564 (11%)
 Frame = -1

Query  1881  RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG  1702
             +LQNGSD+RGVA+ G +G  V LT P  EAIA +F  W    L  ++     + ++VS+G
Sbjct  100   KLQNGSDIRGVAVPGVEGEPVTLTEPVTEAIAAAFSAW----LSEKKKVDASKPLKVSVG  155

Query  1701  MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTAS  1534
              D RIS + L  AV  G+  AG  V   GLA+TPA F ST+     +    D +IM+TAS
Sbjct  156   HDSRISAQVLQDAVTRGVASAGLDVVQYGLASTPAMFNSTLTEDEAFLCPVDGAIMITAS  215

Query  1533  HLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYAN--------RMAKVSTALRAPPSKV  1378
             HLPY RNG KFFT  GGL   +++ I ++A   Y +           K S +L+    +V
Sbjct  216   HLPYNRNGFKFFTNAGGLGKADIKNILERAVDIYNSFTDEGLMKSKRKASESLK----RV  271

Query  1377  DFMSAYAKHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGS  1198
             D+M+ Y     D++K       + + PL+GF I+V+AGNG+GGFF   VL  LGA T GS
Sbjct  272   DYMTLYTS---DLVKAVRKAAGNIEKPLEGFHIVVDAGNGAGGFFAEKVLQPLGAITSGS  328

Query  1197  LHLNPDGMFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGD  1018
               L PDGMFPNHIPNPEDKTAM     AVL+N ADLG++FDTDVDRS VVD +    N +
Sbjct  329   QFLEPDGMFPNHIPNPEDKTAMKAITQAVLENKADLGIIFDTDVDRSAVVDSTAREFNRN  388

Query  1017  RLIALMSAIVLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNE  841
             RLIALMSAIVL+EHPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ V LN 
Sbjct  389   RLIALMSAIVLEEHPGTTIVTDSVTSDGLTTFIENKLGGKHHRFKRGYKNVIDEAVRLNS  448

Query  840   DGVETHLMMETSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEG---IGSLIKDLE  670
              G E+HL +ETSGHGALKEN++LDDGAY++VK++ ++   +  G   G   +  L++ L+
Sbjct  449   VGEESHLAIETSGHGALKENHWLDDGAYLMVKVLNKLASARASGIAGGSKVLTDLVEGLQ  508

Query  669   EPLETAELRMDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDT  490
             EP    ELR+ +  +  H   K      SFR Y                    E  L   
Sbjct  509   EPRVAVELRLKI--DQNHPDLKG----GSFREY-------------------GEAVLKLL  543

Query  489   NDHPAAIDAFMYRAKVSNEE---NGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDL  319
              +H  + D  + +A V+ E    +G  GW  LR S+H+P + +N++++      S    +
Sbjct  544   ENHVES-DPKLQKAPVNYEGVRVSGLGGWFLLRLSLHDPVLPLNIEAS------SHEDAV  596

Query  318   RDKFLLAGEMAKF--LDISQIDEF  253
             +    +A  + KF  LD S +D+F
Sbjct  597   KLGLAVASAVKKFPALDTSALDKF  620



>ref|WP_021362754.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
III family protein [Peptoclostridium difficile]
 gb|EQE16404.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
III family protein [Peptoclostridium difficile CD17]
 gb|EQE62757.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
III family protein [Peptoclostridium difficile CD46]
 gb|EQH40717.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
III family protein [Clostridium difficile DA00244]
 gb|EQJ46291.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
III family protein [Clostridium difficile P24]
 gb|EQJ47550.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
III family protein [Clostridium difficile P25]
 gb|EQJ59151.1| phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain 
III family protein [Clostridium difficile P32]
 emb|CCL83968.1| Putative phosphohexomutase [Clostridium difficile T19]
Length=500

 Score =   392 bits (1007),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 217/543 (40%), Positives = 318/543 (59%), Gaps = 53/543 (10%)
 Frame = -1

Query  1896  MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV  1717
             M  + +LQNG+D+RG+A + +  + V+LT   V+ IA++F  W+    + ++       V
Sbjct  1     MGDLYKLQNGTDIRGIAYEND-SKEVNLTVEEVKKIAKAFHIWLKEKTKKDK-------V  52

Query  1716  RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTA  1537
              V++G D RI+G    + V   L    C V D  +ATTPA FM+T++  +  D +IM+TA
Sbjct  53    TVAIGTDSRITGSQFRSTVIETLTNDDCNVIDCEIATTPAMFMTTIMDGYNSDGAIMITA  112

Query  1536  SHLPYTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYA  1357
             SHLPY  NGLKFFT+ GGL  T+++ + D A +  +    +V+   +      + +  Y+
Sbjct  113   SHLPYYYNGLKFFTESGGLEKTDIKEMLDIAVKNDSVDYEEVNK--KGEVIVKNLIEDYS  170

Query  1356  KHLRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDG  1177
               L D I++ VN   +Y+ P  G +I+V+AGNG+GGFF   VL  LGADT GS  LNPDG
Sbjct  171   NLLIDKIRKGVNSSKNYEKPFSGLKILVDAGNGAGGFFAEKVLHILGADTTGSQFLNPDG  230

Query  1176  MFPNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMS  997
             MFPNHIPNPE+K AM     AVL N +DLG+VFDTDVDR+ +V ++G PIN + LIA++S
Sbjct  231   MFPNHIPNPENKEAMESICKAVLDNKSDLGIVFDTDVDRAAIVGKNGKPINKNALIAVIS  290

Query  996   AIVLKEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLM  817
             +IVL+EHP T +VTD+ TS GL +FI    G+H  ++ GY+NVI++ + LN +G E HL 
Sbjct  291   SIVLEEHPKTAIVTDSITSEGLAKFINELQGRHHRFKRGYKNVINEAIRLNSEGEECHLA  350

Query  816   METSGHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMD  637
             +ETSGH ALKENYFLDDGAY++ KI+I++ K+ LEG          +  +  E  E+R+ 
Sbjct  351   IETSGHAALKENYFLDDGAYLIAKILIKVAKLSLEGKTIEELIENLEEAQ--EEKEVRIG  408

Query  636   VLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAF-  460
             +               E FR Y                   +E  L D + H  +ID + 
Sbjct  409   INK-------------EDFRAY-------------------AEDILKDLDSHVKSIDGWS  436

Query  459   -----MYRAKVSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLR---DKFL  304
                      +V+ +E+   GW  LR S+H P +A+N++SN  GG + +   L+   +K+ 
Sbjct  437   VAPNNFEGIRVNCDESNGDGWFLLRISLHEPLLALNIESNKIGGAEQIYSKLKLFLEKYD  496

Query  303   LAG  295
             L G
Sbjct  497   LKG  499



>ref|XP_010658401.1| PREDICTED: uncharacterized protein LOC100244432 isoform X3 [Vitis 
vinifera]
Length=547

 Score =   394 bits (1011),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 227/518 (44%), Positives = 317/518 (61%), Gaps = 48/518 (9%)
 Frame = -1

Query  1866  SDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRI  1687
             SD+RGVA+ G +G  V LT P  EAIA +FG W+   LE ++       +RVS+G D RI
Sbjct  28    SDIRGVAVAGVEGEPVTLTEPVTEAIAAAFGAWL---LEKKKADGS-RRLRVSIGHDSRI  83

Query  1686  SGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQY----DASIMMTASHLPYT  1519
             S + L  AV  G+  AG  V   GLA+TPA F ST+    Q+    D SIM+TASHLPY 
Sbjct  84    SAQKLQEAVSLGIASAGLEVVQYGLASTPAMFNSTLTEGEQFLCPADGSIMITASHLPYN  143

Query  1518  RNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAK--VSTALRAPPS--KVDFMSAYAKH  1351
             RNG KFFT  GGL   +++ I ++AA  Y+N   +  V++  +A  S  +VD+M+ Y  +
Sbjct  144   RNGFKFFTNAGGLGKADIKDILERAASIYSNFAVEGLVNSERKASVSIKRVDYMALYTSY  203

Query  1350  LRDIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMF  1171
             L + ++    +    + PL+G  I+V+AGNG+GGFF   VL+ LGA T GS  L PDG+F
Sbjct  204   LVEAVRRAAGN---IERPLEGLHIVVDAGNGAGGFFAEKVLEPLGAITTGSQFLEPDGLF  260

Query  1170  PNHIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAI  991
             PNHIPNPEDK AM     AVL N ADLG++FDTDVDRS  VD +G  +N +RLIALMSAI
Sbjct  261   PNHIPNPEDKEAMKAITQAVLANQADLGIIFDTDVDRSAAVDSTGRELNRNRLIALMSAI  320

Query  990   VLKEHPGTTVVTDARTSMGLTRFITGR-GGQHCLYRVGYRNVIDKGVHLNEDGVETHLMM  814
             VL++HPGTT+VTD+ TS GLT FI  + GG+H  ++ GY+NVID+ + LN  G E+HL +
Sbjct  321   VLEKHPGTTIVTDSVTSDGLTTFIEKKLGGKHHRFKRGYKNVIDEAIRLNSVGEESHLAI  380

Query  813   ETSGHGALKENYFLDDGAYMVVKIIIEMVKMK---LEGSEEGIGSLIKDLEEPLETAELR  643
             ETSGHGALKEN++LDDGAY++VK++ ++   +   + G  E +  L++ L+EP    ELR
Sbjct  381   ETSGHGALKENHWLDDGAYLMVKLLNKLASARASGIGGGSEVLTDLVEGLQEPAAAVELR  440

Query  642   MDVLSEPRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDA  463
             + +  +  H   K      SFR Y E                     ++   ++    D 
Sbjct  441   LKI--DKSHEDLKG----GSFREYGE--------------------AVLKLLENLTDSDP  474

Query  462   FMYRAKVSNE---ENGEHGWVHLRQSIHNPNIAVNLQS  358
              + +A V+ E    +G  GW  LR S+H+P + +N+++
Sbjct  475   KLQKAPVNYEGVRASGFGGWFLLRLSLHDPVLPLNIEA  512



>ref|WP_035027734.1| phosphoglucomutase [Carnobacterium mobile]
Length=510

 Score =   392 bits (1007),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 222/526 (42%), Positives = 316/526 (60%), Gaps = 40/526 (8%)
 Frame = -1

Query  1878  LQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWV--ISGLESERGGAVVESVRVSL  1705
             LQNGSD+RG+ALQ    + V LT   +E IA     W+  +  L  ++  A+    +V++
Sbjct  12    LQNGSDIRGIALQTSDNQ-VTLTDERIERIAYGLAVWLKEVKQLPVDQAHAI----KVAI  66

Query  1704  GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMMTASHLP  1525
             G D R+S + +   +   L + G  + D GLATTPA FMST    +Q DA+IM+TASHLP
Sbjct  67    GYDSRLSAQRIQTILIENLTKIGIDIIDAGLATTPAMFMSTQYEEYQCDAAIMITASHLP  126

Query  1524  YTRNGLKFFTKKGGLTSTEVEAICDKAARKYANRMAKVSTALRAPPSKVDFMSAYAKHLR  1345
             Y  NGLKFFTK GG    ++  I   AA    +   + ST +    S    +S YA  L 
Sbjct  127   YEYNGLKFFTKDGGAEHEDIAYILKNAAPH--DITLEKSTGIVIKKS---LLSDYAVDLV  181

Query  1344  DIIKERVNHPTHYDTPLQGFQIIVNAGNGSGGFFTWDVLDKLGADTFGSLHLNPDGMFPN  1165
               I++ +N PT+Y  PL G  I+V+AGNG+GGFF  +VL+KLGA+  GS  L PDG FPN
Sbjct  182   AKIQKWINDPTNYKQPLTGRHIVVDAGNGAGGFFATEVLEKLGANIKGSQFLEPDGNFPN  241

Query  1164  HIPNPEDKTAMAMTRAAVLQNAADLGVVFDTDVDRSGVVDRSGNPINGDRLIALMSAIVL  985
             HIPNP++K AM   + AVL+N ADLG++FDTDVDRS +VD  G  +N + LIA+++AI++
Sbjct  242   HIPNPDNKEAMQSIQTAVLKNKADLGIIFDTDVDRSALVDHEGVTLNRNNLIAVIAAILI  301

Query  984   KEHPGTTVVTDARTSMGLTRFITGRGGQHCLYRVGYRNVIDKGVHLNEDGVETHLMMETS  805
             KE+PGTT+VT++ TS  L  FI   GG+   Y  GYRNVI++ + LN++G+ T L +ETS
Sbjct  302   KENPGTTIVTNSTTSEHLKTFIEDLGGKQNRYLTGYRNVINQAIELNKEGIPTSLAIETS  361

Query  804   GHGALKENYFLDDGAYMVVKIIIEMVKMKLEGSEEGIGSLIKDLEEPLETAELRMDVLSE  625
             GH ALKEN+FLDDGAY+  +I+I      L+   + I SLI+ L++P+ET E+R  +LSE
Sbjct  362   GHAALKENFFLDDGAYLAARILI--ADAVLQKENKTIISLIEALKQPVETDEVRFRILSE  419

Query  624   PRHAKAKAVEAIESFRHYIEKGNLPGWELDSCGDCWVSEGCLVDTNDHPAAIDAFMYRAK  445
                     V  ++ F+ +I+K   P   ++        EG  V+T+              
Sbjct  420   AVQETGMTV--LKRFKEFIQKT--PDLTVEPNN----LEGVRVNTSGKYGT---------  462

Query  444   VSNEENGEHGWVHLRQSIHNPNIAVNLQSNIPGGCQSMARDLRDKF  307
                      GW+ LR S+H P + +NL+S+  G  +S+ +DLR+ F
Sbjct  463   ---------GWLLLRLSLHEPLLVLNLESDQQGAIKSLRQDLREFF  499



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7493303863264