BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21258_g1_i1 len=824 path=[1267:0-264 1532:265-402 1670:403-823]

Length=824
                                                                      Score     E

ref|XP_004251649.1|  PREDICTED: gamma-glutamyltranspeptidase 3          357   2e-115   
gb|ABB59571.1|  putative gamma-glutamyl transferase                     348   6e-115   Populus tremula x Populus alba [gray poplar]
ref|XP_009757182.1|  PREDICTED: gamma-glutamyltranspeptidase 3          355   1e-114   
ref|XP_006353508.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     355   1e-114   
ref|XP_009597034.1|  PREDICTED: gamma-glutamyltranspeptidase 3          353   7e-114   
ref|XP_011093665.1|  PREDICTED: gamma-glutamyltranspeptidase 3          352   1e-113   
emb|CDP03225.1|  unnamed protein product                                352   1e-113   
ref|XP_007204871.1|  hypothetical protein PRUPE_ppa002923mg             347   1e-111   
ref|XP_008242458.1|  PREDICTED: gamma-glutamyltranspeptidase 3          345   6e-111   
gb|KDO55895.1|  hypothetical protein CISIN_1g006929mg                   341   1e-110   
ref|XP_011015454.1|  PREDICTED: gamma-glutamyltranspeptidase 3-li...    345   1e-110   
ref|XP_011015455.1|  PREDICTED: gamma-glutamyltranspeptidase 3-li...    345   1e-110   
ref|XP_011006432.1|  PREDICTED: gamma-glutamyltranspeptidase 3-li...    344   2e-110   
ref|XP_011006434.1|  PREDICTED: gamma-glutamyltranspeptidase 3-li...    344   2e-110   
gb|EYU30676.1|  hypothetical protein MIMGU_mgv1a004306mg                340   8e-110   
ref|XP_006371961.1|  hypothetical protein POPTR_0018s06710g             341   1e-109   
ref|XP_006475363.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     342   2e-109   
ref|XP_006451358.1|  hypothetical protein CICLE_v10007750mg             342   2e-109   
ref|XP_008387437.1|  PREDICTED: gamma-glutamyltranspeptidase 3          342   2e-109   
ref|XP_009352586.1|  PREDICTED: gamma-glutamyltranspeptidase 3 is...    337   7e-108   
ref|XP_009352585.1|  PREDICTED: gamma-glutamyltranspeptidase 3 is...    337   1e-107   
gb|KHG10055.1|  Gamma-glutamyltranspeptidase 1                          335   7e-107   
gb|EYU27245.1|  hypothetical protein MIMGU_mgv1a023702mg                329   2e-105   
gb|KCW79590.1|  hypothetical protein EUGRSUZ_C00950                     328   3e-105   
ref|XP_007012965.1|  Gamma-glutamyl transpeptidase 4                    330   5e-105   
gb|AFW80067.1|  hypothetical protein ZEAMMB73_199418                    318   1e-104   
ref|XP_008337670.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     333   1e-104   
ref|XP_010042687.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     327   6e-104   
ref|XP_002280190.1|  PREDICTED: gamma-glutamyltranspeptidase 3 is...    327   9e-104   Vitis vinifera
ref|XP_010656240.1|  PREDICTED: gamma-glutamyltranspeptidase 3 is...    327   1e-103   
ref|XP_010244393.1|  PREDICTED: gamma-glutamyltranspeptidase 3          325   3e-103   
ref|XP_004287500.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     325   3e-103   
ref|XP_006475362.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     323   7e-103   
ref|XP_008655642.1|  PREDICTED: gamma-glutamyltranspeptidase 3          319   1e-102   
ref|XP_002457361.1|  hypothetical protein SORBIDRAFT_03g006000          323   2e-102   Sorghum bicolor [broomcorn]
gb|KDO55891.1|  hypothetical protein CISIN_1g006865mg                   322   4e-102   
ref|XP_006451357.1|  hypothetical protein CICLE_v10007745mg             320   4e-101   
ref|XP_010920650.1|  PREDICTED: gamma-glutamyltranspeptidase 3          318   1e-100   
ref|XP_010688394.1|  PREDICTED: gamma-glutamyltranspeptidase 3 is...    315   2e-100   
ref|XP_006826821.1|  hypothetical protein AMTR_s00010p00064690          316   6e-100   
ref|XP_010688393.1|  PREDICTED: gamma-glutamyltranspeptidase 3 is...    316   2e-99    
ref|XP_010040321.1|  PREDICTED: gamma-glutamyltranspeptidase 3          307   3e-99    
ref|XP_010086906.1|  Gamma-glutamyltranspeptidase 1                     314   6e-99    
ref|XP_004968222.1|  PREDICTED: gamma-glutamyltranspeptidase 3-li...    313   2e-98    
ref|XP_008784503.1|  PREDICTED: gamma-glutamyltranspeptidase 3          311   8e-98    
ref|XP_010047649.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     311   1e-97    
ref|XP_009405839.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     308   1e-96    
gb|KDP33767.1|  hypothetical protein JCGZ_07338                         308   1e-96    
gb|KCW79596.1|  hypothetical protein EUGRSUZ_C00955                     310   1e-96    
gb|EMS51044.1|  Gamma-glutamyltranspeptidase 1                          302   3e-96    
ref|XP_010540998.1|  PREDICTED: gamma-glutamyltranspeptidase 3 is...    300   7e-95    
gb|EMS68109.1|  Gamma-glutamyltranspeptidase 1                          298   1e-94    
ref|XP_006583561.1|  PREDICTED: gamma-glutamyltranspeptidase 3-li...    297   5e-94    
ref|XP_009404606.1|  PREDICTED: putative inactive gamma-glutamylt...    290   9e-94    
ref|XP_010540996.1|  PREDICTED: gamma-glutamyltranspeptidase 3 is...    300   1e-93    
ref|XP_002514187.1|  gamma glutamyl transpeptidases, putative           300   1e-93    Ricinus communis
ref|XP_006412862.1|  hypothetical protein EUTSA_v10024658mg             300   2e-93    
ref|XP_003565342.1|  PREDICTED: gamma-glutamyltranspeptidase 3          300   2e-93    
gb|KFK29480.1|  hypothetical protein AALP_AA7G139500                    300   3e-93    
dbj|BAJ94053.1|  predicted protein                                      300   5e-93    
dbj|BAJ97185.1|  predicted protein                                      300   5e-93    
dbj|BAJ97288.1|  predicted protein                                      300   6e-93    
dbj|BAJ95633.1|  predicted protein                                      299   6e-93    
ref|XP_007152947.1|  hypothetical protein PHAVU_004G173700g             296   1e-92    
ref|XP_003529066.1|  PREDICTED: gamma-glutamyltranspeptidase 3-li...    297   2e-92    
ref|XP_004513075.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     297   2e-92    
emb|CDY30226.1|  BnaA03g49440D                                          297   3e-92    
ref|XP_008459118.1|  PREDICTED: gamma-glutamyltranspeptidase 3          296   3e-92    
ref|XP_007152946.1|  hypothetical protein PHAVU_004G173700g             296   7e-92    
gb|ACJ61473.1|  gamma-glutamyl transferase                              294   1e-91    
ref|XP_009137839.1|  PREDICTED: gamma-glutamyltranspeptidase 3-li...    294   4e-91    
gb|KHN03219.1|  Gamma-glutamyltranspeptidase 1                          294   4e-91    
ref|XP_003516303.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     294   4e-91    
emb|CDY06830.1|  BnaC01g09290D                                          293   1e-90    
gb|KEH27232.1|  gamma-glutamyltranspeptidase                            287   5e-90    
ref|XP_004141035.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     289   3e-89    
dbj|BAD22536.1|  gamma-glutamyl transferase                             289   4e-89    Raphanus sativus
emb|CDY48603.1|  BnaA01g07620D                                          288   4e-89    
ref|XP_009404605.1|  PREDICTED: gamma-glutamyltranspeptidase 3-li...    288   5e-89    
ref|XP_003620774.1|  Gamma-glutamyltranspeptidase                       287   2e-88    
ref|XP_010438326.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     287   2e-88    
ref|NP_194650.1|  gamma-glutamyl transpeptidase 4                       286   3e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004157902.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    285   6e-88    
ref|XP_009137838.1|  PREDICTED: gamma-glutamyltranspeptidase 3-li...    286   8e-88    
ref|XP_010433124.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     285   9e-88    
ref|XP_010447878.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     283   7e-87    
ref|XP_009128940.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     283   9e-87    
ref|XP_002869447.1|  gamma-glutamyl transpeptidase 3                    281   3e-86    
dbj|BAD61112.1|  putative gamma-glutamyl transpeptidase                 281   3e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006283327.1|  hypothetical protein CARUB_v10004367mg             277   1e-84    
emb|CDY47776.1|  BnaC07g41840D                                          276   2e-84    
gb|EMT33219.1|  Gamma-glutamyltranspeptidase 1                          276   1e-82    
ref|XP_010261138.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     266   6e-81    
gb|ABB59572.1|  putative gamma-glutamyl transferase                     254   5e-80    Populus tremula x Populus alba [gray poplar]
ref|XP_008440656.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     261   3e-79    
gb|AES72274.2|  gamma-glutamyltranspeptidase                            261   3e-79    
ref|XP_003602023.1|  Gamma-glutamyltransferase                          262   4e-79    
gb|KDO43920.1|  hypothetical protein CISIN_1g009773mg                   259   1e-78    
gb|AFF18858.1|  gamma-glutamyl transferase                              249   1e-78    
ref|XP_004169851.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     259   1e-78    
ref|XP_006428086.1|  hypothetical protein CICLE_v10025225mg             259   3e-78    
gb|AFK35153.1|  unknown                                                 251   3e-78    
ref|XP_010905955.1|  PREDICTED: gamma-glutamyltranspeptidase 1          258   6e-78    
gb|KHG13791.1|  Gamma-glutamyltranspeptidase 1                          258   7e-78    
ref|XP_006464312.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    259   1e-77    
ref|XP_006412867.1|  hypothetical protein EUTSA_v10024966mg             255   1e-77    
ref|XP_008801055.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     257   2e-77    
ref|XP_004143492.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     256   3e-77    
gb|KGN48785.1|  hypothetical protein Csa_6G501260                       256   6e-77    
ref|XP_011021908.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    255   2e-76    
ref|XP_009603063.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     254   3e-76    
gb|ABB59573.1|  putative gamma-glutamyl transferase                     253   4e-76    Populus tremula x Populus alba [gray poplar]
ref|XP_003552129.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     254   9e-76    
ref|XP_009766139.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     253   1e-75    
ref|XP_004502464.1|  PREDICTED: gamma-glutamyltranspeptidase 2-like     252   2e-75    
emb|CDP01389.1|  unnamed protein product                                251   3e-75    
ref|XP_007048081.1|  Gamma-glutamyl transpeptidase 1 isoform 1          250   7e-75    
ref|XP_007048082.1|  Gamma-glutamyl transpeptidase 1 isoform 2          250   8e-75    
ref|XP_009401074.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     250   1e-74    
ref|XP_011090593.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    249   1e-74    
ref|XP_011090592.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    249   2e-74    
ref|XP_006355534.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     249   3e-74    
ref|XP_010321470.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    248   3e-74    
ref|XP_001772768.1|  predicted protein                                  248   3e-74    
ref|XP_004240001.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    248   3e-74    
gb|EAZ30956.1|  hypothetical protein OsJ_15033                          245   6e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004975832.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     248   6e-74    
ref|XP_007163614.1|  hypothetical protein PHAVU_001G249200g             248   8e-74    
ref|XP_010531409.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     247   1e-73    
emb|CAD40892.2|  OSJNBa0036B21.10                                       246   2e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003538504.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     247   2e-73    
gb|ABB59570.1|  putative gamma-glutamyl transferase                     236   3e-73    Populus tremula x Populus alba [gray poplar]
gb|EAY94378.1|  hypothetical protein OsI_16142                          246   3e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_006591400.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    243   3e-73    
emb|CAH67025.1|  H0523F07.13                                            246   3e-73    Oryza sativa [red rice]
ref|XP_002447955.1|  hypothetical protein SORBIDRAFT_06g018740          243   3e-73    Sorghum bicolor [broomcorn]
gb|KHN04812.1|  Gamma-glutamyltranspeptidase 1                          245   8e-73    
ref|XP_010099916.1|  Gamma-glutamyltranspeptidase 1                     245   1e-72    
tpg|DAA37487.1|  TPA: hypothetical protein ZEAMMB73_406570              241   2e-72    
emb|CDY30227.1|  BnaA03g49430D                                          236   3e-72    
ref|XP_003537501.2|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    244   3e-72    
ref|XP_003581307.2|  PREDICTED: gamma-glutamyltranspeptidase 1-like     243   5e-72    
gb|KFK29479.1|  hypothetical protein AALP_AA7G139300                    243   7e-72    
gb|KFK29478.1|  hypothetical protein AALP_AA7G139300                    243   9e-72    
gb|EYU31066.1|  hypothetical protein MIMGU_mgv1a003688mg                242   1e-71    
ref|XP_009101855.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     241   2e-71    
emb|CDY53167.1|  BnaA06g40460D                                          241   2e-71    
ref|NP_001147571.1|  gamma-glutamyltranspeptidase 1 precursor           240   4e-71    Zea mays [maize]
ref|XP_002306343.1|  gamma-glutamyltranspeptidase family protein        241   5e-71    Populus trichocarpa [western balsam poplar]
ref|XP_007207202.1|  hypothetical protein PRUPE_ppa002642mg             241   1e-70    
ref|XP_009101854.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     238   2e-70    
emb|CDY53166.1|  BnaA06g40450D                                          238   3e-70    
ref|XP_006838436.1|  hypothetical protein AMTR_s00002p00125730          227   5e-70    
ref|XP_011006915.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     237   9e-70    
ref|XP_002866873.1|  predicted protein                                  236   1e-69    
ref|XP_006411757.1|  hypothetical protein EUTSA_v10027365mg             236   1e-69    
ref|XP_008387031.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    236   1e-69    
ref|XP_008387030.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    236   1e-69    
emb|CDY47777.1|  BnaC07g41830D                                          237   1e-69    
ref|XP_008234476.1|  PREDICTED: gamma-glutamyltranspeptidase 1          236   2e-69    
ref|XP_002298608.2|  hypothetical protein POPTR_0001s34100g             234   4e-69    Populus trichocarpa [western balsam poplar]
gb|KEH34407.1|  gamma-glutamyltranspeptidase                            235   4e-69    
gb|AFK39843.1|  unknown                                                 223   5e-69    
ref|XP_004302214.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     234   6e-69    
ref|XP_009126207.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    234   1e-68    
ref|XP_009126140.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    233   1e-68    
dbj|BAC45233.1|  gamma-glutamyl transferase                             233   2e-68    Raphanus sativus
ref|XP_006283415.1|  hypothetical protein CARUB_v10004464mg             233   2e-68    
ref|XP_010446517.1|  PREDICTED: gamma-glutamyltranspeptidase 1          232   5e-68    
ref|XP_006838433.1|  hypothetical protein AMTR_s00002p00123410          232   5e-68    
ref|XP_010431938.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    232   6e-68    
ref|XP_010437081.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     231   7e-68    
ref|XP_006838434.1|  hypothetical protein AMTR_s00002p00124320          231   1e-67    
emb|CDY41994.1|  BnaA01g05660D                                          231   1e-67    
ref|XP_006411756.1|  hypothetical protein EUTSA_v10024781mg             231   2e-67    
dbj|BAC56855.1|  gamma-glutamyl transferase                             231   2e-67    Raphanus sativus
ref|XP_002866872.1|  hypothetical protein ARALYDRAFT_490743             231   2e-67    
ref|XP_009138098.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     230   2e-67    
emb|CAA18750.1|  putative gamma-glutamyltransferase                     230   2e-67    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20434.1|  AT4G39640                                              230   2e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006838435.1|  hypothetical protein AMTR_s00002p00125660          230   2e-67    
emb|CDY19957.1|  BnaA09g02940D                                          230   3e-67    
emb|CAA89206.1|  gamma-glutamyl transpeptidase                          230   3e-67    Arabidopsis thaliana [mouse-ear cress]
ref|NP_195674.2|  gamma-glutamyl transpeptidase 1                       230   3e-67    Arabidopsis thaliana [mouse-ear cress]
emb|CDX90346.1|  BnaA08g16380D                                          220   3e-67    
emb|CDY42642.1|  BnaC01g00540D                                          229   4e-67    
dbj|BAK03021.1|  predicted protein                                      229   9e-67    
dbj|BAD61113.1|  putative gamma-glutamyl transpeptidase                 229   1e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009372518.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    228   1e-66    
gb|KHN31334.1|  Alanine--glyoxylate aminotransferase 2 like 1, mi...    233   1e-66    
ref|XP_009372517.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    228   1e-66    
emb|CDY41991.1|  BnaA01g05630D                                          228   2e-66    
ref|XP_006653478.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     226   4e-66    
ref|XP_010446520.1|  PREDICTED: gamma-glutamyltranspeptidase 2-like     226   7e-66    
gb|EMT13333.1|  Gamma-glutamyltranspeptidase 1                          227   8e-66    
ref|XP_009126030.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     226   1e-65    
emb|CDY71484.1|  BnaC03g76200D                                          216   2e-65    
ref|XP_006412863.1|  hypothetical protein EUTSA_v10024658mg             224   4e-65    
gb|EPS70272.1|  hypothetical protein M569_04488                         226   5e-65    
gb|KFK30534.1|  hypothetical protein AALP_AA7G274900                    222   1e-64    
ref|XP_010540997.1|  PREDICTED: gamma-glutamyltranspeptidase 3 is...    221   3e-64    
ref|XP_002980264.1|  hypothetical protein SELMODRAFT_419937             222   9e-64    
ref|XP_006391477.1|  hypothetical protein EUTSA_v10019745mg             221   1e-63    
ref|XP_002963073.1|  hypothetical protein SELMODRAFT_438309             221   1e-63    
ref|XP_009109459.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     219   3e-63    
gb|AAS91713.1|  gamma-glutamyl transpeptidase                           211   3e-63    Allium cepa
emb|CAA18751.1|  putative gamma-glutamyltransferase                     218   1e-62    Arabidopsis thaliana [mouse-ear cress]
ref|NP_195675.2|  gamma-glutamyl transpeptidase 2                       218   2e-62    Arabidopsis thaliana [mouse-ear cress]
emb|CDY47779.1|  BnaC07g41810D                                          209   2e-62    
ref|XP_006833442.1|  hypothetical protein AMTR_s00109p00152050          211   6e-61    
gb|AAL61611.2|AF401622_1  gamma-glutamyltransferase                     211   2e-60    Allium cepa
ref|XP_006285909.1|  hypothetical protein CARUB_v10007420mg             212   2e-60    
ref|XP_010437083.1|  PREDICTED: gamma-glutamyltranspeptidase 2-like     211   4e-60    
ref|XP_010431940.1|  PREDICTED: gamma-glutamyltranspeptidase 2-like     211   5e-60    
ref|XP_011072102.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     211   6e-60    
ref|XP_010446509.1|  PREDICTED: gamma-glutamyltranspeptidase 2          211   6e-60    
gb|EMS55114.1|  Gamma-glutamyltranspeptidase 1                          211   4e-59    
gb|AFF18827.1|  gamma-glutamyl transferase                              198   2e-58    
ref|XP_008344003.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     192   2e-57    
gb|EYU42482.1|  hypothetical protein MIMGU_mgv1a023445mg                199   8e-56    
gb|EYU42487.1|  hypothetical protein MIMGU_mgv1a0217831mg               192   1e-55    
gb|EYU42483.1|  hypothetical protein MIMGU_mgv1a021332mg                197   3e-55    
ref|XP_010040323.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     195   9e-55    
ref|NP_177140.1|  gamma-glutamyl transpeptidase 3                       186   2e-54    Arabidopsis thaliana [mouse-ear cress]
emb|CDX72677.1|  BnaC07g46990D                                          184   3e-54    
emb|CDY00064.1|  BnaC09g02370D                                          187   3e-53    
ref|XP_011072100.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     191   2e-52    
gb|EYU40496.1|  hypothetical protein MIMGU_mgv1a025407mg                189   2e-52    
emb|CDX72680.1|  BnaC07g47020D                                          187   3e-51    
gb|EYU42484.1|  hypothetical protein MIMGU_mgv1a003641mg                187   3e-51    
gb|EYU42485.1|  hypothetical protein MIMGU_mgv1a024464mg                185   2e-50    
ref|XP_006853587.1|  hypothetical protein AMTR_s00056p00019670          171   5e-49    
ref|XP_008354542.1|  PREDICTED: gamma-glutamyltranspeptidase 3-like     177   3e-48    
ref|XP_002500977.1|  predicted protein                                  167   3e-44    Micromonas commoda
gb|EEC69963.1|  hypothetical protein OsI_00423                          166   1e-43    Oryza sativa Indica Group [Indian rice]
gb|EAZ10564.1|  hypothetical protein OsJ_00396                          163   2e-43    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042040.2|  Os01g0151500                                       163   1e-42    Oryza sativa Japonica Group [Japonica rice]
ref|NP_974636.1|  gamma-glutamyl transpeptidase 4                       161   5e-42    Arabidopsis thaliana [mouse-ear cress]
gb|KFM26422.1|  Gamma-glutamyltranspeptidase 1                          155   7e-42    
emb|CDM84147.1|  unnamed protein product                                158   2e-41    
ref|XP_002888740.1|  predicted protein                                  150   4e-41    
ref|XP_006851797.1|  hypothetical protein AMTR_s00814p00012490          151   5e-41    
ref|XP_007255036.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     155   8e-40    
gb|EMT04046.1|  hypothetical protein F775_43165                         153   1e-39    
gb|KEH27233.1|  gamma-glutamyltranspeptidase                            154   2e-39    
ref|XP_005815351.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     154   3e-39    
ref|XP_006826822.1|  hypothetical protein AMTR_s00010p00066490          151   6e-39    
ref|XP_005708855.1|  gamma-glutamyltranspeptidase isoform 2             152   3e-38    
gb|AAS91712.1|  gamma-glutamyl transpeptidase                           144   3e-38    Allium cepa
ref|XP_005708856.1|  gamma-glutamyltranspeptidase isoform 1             152   4e-38    
ref|XP_007567785.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     150   5e-38    
ref|WP_013111453.1|  gamma-glutamyltranspeptidase                       150   5e-38    
ref|XP_004337194.1|  gammaglutamyltransferase                           150   8e-38    
ref|XP_007372186.1|  hypothetical protein SPAPADRAFT_57841              150   8e-38    
ref|XP_008291961.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     149   1e-37    
ref|XP_006640286.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     149   2e-37    
gb|KDD72044.1|  gamma-glutamyltranspeptidase                            144   3e-37    
ref|XP_003965538.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     148   3e-37    
ref|NP_956709.1|  gamma-glutamyltranspeptidase 1                        147   3e-37    Danio rerio [leopard danio]
ref|XP_009302438.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    148   3e-37    
ref|XP_008422387.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     147   7e-37    
ref|XP_010744413.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     147   8e-37    
ref|XP_008566818.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    141   9e-37    
ref|XP_005735312.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     146   1e-36    
ref|XP_003974637.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     146   1e-36    
ref|XP_003453892.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     146   1e-36    
ref|XP_006788901.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     146   1e-36    
ref|XP_004538205.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     146   2e-36    
emb|CAG02517.1|  unnamed protein product                                145   2e-36    Tetraodon nigroviridis
ref|XP_697468.3|  PREDICTED: gamma-glutamyltranspeptidase 1-like        145   3e-36    Danio rerio [leopard danio]
ref|XP_970535.2|  PREDICTED: gamma-glutamyltranspeptidase 1 isofo...    145   3e-36    Tribolium castaneum [rust-red flour beetle]
ref|XP_008196638.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    145   4e-36    
ref|XP_001517861.2|  PREDICTED: gamma-glutamyltranspeptidase 1-like     139   4e-36    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_007557086.1|  PREDICTED: gamma-glutamyltranspeptidase 1          145   5e-36    
ref|XP_004312969.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    139   5e-36    
ref|XP_008415764.1|  PREDICTED: gamma-glutamyltranspeptidase 1          145   5e-36    
ref|XP_005815982.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     145   5e-36    
gb|KFH70986.1|  gamma-glutamyltransferase                               145   6e-36    
ref|XP_004276099.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    139   6e-36    
ref|XP_002178865.1|  predicted protein                                  145   7e-36    
ref|XP_005934703.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     144   8e-36    
gb|EPB83570.1|  gamma-glutamyltransferase                               144   1e-35    
ref|XP_003280862.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    138   1e-35    
pdb|4GDX|B  Chain B, Crystal Structure Of Human Gamma-glutamyl Tr...    137   1e-35    
ref|XP_009232474.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    137   2e-35    
ref|XP_005649889.1|  gamma-glutamyltranspeptidase                       143   2e-35    
ref|NP_001133721.1|  Gamma-glutamyltranspeptidase 1                     143   2e-35    
ref|XP_010893407.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     143   2e-35    
emb|CDQ60957.1|  unnamed protein product                                139   2e-35    
ref|XP_010782307.1|  PREDICTED: gamma-glutamyltranspeptidase 1          143   2e-35    
ref|XP_009436265.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    137   3e-35    
gb|AAI28240.1|  GGT1 protein                                            137   3e-35    
gb|AAA02886.1|  gamma-glutamyl transpeptidase                           137   3e-35    
gb|EMP32153.1|  Gamma-glutamyltranspeptidase 1                          143   3e-35    
ref|XP_007063814.1|  PREDICTED: gamma-glutamyltranspeptidase 1          142   3e-35    
gb|EHH62839.1|  hypothetical protein EGM_19526                          136   4e-35    
ref|XP_002736062.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     144   4e-35    
gb|AAH69326.1|  GGT1 protein                                            136   4e-35    
gb|AAI28235.1|  GGT1 protein                                            137   4e-35    
ref|XP_010750738.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     142   4e-35    
ref|XP_003281898.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     136   4e-35    
ref|XP_008274901.1|  PREDICTED: gamma-glutamyltranspeptidase 1          142   5e-35    
ref|XP_010875848.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     142   5e-35    
gb|AAH65921.1|  GGT1 protein                                            137   5e-35    
ref|XP_007247207.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     142   5e-35    
ref|XP_005987177.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     142   6e-35    
ref|XP_008566817.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    141   8e-35    
emb|CDH49227.1|  gamma-glutamyltranspeptidase                           141   1e-34    
ref|XP_319430.4|  AGAP010241-PA                                         140   1e-34    
ref|XP_003445604.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     140   1e-34    
ref|XP_006803259.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     140   2e-34    
ref|XP_005927072.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     140   2e-34    
ref|XP_002601471.1|  hypothetical protein BRAFLDRAFT_104415             141   2e-34    
ref|XP_004742525.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    135   2e-34    
ref|XP_007533849.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     140   2e-34    
ref|XP_007127241.1|  PREDICTED: gamma-glutamyltranspeptidase 1          140   2e-34    
ref|XP_009439320.1|  PREDICTED: gamma-glutamyltransferase light c...    134   3e-34    
ref|XP_004063233.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     135   3e-34    
pdb|4GG2|B  Chain B, The Crystal Structure Of Glutamate-bound Hum...    133   3e-34    
ref|XP_002949026.1|  hypothetical protein VOLCADRAFT_30482              139   3e-34    
ref|XP_003508137.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    139   3e-34    
ref|XP_007451093.1|  PREDICTED: gamma-glutamyltranspeptidase 1          139   3e-34    
gb|ETE70441.1|  Gamma-glutamyltranspeptidase 1                          139   3e-34    
ref|XP_002734130.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     139   4e-34    
ref|XP_004368120.1|  gammaglutamyltransferase                           140   4e-34    
ref|XP_006908746.1|  PREDICTED: gamma-glutamyltransferase light c...    139   4e-34    
ref|XP_006019943.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    139   4e-34    
ref|XP_001090518.1|  PREDICTED: gamma-glutamyltranspeptidase 1          139   4e-34    
emb|CAF99264.1|  unnamed protein product                                139   5e-34    
ref|XP_005595461.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    139   5e-34    
ref|XP_006726883.1|  PREDICTED: LOW QUALITY PROTEIN: putative gam...    134   5e-34    
ref|XP_006267765.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     139   5e-34    
ref|XP_004544148.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     139   5e-34    
gb|ADV40070.1|  gamma glutamyl transpeptidase                           135   5e-34    
ref|XP_007619956.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    139   5e-34    
ref|XP_005729658.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    139   5e-34    
ref|XP_005105284.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     139   5e-34    
ref|XP_004312968.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    139   5e-34    
ref|XP_006676514.1|  hypothetical protein BATDEDRAFT_9466               139   6e-34    
ref|XP_010347530.1|  PREDICTED: gamma-glutamyltranspeptidase 1          139   6e-34    
ref|XP_006621168.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    139   6e-34    
ref|XP_004276098.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    139   6e-34    
ref|XP_004061960.1|  PREDICTED: gamma-glutamyltransferase light c...    133   6e-34    
ref|NP_001193143.1|  gamma-glutamyltranspeptidase 1                     139   7e-34    
ref|XP_006621167.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    139   7e-34    
ref|XP_003419196.1|  PREDICTED: gamma-glutamyltranspeptidase 1          139   7e-34    
ref|NP_032142.1|  gamma-glutamyltranspeptidase 1 precursor              138   8e-34    
ref|XP_002680789.1|  gamma-glutamyl transpeptidase                      140   9e-34    
ref|WP_017655574.1|  gamma-glutamyltranspeptidase                       138   9e-34    
emb|CDQ56323.1|  unnamed protein product                                138   9e-34    
ref|XP_004680978.1|  PREDICTED: gamma-glutamyltranspeptidase 1          138   1e-33    
ref|XP_010812543.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    138   1e-33    
ref|XP_005334513.1|  PREDICTED: gamma-glutamyltranspeptidase 1          138   1e-33    
ref|XP_009232473.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    137   1e-33    
ref|XP_007196382.1|  PREDICTED: gamma-glutamyltranspeptidase 1          138   1e-33    
ref|XP_007973367.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    138   1e-33    
gb|KFQ30012.1|  Gamma-glutamyltranspeptidase 1                          138   1e-33    
emb|CEI92635.1|  Putative Gamma-glutamyltransferase                     132   1e-33    
ref|XP_010176885.1|  PREDICTED: gamma-glutamyltranspeptidase 1          138   1e-33    
ref|XP_002830985.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    138   1e-33    
ref|XP_003696776.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     137   1e-33    
ref|XP_006570291.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    137   1e-33    
ref|XP_005538051.1|  gamma-glutamyltransferase                          139   2e-33    
ref|NP_842563.1|  gamma-glutamyltransferase light chain 1               132   2e-33    
gb|AAA52546.1|  gamma-glutamyltransferase 1 (EC 2.3.2.2)                137   2e-33    
gb|EAW59671.1|  hCG2010666, isoform CRA_a                               137   2e-33    
ref|XP_005288647.1|  PREDICTED: gamma-glutamyltranspeptidase 1          137   2e-33    
ref|XP_006746113.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    132   2e-33    
gb|AFF18826.1|  gamma-glutamyl transferase                              128   2e-33    
gb|AAA35899.1|  gamma-glutamyl transpeptidase                           137   2e-33    
ref|NP_038347.2|  gamma-glutamyltranspeptidase 1 precursor              137   2e-33    
ref|XP_002615599.1|  hypothetical protein CLUG_04481                    137   2e-33    
ref|XP_006979142.1|  PREDICTED: gamma-glutamyltranspeptidase 1          137   2e-33    
gb|AAX36095.1|  gamma-glutamyltransferase 1                             137   2e-33    
ref|XP_001171192.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    137   2e-33    
ref|XP_006570290.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    137   2e-33    
gb|EFX74232.1|  hypothetical protein DAPPUDRAFT_226800                  137   2e-33    
ref|XP_005567836.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    137   2e-33    
ref|XP_001093671.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    137   2e-33    
ref|XP_009197634.1|  PREDICTED: gamma-glutamyltranspeptidase 1          136   3e-33    
emb|CBY40710.1|  unnamed protein product                                132   3e-33    
dbj|BAA20001.1|  gamma-glutamyl transpeptidase                          132   3e-33    
ref|XP_006723725.1|  PREDICTED: gamma-glutamyltransferase light c...    132   3e-33    
ref|XP_009215205.1|  PREDICTED: gamma-glutamyltranspeptidase 1          137   3e-33    
ref|XP_005670946.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    132   3e-33    
ref|XP_005612420.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    131   4e-33    
gb|KFB45483.1|  AGAP010241-PA-like protein                              136   5e-33    
ref|XP_001629743.1|  predicted protein                                  136   5e-33    
ref|XP_010376408.1|  PREDICTED: gamma-glutamyltransferase light c...    131   5e-33    
ref|XP_001947606.2|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    137   6e-33    
ref|XP_009078600.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    136   6e-33    
emb|CEI93379.1|  Putative Gamma-glutamyltransferase                     136   7e-33    
ref|XP_006157225.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    135   7e-33    
ref|XP_009078601.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    135   7e-33    
emb|CEG72389.1|  Putative Gamma-glutamyltransferase                     136   7e-33    
gb|KFP86120.1|  Gamma-glutamyltranspeptidase 1                          135   7e-33    
gb|KFQ26069.1|  Gamma-glutamyltranspeptidase 1                          135   9e-33    
gb|ESA10193.1|  hypothetical protein GLOINDRAFT_198755                  132   9e-33    
ref|XP_008934552.1|  PREDICTED: gamma-glutamyltranspeptidase 1          135   9e-33    
emb|CCG83988.1|  protein of unknown function                            135   1e-32    
ref|XP_008067294.1|  PREDICTED: gamma-glutamyltranspeptidase 1          135   1e-32    
ref|XP_005636614.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    130   1e-32    
emb|CDK13482.1|  Protein C53D5.5, isoform b                             135   1e-32    
ref|XP_001655048.1|  gamma glutamyl transpeptidases                     135   1e-32    
ref|XP_004386224.1|  PREDICTED: gamma-glutamyltranspeptidase 1          135   1e-32    
ref|XP_004716432.1|  PREDICTED: gamma-glutamyltranspeptidase 1          135   1e-32    
ref|XP_004742516.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    135   1e-32    
ref|NP_001239164.1|  gamma-glutamyl transferase 1a                      135   1e-32    
gb|EPB88495.1|  gamma-glutamyltransferase                               135   1e-32    
emb|CCE26932.1|  related to gamma-glutamyltransferase                   135   1e-32    
gb|EFX74231.1|  hypothetical protein DAPPUDRAFT_200087                  135   1e-32    
ref|XP_785511.3|  PREDICTED: gamma-glutamyltranspeptidase 1-like ...    134   1e-32    
ref|XP_009480778.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     133   2e-32    
ref|XP_004932233.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     135   2e-32    
ref|XP_003704006.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     136   2e-32    
gb|KFQ83593.1|  Gamma-glutamyltranspeptidase 1                          135   2e-32    
emb|CEF62587.1|  Gamma-glutamyltranspeptidase family-containing p...    135   2e-32    
ref|XP_004466455.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    130   2e-32    
gb|KFQ61060.1|  Gamma-glutamyltranspeptidase 1                          133   2e-32    
ref|NP_446292.2|  gamma-glutamyltranspeptidase 1                        134   2e-32    
gb|EDL97205.1|  gamma-glutamyltransferase 1, isoform CRA_b              134   2e-32    
ref|XP_001147629.2|  PREDICTED: gamma-glutamyltransferase light c...    129   2e-32    
ref|XP_009232463.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    134   2e-32    
ref|XP_006177129.1|  PREDICTED: gamma-glutamyltranspeptidase 1          134   2e-32    
ref|XP_010953743.1|  PREDICTED: gamma-glutamyltranspeptidase 1          134   2e-32    
gb|EDL97199.1|  gamma-glutamyltransferase 1, isoform CRA_a              134   2e-32    
ref|XP_002638849.1|  Hypothetical protein CBG22061                      135   2e-32    
ref|XP_007955578.1|  PREDICTED: gamma-glutamyltranspeptidase 1          134   2e-32    
ref|NP_490714.1|  Protein C53D5.5                                       135   2e-32    
gb|ERL93408.1|  hypothetical protein D910_10700                         133   2e-32    
gb|ERL93407.1|  hypothetical protein D910_10699                         134   3e-32    
ref|WP_016876899.1|  hypothetical protein                               134   3e-32    
gb|EFX74306.1|  hypothetical protein DAPPUDRAFT_57408                   134   3e-32    
gb|KFM59792.1|  Gamma-glutamyltranspeptidase 1                          134   3e-32    
ref|XP_006213353.1|  PREDICTED: gamma-glutamyltranspeptidase 1          134   3e-32    
ref|XP_009909255.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    134   3e-32    
ref|XP_009090497.1|  PREDICTED: gamma-glutamyltranspeptidase 1          134   3e-32    
ref|XP_005147839.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    134   3e-32    
emb|CDS07085.1|  hypothetical protein LRAMOSA09608                      134   3e-32    
ref|XP_008324537.1|  PREDICTED: gamma-glutamyltranspeptidase 1          134   3e-32    
ref|XP_004400597.1|  PREDICTED: gamma-glutamyltranspeptidase 1          134   3e-32    
emb|CBY32801.1|  unnamed protein product                                134   3e-32    
gb|ERE92757.1|  gamma-glutamyltranspeptidase 1-like protein             136   3e-32    
ref|XP_010985608.1|  PREDICTED: gamma-glutamyltranspeptidase 1          134   3e-32    
ref|XP_003726539.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    134   3e-32    
gb|KFH65889.1|  gamma-glutamyltranspeptidase                            134   4e-32    
ref|WP_038026718.1|  gamma-glutamyltranspeptidase                       134   4e-32    
ref|XP_004176620.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    134   4e-32    
ref|XP_007092370.1|  PREDICTED: gamma-glutamyltranspeptidase 1          134   4e-32    
gb|ENN75953.1|  hypothetical protein YQE_07488                          133   4e-32    
ref|XP_006815741.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     129   4e-32    
ref|XP_002290326.1|  gamma-glutamyltransferase                          134   5e-32    
emb|CAL49391.1|  novel protein similar to Gamma-glutamyltranspept...    132   5e-32    
ref|XP_004670971.1|  PREDICTED: gamma-glutamyltranspeptidase 1          133   5e-32    
ref|XP_009909254.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    133   5e-32    
gb|EKQ71322.1|  gamma-glutamyltransferase 1                             133   5e-32    
ref|XP_002482741.1|  gamma-glutamyltranspeptidase                       134   5e-32    
ref|XP_003229521.1|  PREDICTED: gamma-glutamyltranspeptidase 1          133   5e-32    
emb|CAA27224.1|  gamma-glutamyltranspeptidase precursor                 133   5e-32    
gb|KFV63279.1|  Gamma-glutamyltranspeptidase 1                          133   5e-32    
ref|NP_001089832.1|  gamma-glutamyltransferase 1                        133   5e-32    
ref|WP_020703413.1|  hypothetical protein                               133   5e-32    
ref|WP_036614192.1|  gamma-glutamyltranspeptidase                       133   6e-32    
ref|XP_005360251.1|  PREDICTED: gamma-glutamyltranspeptidase 1          134   6e-32    
ref|XP_002127875.1|  PREDICTED: gamma-glutamyltransferase light c...    130   6e-32    
emb|CCM05719.1|  predicted protein                                      132   6e-32    
gb|EXM00793.1|  gamma-glutamyltransferase                               133   6e-32    
ref|XP_005054841.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    133   6e-32    
emb|CEI93621.1|  Putative Gamma-glutamyltransferase                     133   7e-32    
gb|ELU09505.1|  hypothetical protein CAPTEDRAFT_3766                    127   7e-32    
ref|XP_005105285.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    133   7e-32    
ref|XP_007437441.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    133   7e-32    
ref|XP_005054842.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    133   7e-32    
gb|EMT73261.1|  Gamma-glutamyltranspeptidase 1                          133   7e-32    
ref|XP_005105286.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    133   7e-32    
ref|XP_001748231.1|  hypothetical protein                               134   7e-32    
ref|XP_008335118.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     133   8e-32    
ref|XP_003690896.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    134   8e-32    
gb|ETN65434.1|  gamma-glutamyl transpeptidase                           133   8e-32    
gb|AAH75461.1|  gamma-glutamyltransferase 1                             132   8e-32    
ref|WP_026104444.1|  gamma-glutamyltranspeptidase                       132   9e-32    
ref|XP_005524526.1|  PREDICTED: gamma-glutamyltranspeptidase 1          132   9e-32    
gb|ERG87471.1|  gamma-glutamyltranspeptidase 1                          133   9e-32    
ref|XP_007899946.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     132   9e-32    
gb|KFP19491.1|  Gamma-glutamyltranspeptidase 1                          132   1e-31    
ref|XP_010573542.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    132   1e-31    
ref|XP_009925327.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    132   1e-31    
ref|XP_009641388.1|  PREDICTED: gamma-glutamyltranspeptidase 1          132   1e-31    
ref|XP_005901644.1|  PREDICTED: gamma-glutamyltranspeptidase 1          132   1e-31    
ref|XP_005054840.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    132   1e-31    
ref|NP_001006724.2|  gamma-glutamyltranspeptidase 1                     132   1e-31    
ref|XP_008500999.1|  PREDICTED: gamma-glutamyltranspeptidase 1          132   1e-31    
ref|XP_006746112.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    132   1e-31    
dbj|BAF62329.1|  gamma-glutamyltranspeptidase 1                         132   1e-31    
ref|XP_004817187.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    132   1e-31    
ref|XP_006617490.1|  PREDICTED: gamma-glutamyltranspeptidase 1-li...    133   1e-31    
ref|XP_003803181.1|  PREDICTED: gamma-glutamyltranspeptidase 1          132   1e-31    
ref|XP_005670939.1|  PREDICTED: gamma-glutamyltranspeptidase 1 is...    132   1e-31    
ref|XP_003739596.1|  PREDICTED: gamma-glutamyltranspeptidase 1-like     133   1e-31    
gb|KFP07800.1|  Gamma-glutamyltranspeptidase 1                          132   1e-31    



>ref|XP_004251649.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Solanum lycopersicum]
Length=630

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 189/226 (84%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVD+DRNAVS+TTTVNY FGGGV+SPSTGIVLNNEMGDFS P E+S
Sbjct  405  RWSQLRDHGTSHFCIVDSDRNAVSVTTTVNYPFGGGVLSPSTGIVLNNEMGDFSTPNEIS  464

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI P KRPLSSMTP++VLKDNQLA VIGGSGG  II  V QVF+NH VLG
Sbjct  465  PDKLPPAPANFIQPKKRPLSSMTPVIVLKDNQLAGVIGGSGGLKIIFAVLQVFINHFVLG  524

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AVQSPRVYH+LIPN VLYENWT +DG+HIELS  ++ FLE+RGH+L+A+  GAIC
Sbjct  525  MDPLAAVQSPRVYHELIPNVVLYENWTCIDGDHIELSDDKKHFLEERGHKLEARNGGAIC  584

Query  541  QLLVQNLPKP--------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQNLP P        G+   +G F G+L AVSDPRK G PAAI
Sbjct  585  QLIVQNLPNPPLQMGRRSGKEYKDGIFRGLLVAVSDPRKDGRPAAI  630



>gb|ABB59571.1| putative gamma-glutamyl transferase [Populus tremula x Populus 
alba]
Length=386

 Score =   348 bits (892),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 186/226 (82%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFC+VDA+RNAVSMTTT+NY FG GV+SPSTGI+LNNEMGDFSAPTE++
Sbjct  161  RWSQLRDHGTSHFCVVDAERNAVSMTTTINYGFGAGVLSPSTGILLNNEMGDFSAPTEIT  220

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTPI+V KDNQLA V+GGSGG  II  V QVFLNH VL 
Sbjct  221  PDMLPPAPANFIEPNKRPLSSMTPIIVTKDNQLAGVMGGSGGLFIIPAVIQVFLNHFVLR  280

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AV+SPRVYHKLIPNTVLYENWT++DG+HIEL+G R+ FLE+RGHQL AQ  GAI 
Sbjct  281  MEPLTAVESPRVYHKLIPNTVLYENWTVIDGKHIELAGDRKAFLEERGHQLLAQAGGAIV  340

Query  541  QLLVQNLPKP--------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P           +N   FHG LTAVSDPRK G PAAI
Sbjct  341  QLVVQTLQSPIDVASENSRDSVNAQIFHGTLTAVSDPRKDGRPAAI  386



>ref|XP_009757182.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Nicotiana sylvestris]
Length=624

 Score =   355 bits (910),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 187/226 (83%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVD+DRNAVS+TTTVNY FG GV+SPSTGIVLN+EMGDFS P+E+ 
Sbjct  399  RWSQLRDHGTSHFCIVDSDRNAVSVTTTVNYPFGAGVLSPSTGIVLNDEMGDFSTPSEIY  458

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD+LPP+PANFI P KRPLSSM PI+VLKDNQLA VIGGSGG  II  V QVF+NH +LG
Sbjct  459  PDELPPAPANFIQPKKRPLSSMAPIIVLKDNQLAGVIGGSGGMKIIPAVVQVFINHFILG  518

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AVQSPRVYH+LIPN VLYENWT +DG+HIELS  ++ FLE+RGHQL+A   GAIC
Sbjct  519  MDPLAAVQSPRVYHELIPNVVLYENWTCIDGDHIELSDEKKHFLEERGHQLEAHNGGAIC  578

Query  541  QLLVQNLP--------KPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQNLP        + G+   NG FHGML AVSDPRK G PAAI
Sbjct  579  QLIVQNLPNSHLKLGRRSGKEYKNGVFHGMLVAVSDPRKDGRPAAI  624



>ref|XP_006353508.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Solanum tuberosum]
Length=630

 Score =   355 bits (910),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 188/226 (83%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            R+ QLRDHGTSHFCIVDADRNAVS+TTTVNY FGGGV+SPSTGIVLNNEMGDFS P E+S
Sbjct  405  RFGQLRDHGTSHFCIVDADRNAVSVTTTVNYPFGGGVLSPSTGIVLNNEMGDFSTPNEIS  464

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI P KRPLSSMTP++VLKDNQLA VIGGSGG  II  V QVF+NH VLG
Sbjct  465  PDKLPPAPANFIRPKKRPLSSMTPVIVLKDNQLAGVIGGSGGLKIIFAVVQVFINHFVLG  524

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AVQSPRVYH+LIPN VLYENWT +DG+HIELS  ++ FLE+RGHQL+A+  GAIC
Sbjct  525  MDPLAAVQSPRVYHELIPNVVLYENWTCIDGDHIELSDDKKHFLEERGHQLEARSGGAIC  584

Query  541  QLLVQNLPKP--------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQNLP P        G+   +G F G+L AVSDPRK G PAAI
Sbjct  585  QLIVQNLPNPPLQLGRRSGKQYKDGIFRGLLVAVSDPRKDGRPAAI  630



>ref|XP_009597034.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Nicotiana tomentosiformis]
Length=624

 Score =   353 bits (905),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 187/226 (83%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVD+DRNAVS+TTTVNY FG GV+SPSTGIVLN+EMGDFS P+E+S
Sbjct  399  RWSQLRDHGTSHFCIVDSDRNAVSVTTTVNYPFGAGVLSPSTGIVLNDEMGDFSTPSEIS  458

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD+LPP+PANFI P KRPLSSM PI+VLKDNQLA VIGGSGG  II  V QVF+NH +LG
Sbjct  459  PDELPPAPANFIQPKKRPLSSMAPIIVLKDNQLAGVIGGSGGLKIIPAVVQVFINHFILG  518

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AVQSPRVYH+LIPN VLYENWT +DG+HIELS  ++ FLE+RGHQL+A   GAIC
Sbjct  519  MDPLAAVQSPRVYHELIPNVVLYENWTCIDGDHIELSDEKKHFLEERGHQLEAHNGGAIC  578

Query  541  QLLVQNLP--------KPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQNLP        + G+   NG F GML AVSDPRK G PAAI
Sbjct  579  QLIVQNLPNSPLKLGRRSGKEYKNGVFRGMLVAVSDPRKDGRPAAI  624



>ref|XP_011093665.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Sesamum indicum]
 ref|XP_011093666.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Sesamum indicum]
Length=623

 Score =   352 bits (904),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 189/223 (85%), Gaps = 5/223 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFC+VD+DRNAVSMTTTVNY FGGGV+SPSTGI+LNNEM DFS PT++S
Sbjct  401  RWSQLRDHGTSHFCVVDSDRNAVSMTTTVNYAFGGGVLSPSTGIILNNEMDDFSIPTDIS  460

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+P NFI PNKRPLSSM PI+VLKDNQLA VIGGSGG NII  V QVF+NH +LG
Sbjct  461  PDKLPPAPPNFIRPNKRPLSSMNPIIVLKDNQLAGVIGGSGGLNIIPAVVQVFINHFILG  520

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AVQ+ R+YH+LIPN V YENWT++DGEHIELS  R++FL +RGHQL+A+  GAIC
Sbjct  521  MEPLAAVQNARIYHRLIPNVVSYENWTVVDGEHIELSEERKQFLRERGHQLRAKAGGAIC  580

Query  541  QLLVQNLPKPGQWL-----NNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQNL    ++L     N   FHG+LTAVSDPRKGG PAAI
Sbjct  581  QLVVQNLTNRVEYLGRKVKNENVFHGILTAVSDPRKGGWPAAI  623



>emb|CDP03225.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   352 bits (904),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 186/225 (83%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQL DHGTSHFCIVDADRNAVSMTTTVNY FG GV+SPSTGIVLNNEMGDFS PTE+S
Sbjct  404  RWSQLTDHGTSHFCIVDADRNAVSMTTTVNYPFGAGVLSPSTGIVLNNEMGDFSVPTEIS  463

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             DKLPP+PANFI PNKRPLSSMTPI+VLK NQLA VIGGSGG++II  V QVF+NH +LG
Sbjct  464  SDKLPPAPANFIRPNKRPLSSMTPIIVLKHNQLAGVIGGSGGSDIIPAVVQVFINHFILG  523

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AVQSPRVYH+LIPN VLYENWT++DG+HIELS   R FLE+RGHQLQ +  G IC
Sbjct  524  MEPLAAVQSPRVYHELIPNVVLYENWTVLDGDHIELSNENRHFLEERGHQLQGRSGGGIC  583

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ L +P       G+  NN   HG+LTAVSDPRK G PAAI
Sbjct  584  QFIVQTLQRPRDGGRKFGKTANNEVVHGILTAVSDPRKDGRPAAI  628



>ref|XP_007204871.1| hypothetical protein PRUPE_ppa002923mg [Prunus persica]
 gb|EMJ06070.1| hypothetical protein PRUPE_ppa002923mg [Prunus persica]
Length=621

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 189/225 (84%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDADRNAVSMT+TVNY FGGGV+SPSTGI+LNNEM DFS PTE+S
Sbjct  397  RWSQLRDHGTSHFCIVDADRNAVSMTSTVNYPFGGGVLSPSTGILLNNEMDDFSTPTEIS  456

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD+LPP+PANFI PNKRPLSSMTP++++KDN+LA VIGGSGG NII  V QVFLN+ VLG
Sbjct  457  PDRLPPAPANFIEPNKRPLSSMTPLIIMKDNELAGVIGGSGGMNIIPAVTQVFLNYFVLG  516

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AVQSPR+YHKLIPN V YEN T++DG+HIELS  ++ FL++RGHQL+A+  GAI 
Sbjct  517  MEPLAAVQSPRIYHKLIPNVVSYENLTLIDGDHIELSDEKKLFLQERGHQLEAKAGGAIT  576

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L KP       GQ  N  TFHG LTAVSDPRK G PAA+
Sbjct  577  QLVVQTLRKPVNMGRKSGQNSNEQTFHGTLTAVSDPRKDGKPAAV  621



>ref|XP_008242458.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Prunus mume]
Length=611

 Score =   345 bits (884),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 187/225 (83%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDADRNAVSMT+TVNY FGGGV+SPSTGI+LNNEM DFS PTE+S
Sbjct  387  RWSQLRDHGTSHFCIVDADRNAVSMTSTVNYPFGGGVLSPSTGILLNNEMDDFSTPTEIS  446

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP++++KDN+LA VIGGSGG NII  V QVFLN+ VLG
Sbjct  447  PDHLPPAPANFIEPNKRPLSSMTPLIIMKDNELAGVIGGSGGMNIIPAVTQVFLNYFVLG  506

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AVQSPR+YHKLIPN V YEN T++DG+HIELS  ++ FL++RGHQL+A+  GAI 
Sbjct  507  MDPLAAVQSPRIYHKLIPNVVSYENLTVIDGDHIELSDEKQLFLQERGHQLEAKAGGAIT  566

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L KP       GQ  N  TF G LTAVSDPRK G PAA+
Sbjct  567  QLIVQTLRKPVNMGRKSGQNSNEQTFQGTLTAVSDPRKDGKPAAV  611



>gb|KDO55895.1| hypothetical protein CISIN_1g006929mg [Citrus sinensis]
Length=513

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 185/226 (82%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDA+RNAVSMTTTVNY FG G++SPSTGIVLNNEM DFS PTE+S
Sbjct  288  RWSQLRDHGTSHFCIVDAERNAVSMTTTVNYAFGAGILSPSTGIVLNNEMDDFSIPTEIS  347

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI PNKRPLSSMTP+++ KDNQLA VIGGSGG NII  V QVF+NH +LG
Sbjct  348  PDKLPPAPANFIEPNKRPLSSMTPLIITKDNQLAGVIGGSGGMNIIPAVTQVFINHFILG  407

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AVQ+PRVYHKLIPN V YENWT++DG+HIE+S   + FLE RGHQL+A+  GAI 
Sbjct  408  MEPLAAVQNPRVYHKLIPNVVSYENWTVIDGDHIEISEESKLFLEKRGHQLKAKAGGAIV  467

Query  541  QLLVQNLPKP-------GQWLNNG-TFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ L  P       G+ ++N    HG+LTAVSDPRK G PAA+
Sbjct  468  QFVVQTLQNPINRIRKIGKGIDNAQALHGILTAVSDPRKDGRPAAV  513



>ref|XP_011015454.1| PREDICTED: gamma-glutamyltranspeptidase 3-like isoform X1 [Populus 
euphratica]
Length=638

 Score =   345 bits (885),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 186/226 (82%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFC+VDA+RNAVSMTTT+NY FG GV+SPSTGI+LNNEMGDFSAPTE++
Sbjct  413  RWSQLRDHGTSHFCVVDAERNAVSMTTTINYGFGAGVLSPSTGILLNNEMGDFSAPTEIT  472

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ KD+QLA V+GGSGG  II  V QVFLNH VLG
Sbjct  473  PDMLPPAPANFIEPNKRPLSSMTPVIITKDDQLAGVMGGSGGLFIIPAVIQVFLNHFVLG  532

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AV+SPRVYHKLIPNTVLYENWT++DG+HIEL+G R+ FLE+RGHQL AQ  GAI 
Sbjct  533  MEPLTAVESPRVYHKLIPNTVLYENWTVIDGKHIELAGDRKAFLEERGHQLLAQAGGAIV  592

Query  541  QLLVQNLPKP--------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P           +N    HG LTAVSDPRK G PAAI
Sbjct  593  QLVVQTLQSPIHVDSENSRDSINAQILHGTLTAVSDPRKDGRPAAI  638



>ref|XP_011015455.1| PREDICTED: gamma-glutamyltranspeptidase 3-like isoform X2 [Populus 
euphratica]
Length=637

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 186/226 (82%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFC+VDA+RNAVSMTTT+NY FG GV+SPSTGI+LNNEMGDFSAPTE++
Sbjct  412  RWSQLRDHGTSHFCVVDAERNAVSMTTTINYGFGAGVLSPSTGILLNNEMGDFSAPTEIT  471

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ KD+QLA V+GGSGG  II  V QVFLNH VLG
Sbjct  472  PDMLPPAPANFIEPNKRPLSSMTPVIITKDDQLAGVMGGSGGLFIIPAVIQVFLNHFVLG  531

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AV+SPRVYHKLIPNTVLYENWT++DG+HIEL+G R+ FLE+RGHQL AQ  GAI 
Sbjct  532  MEPLTAVESPRVYHKLIPNTVLYENWTVIDGKHIELAGDRKAFLEERGHQLLAQAGGAIV  591

Query  541  QLLVQNLPKP--------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P           +N    HG LTAVSDPRK G PAAI
Sbjct  592  QLVVQTLQSPIHVDSENSRDSINAQILHGTLTAVSDPRKDGRPAAI  637



>ref|XP_011006432.1| PREDICTED: gamma-glutamyltranspeptidase 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011006433.1| PREDICTED: gamma-glutamyltranspeptidase 3-like isoform X1 [Populus 
euphratica]
Length=638

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 186/226 (82%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFC+VDA+RNAVSMTTT+NY FG GV+SPSTGI+LNNEMGDFSAPTE++
Sbjct  413  RWSQLRDHGTSHFCVVDAERNAVSMTTTINYGFGAGVLSPSTGILLNNEMGDFSAPTEIT  472

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ KD+QLA V+GGSGG  II  V QVFLNH VLG
Sbjct  473  PDMLPPAPANFIEPNKRPLSSMTPVIITKDDQLAGVMGGSGGLFIIPAVIQVFLNHFVLG  532

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AV+SPRVYHKLIPNTVLYENWT++DG+HIEL+G R+ FLE+RGHQL AQ  GAI 
Sbjct  533  MEPLTAVESPRVYHKLIPNTVLYENWTVIDGKHIELAGDRKAFLEERGHQLLAQAGGAIV  592

Query  541  QLLVQNLPKP--------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P           +N    HG LTAVSDPRK G PAAI
Sbjct  593  QLVVQTLQSPIHVDSENSRDSVNAQILHGTLTAVSDPRKDGRPAAI  638



>ref|XP_011006434.1| PREDICTED: gamma-glutamyltranspeptidase 3-like isoform X2 [Populus 
euphratica]
Length=637

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 186/226 (82%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFC+VDA+RNAVSMTTT+NY FG GV+SPSTGI+LNNEMGDFSAPTE++
Sbjct  412  RWSQLRDHGTSHFCVVDAERNAVSMTTTINYGFGAGVLSPSTGILLNNEMGDFSAPTEIT  471

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ KD+QLA V+GGSGG  II  V QVFLNH VLG
Sbjct  472  PDMLPPAPANFIEPNKRPLSSMTPVIITKDDQLAGVMGGSGGLFIIPAVIQVFLNHFVLG  531

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AV+SPRVYHKLIPNTVLYENWT++DG+HIEL+G R+ FLE+RGHQL AQ  GAI 
Sbjct  532  MEPLTAVESPRVYHKLIPNTVLYENWTVIDGKHIELAGDRKAFLEERGHQLLAQAGGAIV  591

Query  541  QLLVQNLPKP--------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P           +N    HG LTAVSDPRK G PAAI
Sbjct  592  QLVVQTLQSPIHVDSENSRDSVNAQILHGTLTAVSDPRKDGRPAAI  637



>gb|EYU30676.1| hypothetical protein MIMGU_mgv1a004306mg [Erythranthe guttata]
Length=534

 Score =   340 bits (871),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 187/223 (84%), Gaps = 5/223 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQ+ DHGTSHFC+VD+DRNAVSMT+TVNYVFGGGVMSPSTGIVLNNEM DFS PT+V+
Sbjct  312  RWSQIIDHGTSHFCVVDSDRNAVSMTSTVNYVFGGGVMSPSTGIVLNNEMDDFSIPTDVT  371

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+P NFI PNKRPLSSMTPIV+LKDNQLA VIGGSGG +II  V QVF+NH +LG
Sbjct  372  PDKLPPAPTNFIKPNKRPLSSMTPIVILKDNQLAGVIGGSGGLDIIPAVVQVFINHFILG  431

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL A+QS RVYH+LIPN V YENWT++DGEHIELS  R+  L ++GH+L+A+  GAIC
Sbjct  432  MEPLAAIQSARVYHRLIPNVVSYENWTVVDGEHIELSEKRKELLREKGHELKAKAGGAIC  491

Query  541  QLLVQNLPKP----GQWL-NNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQNL       G+ L NN    G+LTAVSDPRKGG PAA+
Sbjct  492  QLVVQNLTNAVDFSGRKLRNNNVLCGVLTAVSDPRKGGWPAAV  534



>ref|XP_006371961.1| hypothetical protein POPTR_0018s06710g [Populus trichocarpa]
 gb|ERP49758.1| hypothetical protein POPTR_0018s06710g [Populus trichocarpa]
Length=605

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 186/227 (82%), Gaps = 9/227 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDA+RNAVSMTTT+NY FG GV+SPSTGI+LNNEMGDFSAPTE++
Sbjct  379  RWSQLRDHGTSHFCIVDAERNAVSMTTTINYGFGAGVLSPSTGILLNNEMGDFSAPTEIT  438

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTPI+V KDNQLA V+GGSGG  II  V QVFLNH VL 
Sbjct  439  PDMLPPAPANFIEPNKRPLSSMTPIIVTKDNQLAGVMGGSGGLFIIPAVIQVFLNHFVLR  498

Query  361  MDPLEAVQSPRVYHK-LIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            M+PL AV+SPRVYHK LIPNTVLYENWT++DG+HIEL+G R+ FLE+RGHQL AQ  GAI
Sbjct  499  MEPLTAVESPRVYHKQLIPNTVLYENWTVIDGKHIELAGDRKAFLEERGHQLLAQAGGAI  558

Query  538  CQLLVQNLPKP--------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
             QL+VQ L  P           +N+   HG LTAVSDPRK G PAAI
Sbjct  559  VQLVVQTLQSPIHVDSENSRDSVNSQILHGTLTAVSDPRKDGRPAAI  605



>ref|XP_006475363.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Citrus sinensis]
 gb|KDO55894.1| hypothetical protein CISIN_1g006929mg [Citrus sinensis]
Length=625

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 185/226 (82%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDA+RNAVSMTTTVNY FG G++SPSTGIVLNNEM DFS PTE+S
Sbjct  400  RWSQLRDHGTSHFCIVDAERNAVSMTTTVNYAFGAGILSPSTGIVLNNEMDDFSIPTEIS  459

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI PNKRPLSSMTP+++ KDNQLA VIGGSGG NII  V QVF+NH +LG
Sbjct  460  PDKLPPAPANFIEPNKRPLSSMTPLIITKDNQLAGVIGGSGGMNIIPAVTQVFINHFILG  519

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AVQ+PRVYHKLIPN V YENWT++DG+HIE+S   + FLE RGHQL+A+  GAI 
Sbjct  520  MEPLAAVQNPRVYHKLIPNVVSYENWTVIDGDHIEISEESKLFLEKRGHQLKAKAGGAIV  579

Query  541  QLLVQNLPKP-------GQWLNNG-TFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ L  P       G+ ++N    HG+LTAVSDPRK G PAA+
Sbjct  580  QFVVQTLQNPINRIRKIGKGIDNAQALHGILTAVSDPRKDGRPAAV  625



>ref|XP_006451358.1| hypothetical protein CICLE_v10007750mg [Citrus clementina]
 gb|ESR64598.1| hypothetical protein CICLE_v10007750mg [Citrus clementina]
Length=625

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 185/226 (82%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDA+RNAVSMTTTVNY FG G++SPSTGIVLNNEM DFS PTE+S
Sbjct  400  RWSQLRDHGTSHFCIVDAERNAVSMTTTVNYAFGAGILSPSTGIVLNNEMDDFSIPTEIS  459

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI PNKRPLSSMTP+++ KDNQLA VIGGSGG NII  V QVF+NH +LG
Sbjct  460  PDKLPPAPANFIEPNKRPLSSMTPLIITKDNQLAGVIGGSGGMNIIPAVTQVFINHFILG  519

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AVQ+PRVYHKLIPN V YENWT++DG+HIE+S   + FLE RGHQL+A+  GAI 
Sbjct  520  MEPLAAVQNPRVYHKLIPNVVSYENWTVIDGDHIEISEESKLFLEKRGHQLKAKAGGAIV  579

Query  541  QLLVQNLPKP-------GQWLNNG-TFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ L  P       G+ ++N    HG+LTAVSDPRK G PAA+
Sbjct  580  QFVVQTLQNPINRIRKIGKGIDNAQALHGILTAVSDPRKDGRPAAV  625



>ref|XP_008387437.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Malus domestica]
Length=629

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 185/225 (82%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDADRNAVS+T+TVNY FG GV+SPSTGI+LNNEMGDFS PT++S
Sbjct  405  RWSQLRDHGTSHFCIVDADRNAVSVTSTVNYPFGAGVLSPSTGILLNNEMGDFSTPTDIS  464

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ KDNQLA V+GGSGG NII  V QVF+NH VLG
Sbjct  465  PDHLPPAPANFIEPNKRPLSSMTPLIITKDNQLAGVLGGSGGMNIIPAVTQVFVNHFVLG  524

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL+AVQSPR+YH+LIPN V YEN T++DG+HIELS  R+ FL+ RGHQLQAQ  GAI 
Sbjct  525  MDPLDAVQSPRIYHRLIPNIVCYENMTVIDGDHIELSDERKLFLQQRGHQLQAQAGGAIT  584

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P       G+  N   FHG LTAVSDPRK G PAA+
Sbjct  585  QLIVQTLQNPANIGRKXGKNSNEQIFHGRLTAVSDPRKDGXPAAV  629



>ref|XP_009352586.1| PREDICTED: gamma-glutamyltranspeptidase 3 isoform X2 [Pyrus x 
bretschneideri]
Length=627

 Score =   337 bits (865),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 184/225 (82%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDADRNAVS+T+TVNY FGGGV+SPSTGI+LNNEM DFS PTE+S
Sbjct  403  RWSQLRDHGTSHFCIVDADRNAVSVTSTVNYPFGGGVLSPSTGIILNNEMDDFSTPTEIS  462

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ +DNQLA V+GGSGG NII  V QVFLNH V+G
Sbjct  463  PDHLPPAPANFIEPNKRPLSSMTPLIITRDNQLAGVLGGSGGMNIIPAVTQVFLNHFVMG  522

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL+AVQSPR+YH+LIPN V YEN T++DG+HIELS  R+ FL  RGH+LQA+  GAI 
Sbjct  523  MDPLDAVQSPRIYHRLIPNIVSYENMTVIDGDHIELSDERKLFLLARGHKLQAKAGGAIT  582

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P       G+  N   FHG LTAVSDPRK G PAA+
Sbjct  583  QLVVQTLRNPANIGRKSGKNSNEQIFHGRLTAVSDPRKDGKPAAV  627



>ref|XP_009352585.1| PREDICTED: gamma-glutamyltranspeptidase 3 isoform X1 [Pyrus x 
bretschneideri]
Length=629

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 184/225 (82%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDADRNAVS+T+TVNY FGGGV+SPSTGI+LNNEM DFS PTE+S
Sbjct  405  RWSQLRDHGTSHFCIVDADRNAVSVTSTVNYPFGGGVLSPSTGIILNNEMDDFSTPTEIS  464

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ +DNQLA V+GGSGG NII  V QVFLNH V+G
Sbjct  465  PDHLPPAPANFIEPNKRPLSSMTPLIITRDNQLAGVLGGSGGMNIIPAVTQVFLNHFVMG  524

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL+AVQSPR+YH+LIPN V YEN T++DG+HIELS  R+ FL  RGH+LQA+  GAI 
Sbjct  525  MDPLDAVQSPRIYHRLIPNIVSYENMTVIDGDHIELSDERKLFLLARGHKLQAKAGGAIT  584

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P       G+  N   FHG LTAVSDPRK G PAA+
Sbjct  585  QLVVQTLRNPANIGRKSGKNSNEQIFHGRLTAVSDPRKDGKPAAV  629



>gb|KHG10055.1| Gamma-glutamyltranspeptidase 1 [Gossypium arboreum]
Length=621

 Score =   335 bits (858),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 183/223 (82%), Gaps = 5/223 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFC+VDA+RNAVSMTTTVNY FG GV+SPSTGI++NNEMGDFSAPTE+S
Sbjct  399  RWSQLRDHGTSHFCVVDAERNAVSMTTTVNYPFGAGVLSPSTGIIVNNEMGDFSAPTEIS  458

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ KDNQLA VIGGSGG NII  V QVFLNH VLG
Sbjct  459  PDMLPPAPANFIRPNKRPLSSMTPLIITKDNQLAGVIGGSGGMNIIPAVTQVFLNHFVLG  518

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AVQ PR+YHKLIPN V YENWT++DG+HIEL+   + FL ++GH+L+A+  GAI 
Sbjct  519  MEPLAAVQHPRIYHKLIPNLVYYENWTVIDGDHIELADETKIFLREKGHELRAKSGGAIV  578

Query  541  QLLVQNLPKP---GQWLNNGT--FHGMLTAVSDPRKGGSPAAI  654
            Q +VQ L K    G+     +  FHG LTAVSDPRK G PAA+
Sbjct  579  QFVVQALQKDIERGRKFGKDSYIFHGTLTAVSDPRKDGKPAAV  621



>gb|EYU27245.1| hypothetical protein MIMGU_mgv1a023702mg [Erythranthe guttata]
Length=575

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 181/225 (80%), Gaps = 8/225 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLR+HGTSHFC+VD+DRNAVSMTTTVNY FGGGV+SPSTGI+LNNEM DFS P + S
Sbjct  352  RWSQLREHGTSHFCVVDSDRNAVSMTTTVNYPFGGGVLSPSTGIILNNEMDDFSTPGDKS  411

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             DKLPP+P NFI PNKRPLSSMTP++VLKDNQLA VIGGSGG  II  VAQVF+NH VLG
Sbjct  412  TDKLPPAPTNFIRPNKRPLSSMTPLIVLKDNQLAGVIGGSGGLEIIPAVAQVFVNHFVLG  471

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL  VQS RVYH+LIPN V YENWT++DGEHIELS  R+ FL +RGHQL A+  GAIC
Sbjct  472  MDPLAGVQSARVYHRLIPNVVSYENWTVVDGEHIELSEERKGFLRERGHQLDAKAGGAIC  531

Query  541  QLLVQNLPK-------PGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQNL             L+N    G+LTAVSDPRKGG PAA+
Sbjct  532  QLVVQNLTTNTVDGFGRKTKLDN-VVRGVLTAVSDPRKGGWPAAM  575



>gb|KCW79590.1| hypothetical protein EUGRSUZ_C00950 [Eucalyptus grandis]
Length=547

 Score =   328 bits (841),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 181/225 (80%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQLRDHGTSHF IVDADRNAVSMTTTVNY FGGGV+SP+TGIVLNNEMGDFS PTE+S
Sbjct  323  KWSQLRDHGTSHFGIVDADRNAVSMTTTVNYPFGGGVLSPTTGIVLNNEMGDFSTPTEIS  382

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ KDNQLA V+GGSGG NII  V QVFLNH VLG
Sbjct  383  PDHLPPAPANFIEPNKRPLSSMTPLIITKDNQLAGVVGGSGGMNIIPAVTQVFLNHFVLG  442

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL+AV+ PRVYH+LIPN V+YEN T +DG HIELS  R+ FL   GHQL+A   GAI 
Sbjct  443  MEPLDAVKDPRVYHRLIPNVVMYENCTCIDGIHIELSDERKLFLNGIGHQLEAIAGGAIV  502

Query  541  QLLVQNLP-------KPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQNL        K  + LN+G   G LTAVSDPRK G PAA+
Sbjct  503  QLVVQNLQDTLDLGRKSRKGLNSGIVRGTLTAVSDPRKDGKPAAV  547



>ref|XP_007012965.1| Gamma-glutamyl transpeptidase 4 [Theobroma cacao]
 gb|EOY30584.1| Gamma-glutamyl transpeptidase 4 [Theobroma cacao]
Length=631

 Score =   330 bits (846),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 182/223 (82%), Gaps = 5/223 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFC+VDA+RNAVSMTTTVNY FG GV+SPSTGIV+NNEMGDFSAPTE+S
Sbjct  409  RWSQLRDHGTSHFCVVDAERNAVSMTTTVNYPFGAGVLSPSTGIVVNNEMGDFSAPTEIS  468

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI P KRPLSSMTP+++ K+NQLA VIGGSGG +II  V QVFLNH  LG
Sbjct  469  PDMLPPAPANFIRPKKRPLSSMTPLIITKNNQLAGVIGGSGGMSIIPAVIQVFLNHFFLG  528

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
             +PL AVQ PR+YHKLIPN V YENWT++DG+HIEL+   + FL ++GHQLQA+ SGAI 
Sbjct  529  TEPLAAVQHPRIYHKLIPNVVSYENWTVIDGDHIELAEETKTFLAEKGHQLQAKSSGAIV  588

Query  541  QLLVQNLPKP---GQWLNNGT--FHGMLTAVSDPRKGGSPAAI  654
            Q +VQ L  P   G+    G+  +HG LTAVSDPRK G PAA+
Sbjct  589  QFVVQTLQNPIEMGRKYGKGSNIYHGTLTAVSDPRKDGKPAAL  631



>gb|AFW80067.1| hypothetical protein ZEAMMB73_199418 [Zea mays]
Length=298

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 176/218 (81%), Gaps = 0/218 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQL DHGTSH C+VD DRNAV+MTTTVN  FG  V+SPSTGIVLN+EM DFS P + +
Sbjct  81   KWSQLDDHGTSHLCVVDGDRNAVAMTTTVNAYFGAKVLSPSTGIVLNDEMDDFSVPAKRT  140

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD+LPP+PANFI+P KRPLSSMTP+++LKD +LA V+GGSGGTNIIATV QVF+NH ++G
Sbjct  141  PDRLPPAPANFIAPGKRPLSSMTPLIILKDGELAGVLGGSGGTNIIATVVQVFVNHFIVG  200

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AVQ PRVYHKLIPN V YEN T+ DGE I L G  R FLE+RGH+L++ +SGA+C
Sbjct  201  MDPLAAVQHPRVYHKLIPNVVTYENQTVGDGEVIALGGAARAFLEERGHRLRSTDSGAVC  260

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +V  L +P     +G F G LTAVSDPRKGGSPA +
Sbjct  261  QFIVHELAEPPAAPGHGVFRGRLTAVSDPRKGGSPAGL  298



>ref|XP_008337670.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Malus domestica]
Length=797

 Score =   333 bits (854),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 182/225 (81%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDADRNAVS+T+TVNY FGGGV+SP TGI+LNNEM DFS PTEVS
Sbjct  573  RWSQLRDHGTSHFCIVDADRNAVSVTSTVNYPFGGGVLSPXTGIILNNEMDDFSTPTEVS  632

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ KDNQLA V+GGSGG NII  V QVFLNH VLG
Sbjct  633  PDHLPPAPANFIEPNKRPLSSMTPLIITKDNQLAGVLGGSGGMNIIPAVTQVFLNHFVLG  692

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL+AVQSPR+YH+LIPN V YEN T++DG+HIELS  R+ FL +RGH++QA+   AI 
Sbjct  693  MDPLDAVQSPRIYHRLIPNIVSYENMTVIDGDHIELSDERKLFLLERGHKMQAKAGEAIT  752

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P       G+      FHG LTAVSDPRK G PAA+
Sbjct  753  QLVVQXLRNPANIGRKSGKNSTEEIFHGRLTAVSDPRKDGXPAAV  797



>ref|XP_010042687.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Eucalyptus grandis]
Length=625

 Score =   327 bits (839),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 182/225 (81%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQLRDHGTSHF IVDADRNAVSMTTTVNY FGGGV+SP+TGIVLNNEMGDFS PTE+S
Sbjct  401  KWSQLRDHGTSHFGIVDADRNAVSMTTTVNYPFGGGVLSPTTGIVLNNEMGDFSTPTEIS  460

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ KDNQLA V+GGSGG NII  V QVFLNH VLG
Sbjct  461  PDHLPPAPANFIEPNKRPLSSMTPLIISKDNQLAGVVGGSGGMNIIPAVTQVFLNHFVLG  520

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL+AV+ PRVYH+LIPN V+YEN T ++G HIELS  R+ FL+  GHQL+A   GAI 
Sbjct  521  MEPLDAVKDPRVYHRLIPNVVMYENCTCINGIHIELSDKRKLFLKGIGHQLEAIAGGAIV  580

Query  541  QLLVQNLP-------KPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQNL        K  + LN+G   G LTAVSDPRK G PAA+
Sbjct  581  QLVVQNLQDTLDLGRKSRKGLNSGIVRGTLTAVSDPRKDGKPAAV  625



>ref|XP_002280190.1| PREDICTED: gamma-glutamyltranspeptidase 3 isoform X2 [Vitis vinifera]
 emb|CBI27970.3| unnamed protein product [Vitis vinifera]
Length=626

 Score =   327 bits (837),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 165/225 (73%), Positives = 186/225 (83%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            R+SQLRDHGTSHFCIVDADRNAVSMTTTVNY FG GV+SPSTGIVLNNEM DFS PTE+S
Sbjct  402  RYSQLRDHGTSHFCIVDADRNAVSMTTTVNYGFGAGVLSPSTGIVLNNEMDDFSTPTELS  461

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD+LPP+PANFI PNKRPLSSMTPI+V+KDNQLA VIGGSGG  II  V QVFLNH + G
Sbjct  462  PDRLPPAPANFIKPNKRPLSSMTPIIVVKDNQLAGVIGGSGGIYIIPAVLQVFLNHFIFG  521

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AVQSPRVYH+LIPN V YENWT++DG+HIELS  R+ FL +RGH+L+A+  GAI 
Sbjct  522  MEPLAAVQSPRVYHRLIPNVVFYENWTVIDGDHIELSEERKLFLAERGHRLEAKAGGAIS  581

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L KP       G+  N  TFHG LTAVSDPRK G PAA+
Sbjct  582  QLVVQTLEKPIDMGRKNGKDFNAETFHGTLTAVSDPRKDGRPAAV  626



>ref|XP_010656240.1| PREDICTED: gamma-glutamyltranspeptidase 3 isoform X1 [Vitis vinifera]
Length=628

 Score =   327 bits (837),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/225 (73%), Positives = 186/225 (83%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            R+SQLRDHGTSHFCIVDADRNAVSMTTTVNY FG GV+SPSTGIVLNNEM DFS PTE+S
Sbjct  404  RYSQLRDHGTSHFCIVDADRNAVSMTTTVNYGFGAGVLSPSTGIVLNNEMDDFSTPTELS  463

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD+LPP+PANFI PNKRPLSSMTPI+V+KDNQLA VIGGSGG  II  V QVFLNH + G
Sbjct  464  PDRLPPAPANFIKPNKRPLSSMTPIIVVKDNQLAGVIGGSGGIYIIPAVLQVFLNHFIFG  523

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AVQSPRVYH+LIPN V YENWT++DG+HIELS  R+ FL +RGH+L+A+  GAI 
Sbjct  524  MEPLAAVQSPRVYHRLIPNVVFYENWTVIDGDHIELSEERKLFLAERGHRLEAKAGGAIS  583

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L KP       G+  N  TFHG LTAVSDPRK G PAA+
Sbjct  584  QLVVQTLEKPIDMGRKNGKDFNAETFHGTLTAVSDPRKDGRPAAV  628



>ref|XP_010244393.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Nelumbo nucifera]
Length=626

 Score =   325 bits (834),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 181/227 (80%), Gaps = 9/227 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            R+SQLRDHGTSHFC+VDADRN VS+TTTVNY FG GV+SPSTGIV+NNEM DFS PTE +
Sbjct  400  RYSQLRDHGTSHFCVVDADRNTVSLTTTVNYPFGSGVLSPSTGIVINNEMDDFSTPTETT  459

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             DKLPP PANFI P KRPLSSMTP+++LKDNQL  VIGGSGG  II  V QVF+NH +LG
Sbjct  460  VDKLPPDPANFIEPKKRPLSSMTPLIILKDNQLTGVIGGSGGMMIIPAVVQVFINHFILG  519

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AVQ PRVYH++IPN VLYENWT++DG HIELS   + FLE+RGH L+AQ +GAIC
Sbjct  520  MEPLAAVQYPRVYHRVIPNVVLYENWTVIDGNHIELSQENKIFLEERGHVLKAQATGAIC  579

Query  541  QLLVQNLPK----PGQWL-----NNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ+L +     G+ L     N   FHG+L AVSDPRK G PAA+
Sbjct  580  QLIVQDLSRLPVNSGRKLGGRPDNAQVFHGVLIAVSDPRKDGRPAAV  626



>ref|XP_004287500.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Fragaria vesca 
subsp. vesca]
Length=623

 Score =   325 bits (834),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 186/225 (83%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDADRNAVSMTTTVNY FGGGV+SPSTGIVLNNEMGDFS PT+++
Sbjct  399  RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYPFGGGVLSPSTGIVLNNEMGDFSIPTDIT  458

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+P+NFI P KRPLSSMTPI+V KDNQL  V+GGSGG NII  V QVF+N+ +LG
Sbjct  459  PDHLPPAPSNFIEPIKRPLSSMTPIIVTKDNQLVGVLGGSGGLNIIPAVTQVFINYFILG  518

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AVQSPRVYH+LIPN V YENWT++DG+HIELS  R+ FL+DRGH+LQA+  GAI 
Sbjct  519  MEPLAAVQSPRVYHRLIPNIVSYENWTVIDGDHIELSDERKHFLQDRGHELQAKAGGAIT  578

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P       G+  N   FHG+LTAVSDPRK G PAA+
Sbjct  579  QLIVQKLGNPIQMGRKSGKSSNGNVFHGILTAVSDPRKDGRPAAV  623



>ref|XP_006475362.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Citrus sinensis]
Length=577

 Score =   323 bits (827),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 181/226 (80%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDA+RNAVSMTTTVNY FG G++SPSTGIVLNNEMGDFS PTE  
Sbjct  352  RWSQLRDHGTSHFCIVDAERNAVSMTTTVNYPFGAGILSPSTGIVLNNEMGDFSIPTENP  411

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ KDNQLA VIGGSGG +II  V QVFLNH + G
Sbjct  412  PDMLPPTPANFIKPNKRPLSSMTPLIITKDNQLAGVIGGSGGLHIIPAVIQVFLNHFIFG  471

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            ++ L AVQ+PRVYHK+IPN V+YENWT++DG+HIEL+   + FLE+R HQL+ +  GAI 
Sbjct  472  IESLAAVQNPRVYHKVIPNVVMYENWTVIDGDHIELADETKLFLEERRHQLEGRAGGAIV  531

Query  541  QLLVQNLPKP-------GQWLNNG-TFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P        +++ N    HG+LTAVSDPRK G PAA+
Sbjct  532  QLIVQTLGNPINEAQKLRKYMGNAQVLHGILTAVSDPRKDGRPAAV  577



>ref|XP_008655642.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Zea mays]
 gb|AFW80066.1| hypothetical protein ZEAMMB73_199418 [Zea mays]
Length=469

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 176/218 (81%), Gaps = 0/218 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQL DHGTSH C+VD DRNAV+MTTTVN  FG  V+SPSTGIVLN+EM DFS P + +
Sbjct  252  KWSQLDDHGTSHLCVVDGDRNAVAMTTTVNAYFGAKVLSPSTGIVLNDEMDDFSVPAKRT  311

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD+LPP+PANFI+P KRPLSSMTP+++LKD +LA V+GGSGGTNIIATV QVF+NH ++G
Sbjct  312  PDRLPPAPANFIAPGKRPLSSMTPLIILKDGELAGVLGGSGGTNIIATVVQVFVNHFIVG  371

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AVQ PRVYHKLIPN V YEN T+ DGE I L G  R FLE+RGH+L++ +SGA+C
Sbjct  372  MDPLAAVQHPRVYHKLIPNVVTYENQTVGDGEVIALGGAARAFLEERGHRLRSTDSGAVC  431

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +V  L +P     +G F G LTAVSDPRKGGSPA +
Sbjct  432  QFIVHELAEPPAAPGHGVFRGRLTAVSDPRKGGSPAGL  469



>ref|XP_002457361.1| hypothetical protein SORBIDRAFT_03g006000 [Sorghum bicolor]
 gb|EES02481.1| hypothetical protein SORBIDRAFT_03g006000 [Sorghum bicolor]
Length=640

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 176/218 (81%), Gaps = 0/218 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W QL DHGTSH C+VD DRNAV+MTTTVNY FG  V+SPSTGIVLNNEM DFS P +++
Sbjct  423  KWKQLDDHGTSHLCVVDGDRNAVAMTTTVNYYFGAKVLSPSTGIVLNNEMDDFSVPAKLT  482

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI+P KRPLSSMTP+++LK+ QLA V+GGSGGTNIIATV QVFLNH V+G
Sbjct  483  PDHLPPAPANFIAPGKRPLSSMTPLIILKNGQLAGVLGGSGGTNIIATVTQVFLNHFVVG  542

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AVQ PRVYHKLIPN V YEN T+ DGE I LSG  R FLE+RGH L++  SGA+C
Sbjct  543  MDPLAAVQQPRVYHKLIPNVVTYENMTVADGEVIALSGAARAFLEERGHWLRSTVSGAVC  602

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +V  L +P    ++G F G LTAVSDPRKGGSPA +
Sbjct  603  QFIVHELAEPPATPDHGVFRGRLTAVSDPRKGGSPAGL  640



>gb|KDO55891.1| hypothetical protein CISIN_1g006865mg [Citrus sinensis]
Length=628

 Score =   322 bits (826),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 181/226 (80%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDA+RNAVSMTTTVNY FG G++SPSTGIVLNNEMGDFS PTE  
Sbjct  403  RWSQLRDHGTSHFCIVDAERNAVSMTTTVNYPFGAGILSPSTGIVLNNEMGDFSIPTENP  462

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ KDNQLA VIGGSGG +II  V QVFLNH + G
Sbjct  463  PDMLPPTPANFIKPNKRPLSSMTPLIITKDNQLAGVIGGSGGLHIIPAVIQVFLNHFIFG  522

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            ++ L AVQ+PRVYHK+IPN V+YENWT++DG+HIEL+   + FLE+R HQL+ +  GAI 
Sbjct  523  IESLAAVQNPRVYHKVIPNVVMYENWTVIDGDHIELADETKLFLEERRHQLEGRAGGAIV  582

Query  541  QLLVQNLPKP-------GQWLNNG-TFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P        +++ N    HG+LTAVSDPRK G PAA+
Sbjct  583  QLIVQTLGNPINEAQKLRKYMGNAQVLHGILTAVSDPRKDGRPAAV  628



>ref|XP_006451357.1| hypothetical protein CICLE_v10007745mg [Citrus clementina]
 gb|ESR64597.1| hypothetical protein CICLE_v10007745mg [Citrus clementina]
Length=628

 Score =   320 bits (820),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 181/226 (80%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDA+RNAVSMTTTVNY FG G++SPSTGIVLNNEMGDFS PTE  
Sbjct  403  RWSQLRDHGTSHFCIVDAERNAVSMTTTVNYPFGAGILSPSTGIVLNNEMGDFSIPTENP  462

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTP+++ KDNQLA VIGGSGG +II  V QVFLNH + G
Sbjct  463  PDMLPPTPANFIKPNKRPLSSMTPLIITKDNQLAGVIGGSGGLHIIPAVIQVFLNHFIFG  522

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            ++ L AVQ+PRVYHK+IPN V+YEN T++DG+HIEL+   + FLE+R HQL+A+  GAI 
Sbjct  523  IESLAAVQNPRVYHKVIPNVVMYENLTVIDGDHIELADETKLFLEERRHQLEARAGGAIV  582

Query  541  QLLVQNLPKP-------GQWLNNG-TFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P        +++ N    HG+LTAVSDPRK G PAA+
Sbjct  583  QLIVQTLGNPINEAQKLRKYMGNAQVLHGILTAVSDPRKDGRPAAV  628



>ref|XP_010920650.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Elaeis guineensis]
Length=630

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 176/227 (78%), Gaps = 9/227 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDA+RNAV+MT+TVN+ FG GV+SPSTGIVLNNEM DFS PTE +
Sbjct  404  RWSQLRDHGTSHFCIVDAERNAVAMTSTVNWYFGAGVLSPSTGIVLNNEMADFSTPTEST  463

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI P KRPLSSMTPI+VLKDNQLA V+G SGG  II  V +VF+NH +LG
Sbjct  464  PDHLPPAPANFIEPGKRPLSSMTPIIVLKDNQLAGVVGASGGMKIIPAVIEVFMNHFILG  523

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AVQ PRVYH+LIPN VLYENWT +DGE IE     + FLE RGH L++   GA+C
Sbjct  524  MEPLAAVQHPRVYHELIPNVVLYENWTAIDGEVIEFKEAAKVFLEQRGHHLRSVSGGAVC  583

Query  541  QLLVQNLPK--------PGQWLNN-GTFHGMLTAVSDPRKGGSPAAI  654
            QL+V +L K            +N+ G FHGMLTAVSDPRK G PA +
Sbjct  584  QLVVHDLQKSVLKQIGSKKVEINDVGVFHGMLTAVSDPRKDGRPAGL  630



>ref|XP_010688394.1| PREDICTED: gamma-glutamyltranspeptidase 3 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=536

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 175/226 (77%), Gaps = 9/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQL+DHGTSHFCIVDA+RNAVS+TTTVNY FGGGV+SPSTGIVLN+EM DFS PTEVS
Sbjct  312  RWSQLQDHGTSHFCIVDAERNAVSVTTTVNYPFGGGVLSPSTGIVLNDEMDDFSTPTEVS  371

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI P KRPLSSMTP+V+LKD+QLA VIGGSGG  II  V QVFLNH V G
Sbjct  372  PDNLPPAPANFIQPGKRPLSSMTPLVILKDDQLAGVIGGSGGMKIIPAVVQVFLNHFVQG  431

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AVQSPRVYH+LIPN V YEN T++DGEHIELS  R  FLE++GHQL+    GAIC
Sbjct  432  MDPLTAVQSPRVYHELIPNVVSYENVTVIDGEHIELSQERMAFLEEKGHQLKRIGIGAIC  491

Query  541  QLLVQNLPKPGQW--------LNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ                + N    G L AVSDPRK G PAAI
Sbjct  492  QLIVQTFENSADLGRKTRKNHIGNANI-GTLIAVSDPRKDGRPAAI  536



>ref|XP_006826821.1| hypothetical protein AMTR_s00010p00064690 [Amborella trichopoda]
 gb|ERM94058.1| hypothetical protein AMTR_s00010p00064690 [Amborella trichopoda]
Length=609

 Score =   316 bits (810),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 175/225 (78%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQLRDHGTSHFCIVDA+RNAVSMT+TVN  FGGG++S STGI+LNNEM DFS PTE++
Sbjct  385  QWSQLRDHGTSHFCIVDANRNAVSMTSTVNSPFGGGMVSQSTGILLNNEMDDFSTPTEMT  444

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI+PNKRPLSSM+P +VLKD QLA VIGGS G   I  V QVF+ H + G
Sbjct  445  PDHLPPAPANFIAPNKRPLSSMSPFIVLKDGQLAGVIGGSNGIFTIPAVVQVFIKHFIFG  504

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AVQ PRVYH+LIPN V YENWT++DGEH ELSG  + FLE RGH+LQA E+G IC
Sbjct  505  MDPLSAVQHPRVYHQLIPNEVSYENWTVLDGEHYELSGEAKLFLEKRGHELQAMENGGIC  564

Query  541  QLLVQNLPKPGQWL-------NNGTFHGMLTAVSDPRKGGSPAAI  654
            Q++V NL +P   +        N  FHGMLTAVSD RK G P+  
Sbjct  565  QMVVHNLRRPTTAMLKRRSVGRNRVFHGMLTAVSDARKDGFPSGF  609



>ref|XP_010688393.1| PREDICTED: gamma-glutamyltranspeptidase 3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=624

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 175/226 (77%), Gaps = 9/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQL+DHGTSHFCIVDA+RNAVS+TTTVNY FGGGV+SPSTGIVLN+EM DFS PTEVS
Sbjct  400  RWSQLQDHGTSHFCIVDAERNAVSVTTTVNYPFGGGVLSPSTGIVLNDEMDDFSTPTEVS  459

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI P KRPLSSMTP+V+LKD+QLA VIGGSGG  II  V QVFLNH V G
Sbjct  460  PDNLPPAPANFIQPGKRPLSSMTPLVILKDDQLAGVIGGSGGMKIIPAVVQVFLNHFVQG  519

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AVQSPRVYH+LIPN V YEN T++DGEHIELS  R  FLE++GHQL+    GAIC
Sbjct  520  MDPLTAVQSPRVYHELIPNVVSYENVTVIDGEHIELSQERMAFLEEKGHQLKRIGIGAIC  579

Query  541  QLLVQNLPKPGQW--------LNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ                + N    G L AVSDPRK G PAAI
Sbjct  580  QLIVQTFENSADLGRKTRKNHIGNANI-GTLIAVSDPRKDGRPAAI  624



>ref|XP_010040321.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Eucalyptus grandis]
Length=383

 Score =   307 bits (787),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/224 (67%), Positives = 177/224 (79%), Gaps = 7/224 (3%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            WSQL+ HGTSHF IVDA+RNAVSMTTTVNY FGGGV+SPSTGIVLNNEM DFS PTEVS 
Sbjct  160  WSQLKGHGTSHFGIVDAERNAVSMTTTVNYPFGGGVLSPSTGIVLNNEMADFSIPTEVSS  219

Query  184  DKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLGM  363
            D+LPP+PANFI PNKRPLSSMTP+++ KDNQLA VIGGSGG +II  V QVFLNH VLGM
Sbjct  220  DRLPPAPANFIKPNKRPLSSMTPLIITKDNQLAGVIGGSGGMDIIPAVTQVFLNHFVLGM  279

Query  364  DPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAICQ  543
            +P +AVQ PRVYH+LIPN V YEN+T ++G H EL+  R+ FL++RGH+L+A+  G I Q
Sbjct  280  EPSDAVQYPRVYHRLIPNVVHYENYTCINGNHNELADERKLFLKERGHKLEARAGGGIVQ  339

Query  544  LLVQNLPK-------PGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            L+V +L           +  N+G  HG LTAVSDPRK G PAA+
Sbjct  340  LVVHSLQSTLDSGHMSCEDFNSGVVHGTLTAVSDPRKDGRPAAV  383



>ref|XP_010086906.1| Gamma-glutamyltranspeptidase 1 [Morus notabilis]
 gb|EXB24697.1| Gamma-glutamyltranspeptidase 1 [Morus notabilis]
Length=625

 Score =   314 bits (805),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 179/224 (80%), Gaps = 7/224 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVD DRNAVSMT+TVNY FGGGV+SPSTGIVLNNEM DFS PTE++
Sbjct  401  RWSQLRDHGTSHFCIVDKDRNAVSMTSTVNYPFGGGVLSPSTGIVLNNEMDDFSTPTEIT  460

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSMTPI+V KDNQL  V+GGSGG NII  V Q+FLN+ VLG
Sbjct  461  PDTLPPAPANFIRPNKRPLSSMTPIIVTKDNQLLGVLGGSGGINIIPAVVQIFLNYFVLG  520

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
             DPL+AVQSPRVYHKLIPN V YENWT++DG HIELS G + FL++RGHQL+ +  GAI 
Sbjct  521  KDPLDAVQSPRVYHKLIPNIVSYENWTVIDGNHIELSEGTKLFLQERGHQLEGKAGGAIT  580

Query  541  QLLVQNLP-------KPGQWLNNGTFHGMLTAVSDPRKGGSPAA  651
            QL+VQN         K G+  N   F G L AVSDPRK G PAA
Sbjct  581  QLIVQNFENLIHMGRKSGKQANIQPFLGTLIAVSDPRKDGKPAA  624



>ref|XP_004968222.1| PREDICTED: gamma-glutamyltranspeptidase 3-like isoform X1 [Setaria 
italica]
 ref|XP_004968223.1| PREDICTED: gamma-glutamyltranspeptidase 3-like isoform X2 [Setaria 
italica]
 ref|XP_004968224.1| PREDICTED: gamma-glutamyltranspeptidase 3-like isoform X3 [Setaria 
italica]
Length=633

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 176/219 (80%), Gaps = 2/219 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPT-EV  177
            +W QL DHGTSH C+VD+DRNAV+MTTTVNY FGG V+SPSTGIVLNNEM DFS P  ++
Sbjct  416  KWRQLDDHGTSHLCVVDSDRNAVAMTTTVNYYFGGKVLSPSTGIVLNNEMDDFSVPAVKL  475

Query  178  SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            +PD LPP+PANFI+P KRPLSSMTP+++LK+ QLA V+GGSGGTNIIATV QVFLNH ++
Sbjct  476  APDHLPPAPANFIAPGKRPLSSMTPLIILKNGQLAGVVGGSGGTNIIATVTQVFLNHFIV  535

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            GMDPL AVQ PRVYHKLIPN V YE+ T +DGE I LS G + FLE RGH+L++ +SGA+
Sbjct  536  GMDPLAAVQQPRVYHKLIPNVVTYEDETAVDGEVIALSDGAKAFLEQRGHRLRSTDSGAV  595

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            CQ +V  L +P      G F G LTAVSDPRK GSPA +
Sbjct  596  CQFIVHQLAEP-PASGGGVFRGRLTAVSDPRKDGSPAGL  633



>ref|XP_008784503.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Phoenix dactylifera]
Length=630

 Score =   311 bits (797),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 173/227 (76%), Gaps = 9/227 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDA RNAV+MT+TVN+ FG  V+SPSTGIVLNNEM DFS PTE +
Sbjct  404  RWSQLRDHGTSHFCIVDAQRNAVAMTSTVNWYFGAKVLSPSTGIVLNNEMDDFSTPTEST  463

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI P KRPLSSMTPI+VLKDNQLA V+G SGG  II  V +VFLNH +LG
Sbjct  464  PDHLPPAPANFIEPGKRPLSSMTPIIVLKDNQLAGVVGASGGMKIIPAVTEVFLNHFILG  523

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AVQ PRVYH+LIPN VLYENWT +DGE IE     + FLE RGH LQ+   GA+ 
Sbjct  524  MEPLAAVQHPRVYHELIPNVVLYENWTAIDGELIEFKEEAKVFLEQRGHHLQSMSGGAVS  583

Query  541  QLLVQNLPKP--------GQWLNN-GTFHGMLTAVSDPRKGGSPAAI  654
            QL+V +L +            +N+ G FHGMLTAVSDPRK G PA +
Sbjct  584  QLVVHDLQESVLKQTGITKVEINDVGVFHGMLTAVSDPRKDGRPAGL  630



>ref|XP_010047649.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Eucalyptus grandis]
Length=621

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 177/225 (79%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQL+ HGTSHF IVDA+RNAVSMTTTVNY FGGGV+SPSTGIVLNNEM DFS PTEVS
Sbjct  397  KWSQLKGHGTSHFGIVDAERNAVSMTTTVNYPFGGGVLSPSTGIVLNNEMADFSIPTEVS  456

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D+LPP+PANFI PNKRPLSSMTP+++ KDNQLA VIGGSGG +II  V QVFLNH VLG
Sbjct  457  SDRLPPAPANFIQPNKRPLSSMTPLIITKDNQLAGVIGGSGGMDIIPAVTQVFLNHFVLG  516

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+P +AVQ PR+YH LIPN V YEN+T ++G HIEL+  R+ FL++RGH+L+A+  G I 
Sbjct  517  MEPSDAVQYPRLYHSLIPNVVHYENYTCINGNHIELADERKLFLKERGHKLEARAGGGIV  576

Query  541  QLLVQNLPK-------PGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+V +L           +  N+G  HG LTAVSDPRK   PAA+
Sbjct  577  QLVVHSLQSTLDSGHMSCEDFNSGVVHGTLTAVSDPRKDARPAAV  621



>ref|XP_009405839.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Musa acuminata 
subsp. malaccensis]
Length=629

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 175/228 (77%), Gaps = 10/228 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSH C+VD+DRNAVS+TTTVN+ FG  VMSPSTGIVLNNEM DFS PTE +
Sbjct  402  RWSQLRDHGTSHLCVVDSDRNAVSLTTTVNWYFGARVMSPSTGIVLNNEMDDFSTPTEAT  461

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD+LPP+PANFI P KRPLSSMTPI++LKD+QLA V+G SGG NII  V QVFLNH +L 
Sbjct  462  PDRLPPAPANFIEPKKRPLSSMTPIIILKDDQLAGVVGASGGVNIIPAVVQVFLNHFILR  521

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL+AVQ PRV+H LIPN VLYEN+T +DGEHIE +   + FLE RGH L++   GA+ 
Sbjct  522  MEPLKAVQHPRVFHTLIPNEVLYENFTAIDGEHIEFANEAKLFLEQRGHVLRSLSLGAVS  581

Query  541  QLLVQNL--------PKPGQWLNN--GTFHGMLTAVSDPRKGGSPAAI  654
            QL+V NL         K  +   N  G FHG L AVSDPRK GSPAA+
Sbjct  582  QLVVHNLHERVPNMQRKTDRKAKNGGGVFHGRLIAVSDPRKDGSPAAL  629



>gb|KDP33767.1| hypothetical protein JCGZ_07338 [Jatropha curcas]
Length=632

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 184/226 (81%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFCIVD +RNAVSMTTTVNY FG GV+SPSTGIVLN+EMGDFSAPTE +
Sbjct  407  RWSQLRDQGTSHFCIVDGERNAVSMTTTVNYGFGAGVLSPSTGIVLNDEMGDFSAPTEAT  466

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI  +KRPLSSMTP++V KDNQL  V+GGSGG +II  VAQVF+N  VLG
Sbjct  467  PDMLPPAPANFIESSKRPLSSMTPLIVTKDNQLVGVLGGSGGMDIIPAVAQVFINRFVLG  526

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AVQ+PRVYHKLIP+TV+YENWT++DG+HIEL+   ++FLE++GHQL+ +  GAI 
Sbjct  527  MDPLTAVQNPRVYHKLIPDTVMYENWTVIDGDHIELAEETKKFLEEKGHQLEGKAGGAIV  586

Query  541  QLLVQNLPKP-------GQWLNN-GTFHGMLTAVSDPRKGGSPAAI  654
            QL++QNL K        G+ LN     +G LTAVSDPRK G PAA+
Sbjct  587  QLVIQNLQKTVNMGRKNGRELNEPRILYGKLTAVSDPRKDGRPAAV  632



>gb|KCW79596.1| hypothetical protein EUGRSUZ_C00955 [Eucalyptus grandis]
Length=693

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 177/225 (79%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQL+ HGTSHF IVDA+RNAVSMTTTVNY FGGGV+SPSTGIVLNNEM DFS PTEVS
Sbjct  469  KWSQLKGHGTSHFGIVDAERNAVSMTTTVNYPFGGGVLSPSTGIVLNNEMADFSIPTEVS  528

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D+LPP+PANFI PNKRPLSSMTP+++ KDNQLA VIGGSGG +II  V QVFLNH VLG
Sbjct  529  SDRLPPAPANFIQPNKRPLSSMTPLIITKDNQLAGVIGGSGGMDIIPAVTQVFLNHFVLG  588

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+P +AVQ PR+YH LIPN V YEN+T ++G HIEL+  R+ FL++RGH+L+A+  G I 
Sbjct  589  MEPSDAVQYPRLYHSLIPNVVHYENYTCINGNHIELADERKLFLKERGHKLEARAGGGIV  648

Query  541  QLLVQNLPK-------PGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+V +L           +  N+G  HG LTAVSDPRK   PAA+
Sbjct  649  QLVVHSLQSTLDSGHMSCEDFNSGVVHGTLTAVSDPRKDARPAAV  693



>gb|EMS51044.1| Gamma-glutamyltranspeptidase 1 [Triticum urartu]
Length=463

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            +WSQLRD+GTSH C+VD DRNAV+MTTTVNY FG  V+SPSTGIVLNNEM DFS P+   
Sbjct  245  KWSQLRDNGTSHLCVVDGDRNAVAMTTTVNYYFGAQVLSPSTGIVLNNEMDDFSVPSSYP  304

Query  178  SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            +PD LPP+PANFI+  KRPLSSMTP ++LKD QLA V+G SGGTNIIA V QVFLNH VL
Sbjct  305  TPDHLPPAPANFIAGGKRPLSSMTPTIILKDGQLAGVVGASGGTNIIAAVTQVFLNHFVL  364

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            GM+PL AVQSPRVYH L+PN V YE+ T++DGE IEL    R FL  RGH L+     A+
Sbjct  365  GMNPLAAVQSPRVYHSLVPNVVRYEDETVVDGEVIELKAEAREFLRRRGHVLKGTVWSAV  424

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            CQ++VQ+L  P    +   FHGMLTAVSDPRK GSPA +
Sbjct  425  CQMIVQDLQAPVSSGSENVFHGMLTAVSDPRKDGSPAGV  463



>ref|XP_010540998.1| PREDICTED: gamma-glutamyltranspeptidase 3 isoform X3 [Tarenaya 
hassleriana]
Length=514

 Score =   300 bits (769),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/227 (64%), Positives = 174/227 (77%), Gaps = 9/227 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+QLRDHGTSHF IVD+DRN VSMTT+VNYVFG G +SPSTGI+LNNEM DFS PTE +
Sbjct  288  RWNQLRDHGTSHFSIVDSDRNTVSMTTSVNYVFGSGFLSPSTGIILNNEMDDFSVPTEKT  347

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI PNKRPLSSMTP+V+ KD QL A +GGSGG NII  V QVFLN  VLG
Sbjct  348  PDKLPPAPANFIEPNKRPLSSMTPLVITKDGQLVAALGGSGGMNIIPAVVQVFLNCFVLG  407

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M P +AVQS RVYH+LIPN V YE+ T+++G+HIEL+   + FLE+RGH+L+   +GAI 
Sbjct  408  MKPRDAVQSSRVYHRLIPNVVKYEDLTVINGDHIELAEDSKMFLEERGHELENIAAGAIV  467

Query  541  QLLVQNLP--------KPGQWLNNGT-FHGMLTAVSDPRKGGSPAAI  654
            QL+VQ+          K G+    G    G+LTAVSDPRK G PAA+
Sbjct  468  QLVVQSFEEEHIDRGRKDGKDSKKGNLLKGILTAVSDPRKDGKPAAV  514



>gb|EMS68109.1| Gamma-glutamyltranspeptidase 1 [Triticum urartu]
Length=473

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 167/223 (75%), Gaps = 5/223 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTE-V  177
            +WSQLRD+GTSH C+VD DRNAV+MTTTVNY FG  V+SPSTGIVLNNEM DFS P+   
Sbjct  251  KWSQLRDNGTSHLCVVDGDRNAVAMTTTVNYYFGAHVLSPSTGIVLNNEMDDFSVPSSNP  310

Query  178  SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            +PDKLPP+PANFI+P KRPLSSMTP ++LKD QLA V+G SGGTNII  V QVFLNH V+
Sbjct  311  TPDKLPPAPANFIAPGKRPLSSMTPAIILKDGQLAGVVGASGGTNIITAVTQVFLNHFVV  370

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            GM PL AVQSPRVYHKL+PN V YE+ T  DGE IE S     FL  RGH L++   GA+
Sbjct  371  GMSPLAAVQSPRVYHKLVPNVVRYEDATTADGEVIEFSTEAMEFLRRRGHVLESTSPGAV  430

Query  538  CQLLVQNLPKP----GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            CQL+VQ+L  P            F GMLTAVSDPRK GSPA +
Sbjct  431  CQLIVQDLLAPVSGGSGGGGENVFRGMLTAVSDPRKDGSPAGL  473



>ref|XP_006583561.1| PREDICTED: gamma-glutamyltranspeptidase 3-like isoform X2 [Glycine 
max]
Length=475

 Score =   297 bits (760),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 176/225 (78%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQL DHGTSH CIVDADRNAVS+TTTVNY FG G  S STGI++NNEM DFS PT++S
Sbjct  251  RWSQLSDHGTSHMCIVDADRNAVSLTTTVNYHFGAGFRSTSTGILVNNEMDDFSTPTDIS  310

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI PNKRPLSSMTP++V KD+QL  V+GGSGG NIIA V QVFLNH +LG
Sbjct  311  PDKLPPAPANFIEPNKRPLSSMTPLIVTKDDQLVGVLGGSGGMNIIAAVVQVFLNHFILG  370

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PL+AV SPR+YHKLIPN V YEN T  +G+HIELS   R FLE+RGHQL+  E+ A+ 
Sbjct  371  MKPLDAVVSPRIYHKLIPNVVRYENLTAHNGDHIELSKESRLFLEERGHQLRGSEALAVT  430

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P       G+   + T HG LTAVSDPRKGG PAA+
Sbjct  431  QLIVQTLKTPMNFNRKVGENTKSLTKHGTLTAVSDPRKGGCPAAV  475



>ref|XP_009404606.1| PREDICTED: putative inactive gamma-glutamyltranspeptidase 4 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=278

 Score =   290 bits (741),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 167/229 (73%), Gaps = 11/229 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSH CIVD DRNAVS+TTTVN  FG  V+S STGI+LNNEM DFS PTE +
Sbjct  50   RWSQLRDHGTSHLCIVDTDRNAVSLTTTVNSYFGARVLSSSTGILLNNEMDDFSTPTEAT  109

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSM PI+VLKDNQLA V+G SGG NII  V QVFLNH VLG
Sbjct  110  PDHLPPAPANFIEPNKRPLSSMAPIIVLKDNQLAGVVGASGGLNIIPAVVQVFLNHFVLG  169

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGH-QLQAQESGAI  537
            M+PL AV+ PRV+HKLIPN VLYEN+T +DGE IE     + FLE RGH       + A+
Sbjct  170  MEPLAAVRHPRVFHKLIPNKVLYENFTAIDGEKIEFGEEAKLFLEQRGHIVSSLSSAAAV  229

Query  538  CQLLVQNLPKP--------GQWLNNGT--FHGMLTAVSDPRKGGSPAAI  654
             QL+V NL  P         + + NG   FHG L A+SDPRK GSPA +
Sbjct  230  SQLVVHNLQVPILSTHRKDNRKVKNGNNIFHGKLIAISDPRKDGSPAGL  278



>ref|XP_010540996.1| PREDICTED: gamma-glutamyltranspeptidase 3 isoform X1 [Tarenaya 
hassleriana]
Length=627

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/227 (64%), Positives = 174/227 (77%), Gaps = 9/227 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+QLRDHGTSHF IVD+DRN VSMTT+VNYVFG G +SPSTGI+LNNEM DFS PTE +
Sbjct  401  RWNQLRDHGTSHFSIVDSDRNTVSMTTSVNYVFGSGFLSPSTGIILNNEMDDFSVPTEKT  460

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI PNKRPLSSMTP+V+ KD QL A +GGSGG NII  V QVFLN  VLG
Sbjct  461  PDKLPPAPANFIEPNKRPLSSMTPLVITKDGQLVAALGGSGGMNIIPAVVQVFLNCFVLG  520

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M P +AVQS RVYH+LIPN V YE+ T+++G+HIEL+   + FLE+RGH+L+   +GAI 
Sbjct  521  MKPRDAVQSSRVYHRLIPNVVKYEDLTVINGDHIELAEDSKMFLEERGHELENIAAGAIV  580

Query  541  QLLVQNLP--------KPGQWLNNGT-FHGMLTAVSDPRKGGSPAAI  654
            QL+VQ+          K G+    G    G+LTAVSDPRK G PAA+
Sbjct  581  QLVVQSFEEEHIDRGRKDGKDSKKGNLLKGILTAVSDPRKDGKPAAV  627



>ref|XP_002514187.1| gamma glutamyl transpeptidases, putative [Ricinus communis]
 gb|EEF48141.1| gamma glutamyl transpeptidases, putative [Ricinus communis]
Length=631

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 180/226 (80%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDA+RNAVSMTTTVNY FG G++SPSTGIVLNNEMGDFS PTE++
Sbjct  406  RWSQLRDHGTSHFCIVDAERNAVSMTTTVNYPFGAGLLSPSTGIVLNNEMGDFSVPTEIT  465

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+P+NFI  NKRPLSSMTPIVV KD+Q+  V+GGSGG +II  VAQVF+NH VLG
Sbjct  466  PDVLPPAPSNFIESNKRPLSSMTPIVVTKDDQVVGVLGGSGGMDIIPAVAQVFINHFVLG  525

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            ++PL AV+ PR+YH+LIPN V YENWT++DG+HIEL+   + FL++RGH+L+A+  GAI 
Sbjct  526  LEPLIAVEKPRIYHRLIPNIVKYENWTVIDGDHIELAEETKLFLKERGHELEAKAGGAIV  585

Query  541  QLLVQNLPKPGQW--------LNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P +          N     G LTAVSDPRK G PAA+
Sbjct  586  QLVVQTLQNPIKIGRKSERDSQNAQILRGELTAVSDPRKDGRPAAV  631



>ref|XP_006412862.1| hypothetical protein EUTSA_v10024658mg [Eutrema salsugineum]
 gb|ESQ54315.1| hypothetical protein EUTSA_v10024658mg [Eutrema salsugineum]
Length=639

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 173/232 (75%), Gaps = 14/232 (6%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFCIVDADRN VSMTTTVNYVFG GV+SPSTGIVLNNEM DFS P E++
Sbjct  408  RWSQLRDQGTSHFCIVDADRNTVSMTTTVNYVFGAGVLSPSTGIVLNNEMDDFSVPAEIT  467

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+P NFI P KRPLSSMTP+V+ KD +  A +GGSGG NII  V QVFLN  VL 
Sbjct  468  PDKLPPAPTNFIEPKKRPLSSMTPLVITKDGEFVAALGGSGGMNIIPAVIQVFLNCFVLK  527

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PLEAV+S RVYHKLIPN V YEN+T ++G+HI ++   + FL +RGH+L+ Q  GAI 
Sbjct  528  MKPLEAVESARVYHKLIPNVVRYENFTAINGDHIGVTEDSKMFLAERGHELEEQSGGAIV  587

Query  541  QLLVQNLP-KPGQWLN-------------NGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ+   + G+ +N             +  F G+LTAVSDPRK G PAA+
Sbjct  588  QLVVQSFKEEEGEVINEIGRRIGKDSFKKSKPFKGLLTAVSDPRKDGKPAAV  639



>ref|XP_003565342.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Brachypodium distachyon]
Length=625

 Score =   300 bits (767),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 173/222 (78%), Gaps = 7/222 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPT-EV  177
            +WSQL DHGTSH C+VD DRNAV+MTTTVNY FG  V+SPSTGIVLNNEM DFS P+   
Sbjct  407  KWSQLDDHGTSHLCVVDGDRNAVAMTTTVNYYFGAKVLSPSTGIVLNNEMDDFSVPSNHP  466

Query  178  SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            +PD LPP+PANFI+P KRPLSSMTP ++LKD QLA V+G SGGTNIIATV QVFLNH V+
Sbjct  467  TPDHLPPAPANFIAPGKRPLSSMTPAIILKDGQLAGVVGASGGTNIIATVTQVFLNHFVV  526

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMD-GEHIELSGGRRRFLEDRGHQLQAQESGA  534
            G+ PL +VQ  RVYHKL+PN V YE+  + D GE IELSG  R FL  RGHQL++  SGA
Sbjct  527  GLGPLASVQRARVYHKLVPNVVKYEDEIVADGGEVIELSGEARAFLRMRGHQLESTASGA  586

Query  535  ICQLLVQNLPK--PGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            +CQL+VQ LP+  P +      + GMLTAVSDPRKGGSPA +
Sbjct  587  VCQLIVQELPESVPEEI---KVYRGMLTAVSDPRKGGSPAGL  625



>gb|KFK29480.1| hypothetical protein AALP_AA7G139500 [Arabis alpina]
Length=641

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 170/233 (73%), Gaps = 15/233 (6%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFCIVDADRN VSMTTTVN+VFG GV+SPSTGIVLNNEM DFS PTE++
Sbjct  409  RWSQLRDQGTSHFCIVDADRNTVSMTTTVNFVFGAGVLSPSTGIVLNNEMDDFSVPTEIT  468

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+P NFI PNKRPLSSMTP+V+ KD QL A +GGSGG NII  V QVFLN  VL 
Sbjct  469  PDNLPPAPTNFIVPNKRPLSSMTPLVITKDGQLVAALGGSGGMNIIPAVIQVFLNFFVLK  528

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PLEAV+SPRVYH L+PN V YEN+T ++G+HI  +   + FLE RGH+++    GAI 
Sbjct  529  MKPLEAVESPRVYHMLMPNVVRYENFTAINGDHIGFTEDSKMFLEQRGHEVKEISGGAIV  588

Query  541  QLLVQNLP-------------KPGQWLNNGT--FHGMLTAVSDPRKGGSPAAI  654
            QL+VQN               K G+        F G+LTAVSDPRK G PAA+
Sbjct  589  QLIVQNFKEEKDEEMIIEIARKIGKVYTKKAKQFKGLLTAVSDPRKDGKPAAV  641



>dbj|BAJ94053.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   300 bits (767),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 169/223 (76%), Gaps = 5/223 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            +WSQLRD+GTSH C+VD DRNAV+MTTTVN  FG  V+SPSTG+VLNNEM DFS P+   
Sbjct  432  KWSQLRDNGTSHLCVVDGDRNAVAMTTTVNSYFGAHVLSPSTGVVLNNEMDDFSVPSSSP  491

Query  178  SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            +PDKLPP+PANFI+P KRPLSSMTP ++LKD QLA V+G SGGTNII  V QVFLNH VL
Sbjct  492  TPDKLPPAPANFIAPGKRPLSSMTPTIILKDGQLAGVVGASGGTNIITAVMQVFLNHFVL  551

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            GM PL AVQSPRVYHKL+PN V YE+  + DGE IE S     FL  RGH L++   GA+
Sbjct  552  GMSPLAAVQSPRVYHKLVPNVVRYEDDMMADGEVIEFSTEAMEFLRARGHVLESTLPGAV  611

Query  538  CQLLVQNLPKP----GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            CQL+VQ+L  P    G       FHGMLTAVSDPRKGGSPA +
Sbjct  612  CQLIVQDLLAPVSRGGDDGGGNVFHGMLTAVSDPRKGGSPAGV  654



>dbj|BAJ97185.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=655

 Score =   300 bits (767),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 169/223 (76%), Gaps = 5/223 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            +WSQLRD+GTSH C+VD DRNAV+MTTTVN  FG  V+SPSTG+VLNNEM DFS P+   
Sbjct  433  KWSQLRDNGTSHLCVVDGDRNAVAMTTTVNSYFGAHVLSPSTGVVLNNEMDDFSVPSSSP  492

Query  178  SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            +PDKLPP+PANFI+P KRPLSSMTP ++LKD QLA V+G SGGTNII  V QVFLNH VL
Sbjct  493  TPDKLPPAPANFIAPGKRPLSSMTPTIILKDGQLAGVVGASGGTNIITAVMQVFLNHFVL  552

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            GM PL AVQSPRVYHKL+PN V YE+  + DGE IE S     FL  RGH L++   GA+
Sbjct  553  GMSPLAAVQSPRVYHKLVPNVVRYEDDMMADGEVIEFSTEAMEFLRARGHVLESTLPGAV  612

Query  538  CQLLVQNLPKP----GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            CQL+VQ+L  P    G       FHGMLTAVSDPRKGGSPA +
Sbjct  613  CQLIVQDLLAPVSRGGDDGGGNVFHGMLTAVSDPRKGGSPAGV  655



>dbj|BAJ97288.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=664

 Score =   300 bits (767),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 169/223 (76%), Gaps = 5/223 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            +WSQLRD+GTSH C+VD DRNAV+MTTTVN  FG  V+SPSTG+VLNNEM DFS P+   
Sbjct  442  KWSQLRDNGTSHLCVVDGDRNAVAMTTTVNSYFGAHVLSPSTGVVLNNEMDDFSVPSSSP  501

Query  178  SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            +PDKLPP+PANFI+P KRPLSSMTP ++LKD QLA V+G SGGTNII  V QVFLNH VL
Sbjct  502  TPDKLPPAPANFIAPGKRPLSSMTPTIILKDGQLAGVVGASGGTNIITAVMQVFLNHFVL  561

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            GM PL AVQSPRVYHKL+PN V YE+  + DGE IE S     FL  RGH L++   GA+
Sbjct  562  GMSPLAAVQSPRVYHKLVPNVVRYEDDMMADGEVIEFSTEAMEFLRARGHVLESTLPGAV  621

Query  538  CQLLVQNLPKP----GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            CQL+VQ+L  P    G       FHGMLTAVSDPRKGGSPA +
Sbjct  622  CQLIVQDLLAPVSRGGDDGGGNVFHGMLTAVSDPRKGGSPAGV  664



>dbj|BAJ95633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=655

 Score =   299 bits (766),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 169/223 (76%), Gaps = 5/223 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            +WSQLRD+GTSH C+VD DRNAV+MTTTVN  FG  V+SPSTG+VLNNEM DFS P+   
Sbjct  433  KWSQLRDNGTSHLCVVDGDRNAVAMTTTVNSYFGAHVLSPSTGVVLNNEMDDFSVPSSSP  492

Query  178  SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            +PDKLPP+PANFI+P KRPLSSMTP ++LKD QLA V+G SGGTNII  V QVFLNH VL
Sbjct  493  TPDKLPPAPANFIAPGKRPLSSMTPTIILKDGQLAGVVGASGGTNIITAVMQVFLNHFVL  552

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            GM PL AVQSPRVYHKL+PN V YE+  + DGE IE S     FL  RGH L++   GA+
Sbjct  553  GMSPLAAVQSPRVYHKLVPNVVRYEDDMMADGEVIEFSTEAMEFLRARGHVLESTLPGAV  612

Query  538  CQLLVQNLPKP----GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            CQL+VQ+L  P    G       FHGMLTAVSDPRKGGSPA +
Sbjct  613  CQLIVQDLLAPVSRGGDDGGGNVFHGMLTAVSDPRKGGSPAGV  655



>ref|XP_007152947.1| hypothetical protein PHAVU_004G173700g [Phaseolus vulgaris]
 ref|XP_007152948.1| hypothetical protein PHAVU_004G173700g [Phaseolus vulgaris]
 gb|ESW24941.1| hypothetical protein PHAVU_004G173700g [Phaseolus vulgaris]
 gb|ESW24942.1| hypothetical protein PHAVU_004G173700g [Phaseolus vulgaris]
Length=566

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 177/225 (79%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSH CIVDADRNAVS+T+TVNY FG G  S STGI++NNEM DFSAPTE++
Sbjct  342  RWSQLRDHGTSHMCIVDADRNAVSLTSTVNYHFGAGFRSVSTGILVNNEMDDFSAPTEIT  401

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI PNKRPLSSMTP+++ KD++L  V+GGSGG NI   V Q+F+NH +LG
Sbjct  402  PDKLPPAPANFIEPNKRPLSSMTPLIITKDDELVGVLGGSGGMNIAPAVIQIFINHFILG  461

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PL+AV SPR+YHKLIPN V YEN T ++G+HI+ S  RR FLE+RGHQL   E+ A+ 
Sbjct  462  MKPLDAVMSPRIYHKLIPNVVRYENLTALNGDHIQFSKERRIFLEERGHQLSECEALAVT  521

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQNL  P       G+ +N  + HG L AVSDPRKGG PAA+
Sbjct  522  QLVVQNLKTPVKMNRKIGKNINLQSKHGTLIAVSDPRKGGCPAAV  566



>ref|XP_003529066.1| PREDICTED: gamma-glutamyltranspeptidase 3-like isoform X1 [Glycine 
max]
 gb|KHN40362.1| Gamma-glutamyltranspeptidase 1 [Glycine soja]
Length=618

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 176/225 (78%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQL DHGTSH CIVDADRNAVS+TTTVNY FG G  S STGI++NNEM DFS PT++S
Sbjct  394  RWSQLSDHGTSHMCIVDADRNAVSLTTTVNYHFGAGFRSTSTGILVNNEMDDFSTPTDIS  453

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI PNKRPLSSMTP++V KD+QL  V+GGSGG NIIA V QVFLNH +LG
Sbjct  454  PDKLPPAPANFIEPNKRPLSSMTPLIVTKDDQLVGVLGGSGGMNIIAAVVQVFLNHFILG  513

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PL+AV SPR+YHKLIPN V YEN T  +G+HIELS   R FLE+RGHQL+  E+ A+ 
Sbjct  514  MKPLDAVVSPRIYHKLIPNVVRYENLTAHNGDHIELSKESRLFLEERGHQLRGSEALAVT  573

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P       G+   + T HG LTAVSDPRKGG PAA+
Sbjct  574  QLIVQTLKTPMNFNRKVGENTKSLTKHGTLTAVSDPRKGGCPAAV  618



>ref|XP_004513075.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Cicer arietinum]
Length=615

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 173/225 (77%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQ+RDHGTSH C+VDADRNAVS+TT+VN  FG G+ S STGIV+N+EM DFS PT++S
Sbjct  391  RWSQVRDHGTSHLCVVDADRNAVSLTTSVNRHFGAGIRSTSTGIVINDEMDDFSIPTDIS  450

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            P+KLPP+P NFI PNKRPLSSMTPI++ KD+QLA V+GGSGG NII+ V QVFLNH +LG
Sbjct  451  PEKLPPAPTNFIEPNKRPLSSMTPIIITKDDQLAGVLGGSGGMNIISAVTQVFLNHFILG  510

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PL+AV  PRVY KLIP+ V YEN T  DG+HIE+S   R FL +RGHQL A ++ AI 
Sbjct  511  MKPLDAVLRPRVYTKLIPDCVCYENLTTHDGDHIEVSKESRLFLNERGHQLNASQALAIT  570

Query  541  QLLVQ--NLP-----KPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+V    +P     K G+  N+   HG L AVSDPRKGG PAA+
Sbjct  571  QLIVHTPKIPININRKIGEDTNSYVKHGTLIAVSDPRKGGCPAAV  615



>emb|CDY30226.1| BnaA03g49440D [Brassica napus]
Length=629

 Score =   297 bits (760),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 173/225 (77%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHF IVD+DRNAVSMTTTVN+VFG GV+SPSTGIVLNNEMGDFS PTE +
Sbjct  405  RWSQLRDQGTSHFSIVDSDRNAVSMTTTVNFVFGAGVLSPSTGIVLNNEMGDFSVPTENT  464

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+P NFI PNKRPLSSMTP+V+ KD +L A +GGSGG  II  V QVFLN  VL 
Sbjct  465  PDDLPPAPTNFIEPNKRPLSSMTPLVITKDGELVATLGGSGGMKIIPAVIQVFLNCFVLK  524

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PLEAV+S RVYHKLIPN V YEN+T ++G+HI ++   + FL +RGH+L+    GAI 
Sbjct  525  MKPLEAVESARVYHKLIPNVVQYENFTAINGDHIGVTKNSKMFLAERGHELEEVSGGAIV  584

Query  541  QLLVQ-NLPKPGQWLNNGT------FHGMLTAVSDPRKGGSPAAI  654
            QL+VQ N+ + G+ L   +      F G+LTAVSDPRK G PAA+
Sbjct  585  QLIVQKNIIELGRKLGKDSTKRLKPFKGLLTAVSDPRKDGKPAAV  629



>ref|XP_008459118.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Cucumis melo]
 ref|XP_008459126.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Cucumis melo]
Length=621

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 172/226 (76%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDA+RNAVS+TTTVN   G G++SPSTGIVLNNEMGDFS PT +S
Sbjct  396  RWSQLRDHGTSHFCIVDAERNAVSLTTTVNGHLGAGILSPSTGIVLNNEMGDFSTPTNIS  455

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+P NF+ PNKRPLSSMTPI+V KD++L AV+GGSGG  I+  V QVFLN+  LG
Sbjct  456  PDKLPPAPTNFVQPNKRPLSSMTPIIVTKDDRLIAVMGGSGGMKILPAVIQVFLNYFSLG  515

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQE-SGAI  537
              P  AV+  RVYH+LIPN V YEN T ++G+H+E S   ++FLEDRGHQ+ A + +GAI
Sbjct  516  FQPFSAVERSRVYHQLIPNVVKYENLTCINGDHVEFSAKEKQFLEDRGHQVVAMDAAGAI  575

Query  538  CQLLVQNLP-------KPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
             QL+VQN         K G+  NN    G+LTAV DPRK G+PA +
Sbjct  576  VQLVVQNFEDAIDIGRKGGKISNNQQDFGLLTAVCDPRKNGNPAVV  621



>ref|XP_007152946.1| hypothetical protein PHAVU_004G173700g [Phaseolus vulgaris]
 gb|ESW24940.1| hypothetical protein PHAVU_004G173700g [Phaseolus vulgaris]
Length=620

 Score =   296 bits (757),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 177/225 (79%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSH CIVDADRNAVS+T+TVNY FG G  S STGI++NNEM DFSAPTE++
Sbjct  396  RWSQLRDHGTSHMCIVDADRNAVSLTSTVNYHFGAGFRSVSTGILVNNEMDDFSAPTEIT  455

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI PNKRPLSSMTP+++ KD++L  V+GGSGG NI   V Q+F+NH +LG
Sbjct  456  PDKLPPAPANFIEPNKRPLSSMTPLIITKDDELVGVLGGSGGMNIAPAVIQIFINHFILG  515

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PL+AV SPR+YHKLIPN V YEN T ++G+HI+ S  RR FLE+RGHQL   E+ A+ 
Sbjct  516  MKPLDAVMSPRIYHKLIPNVVRYENLTALNGDHIQFSKERRIFLEERGHQLSECEALAVT  575

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQNL  P       G+ +N  + HG L AVSDPRKGG PAA+
Sbjct  576  QLVVQNLKTPVKMNRKIGKNINLQSKHGTLIAVSDPRKGGCPAAV  620



>gb|ACJ61473.1| gamma-glutamyl transferase [Glycine max]
Length=578

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 175/225 (78%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSH CIVDADRNAVS+TTTVN  FG G  S STGI++NNEM DFS PT++S
Sbjct  354  RWSQLRDHGTSHMCIVDADRNAVSLTTTVNNHFGAGFRSTSTGILVNNEMDDFSTPTDIS  413

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI PNKRPLSSMTP+++ KD+QL  V+GGSGG NIIA V QVFLNH +LG
Sbjct  414  PDKLPPAPANFIEPNKRPLSSMTPLIITKDDQLVGVLGGSGGMNIIAAVVQVFLNHFILG  473

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PL+AV SPR+YHKL+PN V YEN T  +G+HIELS   R FLE+RGHQL   E+ A+ 
Sbjct  474  MKPLDAVVSPRIYHKLMPNVVRYENLTAHNGDHIELSKESRLFLEERGHQLSGSEALAVT  533

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P       G+   + T HG LTAVSDPRKGG PAA+
Sbjct  534  QLIVQTLKTPMNMNRKVGENTKSLTKHGTLTAVSDPRKGGCPAAV  578



>ref|XP_009137839.1| PREDICTED: gamma-glutamyltranspeptidase 3-like isoform X2 [Brassica 
rapa]
Length=637

 Score =   294 bits (753),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 173/233 (74%), Gaps = 15/233 (6%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHF IVD+DRNAVSMTTTVN+VFG GV+SPSTGIVLNNEMGDFS PTE +
Sbjct  405  RWSQLRDQGTSHFSIVDSDRNAVSMTTTVNFVFGAGVLSPSTGIVLNNEMGDFSVPTENT  464

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+P NFI PNKRPLSSMTP+V+ KD +L A +GGSGG  II  V QVFLN  VL 
Sbjct  465  PDDLPPAPTNFIEPNKRPLSSMTPLVITKDGELVATLGGSGGMKIIPAVIQVFLNCFVLK  524

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PLEAV+S RVYHKLIPN V YEN+T ++G+HI ++   + FL +RGH+L+    GAI 
Sbjct  525  MKPLEAVESARVYHKLIPNVVQYENFTAINGDHIGVTKNSKMFLAERGHELEEVSGGAIV  584

Query  541  QLLVQ---------NLPKPGQWLNNGT------FHGMLTAVSDPRKGGSPAAI  654
            QL+VQ         N+ + G+ L   +      F G+LTAVSDPRK G PAA+
Sbjct  585  QLIVQSFEEGEDKENIIELGRKLGKDSTKRLKPFKGLLTAVSDPRKDGKPAAV  637



>gb|KHN03219.1| Gamma-glutamyltranspeptidase 1 [Glycine soja]
Length=626

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 175/225 (78%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSH CIVDADRNAVS+TTTVN  FG G  S STGI++NNEM DFS PT++S
Sbjct  402  RWSQLRDHGTSHMCIVDADRNAVSLTTTVNNHFGAGFRSTSTGILVNNEMDDFSTPTDIS  461

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI PNKRPLSSMTP+++ KD+QL  V+GGSGG NIIA V QVFLNH +LG
Sbjct  462  PDKLPPAPANFIEPNKRPLSSMTPLIITKDDQLVGVLGGSGGMNIIAAVVQVFLNHFILG  521

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PL+AV SPR+YHKL+PN V YEN T  +G+HIELS   R FLE+RGHQL   E+ A+ 
Sbjct  522  MKPLDAVVSPRIYHKLMPNVVRYENLTAHNGDHIELSKESRLFLEERGHQLSGSEALAVT  581

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P       G+   + T HG LTAVSDPRKGG PAA+
Sbjct  582  QLIVQTLKTPMNMNRKVGENTKSLTKHGTLTAVSDPRKGGCPAAV  626



>ref|XP_003516303.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Glycine max]
Length=626

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 175/225 (78%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSH CIVDADRNAVS+TTTVN  FG G  S STGI++NNEM DFS PT++S
Sbjct  402  RWSQLRDHGTSHMCIVDADRNAVSLTTTVNNHFGAGFRSTSTGILVNNEMDDFSTPTDIS  461

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI PNKRPLSSMTP+++ KD+QL  V+GGSGG NIIA V QVFLNH +LG
Sbjct  462  PDKLPPAPANFIEPNKRPLSSMTPLIITKDDQLVGVLGGSGGMNIIAAVVQVFLNHFILG  521

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PL+AV SPR+YHKL+PN V YEN T  +G+HIELS   R FLE+RGHQL   E+ A+ 
Sbjct  522  MKPLDAVVSPRIYHKLMPNVVRYENLTAHNGDHIELSKESRLFLEERGHQLSGSEALAVT  581

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ L  P       G+   + T HG LTAVSDPRKGG PAA+
Sbjct  582  QLIVQTLKTPMNMNRKVGENTKSLTKHGTLTAVSDPRKGGCPAAV  626



>emb|CDY06830.1| BnaC01g09290D [Brassica napus]
Length=632

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 174/234 (74%), Gaps = 25/234 (11%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFCIVD DRN+VS+T+TVNY FGGGV+SPSTGI+LNNEM DFS P E++
Sbjct  408  RWSQLRDQGTSHFCIVDGDRNSVSLTSTVNYPFGGGVLSPSTGILLNNEMDDFSVP-EIT  466

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+P NFI PNKRPLSSMTP+V+ K+ +L AV+GGSGGTNIIA V QVFLN  VL 
Sbjct  467  PDHLPPAPTNFIEPNKRPLSSMTPLVITKEGELVAVVGGSGGTNIIAAVIQVFLNCFVLK  526

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQES-GAI  537
            M PLEAV S RVYHKLIPN V YEN+T ++G+HI +S   + FLE++GH+L+   S GAI
Sbjct  527  MKPLEAVASARVYHKLIPNVVRYENFTAINGDHIGVSKDSKMFLEEKGHELEEMSSGGAI  586

Query  538  CQLLVQNL---------------PKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
             QL+VQ +               PKP        F G+LTAVSDPRK G PAA+
Sbjct  587  VQLIVQKMVTDFGRKLGKDFIKKPKP--------FKGLLTAVSDPRKDGKPAAV  632



>gb|KEH27232.1| gamma-glutamyltranspeptidase [Medicago truncatula]
Length=475

 Score =   287 bits (734),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 167/225 (74%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSH C+VDADRNAVS+TT+VN+ FG G+ S STGIV+NNEM DFS PT++S
Sbjct  251  RWSQLRDHGTSHLCVVDADRNAVSLTTSVNWHFGAGIRSTSTGIVVNNEMDDFSTPTDIS  310

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+P NFI PNKRPLSSMTPI++ KD+QL  VIG SGG +II  V QVFLNH +LG
Sbjct  311  PDKLPPAPTNFIEPNKRPLSSMTPIIITKDDQLVGVIGASGGMSIIPAVTQVFLNHFILG  370

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PL+AV  PRVY KL+P+TV YEN    DG HIELS   R FL++RGH+L   +  AI 
Sbjct  371  MKPLDAVLRPRVYTKLLPDTVSYENLIDRDGGHIELSDESRLFLKERGHKLCVCQGKAIT  430

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+V     P       G+  ++    G LTAVSDPRKGG PAA+
Sbjct  431  QLIVHTPKTPLNINRKIGENADSHVKRGTLTAVSDPRKGGCPAAV  475



>ref|XP_004141035.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Cucumis sativus]
 gb|KGN60559.1| hypothetical protein Csa_2G000660 [Cucumis sativus]
Length=621

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 171/226 (76%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDA+RNAVS+TTTVN   G GV+SPSTGIVLNN+MGDFS  T +S
Sbjct  396  RWSQLRDHGTSHFCIVDAERNAVSLTTTVNGHLGAGVLSPSTGIVLNNQMGDFSISTNIS  455

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+P NFI PNKRPLSSMTPI+V KD++L AV+GGSGG  I+  V QVFLN+  LG
Sbjct  456  PDKLPPAPTNFIQPNKRPLSSMTPIIVTKDDRLIAVMGGSGGMKIVPAVIQVFLNYFSLG  515

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQE-SGAI  537
              P  AV+  RVYH+L+PN V YEN T ++G+++E S   ++FLEDRGH++ A + +GAI
Sbjct  516  FQPFSAVERSRVYHQLMPNVVKYENLTCINGDYVEFSAKEKQFLEDRGHEVVAMDGAGAI  575

Query  538  CQLLVQNLP-------KPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
             QL+VQN         K G+  NN    G+LTAV DPRK G+PA +
Sbjct  576  VQLVVQNFEDAIDIGRKGGKLSNNQNNFGVLTAVCDPRKNGNPAVV  621



>dbj|BAD22536.1| gamma-glutamyl transferase [Raphanus sativus]
Length=635

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 171/234 (73%), Gaps = 16/234 (7%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFCIVD +RN VSMTTTVNY FG GV+SPSTGI+LNNEM DFS P  ++
Sbjct  402  RWSQLRDQGTSHFCIVDGNRNTVSMTTTVNYPFGAGVLSPSTGILLNNEMDDFSVPESIT  461

Query  181  -PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
             PD LPP+P NFI PNKRPLSSMTP+V+ K+ +L AV+GGSGGTNIIA V QVFLN  VL
Sbjct  462  TPDHLPPAPTNFIEPNKRPLSSMTPLVITKEGELVAVLGGSGGTNIIAAVIQVFLNCFVL  521

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQES-GA  534
             M PLEAV S RVYHKL+PN V YEN+T ++G+HI  S   + FLE++GH+L+   S GA
Sbjct  522  KMKPLEAVASARVYHKLVPNVVRYENFTAINGDHIGFSKDSKMFLEEKGHELEEMSSGGA  581

Query  535  ICQLLVQNLPKPGQWL--------------NNGTFHGMLTAVSDPRKGGSPAAI  654
            I QL+VQ+  +  + +                 TF G+LTAVSDPRK G PAA+
Sbjct  582  IVQLIVQSFKEEEEMVIDFGRRLGKDNTIKKTKTFKGLLTAVSDPRKDGKPAAV  635



>emb|CDY48603.1| BnaA01g07620D [Brassica napus]
Length=626

 Score =   288 bits (738),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 172/220 (78%), Gaps = 3/220 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFCIVD DRN+VS+T+TVNY FG GV+S STGI+LNNEM DFS P E++
Sbjct  408  RWSQLRDQGTSHFCIVDGDRNSVSLTSTVNYPFGAGVLSTSTGILLNNEMDDFSVP-EIT  466

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+P NFI PNKRPLSSMTP+V+ K+ +L AV+GGSGGTNIIA V QVFLN  V+ 
Sbjct  467  PDDLPPAPTNFIVPNKRPLSSMTPLVITKEGELVAVVGGSGGTNIIAAVIQVFLNCFVMK  526

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQES-GAI  537
            M PLEAV S RVYHKLIPN V YEN+T ++G+HI ++   + FLE++GH+L+   S GAI
Sbjct  527  MKPLEAVASARVYHKLIPNVVRYENFTAINGDHIGVTKDSKMFLEEKGHELEEMSSGGAI  586

Query  538  CQLLVQNLPK-PGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
             QL+VQ+  +   + +    F G+LTAVSDPRK G PAA+
Sbjct  587  VQLIVQSFKEDEDKEIKPKPFKGLLTAVSDPRKDGKPAAV  626



>ref|XP_009404605.1| PREDICTED: gamma-glutamyltranspeptidase 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=633

 Score =   288 bits (738),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 167/229 (73%), Gaps = 11/229 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSH CIVD DRNAVS+TTTVN  FG  V+S STGI+LNNEM DFS PTE +
Sbjct  405  RWSQLRDHGTSHLCIVDTDRNAVSLTTTVNSYFGARVLSSSTGILLNNEMDDFSTPTEAT  464

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+PANFI PNKRPLSSM PI+VLKDNQLA V+G SGG NII  V QVFLNH VLG
Sbjct  465  PDHLPPAPANFIEPNKRPLSSMAPIIVLKDNQLAGVVGASGGLNIIPAVVQVFLNHFVLG  524

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGH-QLQAQESGAI  537
            M+PL AV+ PRV+HKLIPN VLYEN+T +DGE IE     + FLE RGH       + A+
Sbjct  525  MEPLAAVRHPRVFHKLIPNKVLYENFTAIDGEKIEFGEEAKLFLEQRGHIVSSLSSAAAV  584

Query  538  CQLLVQNLPKP--------GQWLNNGT--FHGMLTAVSDPRKGGSPAAI  654
             QL+V NL  P         + + NG   FHG L A+SDPRK GSPA +
Sbjct  585  SQLVVHNLQVPILSTHRKDNRKVKNGNNIFHGKLIAISDPRKDGSPAGL  633



>ref|XP_003620774.1| Gamma-glutamyltranspeptidase [Medicago truncatula]
 gb|AES76992.1| gamma-glutamyltranspeptidase [Medicago truncatula]
Length=623

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 167/225 (74%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSH C+VDADRNAVS+TT+VN+ FG G+ S STGIV+NNEM DFS PT++S
Sbjct  399  RWSQLRDHGTSHLCVVDADRNAVSLTTSVNWHFGAGIRSTSTGIVVNNEMDDFSTPTDIS  458

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+P NFI PNKRPLSSMTPI++ KD+QL  VIG SGG +II  V QVFLNH +LG
Sbjct  459  PDKLPPAPTNFIEPNKRPLSSMTPIIITKDDQLVGVIGASGGMSIIPAVTQVFLNHFILG  518

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PL+AV  PRVY KL+P+TV YEN    DG HIELS   R FL++RGH+L   +  AI 
Sbjct  519  MKPLDAVLRPRVYTKLLPDTVSYENLIDRDGGHIELSDESRLFLKERGHKLCVCQGKAIT  578

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+V     P       G+  ++    G LTAVSDPRKGG PAA+
Sbjct  579  QLIVHTPKTPLNINRKIGENADSHVKRGTLTAVSDPRKGGCPAAV  623



>ref|XP_010438326.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Camelina sativa]
Length=637

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 171/228 (75%), Gaps = 11/228 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFCIVDA+RN VSMTTTVNY FG  V+SP+TGIVLNNEM DFSAP+E++
Sbjct  409  RWSQLRDQGTSHFCIVDAERNTVSMTTTVNYAFGAKVLSPATGIVLNNEMDDFSAPSEIT  468

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD+LPP+P NFI PNKRPLSSMTP+VV KD +L A +GG+GG NIIA V QVFLN  VL 
Sbjct  469  PDELPPAPTNFIEPNKRPLSSMTPLVVTKDGELVAALGGAGGMNIIAGVLQVFLNCFVLN  528

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PL+AV+S RVYH+LIPN V YEN+T ++G++I L+   + FL +RGH+ +A    AI 
Sbjct  529  MKPLQAVESARVYHRLIPNVVQYENFTAINGDYIGLTEDTKMFLAERGHEFEAVSGRAIV  588

Query  541  QLLVQNLPKPGQ---WLNNGT--------FHGMLTAVSDPRKGGSPAA  651
            QL+VQ   +  +   +++ G           G+LTAVSDPRK G PAA
Sbjct  589  QLIVQTFKEDKEEDMFIDIGRKIGKHKKPLKGLLTAVSDPRKDGKPAA  636



>ref|NP_194650.1| gamma-glutamyl transpeptidase 4 [Arabidopsis thaliana]
 sp|Q9M0G0.1|GAGT3_ARATH RecName: Full=Gamma-glutamyltranspeptidase 3; AltName: Full=Gamma-glutamyltransferase 
3; AltName: Full=Gamma-glutamyltranspeptidase 
4; AltName: Full=Glutathione hydrolase 3 [Arabidopsis 
thaliana]
 emb|CAB79679.1| gamma-glutamyltransferase-like protein [Arabidopsis thaliana]
 gb|AAO64159.1| putative gamma-glutamyltransferase [Arabidopsis thaliana]
 dbj|BAF00492.1| gamma-glutamyltransferase-like protein [Arabidopsis thaliana]
 gb|AEE85602.1| gamma-glutamyl transpeptidase 4 [Arabidopsis thaliana]
Length=637

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 170/229 (74%), Gaps = 11/229 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFC+VDADRN+VSMT+TVNY FG GV+SPSTGIVLNNEM DFS PTE++
Sbjct  409  RWSQLRDQGTSHFCVVDADRNSVSMTSTVNYRFGAGVLSPSTGIVLNNEMDDFSTPTEIT  468

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+P NFI PNKRPLSSMTP+V+ KD +  A +GG+GG +II  V QVFLN  VL 
Sbjct  469  PDMLPPAPTNFIEPNKRPLSSMTPLVITKDGEFVAALGGAGGMHIIPAVLQVFLNCFVLN  528

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M P EAV+S R+YH+LIPN V YEN+T ++G+HI +S   + FL +RGH+L+    GAI 
Sbjct  529  MKPKEAVESARIYHRLIPNVVSYENFTTINGDHIGVSEDTKMFLAERGHELKELSGGAIV  588

Query  541  QLLVQNL---------PKPGQWLNNGT--FHGMLTAVSDPRKGGSPAAI  654
            QL+VQ+           + G+ +   +    G+LTAVSDPRK G PAA+
Sbjct  589  QLIVQSFKEEKEEEMIIEIGRKIGKKSKPLKGLLTAVSDPRKDGKPAAV  637



>ref|XP_004157902.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyltranspeptidase 
1-like [Cucumis sativus]
Length=621

 Score =   285 bits (730),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 170/226 (75%), Gaps = 8/226 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFC+VDA+RNAVS+TTTVN   G GV+SPSTGIVLNN+MGDFS  T +S
Sbjct  396  RWSQLRDHGTSHFCVVDAERNAVSLTTTVNGHLGAGVLSPSTGIVLNNQMGDFSISTNIS  455

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+P  FI PNKRPLSSMTPI+V KD++L AV+GGSGG  I+  V QVFLN+  LG
Sbjct  456  PDKLPPAPTXFIQPNKRPLSSMTPIIVTKDDRLIAVMGGSGGMKIVPAVIQVFLNYFSLG  515

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQE-SGAI  537
              P  AV+  RVYH+L+PN V YEN T ++G+++E S   ++FLEDRGH++ A + +GAI
Sbjct  516  FQPFSAVERSRVYHQLMPNVVKYENLTCINGDYVEFSAKEKQFLEDRGHEVVAMDGAGAI  575

Query  538  CQLLVQNLP-------KPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
             QL+VQN         K G+  NN    G+LTAV DPRK G+PA +
Sbjct  576  VQLVVQNFEDAIDIGRKGGKLSNNQNNFGVLTAVCDPRKNGNPAVV  621



>ref|XP_009137838.1| PREDICTED: gamma-glutamyltranspeptidase 3-like isoform X1 [Brassica 
rapa]
Length=647

 Score =   286 bits (731),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 168/226 (74%), Gaps = 15/226 (7%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHF IVD+DRNAVSMTTTVN+VFG GV+SPSTGIVLNNEMGDFS PTE +
Sbjct  405  RWSQLRDQGTSHFSIVDSDRNAVSMTTTVNFVFGAGVLSPSTGIVLNNEMGDFSVPTENT  464

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+P NFI PNKRPLSSMTP+V+ KD +L A +GGSGG  II  V QVFLN  VL 
Sbjct  465  PDDLPPAPTNFIEPNKRPLSSMTPLVITKDGELVATLGGSGGMKIIPAVIQVFLNCFVLK  524

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PLEAV+S RVYHKLIPN V YEN+T ++G+HI ++   + FL +RGH+L+    GAI 
Sbjct  525  MKPLEAVESARVYHKLIPNVVQYENFTAINGDHIGVTKNSKMFLAERGHELEEVSGGAIV  584

Query  541  QLLVQ---------NLPKPGQWLNNGT------FHGMLTAVSDPRK  633
            QL+VQ         N+ + G+ L   +      F G+LTAVSDPRK
Sbjct  585  QLIVQSFEEGEDKENIIELGRKLGKDSTKRLKPFKGLLTAVSDPRK  630



>ref|XP_010433124.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Camelina sativa]
Length=640

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 166/228 (73%), Gaps = 11/228 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFCIVDADRN VSMTTTVNY FG  V+SP+TGIVLNNEM DFSAPTE++
Sbjct  412  RWSQLRDQGTSHFCIVDADRNTVSMTTTVNYAFGAKVLSPATGIVLNNEMDDFSAPTEIT  471

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D LPP+P NFI PNKRPLSSMTP++V KD +L A +GG+GG NIIA V QVFLN  VL 
Sbjct  472  TDMLPPAPTNFIEPNKRPLSSMTPLIVTKDGELVAALGGAGGMNIIAGVLQVFLNCFVLN  531

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M P EAV+S RVYH+LIPN + YEN+T + G++I L+   + FL +RGH+ +A    AI 
Sbjct  532  MKPSEAVESARVYHRLIPNVLQYENFTAISGDYIGLTEDTKMFLTERGHEFEAVSGKAIV  591

Query  541  QLLVQNLPKP---------GQWLNNGT--FHGMLTAVSDPRKGGSPAA  651
            QL+VQ+  K          G+     T    G+LTAVSDPRK G PAA
Sbjct  592  QLIVQSFKKDEEEDMFIEIGRKFGKKTKPLKGLLTAVSDPRKDGKPAA  639



>ref|XP_010447878.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Camelina sativa]
Length=639

 Score =   283 bits (724),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 166/228 (73%), Gaps = 11/228 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFCIVDADRN VSMTTTVNY FG  V+SP+TGIVLNNEM DFSAPTE++
Sbjct  411  RWSQLRDQGTSHFCIVDADRNTVSMTTTVNYAFGAKVLSPATGIVLNNEMDDFSAPTEIT  470

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D LPP+P NFI PNKRPLSSMTP++V KD +L A +GG+GG NIIA V QVFLN  VL 
Sbjct  471  TDMLPPAPTNFIEPNKRPLSSMTPLIVTKDGELVAALGGAGGMNIIAGVLQVFLNCFVLN  530

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M P EAV+S RVYH+LIPN V YEN+T + G++I L+   + FL +RGH+ +     AI 
Sbjct  531  MKPSEAVESARVYHRLIPNVVQYENFTAISGDYIGLTEDTKMFLAERGHEFEEVSGKAIV  590

Query  541  QLLVQNLPKPGQ---WLNNG--------TFHGMLTAVSDPRKGGSPAA  651
            QL+VQ+  +  +   ++  G           G+LTAVSDPRK G PAA
Sbjct  591  QLIVQSFKEDKEEDMFIEIGRKFGKKSKQLKGLLTAVSDPRKDGKPAA  638



>ref|XP_009128940.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Brassica rapa]
Length=640

 Score =   283 bits (723),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 173/234 (74%), Gaps = 17/234 (7%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFCIVD DRN+VS+T+TVNY FG GV+S STGI+LNNEM DFS P E++
Sbjct  408  RWSQLRDQGTSHFCIVDGDRNSVSLTSTVNYPFGAGVLSTSTGILLNNEMDDFSVP-EIT  466

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+P NFI PNKRPLSSMTP+V+ K+ +L AV+GGSGGTNIIA V QVFLN  V+ 
Sbjct  467  PDDLPPAPTNFIVPNKRPLSSMTPLVITKEGELVAVVGGSGGTNIIAAVIQVFLNCFVMK  526

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQES-GAI  537
            M PLEAV S RVYHKLIPN V YEN+T ++G+HI ++   + FLE++GH+L+   S GAI
Sbjct  527  MKPLEAVASARVYHKLIPNVVRYENFTAINGDHIGVTKDSKMFLEEKGHELEEMSSGGAI  586

Query  538  CQLLVQNLPKP---------GQWLNNGT------FHGMLTAVSDPRKGGSPAAI  654
             QL+VQ+  +          G+ L          F G+LTAVSDPRK G PAA+
Sbjct  587  VQLIVQSFKEDEDKEIVTDFGRKLGRDFIKKPKPFKGLLTAVSDPRKDGKPAAV  640



>ref|XP_002869447.1| gamma-glutamyl transpeptidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45706.1| gamma-glutamyl transpeptidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=639

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 169/229 (74%), Gaps = 11/229 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFCIVDADRN+VSMT+TVNY FG GV+SPSTGIVLNNEM DFS P E++
Sbjct  411  RWSQLRDQGTSHFCIVDADRNSVSMTSTVNYGFGAGVLSPSTGIVLNNEMDDFSVPAEIT  470

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD+LPP+P NFI PNKRPLSSMTP+V+ KD +  A +GG+GG +II  V QVFLN  VL 
Sbjct  471  PDRLPPAPTNFIEPNKRPLSSMTPLVITKDGEFVAALGGAGGMHIIPAVLQVFLNCFVLN  530

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M P +AV+S R+YH+LIPN V YEN+T ++G+HI +S   + FL  RGH+L+A   GAI 
Sbjct  531  MKPKQAVESARIYHRLIPNVVSYENFTAINGDHIGVSEDTKMFLAGRGHELKAVSGGAIV  590

Query  541  QLLVQNL---------PKPGQWLNNGT--FHGMLTAVSDPRKGGSPAAI  654
            QL+VQ+           + G+ +   +    G+LTAV DPRK G PAA+
Sbjct  591  QLIVQSFKEEKEEEMIIEIGRKIGKKSKPSKGLLTAVCDPRKDGKPAAV  639



>dbj|BAD61112.1| putative gamma-glutamyl transpeptidase [Oryza sativa Japonica 
Group]
Length=619

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 163/215 (76%), Gaps = 7/215 (3%)
 Frame = +1

Query  31   SHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSPDKLPPSPAN  210
            S++   D DRNAV+MTTTVN  FG  V+SPSTGIVLNNEM DFS P E +PD LPP+PAN
Sbjct  405  SYYFPNDGDRNAVAMTTTVNSYFGAHVLSPSTGIVLNNEMDDFSVPAERTPDHLPPAPAN  464

Query  211  FISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLGMDPLEAVQSP  390
            FI+P KRPLSSMTP ++LK+ QLA V+GGSGGTNIIAT AQVF+NH ++GM PL AVQ P
Sbjct  465  FIAPGKRPLSSMTPTIILKNGQLAGVVGGSGGTNIIATAAQVFVNHFIVGMHPLAAVQHP  524

Query  391  RVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAICQLLVQNLPKP  570
            RVYHKL+PN V+YEN T++ GE IELSG  R FL  RGH+L++  SGA+CQ +VQ+L  P
Sbjct  525  RVYHKLVPNVVVYENETVVGGEVIELSGEAREFLRRRGHRLRSTGSGAVCQFIVQDLLAP  584

Query  571  -------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
                    Q      FHGMLTAVSDPRKGG PA +
Sbjct  585  VGSAADRRQHGGGNVFHGMLTAVSDPRKGGRPAGM  619



>ref|XP_006283327.1| hypothetical protein CARUB_v10004367mg [Capsella rubella]
 gb|EOA16225.1| hypothetical protein CARUB_v10004367mg [Capsella rubella]
Length=630

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 166/228 (73%), Gaps = 10/228 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHF IVDADRN VSMTTTVNY FG  V+SP+TGIVLNNEM DFS P+E++
Sbjct  403  RWSQLRDQGTSHFSIVDADRNTVSMTTTVNYSFGAKVLSPATGIVLNNEMDDFSVPSEIT  462

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D LPP+P NFI PNKRPLSSMTP+VV KD +L A +GG+GG NII  V QVFLN  VL 
Sbjct  463  SDMLPPAPTNFIEPNKRPLSSMTPLVVTKDGELVAALGGAGGMNIIPAVLQVFLNCFVLN  522

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PLEAV++ RVYH+LIPN V +EN+T ++G++I L+   + FL +RGH++ A    AI 
Sbjct  523  MKPLEAVETARVYHRLIPNVVQFENFTAINGDYIGLTEDTKMFLAERGHEVNAVSGKAIV  582

Query  541  QLLVQNLPKPGQWL----------NNGTFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ+  +  + +           +    G+LTAVSDPRK G PAA+
Sbjct  583  QLIVQSFKEDEEEMFIEIGRKIGKKSKQVKGLLTAVSDPRKDGKPAAV  630



>emb|CDY47776.1| BnaC07g41840D [Brassica napus]
Length=622

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 165/224 (74%), Gaps = 12/224 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHF IVD++RN VSMTTTVNYVFG GV+SPSTGIVLNNEM DFS PTE +
Sbjct  405  RWSQLRDQGTSHFSIVDSERNTVSMTTTVNYVFGAGVLSPSTGIVLNNEMDDFSVPTENT  464

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD LPP+P NFI PNKRPLSSMTP+    D +L A +GGSGG  II  V QVFLN  VL 
Sbjct  465  PDNLPPAPTNFIEPNKRPLSSMTPL----DGELVATLGGSGGMKIIPAVIQVFLNFFVLK  520

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PLEAV+S RVYHKLIPN V YEN+T ++G+HI ++     FL +RGH+L+    GAI 
Sbjct  521  MKPLEAVESARVYHKLIPNVVQYENFTAINGDHIGVTKNSEMFLAERGHELEEISGGAIV  580

Query  541  QLLVQNLPKPGQWLNNGT------FHGMLTAVSDPRKGGSPAAI  654
            QL++  + + G+ L   +      F G+LTAVSDPRK G PAA+
Sbjct  581  QLIM--IIELGRKLGKDSSKRLKPFKGLLTAVSDPRKDGKPAAV  622



>gb|EMT33219.1| Gamma-glutamyltranspeptidase 1 [Aegilops tauschii]
Length=862

 Score =   276 bits (707),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 158/211 (75%), Gaps = 5/211 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTE-V  177
            +WSQLRD+GTSH C+VD DRNAV+MTTTVNY FG  V+SPSTGIVLNNEM DFS P+   
Sbjct  407  KWSQLRDNGTSHLCVVDGDRNAVAMTTTVNYYFGAHVLSPSTGIVLNNEMDDFSVPSSNP  466

Query  178  SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            +PD+LPP+PANFI+P KRPLSSMTP ++LKD QLA V+G SGGTNII  V QVFLNH V+
Sbjct  467  TPDQLPPAPANFIAPGKRPLSSMTPAIILKDRQLAGVVGASGGTNIITAVTQVFLNHFVV  526

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            GM PL AVQSPRVYHKL+PN V YE+ T+ DGE IE S     FL  RGH L++   GA+
Sbjct  527  GMSPLAAVQSPRVYHKLVPNVVRYEDATMADGEVIEFSTEAMEFLRRRGHVLESTSPGAV  586

Query  538  CQLLVQNLPKPGQ----WLNNGTFHGMLTAV  618
            CQL+VQ+L  P            F GMLTA+
Sbjct  587  CQLIVQDLLAPASGGGGGGGENVFRGMLTAL  617



>ref|XP_010261138.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Nelumbo nucifera]
Length=589

 Score =   266 bits (680),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 156/218 (72%), Gaps = 2/218 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q++DHGTSH  +VD +RNAVSMTTT+N  FG   +SPSTGI+LNNEM DFS P   S
Sbjct  374  RWNQIQDHGTSHMSVVDRERNAVSMTTTINGYFGAVFLSPSTGILLNNEMDDFSMPGNSS  433

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D  PP+PANFI PNKRPLSSM+P +VLKD QL AV+G SGG  IIA   +VFLNH   G
Sbjct  434  ADLPPPAPANFIRPNKRPLSSMSPTIVLKDGQLKAVVGASGGAMIIAGTTEVFLNHFAKG  493

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR+YH+LIPN VLYENWT ++G+H E+    R  L+ +GH L++   G IC
Sbjct  494  MDPLSSVLAPRIYHQLIPNVVLYENWTTVNGDHFEIPAETRAALQKKGHILKSLAGGTIC  553

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q ++  L   G  ++ GT  G L AVSDPRKGG PA  
Sbjct  554  QFILHRL--EGSKVDKGTVFGELAAVSDPRKGGFPAGF  589



>gb|ABB59572.1| putative gamma-glutamyl transferase [Populus tremula x Populus 
alba]
Length=258

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 147/217 (68%), Gaps = 4/217 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  IVD++RNAVSMT TVN  FG  ++SPSTGIVLNNEM DFS P   +
Sbjct  45   RWNQINDHGTSHISIVDSERNAVSMTNTVNAYFGAQILSPSTGIVLNNEMDDFSMPGNNT  104

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
               LPP+P N I P KRPLSSMTP +VLKD +L  V+G SGG+ IIA   +V LNH V G
Sbjct  105  GHVLPPAPPNLIRPGKRPLSSMTPTIVLKDKKLKGVVGASGGSMIIAGTTEVLLNHFVKG  164

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYHKL PN V YENWT + G+H EL    R FL+ RGH L+    G IC
Sbjct  165  MDPLSSVLAPRVYHKLTPNVVQYENWTTVYGDHFELPADVRAFLQKRGHDLEGIAGGTIC  224

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAA  651
            Q +VQ+L    +        G L  VSDPRKGG PA 
Sbjct  225  QFIVQDL----EAAEGNKLMGKLVGVSDPRKGGLPAG  257



>ref|XP_008440656.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Cucumis melo]
 ref|XP_008440657.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Cucumis melo]
 ref|XP_008440658.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Cucumis melo]
 ref|XP_008440659.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Cucumis melo]
 ref|XP_008440660.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Cucumis melo]
 ref|XP_008440661.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Cucumis melo]
 ref|XP_008440662.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Cucumis melo]
 ref|XP_008440663.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Cucumis melo]
 ref|XP_008440664.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Cucumis melo]
Length=570

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 152/218 (70%), Gaps = 4/218 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ ++DHGTSH  +VD +RNAVSMTTTVNY FG  V+SPSTGIVLNNEM DF+ P  VS
Sbjct  357  RWNPIKDHGTSHLSVVDGERNAVSMTTTVNYYFGANVLSPSTGIVLNNEMDDFAIPAAVS  416

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             ++LPP+PANFI P KRPLSSM+P +VLK+ QL AV+G SGG  IIA  A+V LNH   G
Sbjct  417  ANELPPAPANFIRPGKRPLSSMSPTIVLKNGQLKAVVGASGGGFIIAGTAEVLLNHFAKG  476

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP  +V +PRVYH+LIPN + YENWT + G+H E+    R  L  +GH L+    G IC
Sbjct  477  MDPFSSVMAPRVYHQLIPNVLNYENWTTVLGDHFEVPAETRAALAKKGHVLEGLAGGTIC  536

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ        L  G   G L AVSDPRKGG+PA  
Sbjct  537  QFIVQG----SSSLRQGGGFGKLVAVSDPRKGGTPAGF  570



>gb|AES72274.2| gamma-glutamyltranspeptidase [Medicago truncatula]
Length=582

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 156/219 (71%), Gaps = 4/219 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTE-V  177
            +W+Q+ DHGTSH  I+D +RNAVSMTTTVN  FG  ++SPSTGIVLNNEM DFS P + V
Sbjct  367  KWNQINDHGTSHLSIIDFERNAVSMTTTVNSYFGATILSPSTGIVLNNEMDDFSMPIKNV  426

Query  178  SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            S D  PP+PANF+ P KRPLSSM+P +VLKD +L AV+G SGG  IIA  ++V LNH V 
Sbjct  427  SKDVRPPAPANFVVPGKRPLSSMSPTIVLKDRELKAVVGASGGIMIIAATSEVLLNHFVK  486

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            GMDP  +V +PRVYH+LIPN V YENWT + G+H ELS   R  L  +GH LQ+   G I
Sbjct  487  GMDPFSSVTAPRVYHQLIPNVVYYENWTTVSGDHFELSADIREGLRSKGHVLQSLAGGTI  546

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            CQ +V +  +  + +N G   G L AVSDPRKGG PA I
Sbjct  547  CQFIVSDTSEHSK-INKGV--GKLVAVSDPRKGGFPAGI  582



>ref|XP_003602023.1| Gamma-glutamyltransferase [Medicago truncatula]
Length=592

 Score =   262 bits (669),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 156/219 (71%), Gaps = 4/219 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTE-V  177
            +W+Q+ DHGTSH  I+D +RNAVSMTTTVN  FG  ++SPSTGIVLNNEM DFS P + V
Sbjct  377  KWNQINDHGTSHLSIIDFERNAVSMTTTVNSYFGATILSPSTGIVLNNEMDDFSMPIKNV  436

Query  178  SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            S D  PP+PANF+ P KRPLSSM+P +VLKD +L AV+G SGG  IIA  ++V LNH V 
Sbjct  437  SKDVRPPAPANFVVPGKRPLSSMSPTIVLKDRELKAVVGASGGIMIIAATSEVLLNHFVK  496

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            GMDP  +V +PRVYH+LIPN V YENWT + G+H ELS   R  L  +GH LQ+   G I
Sbjct  497  GMDPFSSVTAPRVYHQLIPNVVYYENWTTVSGDHFELSADIREGLRSKGHVLQSLAGGTI  556

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            CQ +V +  +  + +N G   G L AVSDPRKGG PA I
Sbjct  557  CQFIVSDTSEHSK-INKGV--GKLVAVSDPRKGGFPAGI  592



>gb|KDO43920.1| hypothetical protein CISIN_1g009773mg [Citrus sinensis]
Length=526

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 150/218 (69%), Gaps = 4/218 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  IVD +RNAVSMTTTVN  FG  ++SPSTGIVLNNEM DFS P   S
Sbjct  313  RWNQIHDHGTSHLSIVDHERNAVSMTTTVNAYFGAQILSPSTGIVLNNEMDDFSMPMNGS  372

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFI P KRPLSSMTP +VLKD +L AV+G SGG NII  +  V LNH V G
Sbjct  373  KNLPPPAPANFIRPGKRPLSSMTPTIVLKDEKLIAVLGASGGANIIGGITGVLLNHFVRG  432

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AV +PRVYH+LIPN V YENWT + G+H E+ G  R  L  +GH L++   G IC
Sbjct  433  MDPLSAVMAPRVYHQLIPNIVYYENWTTVIGDHFEIPGNIRASLRKKGHVLESMAGGTIC  492

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ      +  N G   G L  VSDPRKGG PA  
Sbjct  493  QFIVQQFESIKE--NEGV--GELVGVSDPRKGGFPAGF  526



>gb|AFF18858.1| gamma-glutamyl transferase, partial [Dimocarpus longan]
Length=218

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 146/212 (69%), Gaps = 4/212 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  IVD +RNAVSMT TVN  FG  ++SPSTGIVLNNEM DFS P   S
Sbjct  11   RWNQIHDHGTSHVSIVDRNRNAVSMTNTVNAYFGAQILSPSTGIVLNNEMDDFSMPLNSS  70

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFI P KRPLSSM+P +VL+D +L AV+G SGG NIIA   +VFLNH  L 
Sbjct  71   QNLPPPAPANFIRPGKRPLSSMSPTIVLQDGKLKAVLGASGGANIIAGTTEVFLNHFALK  130

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP  ++ +PRVYH LIPN VLYENWT + G+H E+    R  LE +GH LQ    G IC
Sbjct  131  MDPFSSIMAPRVYHMLIPNIVLYENWTTVSGDHFEVPADIRASLEKKGHVLQGIAGGTIC  190

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKG  636
            Q +VQ L    +  N G   G L  +SDPRKG
Sbjct  191  QFIVQELEHIQE--NQGV--GRLVGISDPRKG  218



>ref|XP_004169851.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Cucumis sativus]
Length=570

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 152/216 (70%), Gaps = 4/216 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ + DHGTSH  +VD +RNAVSMTTTVNY FG  ++SPSTGIVLNNEM DF+ P  VS
Sbjct  357  RWNPINDHGTSHLSVVDGERNAVSMTTTVNYYFGAHILSPSTGIVLNNEMDDFAIPANVS  416

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             ++LPP+PANFI P KRPLSSM+P +VLK+ QL AV+G SGG  IIA  A+V LNH   G
Sbjct  417  ANQLPPAPANFIRPGKRPLSSMSPTIVLKNGQLKAVVGASGGGFIIAGTAEVLLNHFAKG  476

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M P  +V +PRVYH+L+PN + YENWT + G+H E+  G R  L  +GH L+    G IC
Sbjct  477  MSPFSSVMAPRVYHQLVPNILNYENWTTVLGDHFEVPAGTRAVLAKKGHVLEGLAGGTIC  536

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +VQ      + L  G   G L AVSDPRKGG+PA
Sbjct  537  QFIVQG----SRSLRQGDGFGKLVAVSDPRKGGAPA  568



>ref|XP_006428086.1| hypothetical protein CICLE_v10025225mg [Citrus clementina]
 ref|XP_006464313.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X2 [Citrus 
sinensis]
 gb|ESR41326.1| hypothetical protein CICLE_v10025225mg [Citrus clementina]
Length=591

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 150/218 (69%), Gaps = 4/218 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  IVD +RNAVSMTTTVN  FG  ++SPSTGIVLNNEM DFS P   S
Sbjct  378  RWNQIHDHGTSHLSIVDHERNAVSMTTTVNAYFGAQILSPSTGIVLNNEMDDFSMPMNGS  437

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFI P KRPLSSMTP +VLKD +L AV+G SGG NII  +  V LNH V G
Sbjct  438  KNLPPPAPANFIRPGKRPLSSMTPTIVLKDEKLIAVLGASGGANIIGGITGVLLNHFVRG  497

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AV +PRVYH+LIPN V YENWT + G+H E+ G  R  L  +GH L++   G IC
Sbjct  498  MDPLSAVMAPRVYHQLIPNIVYYENWTTVIGDHFEIPGNIRASLRKKGHVLESMAGGTIC  557

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ      +  N G   G L  VSDPRKGG PA  
Sbjct  558  QFIVQEFESIKE--NEGV--GELVGVSDPRKGGFPAGF  591



>gb|AFK35153.1| unknown [Lotus japonicus]
Length=331

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 150/219 (68%), Gaps = 5/219 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH  IVD +RNA+SMTTTVN  FG  ++SPSTGIVLNNEM DFS P  VS
Sbjct  117  KWNQILDHGTSHLSIVDVERNAISMTTTVNAYFGSKILSPSTGIVLNNEMDDFSIPRNVS  176

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D  PP+PANFI P KRPLSSM+P + L D +L AV+G SGG  IIA  ++V LNH V G
Sbjct  177  KDVPPPAPANFIVPGKRPLSSMSPTIALNDGKLKAVLGASGGAMIIAGTSEVLLNHFVKG  236

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP  ++ +PRVYH+LIPN V YENWT + G+HIEL    R  L  +GH LQ    G IC
Sbjct  237  MDPFSSITAPRVYHQLIPNVVSYENWTTVSGKHIELPSDIREALSSKGHVLQGLAGGTIC  296

Query  541  QLL-VQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q + V +L      + N  F G L AVSDPRKGG PA  
Sbjct  297  QFIAVDDLE---HSVKNKGF-GKLVAVSDPRKGGFPAGF  331



>ref|XP_010905955.1| PREDICTED: gamma-glutamyltranspeptidase 1 [Elaeis guineensis]
Length=584

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 151/216 (70%), Gaps = 2/216 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ + DHGTSH CIVD++RNAVSMT+TVN  FG   +SPSTGIVLNNEM DFS P   S
Sbjct  369  RWNIVHDHGTSHLCIVDSERNAVSMTSTVNAYFGAQFLSPSTGIVLNNEMDDFSIPQNAS  428

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFISP KRPLSSM P +VLKD QL AV+G SGG  IIA   +VFLNH    
Sbjct  429  ANVPPPAPANFISPLKRPLSSMAPTIVLKDGQLRAVVGASGGAMIIAGTTEVFLNHFAKR  488

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR YH+LIPN V YENWT + G+H EL    R  L+ +GH LQ    G IC
Sbjct  489  MDPLSSVMAPRTYHQLIPNVVQYENWTTVTGDHFELPATTRADLQKKGHVLQGLAGGTIC  548

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +V +L      +++G   G LTAVSDPRKGG PA
Sbjct  549  QFIVHSLEN--SKMHDGVKFGELTAVSDPRKGGLPA  582



>gb|KHG13791.1| Gamma-glutamyltranspeptidase 1 [Gossypium arboreum]
Length=577

 Score =   258 bits (659),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 153/216 (71%), Gaps = 4/216 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQ+ DHGTSH  I D+DRNAVSMTTTVN  FG  ++SPSTGIVLNNEM DFS P   S
Sbjct  364  RWSQVHDHGTSHISIADSDRNAVSMTTTVNAYFGSKILSPSTGIVLNNEMDDFSMPINSS  423

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+P NFI P K+PLSSMTP +VLKD +L  V+G SGG+NIIA   +VFLNH   G
Sbjct  424  GNTPPPAPPNFIRPGKKPLSSMTPTIVLKDEKLKGVVGASGGSNIIAATTEVFLNHFARG  483

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR+YH+LIPN V+YENWT + G+H E+S   R  L+ +GH L+    GAI 
Sbjct  484  MDPLSSVMAPRIYHQLIPNVVMYENWTTVTGDHFEVSSRIRSDLQKKGHILRGLAGGAIS  543

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +V  L   G+ +   +  G L AVSDPRKGG PA
Sbjct  544  QFIVHKL--EGRKVKGSS--GELVAVSDPRKGGIPA  575



>ref|XP_006464312.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X1 [Citrus 
sinensis]
Length=628

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 150/218 (69%), Gaps = 4/218 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  IVD +RNAVSMTTTVN  FG  ++SPSTGIVLNNEM DFS P   S
Sbjct  415  RWNQIHDHGTSHLSIVDHERNAVSMTTTVNAYFGAQILSPSTGIVLNNEMDDFSMPMNGS  474

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFI P KRPLSSMTP +VLKD +L AV+G SGG NII  +  V LNH V G
Sbjct  475  KNLPPPAPANFIRPGKRPLSSMTPTIVLKDEKLIAVLGASGGANIIGGITGVLLNHFVRG  534

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AV +PRVYH+LIPN V YENWT + G+H E+ G  R  L  +GH L++   G IC
Sbjct  535  MDPLSAVMAPRVYHQLIPNIVYYENWTTVIGDHFEIPGNIRASLRKKGHVLESMAGGTIC  594

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ      +  N G   G L  VSDPRKGG PA  
Sbjct  595  QFIVQEFESIKE--NEGV--GELVGVSDPRKGGFPAGF  628



>ref|XP_006412867.1| hypothetical protein EUTSA_v10024966mg [Eutrema salsugineum]
 gb|ESQ54320.1| hypothetical protein EUTSA_v10024966mg [Eutrema salsugineum]
Length=505

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 152/214 (71%), Gaps = 8/214 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            ++SQL+D GTSHF +VD   NAVSMTTTVNY FG G MSPSTGI+LNN+M DFS PT  +
Sbjct  282  KYSQLKDQGTSHFSVVDRYGNAVSMTTTVNYAFGSGFMSPSTGIILNNQMADFSIPTGGT  341

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             + LPP+PAN+I+P+KRPLSSM P+++ K+N+LA VIG SGG  II  V QVFLNH V  
Sbjct  342  SNSLPPAPANYIAPHKRPLSSMMPLIITKNNELAGVIGASGGIYIIPAVIQVFLNHFVFD  401

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PLEAV SPRVYHKL PN VLYE+W + +G+HI L    R+ LE + H L+  + GAI 
Sbjct  402  MSPLEAVNSPRVYHKLKPNEVLYEDWKVYNGDHILLEEDTRKVLESKNHVLKLTKQGAIV  461

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGS  642
            QL+VQN          G     LTAVSD RKGG 
Sbjct  462  QLVVQN--------RVGDTKTDLTAVSDLRKGGK  487



>ref|XP_008801055.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Phoenix dactylifera]
Length=585

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 151/216 (70%), Gaps = 2/216 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ + DHGTSH CIVD++RNA+SMT+TVN  FG   +SPSTGIVLNNEM DFS P   S
Sbjct  370  RWNIIHDHGTSHLCIVDSERNAISMTSTVNSYFGARFLSPSTGIVLNNEMDDFSIPGNAS  429

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFISP KRPLSSM P +VLKD QL AV+G SGG  IIA   +VFLNH    
Sbjct  430  ANVPPPAPANFISPLKRPLSSMAPTIVLKDGQLKAVVGASGGAMIIAGTTEVFLNHFAKR  489

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR YH+LIPN V YENWT + G+H EL    R  L+ +GH LQ    G IC
Sbjct  490  MDPLSSVMAPRTYHQLIPNVVQYENWTTVTGDHFELPATTRADLQKKGHVLQGLAGGTIC  549

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +V +L      +++G   G LTAVSDPRKGG PA
Sbjct  550  QFVVHSLEN--SKMHDGVKFGDLTAVSDPRKGGLPA  583



>ref|XP_004143492.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Cucumis sativus]
Length=570

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 150/216 (69%), Gaps = 4/216 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ + DHGTSH  +VD +RNAVSMTTTVNY FG  ++SPSTGIVLNNEM DF+ P  VS
Sbjct  357  RWNPINDHGTSHLSVVDGERNAVSMTTTVNYYFGAHILSPSTGIVLNNEMDDFAIPANVS  416

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             ++LPP+PANFI P KRPLSSM+P +VLK+ QL AV+G SGG  IIA  A+V LNH   G
Sbjct  417  ANQLPPAPANFIRPGKRPLSSMSPTIVLKNGQLKAVVGASGGGFIIAGTAEVLLNHFAKG  476

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M P  +V +PRVYH+L+PN + YENWT + G+H E+    R  L  +GH L+    G IC
Sbjct  477  MSPFSSVMAPRVYHQLVPNILNYENWTTVLGDHFEVPAETRAVLAKKGHVLEGLAGGTIC  536

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +VQ        L  G   G L AVSDPRKGG+PA
Sbjct  537  QFIVQG----SSSLRQGDGFGKLVAVSDPRKGGAPA  568



>gb|KGN48785.1| hypothetical protein Csa_6G501260 [Cucumis sativus]
Length=587

 Score =   256 bits (653),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 150/216 (69%), Gaps = 4/216 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ + DHGTSH  +VD +RNAVSMTTTVNY FG  ++SPSTGIVLNNEM DF+ P  VS
Sbjct  374  RWNPINDHGTSHLSVVDGERNAVSMTTTVNYYFGAHILSPSTGIVLNNEMDDFAIPANVS  433

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             ++LPP+PANFI P KRPLSSM+P +VLK+ QL AV+G SGG  IIA  A+V LNH   G
Sbjct  434  ANQLPPAPANFIRPGKRPLSSMSPTIVLKNGQLKAVVGASGGGFIIAGTAEVLLNHFAKG  493

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M P  +V +PRVYH+L+PN + YENWT + G+H E+    R  L  +GH L+    G IC
Sbjct  494  MSPFSSVMAPRVYHQLVPNILNYENWTTVLGDHFEVPAETRAVLAKKGHVLEGLAGGTIC  553

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +VQ        L  G   G L AVSDPRKGG+PA
Sbjct  554  QFIVQG----SSSLRQGDGFGKLVAVSDPRKGGAPA  585



>ref|XP_011021908.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyltranspeptidase 
1-like [Populus euphratica]
Length=615

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 147/216 (68%), Gaps = 4/216 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQ+ DHGTSH  IVD++RNAVSMT TVN  FG  ++SPSTGIVLNNEM DFS P   +
Sbjct  402  RWSQINDHGTSHISIVDSERNAVSMTNTVNSYFGAQILSPSTGIVLNNEMDDFSMPGNNT  461

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                PP+P NFI P KRPLSSMTP +VLKD QL  V+G SGG+ IIA   +V LNH   G
Sbjct  462  GHVPPPAPPNFIRPGKRPLSSMTPTIVLKDEQLKGVVGASGGSMIIAGTTEVLLNHFAKG  521

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL ++ +PRVYH+L PN V YENWT + G+H ELS   R FL+ RGH LQ    G IC
Sbjct  522  MDPLSSILAPRVYHQLTPNVVQYENWTTLYGDHFELSADVRAFLQKRGHVLQDIAGGTIC  581

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +VQ+L    +        G L  VSDPRKGG PA
Sbjct  582  QFIVQDL----ETTEGNKLMGKLVGVSDPRKGGLPA  613



>ref|XP_009603063.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Nicotiana tomentosiformis]
Length=582

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 149/218 (68%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH  IVD+DRNAVSMT+TVN  FG   +SPSTGIVLNNEM DFS P + S
Sbjct  373  KWNQIHDHGTSHMSIVDSDRNAVSMTSTVNAYFGAKYLSPSTGIVLNNEMDDFSIPEKCS  432

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFI P KRPLSSMTP +VLK  QL AVIG SGG  IIA   +VFLNH   G
Sbjct  433  ENVPPPAPANFIRPGKRPLSSMTPTIVLKGEQLRAVIGASGGAMIIAGTTEVFLNHFARG  492

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP  +V +PR YH+LIPN + YENWTI+ G+HIE+    R  L+ +GH LQ+   G IC
Sbjct  493  MDPFSSVMAPRSYHQLIPNVLQYENWTIVTGDHIEVPAKTRTSLQKKGHILQSIAGGTIC  552

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ            +  G L A+SDPRKGG P+  
Sbjct  553  QFVVQEF--------KSSKLGELVAISDPRKGGFPSGF  582



>gb|ABB59573.1| putative gamma-glutamyl transferase [Populus tremula x Populus 
alba]
Length=580

 Score =   253 bits (647),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 147/216 (68%), Gaps = 4/216 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  IVD++RNAVSMT TVN  FG  ++SPSTGIVLNNEM DFS P   +
Sbjct  367  RWNQINDHGTSHISIVDSERNAVSMTNTVNSYFGAQILSPSTGIVLNNEMDDFSMPGNNT  426

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             + LPP+P NFI P KRPLSSMTP +VLKD QL  V+G SGG+ IIA   +V LNH   G
Sbjct  427  GNVLPPAPPNFIRPGKRPLSSMTPTIVLKDKQLKGVVGASGGSMIIAGTTEVLLNHFAKG  486

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYHKL PN V YENWT + G+H EL    R FL+  GH L+    G IC
Sbjct  487  MDPLSSVLAPRVYHKLTPNVVQYENWTTVYGDHFELPADVRAFLQKIGHALEGFTGGTIC  546

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +VQ+L    +        G L  VSDPRKGG PA
Sbjct  547  QFIVQDL----EAAEGNKLMGKLVGVSDPRKGGLPA  578



>ref|XP_003552129.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Glycine max]
Length=624

 Score =   254 bits (648),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 151/218 (69%), Gaps = 2/218 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  I+D +RNA+SMT+TVN  FG  ++SPSTGIVLNNEM DFS P  V+
Sbjct  409  RWNQIHDHGTSHLSIIDPERNAISMTSTVNAYFGSKILSPSTGIVLNNEMDDFSMPRNVT  468

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D  PP+PANFI P KRPLSSM+P + LKD +L AV+G SGG  II   A+V LNH V G
Sbjct  469  KDVPPPAPANFIMPGKRPLSSMSPTIALKDGKLKAVVGASGGAFIIGGTAEVLLNHFVKG  528

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP  +V +PRVYH+L+PN V YENWT + GEH EL    R  L+ +GH L+    G IC
Sbjct  529  MDPFSSVTAPRVYHQLLPNVVNYENWTTL-GEHFELPADIREALKSKGHVLKGLAGGTIC  587

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +V +   P +  N G  +G L AVSDPRKGG PA  
Sbjct  588  QFIVLDNSVPSRQ-NKGIGNGKLVAVSDPRKGGFPAGF  624



>ref|XP_009766139.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Nicotiana sylvestris]
Length=582

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 148/218 (68%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH  IVD+DRNAVSMT+TVN  FG   +SPSTGIVLNNEM DFS P + S
Sbjct  373  KWNQIHDHGTSHMSIVDSDRNAVSMTSTVNAYFGAKYLSPSTGIVLNNEMDDFSIPEKRS  432

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFI P KRPLSSMTP + LK  QL AVIG SGG  IIA   +VFLNH   G
Sbjct  433  ENVPPPAPANFIRPGKRPLSSMTPTIFLKGEQLRAVIGASGGAMIIAGTTEVFLNHFARG  492

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP  +V +PR YH+LIPN + YENWTI+ G+HIE+    R  L+ +GH LQ+   G IC
Sbjct  493  MDPFSSVMAPRSYHQLIPNVLQYENWTIVTGDHIEIPATTRAALQKKGHVLQSIAGGTIC  552

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ            +  G L AVSDPRKGG P+  
Sbjct  553  QFVVQEF--------KSSKLGELVAVSDPRKGGFPSGF  582



>ref|XP_004502464.1| PREDICTED: gamma-glutamyltranspeptidase 2-like [Cicer arietinum]
Length=586

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 153/219 (70%), Gaps = 4/219 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  I+D +RNAVSMTTT+N  FG  ++SPSTGIVLNNEM DFS P  VS
Sbjct  371  RWNQINDHGTSHISIIDLERNAVSMTTTINGYFGAKILSPSTGIVLNNEMDDFSMPVNVS  430

Query  181  -PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
              D  PPSPANFI P KRPLSSM+P + LKD ++ AV+G SGG  IIA  ++V LNH V 
Sbjct  431  NKDVPPPSPANFIMPGKRPLSSMSPTIALKDGKVKAVVGASGGAMIIAGTSEVLLNHFVK  490

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            GMDP  +V +PRVYH+LIPN V YENWT ++G+H ELS   R  L  +GH L+    G I
Sbjct  491  GMDPFSSVTAPRVYHRLIPNVVNYENWTTVNGDHFELSADIREALRSKGHVLKGLAGGTI  550

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            CQ +V +  +  + +N G   G L AVSDPRKGG PA  
Sbjct  551  CQFIVLDNFEHSR-INEGI--GKLVAVSDPRKGGFPAGF  586



>emb|CDP01389.1| unnamed protein product [Coffea canephora]
Length=579

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 150/218 (69%), Gaps = 11/218 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  IVD DRNAVSMT T+N  FG   +SPSTGIVLNNEM DFS P   S
Sbjct  373  RWNQIHDHGTSHVSIVDTDRNAVSMTNTINGYFGAKFLSPSTGIVLNNEMDDFSMPDNAS  432

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D+ PP+PANF+ P KRPLSSM+P +VL+  +L AV+G SGG+ IIA  A+VFLN+ V G
Sbjct  433  TDEPPPAPANFVHPGKRPLSSMSPTIVLQGGKLKAVVGASGGSKIIAGTAEVFLNYFVNG  492

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR YH+LIPN V YE+W ++ G+H E+    R FL+ RGH L++   G IC
Sbjct  493  MDPLASVMAPRFYHELIPNVVNYEDWKVVTGDHFEVPEETRSFLKKRGHVLKSVAGGTIC  552

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ+L               L AVSDPRKGG PA  
Sbjct  553  QFVVQDLES-----------NELVAVSDPRKGGFPAGF  579



>ref|XP_007048081.1| Gamma-glutamyl transpeptidase 1 isoform 1 [Theobroma cacao]
 gb|EOX92238.1| Gamma-glutamyl transpeptidase 1 isoform 1 [Theobroma cacao]
Length=588

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 148/218 (68%), Gaps = 7/218 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  IVD  RNAVSMT TVN  FG  ++SPSTGIVLNNEM DFS PT  S
Sbjct  378  RWNQIHDHGTSHVAIVDIKRNAVSMTNTVNAYFGSKILSPSTGIVLNNEMDDFSMPTNSS  437

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+P NF+ P KRPLSSMTP +VLKD +L+ V+G SGG NIIA  A VFLNH   G
Sbjct  438  GNTPPPAPPNFVRPGKRPLSSMTPTIVLKDERLSGVVGASGGANIIAGTAGVFLNHFARG  497

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR+YH+LIPN V YENWT +  +H E+    RR L+ +GH L+    G IC
Sbjct  498  MDPLSSVMAPRIYHQLIPNVVTYENWTTVIRDHFEVPAHIRRDLQKKGHVLRGLAGGTIC  557

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +V         L+    +G L AVSDPRKGG PA  
Sbjct  558  QFIVHK-------LDALKGNGGLVAVSDPRKGGFPAGF  588



>ref|XP_007048082.1| Gamma-glutamyl transpeptidase 1 isoform 2 [Theobroma cacao]
 gb|EOX92239.1| Gamma-glutamyl transpeptidase 1 isoform 2 [Theobroma cacao]
Length=589

 Score =   250 bits (639),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 148/218 (68%), Gaps = 7/218 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  IVD  RNAVSMT TVN  FG  ++SPSTGIVLNNEM DFS PT  S
Sbjct  379  RWNQIHDHGTSHVAIVDIKRNAVSMTNTVNAYFGSKILSPSTGIVLNNEMDDFSMPTNSS  438

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+P NF+ P KRPLSSMTP +VLKD +L+ V+G SGG NIIA  A VFLNH   G
Sbjct  439  GNTPPPAPPNFVRPGKRPLSSMTPTIVLKDERLSGVVGASGGANIIAGTAGVFLNHFARG  498

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR+YH+LIPN V YENWT +  +H E+    RR L+ +GH L+    G IC
Sbjct  499  MDPLSSVMAPRIYHQLIPNVVTYENWTTVIRDHFEVPAHIRRDLQKKGHVLRGLAGGTIC  558

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +V         L+    +G L AVSDPRKGG PA  
Sbjct  559  QFIVHK-------LDALKGNGGLVAVSDPRKGGFPAGF  589



>ref|XP_009401074.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=579

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 151/218 (69%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ + DHGTSH  IVD+DRNAVSMT+TVN  FG  ++SPSTGI+LNNEM DFS P   S
Sbjct  366  RWNLINDHGTSHLSIVDSDRNAVSMTSTVNSYFGSQILSPSTGILLNNEMDDFSIPNSSS  425

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFI P KRPLSSM+P +V+KD QL AV+G SGG  IIA  A++ LNH    
Sbjct  426  ANIPPPAPANFIRPLKRPLSSMSPTIVVKDGQLKAVVGASGGAMIIAATAEILLNHFAQR  485

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR YH+LIPN V YENWT + G+H E+    R  L+ +GH LQA   G IC
Sbjct  486  MDPLSSVLAPRSYHQLIPNVVQYENWTTVTGDHFEVPAATRAALQKKGHVLQALSGGTIC  545

Query  541  QLLV--QNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +V   +L K      + T  G LTAVSDPRKGG PA
Sbjct  546  QFIVVRSSLEK------SATVGGELTAVSDPRKGGLPA  577



>ref|XP_011090593.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X2 [Sesamum 
indicum]
 ref|XP_011090594.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X2 [Sesamum 
indicum]
Length=574

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 146/218 (67%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  IVD +RNAVSMTTT+N  FG   +SP TGI+LNNEM DFS P   S
Sbjct  365  RWNQIHDHGTSHISIVDRERNAVSMTTTINAYFGSKFLSPRTGILLNNEMDDFSMPENTS  424

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFI P KRPLSSMTP +VLK  +L AV G SGG+ IIA   +V LNHL  G
Sbjct  425  QNVPPPAPANFIHPGKRPLSSMTPAIVLKGAKLKAVAGASGGSLIIAGTTEVLLNHLARG  484

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR YH+LIPN V YENWT+  GEH E+    R  LE +GH L++   G IC
Sbjct  485  MDPLSSVLAPRTYHQLIPNAVRYENWTVPTGEHFEVPAETRAALEKKGHVLESLAGGTIC  544

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ L          +  G L AVSDPRKGG PA  
Sbjct  545  QFVVQEL--------ESSKSGYLVAVSDPRKGGFPAGF  574



>ref|XP_011090592.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X1 [Sesamum 
indicum]
Length=596

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 146/218 (67%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  IVD +RNAVSMTTT+N  FG   +SP TGI+LNNEM DFS P   S
Sbjct  387  RWNQIHDHGTSHISIVDRERNAVSMTTTINAYFGSKFLSPRTGILLNNEMDDFSMPENTS  446

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFI P KRPLSSMTP +VLK  +L AV G SGG+ IIA   +V LNHL  G
Sbjct  447  QNVPPPAPANFIHPGKRPLSSMTPAIVLKGAKLKAVAGASGGSLIIAGTTEVLLNHLARG  506

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR YH+LIPN V YENWT+  GEH E+    R  LE +GH L++   G IC
Sbjct  507  MDPLSSVLAPRTYHQLIPNAVRYENWTVPTGEHFEVPAETRAALEKKGHVLESLAGGTIC  566

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ L          +  G L AVSDPRKGG PA  
Sbjct  567  QFVVQEL--------ESSKSGYLVAVSDPRKGGFPAGF  596



>ref|XP_006355534.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Solanum tuberosum]
Length=581

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 148/218 (68%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH  IVD++RNAVSMT+TVN  FG   +SPSTGIVLNNEM DFS P + S
Sbjct  372  KWNQINDHGTSHMSIVDSERNAVSMTSTVNSYFGAKYLSPSTGIVLNNEMDDFSIPAKHS  431

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFI P KRPLSSMTP +VLK  QL AV+G SGG  IIA   +VFLNH   G
Sbjct  432  ENVPPPAPANFIHPGKRPLSSMTPTIVLKGGQLRAVVGASGGGMIIAGTTEVFLNHFARG  491

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP  +V +PR YH+LIPN + YENWT++ G+H+E     R  L+ +GH LQ+   G IC
Sbjct  492  MDPFSSVMAPRYYHQLIPNVLQYENWTVVTGDHVEAPAKIRAALQKKGHVLQSIAGGTIC  551

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ            +  G L AVSDPRKGG PA  
Sbjct  552  QFVVQEF--------KSSKLGELVAVSDPRKGGFPAGF  581



>ref|XP_010321470.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X2 [Solanum 
lycopersicum]
Length=574

 Score =   248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 149/218 (68%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH  +VD++RNAVSMT+TVN  FG   +SPSTGIVLNNEM DFSAP + S
Sbjct  365  KWNQINDHGTSHMSVVDSERNAVSMTSTVNSYFGAKYLSPSTGIVLNNEMDDFSAPAKRS  424

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFI P KRPLSSMTP +VLK  QL AV+G SGG  IIA   +VFLNH   G
Sbjct  425  ENVPPPAPANFIHPGKRPLSSMTPTIVLKGGQLGAVVGASGGAMIIAGTIEVFLNHFARG  484

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP  +V +PR YH+LIPN + YENWT++ G+H+E     R  L+ +GH L++   G IC
Sbjct  485  MDPFASVMAPRYYHQLIPNELQYENWTVVTGDHVEAPAKIRADLQKKGHVLKSIAGGTIC  544

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ            +  G L AVSDPRKGG PA  
Sbjct  545  QFVVQEF--------KSSKLGELVAVSDPRKGGFPAGF  574



>ref|XP_001772768.1| predicted protein [Physcomitrella patens]
 gb|EDQ62482.1| predicted protein [Physcomitrella patens]
Length=552

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 159/227 (70%), Gaps = 9/227 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW QL DHGTSHF IVD  RNAV+MTTT+NY FG  ++SPSTG++LNNEM DF+ PT   
Sbjct  326  RWRQLEDHGTSHFSIVDPHRNAVAMTTTINYPFGALMLSPSTGVILNNEMDDFAIPTSQP  385

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            P  LPP P NF+ P KRPLSSMTP +VLKD +L  V+GGSGG  II TVAQVF+N  V  
Sbjct  386  PGYLPPPPQNFVRPGKRPLSSMTPTIVLKDGRLYGVLGGSGGNKIITTVAQVFINQFVKK  445

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            +DPL +V + RV+H+L+PN + YENWT++ G+H+EL    RR LE +GH L+A  SGA+C
Sbjct  446  LDPLTSVATTRVHHQLVPNVIHYENWTLVTGKHVELGEITRRGLESKGHILEAHTSGAVC  505

Query  541  QLLVQNLPKPGQ-------WLNNGTF--HGMLTAVSDPRKGGSPAAI  654
            QL+VQ+L  P +       WL    +   G L  VSD RK G+PA +
Sbjct  506  QLVVQDLKTPIRMSLFKMGWLRGPRYSSRGKLIGVSDERKDGAPAGL  552



>ref|XP_004240001.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X1 [Solanum 
lycopersicum]
Length=581

 Score =   248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 149/218 (68%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH  +VD++RNAVSMT+TVN  FG   +SPSTGIVLNNEM DFSAP + S
Sbjct  372  KWNQINDHGTSHMSVVDSERNAVSMTSTVNSYFGAKYLSPSTGIVLNNEMDDFSAPAKRS  431

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFI P KRPLSSMTP +VLK  QL AV+G SGG  IIA   +VFLNH   G
Sbjct  432  ENVPPPAPANFIHPGKRPLSSMTPTIVLKGGQLGAVVGASGGAMIIAGTIEVFLNHFARG  491

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP  +V +PR YH+LIPN + YENWT++ G+H+E     R  L+ +GH L++   G IC
Sbjct  492  MDPFASVMAPRYYHQLIPNELQYENWTVVTGDHVEAPAKIRADLQKKGHVLKSIAGGTIC  551

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ            +  G L AVSDPRKGG PA  
Sbjct  552  QFVVQEF--------KSSKLGELVAVSDPRKGGFPAGF  581



>gb|EAZ30956.1| hypothetical protein OsJ_15033 [Oryza sativa Japonica Group]
Length=493

 Score =   245 bits (626),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 148/216 (69%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ L+DHGTSH  IVD++RNAVSMTTTVN  FG  ++SPSTGI+LNNEM DFS P   S
Sbjct  286  RWNILQDHGTSHLSIVDSERNAVSMTTTVNAYFGSLILSPSTGILLNNEMDDFSMPANTS  345

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANF+ P KRPLSSMTP ++LKD  L A +G SGG+ I A   +V LNH V  
Sbjct  346  ANSPPPAPANFVRPLKRPLSSMTPTIILKDGNLKAAVGASGGSMIPAGTMEVLLNHFVKN  405

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT + G+H EL    R  L  +GH L+    G I 
Sbjct  406  MDPLSSVMAPRVYHQLIPNVVQYENWTTVTGDHFELDAATRADLRRKGHVLEPLAGGTIS  465

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            QL+V ++ +          HG LTAVSDPRKGG PA
Sbjct  466  QLVVDDVER----------HGGLTAVSDPRKGGFPA  491



>ref|XP_004975832.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Setaria italica]
Length=578

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 149/216 (69%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW  L+DHGTSH  I+D++RNAVSMT+TVN  FG  ++SPSTGI+LNNEM DFS P   +
Sbjct  371  RWDILQDHGTSHLSIIDSERNAVSMTSTVNSYFGSLILSPSTGILLNNEMDDFSMPANTT  430

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANF+SP KRPLSSMTP +VLKD +L A +G SGG  I A   +VFLNH V  
Sbjct  431  ANSPPPAPANFVSPLKRPLSSMTPTIVLKDGKLKAAVGASGGAMIPAGTIEVFLNHFVRN  490

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT + G+H EL    R  L+  GH L+    G I 
Sbjct  491  MDPLASVMAPRVYHQLIPNVVQYENWTTVTGDHFELDAATRADLQKIGHVLKPLAGGTIG  550

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            QL+V N+ +          HG LTAVSDPRKGG PA
Sbjct  551  QLVVHNVER----------HGDLTAVSDPRKGGVPA  576



>ref|XP_007163614.1| hypothetical protein PHAVU_001G249200g [Phaseolus vulgaris]
 gb|ESW35608.1| hypothetical protein PHAVU_001G249200g [Phaseolus vulgaris]
Length=583

 Score =   248 bits (632),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 150/219 (68%), Gaps = 3/219 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH C++D +RNA+SMTTTVN  FG  ++SPSTGIVLNNEM DFS P  VS
Sbjct  367  KWNQIHDHGTSHLCVIDLERNAISMTTTVNAYFGSKILSPSTGIVLNNEMDDFSIPRNVS  426

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D  PP+P+NFI P KRPLSSM+P + LKD +L AV+G SGG  II   ++V LNH   G
Sbjct  427  KDVPPPAPSNFIMPGKRPLSSMSPTIALKDGKLKAVVGASGGAFIIGGTSEVLLNHFGKG  486

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            +DP  +V +PRVYH+LIPN V YENWT + G+H EL    R+ L  +GH LQ+   G IC
Sbjct  487  LDPFSSVTAPRVYHQLIPNVVNYENWTTVTGDHFELGADIRKVLRSKGHVLQSLAGGTIC  546

Query  541  Q-LLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q ++V+N     +    G     L AVSDPRKGG PA  
Sbjct  547  QFIVVENSVSSRKTKVTGIER--LVAVSDPRKGGLPAGF  583



>ref|XP_010531409.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Tarenaya hassleriana]
 ref|XP_010531410.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Tarenaya hassleriana]
Length=580

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 152/220 (69%), Gaps = 9/220 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            RW+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  V+SPSTGIVLN+EM DFS P++V 
Sbjct  364  RWNQINDHGTSHLSIIDQERNAVSMTSTINRYFGAVVLSPSTGIVLNDEMDDFSVPSKVN  423

Query  178  SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            S D  PP+PANFI P KRPLSSM P +VLKDN++ A +G SGG NIIA   +VF+NH  L
Sbjct  424  SKDVPPPAPANFIRPGKRPLSSMAPTIVLKDNKVKAAVGASGGANIIAGTTEVFINHFFL  483

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDPL +V +PR+YH+LIPN V YENWT    +H E+    R  L  +GH LQ    G I
Sbjct  484  KMDPLSSVLAPRIYHQLIPNNVFYENWTTAYNDHFEVPKDIRDGLRKKGHVLQEIPGGTI  543

Query  538  CQLLVQNLPKPGQWLNNGTFHG---MLTAVSDPRKGGSPA  648
             QL+VQ L       ++G  HG    L AVSDPRKGG PA
Sbjct  544  SQLVVQELDG-----SSGNSHGDVSELVAVSDPRKGGFPA  578



>emb|CAD40892.2| OSJNBa0036B21.10 [Oryza sativa Japonica Group]
Length=574

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 148/216 (69%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ L+DHGTSH  IVD++RNAVSMTTTVN  FG  ++SPSTGI+LNNEM DFS P   S
Sbjct  367  RWNILQDHGTSHLSIVDSERNAVSMTTTVNAYFGSLILSPSTGILLNNEMDDFSMPANTS  426

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANF+ P KRPLSSMTP ++LKD  L A +G SGG+ I A   +V LNH V  
Sbjct  427  ANSPPPAPANFVRPLKRPLSSMTPTIILKDGNLKAAVGASGGSMIPAGTMEVLLNHFVKN  486

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT + G+H EL    R  L  +GH L+    G I 
Sbjct  487  MDPLSSVMAPRVYHQLIPNVVQYENWTTVTGDHFELDAATRADLRRKGHVLEPLAGGTIS  546

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            QL+V ++ +          HG LTAVSDPRKGG PA
Sbjct  547  QLVVDDVER----------HGGLTAVSDPRKGGFPA  572



>ref|XP_003538504.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Glycine max]
Length=613

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 151/218 (69%), Gaps = 1/218 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ + DHGTSH  I+D +RNA+SMT+TVN  FG  ++SPSTGIVLNNEM DFS P  V+
Sbjct  397  RWNPINDHGTSHLSIIDPERNAISMTSTVNSYFGSKILSPSTGIVLNNEMDDFSIPRNVT  456

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D  PP+PANFI P KRPLSSM+P +VLKD +L AV+G SGG  II   A+V LNH V G
Sbjct  457  KDVPPPAPANFIKPGKRPLSSMSPTIVLKDGKLKAVVGASGGGFIIGGTAEVLLNHFVKG  516

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            ++P  +V +PRVYH+L+PN V YENWT + G+H E+    R+ L+ +GH L+    G IC
Sbjct  517  LNPFSSVTAPRVYHQLLPNVVNYENWTTVFGDHFEVPADIRKALKSKGHVLKGLAGGTIC  576

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +V +   P +  N G  +  L AVSDPRKGG PA  
Sbjct  577  QFIVLDTIVPSKQ-NKGIENETLVAVSDPRKGGFPAGF  613



>gb|ABB59570.1| putative gamma-glutamyl transferase [Populus tremula x Populus 
alba]
Length=252

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 147/217 (68%), Gaps = 6/217 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGT H  +VD +RNAVSMT TVN  FG  ++SPSTGI+LNNEM DFS P   +
Sbjct  41   RWNQILDHGTGHISVVDIERNAVSMTNTVNAYFGSNILSPSTGILLNNEMDDFSIPMN-N  99

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D  PP+P NFI P KRPLSSMTP ++LKD +L AV+G SGG  IIA   +V LNHL  G
Sbjct  100  GDVPPPAPPNFIRPGKRPLSSMTPTIILKDEKLKAVVGASGGAMIIAGTTEVILNHL-RG  158

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT   GEH E+    R FL  RGH LQ+   G+IC
Sbjct  159  MDPLHSVLAPRVYHQLIPNVVQYENWTTPYGEHYEVPANVRAFLHKRGHVLQSLAGGSIC  218

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAA  651
            Q +  ++    +  N G   G L  VSDPRKGG PA 
Sbjct  219  QFIFVDVETSRK--NKG--RGELVGVSDPRKGGFPAG  251



>gb|EAY94378.1| hypothetical protein OsI_16142 [Oryza sativa Indica Group]
Length=573

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 148/216 (69%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ L+DHGTSH  IVD++RNAVSMTTTVN  FG  ++SPSTGI+LNNEM DFS P   S
Sbjct  366  RWNILQDHGTSHLSIVDSERNAVSMTTTVNAYFGSLILSPSTGILLNNEMDDFSMPANTS  425

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANF+ P KRPLSSMTP ++LKD  L A +G SGG+ I A   +V LNH V  
Sbjct  426  ANSPPPAPANFVRPLKRPLSSMTPTIILKDGNLKAAVGASGGSMIPAGTMEVLLNHFVKN  485

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT + G+H EL    R  L  +GH L+    G I 
Sbjct  486  MDPLSSVMAPRVYHQLIPNVVQYENWTTVTGDHFELDAATRADLRRKGHVLEPLAGGTIS  545

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            QL+V ++ +          HG LTAVSDPRKGG PA
Sbjct  546  QLVVDDVER----------HGGLTAVSDPRKGGFPA  571



>ref|XP_006591400.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X2 [Glycine 
max]
Length=486

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 150/218 (69%), Gaps = 1/218 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ + DHGTSH  I+D +RNA++MT TVN  FG  ++SPSTGIVLNNEM DFS P  V+
Sbjct  270  RWNPINDHGTSHLSIIDPERNAIAMTCTVNSYFGSKILSPSTGIVLNNEMDDFSIPRNVT  329

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D  PP+PANFI P KRPLSSM+P +VLKD +L AV+G SGG  II   A+V LNH V G
Sbjct  330  KDVPPPAPANFIMPGKRPLSSMSPTIVLKDGKLKAVVGASGGGFIIGGTAEVLLNHFVKG  389

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            ++P  +V +PRVYH+L+PN V YENWT + G+H E+    R+ L+ +GH L+    G IC
Sbjct  390  LNPFSSVTAPRVYHQLLPNVVNYENWTTVFGDHFEVPADIRKALKSKGHVLKGLAGGTIC  449

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +V +   P +  N G  +  L AVSDPRKGG PA  
Sbjct  450  QFIVLDTIVPYEQ-NKGIENETLVAVSDPRKGGFPAGF  486



>emb|CAH67025.1| H0523F07.13 [Oryza sativa Indica Group]
Length=574

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 148/216 (69%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ L+DHGTSH  IVD++RNAVSMTTTVN  FG  ++SPSTGI+LNNEM DFS P   S
Sbjct  367  RWNILQDHGTSHLSIVDSERNAVSMTTTVNAYFGSLILSPSTGILLNNEMDDFSMPANTS  426

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANF+ P KRPLSSMTP ++LKD  L A +G SGG+ I A   +V LNH V  
Sbjct  427  ANSPPPAPANFVRPLKRPLSSMTPTIILKDGNLKAAVGASGGSMIPAGTMEVLLNHFVKN  486

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT + G+H EL    R  L  +GH L+    G I 
Sbjct  487  MDPLSSVMAPRVYHQLIPNVVQYENWTTVTGDHFELDAATRADLRRKGHVLEPLAGGTIS  546

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            QL+V ++ +          HG LTAVSDPRKGG PA
Sbjct  547  QLVVDDVER----------HGGLTAVSDPRKGGFPA  572



>ref|XP_002447955.1| hypothetical protein SORBIDRAFT_06g018740 [Sorghum bicolor]
 gb|EES12283.1| hypothetical protein SORBIDRAFT_06g018740 [Sorghum bicolor]
Length=457

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 149/216 (69%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ L+DHGTSH  IVD++RNAVSMT+TVN  FG  + SP TGI+LNNEM DFS P   +
Sbjct  250  RWNILQDHGTSHLSIVDSERNAVSMTSTVNSYFGSLIHSPRTGILLNNEMDDFSMPANTT  309

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANF+SP KRPLSSMTP +V+KD +L + +G SGG+ I A   +VF+NH V  
Sbjct  310  ENSPPPAPANFVSPMKRPLSSMTPTIVVKDGKLVSAVGASGGSMIPAGTIEVFINHFVKN  369

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT + G+H EL    R  L+ RGH L+    G I 
Sbjct  370  MDPLASVMAPRVYHQLIPNEVKYENWTTVTGDHFELDAATRADLQKRGHVLKPLAGGTIS  429

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            QL+V N+ + G           LTAVSDPRKGG PA
Sbjct  430  QLVVHNVGRQGD----------LTAVSDPRKGGVPA  455



>gb|KHN04812.1| Gamma-glutamyltranspeptidase 1 [Glycine soja]
Length=588

 Score =   245 bits (625),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 150/218 (69%), Gaps = 1/218 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ + DHGTSH  I+D +RNA++MT TVN  FG  ++SPSTGIVLNNEM DFS P  V+
Sbjct  372  RWNPINDHGTSHLSIIDPERNAIAMTCTVNSYFGSKILSPSTGIVLNNEMDDFSIPRNVT  431

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D  PP+PANFI P KRPLSSM+P +VLKD +L AV+G SGG  II   A+V LNH V G
Sbjct  432  KDVPPPAPANFIMPGKRPLSSMSPTIVLKDGKLKAVVGASGGGFIIGGTAEVLLNHFVKG  491

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            ++P  +V +PRVYH+L+PN V YENWT + G+H E+    R+ L+ +GH L+    G IC
Sbjct  492  LNPFSSVTAPRVYHQLLPNVVNYENWTTVFGDHFEVPADIRKALKSKGHVLKGLAGGTIC  551

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +V +   P +  N G  +  L AVSDPRKGG PA  
Sbjct  552  QFIVLDTIVPSEQ-NKGIENETLVAVSDPRKGGFPAGF  588



>ref|XP_010099916.1| Gamma-glutamyltranspeptidase 1 [Morus notabilis]
 gb|EXB80845.1| Gamma-glutamyltranspeptidase 1 [Morus notabilis]
Length=618

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 146/218 (67%), Gaps = 4/218 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH  ++D   NAVSMTTTVN  FG  +MSPSTGI+LNNEM DFS P  VS
Sbjct  405  KWNQIYDHGTSHLSVIDHQENAVSMTTTVNSYFGSKIMSPSTGIILNNEMDDFSMPGNVS  464

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                PP+P NFI P KRPLSSM+P +VLKDNQL AV+G SGGT I + V +V LNH    
Sbjct  465  TGIQPPAPPNFIRPGKRPLSSMSPTIVLKDNQLKAVLGASGGTFIFSAVGEVLLNHFAKK  524

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP  ++ +PR+YH+LIPN V YENWT + G+HIE++   R  L+ +GH L+    G IC
Sbjct  525  MDPFSSIMTPRIYHQLIPNVVKYENWTTVIGDHIEVAANIRESLQKKGHVLEGLAGGTIC  584

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ     G+          + AVSDPRKGG P+  
Sbjct  585  QFIVQY----GETSKENKHIRKIVAVSDPRKGGFPSGF  618



>tpg|DAA37487.1| TPA: hypothetical protein ZEAMMB73_406570 [Zea mays]
Length=457

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 145/216 (67%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ L DHGTSH  IVD++RNAVSMT+TVN  FG  ++SP TG++LNNEM DFS P   S
Sbjct  250  RWNILEDHGTSHLSIVDSERNAVSMTSTVNAYFGSLILSPRTGVLLNNEMDDFSMPANAS  309

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANF+SP KRPLSSM P VV+KD +L A +G SGG  I A   +VF+NH V  
Sbjct  310  ENSPPPAPANFVSPLKRPLSSMAPTVVVKDGKLVAAVGASGGGMIPAGTIEVFINHFVKN  369

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT + G+H EL    R  L  RGH L     G I 
Sbjct  370  MDPLASVMAPRVYHQLIPNEVRYENWTTVTGDHFELDAATRADLHRRGHVLTPIAGGTIS  429

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            QL+V N+ + G           LTAVSDPRKGG PA
Sbjct  430  QLVVHNVGRQGD----------LTAVSDPRKGGVPA  455



>emb|CDY30227.1| BnaA03g49430D [Brassica napus]
Length=318

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 143/202 (71%), Gaps = 3/202 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +++QL D GT+HFC+VD DRNAVSMTTTVNY FG G MSPSTGI+LN +M DF+ PT VS
Sbjct  114  KYNQLEDQGTTHFCVVDKDRNAVSMTTTVNYAFGSGFMSPSTGIILNGQMEDFAIPTLVS  173

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
               LPP+P N+I+P KR LSSM P+++ +DN+L  VIG SGG  I   V QVFLNH +  
Sbjct  174  SYSLPPAPTNYIAPKKRALSSMMPLIITQDNELVGVIGASGGPYIFPAVIQVFLNHFIFK  233

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PLEAVQ PRVY KL PNTVLYE+ T+ +G+HI+L+   R FL+ RGH+L     G I 
Sbjct  234  MSPLEAVQRPRVYPKLKPNTVLYEDMTVYNGDHIKLTEETREFLKGRGHELVVTSVGGIV  293

Query  541  Q--LLVQNLPKPGQWLNN-GTF  597
            Q  L V  L +  +W+   GT+
Sbjct  294  QVWLSVTFLFEMLKWMKKLGTY  315



>ref|XP_003537501.2| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X1 [Glycine 
max]
Length=613

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 150/218 (69%), Gaps = 1/218 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ + DHGTSH  I+D +RNA++MT TVN  FG  ++SPSTGIVLNNEM DFS P  V+
Sbjct  397  RWNPINDHGTSHLSIIDPERNAIAMTCTVNSYFGSKILSPSTGIVLNNEMDDFSIPRNVT  456

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D  PP+PANFI P KRPLSSM+P +VLKD +L AV+G SGG  II   A+V LNH V G
Sbjct  457  KDVPPPAPANFIMPGKRPLSSMSPTIVLKDGKLKAVVGASGGGFIIGGTAEVLLNHFVKG  516

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            ++P  +V +PRVYH+L+PN V YENWT + G+H E+    R+ L+ +GH L+    G IC
Sbjct  517  LNPFSSVTAPRVYHQLLPNVVNYENWTTVFGDHFEVPADIRKALKSKGHVLKGLAGGTIC  576

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +V +   P +  N G  +  L AVSDPRKGG PA  
Sbjct  577  QFIVLDTIVPYEQ-NKGIENETLVAVSDPRKGGFPAGF  613



>ref|XP_003581307.2| PREDICTED: gamma-glutamyltranspeptidase 1-like [Brachypodium 
distachyon]
Length=572

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 145/216 (67%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ L+DHGTSH  +VD +RNAVSMT+TVN  FG  ++SPSTG++LNNEM DFS P   S
Sbjct  365  RWNILQDHGTSHLSVVDGERNAVSMTSTVNSYFGSLILSPSTGVLLNNEMDDFSMPANTS  424

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  P +PANF+SP KRPLSSM P +VLKD +L AV+G SGG+ I A   +VFLNH    
Sbjct  425  ANSPPSAPANFVSPLKRPLSSMCPTIVLKDGKLKAVVGASGGSMIPAGTLEVFLNHFAKK  484

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT + G+H EL    R  L  +GH L     G I 
Sbjct  485  MDPLSSVMAPRVYHQLIPNVVQYENWTTVSGDHFELDAATRADLRKKGHVLAPLAGGTIT  544

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            QLLV N+   G           LTAVSDPRKGG PA
Sbjct  545  QLLVHNIETRGD----------LTAVSDPRKGGFPA  570



>gb|KFK29479.1| hypothetical protein AALP_AA7G139300 [Arabis alpina]
Length=600

 Score =   243 bits (619),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 147/217 (68%), Gaps = 8/217 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +++QL D GT+HFC+VD DRNAVSMTTT+NY FG G MSP+TG++LN +M DF+ PT  S
Sbjct  389  KYNQLEDQGTTHFCVVDKDRNAVSMTTTLNYAFGSGFMSPTTGVILNGQMEDFAIPTLNS  448

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            P  LPP+PANFI+P KR LSSM P+++ KD +L  VIG SGG  I   V QVFLNH +  
Sbjct  449  PSSLPPAPANFIAPKKRALSSMMPLIITKDKELVGVIGASGGPYIFPAVIQVFLNHFIFK  508

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PLEAVQSPRVY KL PN V YE+  + +G+HI+L    + FL+ R H+L     G I 
Sbjct  509  MSPLEAVQSPRVYPKLKPNEVWYEDMKVYNGDHIKLKEETQEFLKMRRHKLVVTTVGGIV  568

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAA  651
            Q +VQN     + +        LTAVSD RK G PAA
Sbjct  569  QFVVQNRVHDSKTV--------LTAVSDLRKDGKPAA  597



>gb|KFK29478.1| hypothetical protein AALP_AA7G139300 [Arabis alpina]
Length=601

 Score =   243 bits (619),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 147/217 (68%), Gaps = 8/217 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +++QL D GT+HFC+VD DRNAVSMTTT+NY FG G MSP+TG++LN +M DF+ PT  S
Sbjct  390  KYNQLEDQGTTHFCVVDKDRNAVSMTTTLNYAFGSGFMSPTTGVILNGQMEDFAIPTLNS  449

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            P  LPP+PANFI+P KR LSSM P+++ KD +L  VIG SGG  I   V QVFLNH +  
Sbjct  450  PSSLPPAPANFIAPKKRALSSMMPLIITKDKELVGVIGASGGPYIFPAVIQVFLNHFIFK  509

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PLEAVQSPRVY KL PN V YE+  + +G+HI+L    + FL+ R H+L     G I 
Sbjct  510  MSPLEAVQSPRVYPKLKPNEVWYEDMKVYNGDHIKLKEETQEFLKMRRHKLVVTTVGGIV  569

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAA  651
            Q +VQN     + +        LTAVSD RK G PAA
Sbjct  570  QFVVQNRVHDSKTV--------LTAVSDLRKDGKPAA  598



>gb|EYU31066.1| hypothetical protein MIMGU_mgv1a003688mg [Erythranthe guttata]
 gb|EYU31067.1| hypothetical protein MIMGU_mgv1a003688mg [Erythranthe guttata]
Length=570

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 147/216 (68%), Gaps = 12/216 (6%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  IVD  RNAVSMT+T+N  FG   +SP+TGI+LNNEM DFS P   S
Sbjct  365  RWNQIHDHGTSHVSIVDGQRNAVSMTSTINGYFGSKFLSPTTGIILNNEMDDFSMPANKS  424

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANFI P KRPLSSMTP +V+KD QL AV+G SGG+ IIA   +V LN+L  G
Sbjct  425  ENVPPPAPANFIVPGKRPLSSMTPTIVVKDGQLKAVVGASGGSLIIAGTTEVLLNYLARG  484

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR YH+LIPN + YENWT+  G+H E+    R  L+ +GH L++   G IC
Sbjct  485  MDPLSSVLAPRSYHQLIPNVLRYENWTVPTGDHFEVRREIRDALKKKGHVLESISGGTIC  544

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +VQ L            +G L  VSDPRKGG PA
Sbjct  545  QFVVQEL------------NGHLIGVSDPRKGGFPA  568



>ref|XP_009101855.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Brassica rapa]
 ref|XP_009101856.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Brassica rapa]
Length=567

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 146/218 (67%), Gaps = 14/218 (6%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            RW+Q++DHGTSH  I+D +RN VSMT+T+N  FG  ++SPSTGIVLNNEM DFS P +  
Sbjct  360  RWNQIKDHGTSHLSIIDHERNCVSMTSTINAFFGALMLSPSTGIVLNNEMDDFSIPLKSF  419

Query  178  -SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
               DK PP+PANFI P KRPLSSMTP +VLKD ++ A +G SGG  IIA   +VFLNH +
Sbjct  420  HDSDKPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAAVGASGGMYIIAGTTEVFLNHFL  479

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN+V YENWT    +H E+  G R  LE +GH L     G 
Sbjct  480  LNMDPLSSVVAPRIYHQLIPNSVKYENWTTAYNDHFEIPKGTRHVLEKKGHVLTPFAGGT  539

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            I Q +VQ               G L AVSDPRKGG P+
Sbjct  540  ISQFIVQE------------SDGKLVAVSDPRKGGFPS  565



>emb|CDY53167.1| BnaA06g40460D [Brassica napus]
Length=567

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 146/218 (67%), Gaps = 14/218 (6%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            RW+Q++DHGTSH  I+D +RN VSMT+T+N  FG  ++SPSTGIVLNNEM DFS P +  
Sbjct  360  RWNQIKDHGTSHLSIIDHERNCVSMTSTINAFFGALMLSPSTGIVLNNEMDDFSIPLKSF  419

Query  178  -SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
               DK PP+PANFI P KRPLSSMTP +VLKD ++ A +G SGG  IIA   +VFLNH +
Sbjct  420  HDSDKPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAAVGASGGMYIIAGTTEVFLNHFL  479

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN+V YENWT    +H E+  G R  LE +GH L     G 
Sbjct  480  LNMDPLSSVVAPRIYHQLIPNSVKYENWTTAYNDHFEIPKGTRHVLEKKGHVLTPFAGGT  539

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            I Q +VQ               G L AVSDPRKGG P+
Sbjct  540  ISQFIVQE------------SDGKLVAVSDPRKGGFPS  565



>ref|NP_001147571.1| gamma-glutamyltranspeptidase 1 precursor [Zea mays]
 gb|ACG27955.1| gamma-glutamyltranspeptidase 1 precursor [Zea mays]
 tpg|DAA37486.1| TPA: gamma-glutamyltranspeptidase 1 [Zea mays]
Length=580

 Score =   240 bits (613),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 145/216 (67%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ L DHGTSH  IVD++RNAVSMT+TVN  FG  ++SP TG++LNNEM DFS P   S
Sbjct  373  RWNILEDHGTSHLSIVDSERNAVSMTSTVNAYFGSLILSPRTGVLLNNEMDDFSMPANAS  432

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+PANF+SP KRPLSSM P VV+KD +L A +G SGG  I A   +VF+NH V  
Sbjct  433  ENSPPPAPANFVSPLKRPLSSMAPTVVVKDGKLVAAVGASGGGMIPAGTIEVFINHFVKN  492

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT + G+H EL    R  L  RGH L     G I 
Sbjct  493  MDPLASVMAPRVYHQLIPNEVRYENWTTVTGDHFELDAATRADLHRRGHVLTPIAGGTIS  552

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            QL+V N+ + G           LTAVSDPRKGG PA
Sbjct  553  QLVVHNVGRQGD----------LTAVSDPRKGGVPA  578



>ref|XP_002306343.1| gamma-glutamyltranspeptidase family protein [Populus trichocarpa]
 gb|EEE93339.1| gamma-glutamyltranspeptidase family protein [Populus trichocarpa]
Length=624

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 147/231 (64%), Gaps = 19/231 (8%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  IVD++RNAVSMT TVN  FG  ++SPSTGIVLNNEM DFS P   +
Sbjct  396  RWNQINDHGTSHISIVDSERNAVSMTNTVNSYFGTQILSPSTGIVLNNEMDDFSMPGNNT  455

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                PP+P N I P KRPLSSMTP +VLKD QL  V+G SGG+ IIA   +V LNH   G
Sbjct  456  GHVPPPAPLNLIRPGKRPLSSMTPTIVLKDEQLKGVVGASGGSMIIAGTTEVLLNHFAKG  515

Query  361  MDPLEAVQSPRVYHK---------------LIPNTVLYENWTIMDGEHIELSGGRRRFLE  495
            MDPL +V +PRVYH+               L PN V YENWT + G+H ELS   R FL+
Sbjct  516  MDPLSSVLAPRVYHQVYMQFTPLGMACRFLLTPNVVQYENWTTVYGDHFELSADVRAFLQ  575

Query  496  DRGHQLQAQESGAICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
             RGH L+    G ICQ +VQ+L    +        G L AVSDPRKGG PA
Sbjct  576  KRGHVLKGIAGGTICQFIVQDL----ETTEGNKLMGKLVAVSDPRKGGLPA  622



>ref|XP_007207202.1| hypothetical protein PRUPE_ppa002642mg [Prunus persica]
 gb|EMJ08401.1| hypothetical protein PRUPE_ppa002642mg [Prunus persica]
Length=649

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 147/218 (67%), Gaps = 5/218 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  I+D ++NAVSMTTTVN  FG  ++S STGI+LNNEM DFS P   S
Sbjct  437  RWNQIHDHGTSHLSIIDNEQNAVSMTTTVNGYFGSQILSSSTGIILNNEMDDFSIPGNDS  496

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                PP+P NFI P KRPLSSMTP +VLKD QL AV+G SGG  IIA  AQV LNH   G
Sbjct  497  TVP-PPAPPNFIRPGKRPLSSMTPTIVLKDEQLKAVVGASGGGMIIAATAQVLLNHFARG  555

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            +DPL +V +PRVYH+L+PN V YENWT + G+H E+    R+ L  +GH L     G+IC
Sbjct  556  LDPLSSVMAPRVYHQLLPNVVQYENWTTVTGDHFEVPAQIRKALHKKGHVLDPLSGGSIC  615

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ +    + L N      + AVSDPRKGG PA  
Sbjct  616  QFIVQQI----EALKNNGGTREIVAVSDPRKGGFPAGF  649



>ref|XP_009101854.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Brassica rapa]
Length=570

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 146/218 (67%), Gaps = 14/218 (6%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W++L+DHGTSH  I+D DRNAVSMT TVNY FG  ++SPSTGIVLNNEM DFS P +  
Sbjct  363  KWNELQDHGTSHLSIIDKDRNAVSMTNTVNYFFGALMLSPSTGIVLNNEMDDFSIPMKFV  422

Query  181  PDK-LP-PSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
             D+ +P P+PANFI P KRPLSSM P +VLKD ++ A +G SGG  IIA   +VFLNH  
Sbjct  423  GDRNVPLPAPANFIRPGKRPLSSMAPTIVLKDGKVKASVGASGGIFIIAGTTEVFLNHFF  482

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN VLYENWT +  +H E+    R  LE +GH L     G 
Sbjct  483  LNMDPLSSVLAPRIYHQLIPNRVLYENWTTVYDDHFEIPKETRDVLEKKGHVLAPIAGGM  542

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            I Q +VQ               G L AVSDPRKGG P+
Sbjct  543  ISQFIVQE------------SDGKLVAVSDPRKGGFPS  568



>emb|CDY53166.1| BnaA06g40450D [Brassica napus]
Length=581

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 146/218 (67%), Gaps = 14/218 (6%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W++L+DHGTSH  I+D DRNAVSMT TVNY FG  ++SPSTGIVLNNEM DFS P +  
Sbjct  374  KWNELQDHGTSHLSIIDKDRNAVSMTNTVNYFFGALMLSPSTGIVLNNEMDDFSIPMKFV  433

Query  181  PDK-LP-PSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
             D+ +P P+PANFI P KRPLSSM P +VLKD ++ A +G SGG  IIA   +VFLNH  
Sbjct  434  GDRNVPLPAPANFIRPGKRPLSSMAPTIVLKDGKVKASVGASGGIFIIAGTTEVFLNHFF  493

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN VLYENWT +  +H E+    R  LE +GH L     G 
Sbjct  494  LNMDPLSSVLAPRIYHQLIPNRVLYENWTTVYDDHFEIPKETRDVLEKKGHVLAPIAGGM  553

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            I Q +VQ               G L AVSDPRKGG P+
Sbjct  554  ISQFIVQE------------SDGKLVAVSDPRKGGFPS  579



>ref|XP_006838436.1| hypothetical protein AMTR_s00002p00125730, partial [Amborella 
trichopoda]
 gb|ERN01005.1| hypothetical protein AMTR_s00002p00125730, partial [Amborella 
trichopoda]
Length=216

 Score =   227 bits (578),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 146/216 (68%), Gaps = 3/216 (1%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            ++Q  DHGTSH  +VD++RNAV +T+TVN  FG    S  TG++LNN+M DFS P+  + 
Sbjct  1    YNQTIDHGTSHMSVVDSERNAVGLTSTVNNFFGAWFRSRRTGMILNNQMDDFSIPSNTTS  60

Query  184  DK-LPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            +  +PP+PANFI P+KRPLSS  P ++LK+ QL AVIG SGG  II    QVFLNH V  
Sbjct  61   NTTMPPAPANFIVPHKRPLSSTMPTIILKNGQLNAVIGASGGPRIIPANIQVFLNHFVHN  120

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP  A+ +PRVYH+LIPN V YE W  + G+HIE+S   R  L  +GH+LQA   GA C
Sbjct  121  MDPFSAILAPRVYHRLIPNFVEYEKWDTVSGDHIEVSLRDRLGLARKGHKLQALAFGAKC  180

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +VQ+LP   +        G LTAVSDPRKGG PA
Sbjct  181  QFVVQHLPIMAK--GKSIIMGNLTAVSDPRKGGFPA  214



>ref|XP_011006915.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Populus euphratica]
Length=582

 Score =   237 bits (604),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 147/216 (68%), Gaps = 6/216 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  +VD +RNAVSMT TVN  FG  ++SPSTGI+LNNEM DFS P   +
Sbjct  371  RWNQIHDHGTSHISVVDTERNAVSMTNTVNAYFGSNILSPSTGILLNNEMDDFSIPMN-N  429

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D  PP+P N I P KRPLSSMTP ++LKD +L AV+G SGG  IIA   +V LNHL  G
Sbjct  430  GDVPPPAPPNSIRPGKRPLSSMTPTIILKDEKLKAVVGASGGAMIIAGTTEVILNHL-RG  488

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT   GEH E+    R FL  RGH LQ+   G+IC
Sbjct  489  MDPLHSVLAPRVYHQLIPNVVQYENWTTPYGEHYEVPANIRAFLRKRGHVLQSLAGGSIC  548

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +  ++    +  N G   G L  VSDPRKGG PA
Sbjct  549  QFIFVDVETSRK--NKG--RGKLVGVSDPRKGGFPA  580



>ref|XP_002866873.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43132.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=578

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 150/220 (68%), Gaps = 12/220 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q++DHGTSH  I+D++RNAVSMTTT+N  FG  ++SPSTGIVLNNEM DFS P +  
Sbjct  365  KWNQIKDHGTSHLSIIDSERNAVSMTTTINGYFGAIMLSPSTGIVLNNEMDDFSIPMKSG  424

Query  181  --PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
              PD  PP+PANFI P KRPLSSMTP +VLKD ++ A +G SGG  IIA   +V+LNH  
Sbjct  425  GGPDVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAALGASGGMFIIAGTTEVYLNHFF  484

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN   YENWT +  +H E+    R  LE +GH L     G 
Sbjct  485  LNMDPLSSVVAPRIYHQLIPNKASYENWTTVYNDHFEIPEETRLVLEKKGHVLMPIAGGT  544

Query  535  ICQLLVQNLPKPGQWLNNGTFHGM--LTAVSDPRKGGSPA  648
            I Q +V+         ++G+  GM  L AVSDPRKGG P+
Sbjct  545  ISQFIVEE--------SDGSSGGMSKLVAVSDPRKGGFPS  576



>ref|XP_006411757.1| hypothetical protein EUTSA_v10027365mg [Eutrema salsugineum]
 gb|ESQ53210.1| hypothetical protein EUTSA_v10027365mg [Eutrema salsugineum]
Length=572

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 147/218 (67%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+++ DHGTSH  I+D++RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS P + S
Sbjct  359  KWNEINDHGTSHLSIIDSERNAVSMTSTINGYFGAIMLSPSTGIVLNNEMDDFSIPMKSS  418

Query  181  --PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
               D  PP+PANFI P KRPLSSMTP +VLKD ++ AV+G SGG  IIA   +VFLNH  
Sbjct  419  GGQDVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAVVGASGGMYIIAGTTEVFLNHFF  478

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN + YENWT +  +H E+    R  LE +GH L     G 
Sbjct  479  LNMDPLSSVTAPRIYHQLIPNMISYENWTTVYNDHFEIPKETRVVLEKKGHVLTPLSGGT  538

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            I Q +VQ        LN       L AVSDPRKGG P+
Sbjct  539  ISQFIVQETDGNSGELNK------LVAVSDPRKGGFPS  570



>ref|XP_008387031.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X2 [Malus 
domestica]
Length=577

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 146/217 (67%), Gaps = 9/217 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQ+ DHGTSH  IVD   NAVSMT+TVN  FG  ++S STGIVLNNEM DFS P  VS
Sbjct  367  RWSQINDHGTSHLSIVDPQGNAVSMTSTVNGYFGAHILSSSTGIVLNNEMDDFSIPGNVS  426

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                P +P NFI P KRPLSSMTP +VLKD+QL AV+G SGG  II   A+V LNH   G
Sbjct  427  ASPXP-APPNFIRPGKRPLSSMTPAIVLKDDQLKAVVGASGGALIIPATAEVLLNHFARG  485

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR YH+L+PN V YENWT + G+H E+    R+ L+ +GH L+   SGAIC
Sbjct  486  MDPLSSVMAPRAYHQLLPNVVRYENWTSVTGDHFEVPTQIRKSLQKKGHILEPLTSGAIC  545

Query  541  QLLVQNLPKPGQWL-NNGTFHGMLTAVSDPRKGGSPA  648
            Q +V        W  N GT    + AVSDPRKGG PA
Sbjct  546  QFIVHK-----AWTENEGTPE--IVAVSDPRKGGVPA  575



>ref|XP_008387030.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X1 [Malus 
domestica]
Length=579

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 146/219 (67%), Gaps = 9/219 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQ+ DHGTSH  IVD   NAVSMT+TVN  FG  ++S STGIVLNNEM DFS P  VS
Sbjct  369  RWSQINDHGTSHLSIVDPQGNAVSMTSTVNGYFGAHILSSSTGIVLNNEMDDFSIPGNVS  428

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                P +P NFI P KRPLSSMTP +VLKD+QL AV+G SGG  II   A+V LNH   G
Sbjct  429  ASPXP-APPNFIRPGKRPLSSMTPAIVLKDDQLKAVVGASGGALIIPATAEVLLNHFARG  487

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR YH+L+PN V YENWT + G+H E+    R+ L+ +GH L+   SGAIC
Sbjct  488  MDPLSSVMAPRAYHQLLPNVVRYENWTSVTGDHFEVPTQIRKSLQKKGHILEPLTSGAIC  547

Query  541  QLLVQNLPKPGQWL-NNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +V        W  N GT    + AVSDPRKGG PA  
Sbjct  548  QFIVHK-----AWTENEGTPE--IVAVSDPRKGGVPAGF  579



>emb|CDY47777.1| BnaC07g41830D [Brassica napus]
Length=619

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 144/213 (68%), Gaps = 18/213 (8%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            ++ QL+D GTSHFC+VD DRN VSMTTTVN+ FG G MS STGI+LNN+M DFS  +E S
Sbjct  406  KYKQLKDEGTSHFCVVDKDRNVVSMTTTVNHAFGSGFMSTSTGIILNNQMADFSVTSEES  465

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                   PAN+I  NKRPLSSM P+++ KDN+L  VIG SGG  II  V QVFLNH VL 
Sbjct  466  A-----PPANYIEANKRPLSSMMPLIITKDNELVGVIGASGGIYIIPAVIQVFLNHFVLN  520

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PLEAV+SPRVYHKL PN VLYENWT+ + +HI L+   R FL+ + H++ +   GA  
Sbjct  521  MSPLEAVKSPRVYHKLEPNQVLYENWTVYNQDHILLNKETRDFLKTKKHEIVSTSMGATV  580

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGG  639
            Q +VQ+               +LTAVSD RK G
Sbjct  581  QFVVQD-------------RQVLTAVSDLRKDG  600



>ref|XP_008234476.1| PREDICTED: gamma-glutamyltranspeptidase 1 [Prunus mume]
Length=609

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 144/213 (68%), Gaps = 5/213 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  I+D  +NAVSMTTTVN  FG  ++S STGI+LNNEM DFS P   S
Sbjct  367  RWNQIHDHGTSHLSIIDNKQNAVSMTTTVNGYFGAQILSSSTGIILNNEMDDFSIPGNDS  426

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                PP+P NFI P KRPLSSMTP +VLKD QL AV+G SGG  IIA  AQV LNH   G
Sbjct  427  TVP-PPAPPNFIRPGKRPLSSMTPTIVLKDEQLKAVVGASGGGMIIAATAQVLLNHFARG  485

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            +DPL +V +PRVYH+L+PN V YENWT + G+H E+    R+ L  +GH L     G+IC
Sbjct  486  LDPLSSVMAPRVYHQLLPNVVQYENWTTVTGDHFEVPAQIRKALHKKGHVLDPLSGGSIC  545

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGG  639
            Q +VQ +    + L N      + AVSDPRKGG
Sbjct  546  QFIVQQI----EALKNNGGTREIVAVSDPRKGG  574



>ref|XP_002298608.2| hypothetical protein POPTR_0001s34100g [Populus trichocarpa]
 gb|EEE83413.2| hypothetical protein POPTR_0001s34100g [Populus trichocarpa]
Length=524

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 146/216 (68%), Gaps = 6/216 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  +VD +RNAVSMT TVN  FG  ++SPSTGI+LNNEM +FS P   +
Sbjct  313  RWNQIHDHGTSHISVVDIERNAVSMTNTVNAYFGSNILSPSTGILLNNEMDEFSIPMN-N  371

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D  PP+P N I P KRPLSSMTP ++LKD +L AV+G SGG  IIA   +V LNHL  G
Sbjct  372  GDVPPPAPPNSIRPGKRPLSSMTPTIILKDEKLKAVVGASGGAMIIAGTTEVILNHL-RG  430

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT   GEH E+    R FL  RGH LQ+   G+IC
Sbjct  431  MDPLHSVLAPRVYHQLIPNVVQYENWTTPYGEHYEVPANVRTFLRKRGHVLQSLAGGSIC  490

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +  +     +  N G   G L  VSDPRKGG PA
Sbjct  491  QFIFVDAETSRK--NKG--RGELVGVSDPRKGGFPA  522



>gb|KEH34407.1| gamma-glutamyltranspeptidase [Medicago truncatula]
Length=577

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 149/219 (68%), Gaps = 4/219 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTE-V  177
            +W+Q+ DHGT+H  I+D ++NAVS+T T+N  FG   +SPSTGI+LNNEM DFS P + V
Sbjct  362  KWNQINDHGTTHLSIIDFEKNAVSLTCTINAFFGSKFLSPSTGIILNNEMDDFSMPMKNV  421

Query  178  SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            S +  PP+PANF++P KRPLSS++P + LKD ++ A++G SGG NII   A+V +NH V 
Sbjct  422  SKNVPPPAPANFVAPGKRPLSSISPTIALKDGEVKAIVGASGGANIIPGTAEVLMNHFVK  481

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            GM P  AV +PR YH+LIPN V YENWT   G+H EL    R FL  RGH L+    GAI
Sbjct  482  GMKPFSAVVAPRFYHQLIPNWVSYENWTTPYGDHFELPADIREFLRSRGHVLKPFAGGAI  541

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
             Q +V N+      +N G   G + A+SDPRKGG PA +
Sbjct  542  SQFIVTNVSD-HSGINKGI--GKIVAISDPRKGGFPAGV  577



>gb|AFK39843.1| unknown [Lotus japonicus]
Length=176

 Score =   223 bits (567),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 129/176 (73%), Gaps = 7/176 (4%)
 Frame = +1

Query  148  MGDFSAPTEVSPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATV  327
            M DFS PT+VSPDKLPP+P NFI PNKRPLSSMTPI++ KD+QL  VIGGSGG NII  V
Sbjct  1    MDDFSTPTDVSPDKLPPAPTNFIKPNKRPLSSMTPIIITKDDQLVGVIGGSGGMNIIPAV  60

Query  328  AQVFLNHLVLGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGH  507
            AQVFLNH +LGM PL+AV  PR+YHKLIPN V YE+ T  +G+HI L+   R FLE+RGH
Sbjct  61   AQVFLNHFILGMKPLDAVLRPRIYHKLIPNVVSYEHLTAYNGDHIGLAEESRHFLEERGH  120

Query  508  QLQAQESGAICQLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            +L      A+ QL+VQ L  P       G+  N+   HG+LTAVSDPRKGG PAA+
Sbjct  121  ELCECAVKAVTQLIVQTLDTPIKLNRKTGEKTNSHGMHGILTAVSDPRKGGCPAAV  176



>ref|XP_004302214.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Fragaria vesca 
subsp. vesca]
Length=579

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 144/218 (66%), Gaps = 7/218 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW Q+ DHGTSH  IVD ++NA+SMT+TVN  FG  ++S STGIVLNNEM DFS P  VS
Sbjct  369  RWKQINDHGTSHLSIVDHEQNAISMTSTVNAYFGAQMLSSSTGIVLNNEMDDFSIPGNVS  428

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                PP+ ANFI P KRPLSSMTP ++LKD QL AV+G SGG  II   A+V LNH   G
Sbjct  429  TGP-PPALANFIRPGKRPLSSMTPTIILKDEQLKAVVGASGGAMIIPATAEVLLNHFARG  487

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR YH+L PN V YENWT + G+H EL    R+ L+ +GH L+    GAIC
Sbjct  488  MDPLSSVLAPRFYHQLYPNVVHYENWTTVIGDHFELPAQIRKSLQKKGHVLEPLAGGAIC  547

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +V    K     N G+      AVSDPRKGG PA  
Sbjct  548  QFIVIEALKK----NGGSQE--FVAVSDPRKGGIPAGF  579



>ref|XP_009126207.1| PREDICTED: gamma-glutamyltranspeptidase 1 isoform X2 [Brassica 
rapa]
 ref|XP_009126279.1| PREDICTED: gamma-glutamyltranspeptidase 1 isoform X2 [Brassica 
rapa]
Length=572

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 148/219 (68%), Gaps = 12/219 (5%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS P + S 
Sbjct  360  WNQIDDHGTSHLSIIDRERNAVSMTSTINGYFGAVMLSPSTGIVLNNEMDDFSVPAKSSG  419

Query  184  D--KLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            D    PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +VFLNH  L
Sbjct  420  DLNVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTIEVFLNHFFL  479

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDPL +V +PR+YH+LIPN V +ENWT +  +H E+    R  LE +GH L     G I
Sbjct  480  NMDPLSSVLAPRIYHQLIPNRVSFENWTTVFNDHFEVPKETRIVLEKKGHVLTPTAGGTI  539

Query  538  CQLLVQNLPKPGQWLNNGTFHGM--LTAVSDPRKGGSPA  648
             Q +V+         ++G   GM  L AVSDPRKGG P+
Sbjct  540  AQFIVEE--------SDGNAGGMSKLVAVSDPRKGGFPS  570



>ref|XP_009126140.1| PREDICTED: gamma-glutamyltranspeptidase 1 isoform X1 [Brassica 
rapa]
Length=575

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 148/219 (68%), Gaps = 12/219 (5%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS P + S 
Sbjct  363  WNQIDDHGTSHLSIIDRERNAVSMTSTINGYFGAVMLSPSTGIVLNNEMDDFSVPAKSSG  422

Query  184  D--KLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            D    PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +VFLNH  L
Sbjct  423  DLNVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTIEVFLNHFFL  482

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDPL +V +PR+YH+LIPN V +ENWT +  +H E+    R  LE +GH L     G I
Sbjct  483  NMDPLSSVLAPRIYHQLIPNRVSFENWTTVFNDHFEVPKETRIVLEKKGHVLTPTAGGTI  542

Query  538  CQLLVQNLPKPGQWLNNGTFHGM--LTAVSDPRKGGSPA  648
             Q +V+         ++G   GM  L AVSDPRKGG P+
Sbjct  543  AQFIVEE--------SDGNAGGMSKLVAVSDPRKGGFPS  573



>dbj|BAC45233.1| gamma-glutamyl transferase [Raphanus sativus]
Length=572

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 148/218 (68%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  I+D++RNAVSMTTT+N  FG  ++SPSTGIV+NNEM DFS P +  
Sbjct  359  RWNQIEDHGTSHLSIIDSERNAVSMTTTINGYFGALILSPSTGIVMNNEMDDFSIPMKSD  418

Query  181  PDKL--PPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
             ++   PP+PANFI P KRPLSSMTP +VLKD ++ A +G SGG NIIA   +V+LN+  
Sbjct  419  GNESVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAAVGASGGVNIIAGTIEVYLNYFF  478

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L  DPL AV +PR+YH+L+PN V YENWT +  +H E+    R  LE +GH L+    G 
Sbjct  479  LKRDPLSAVLAPRIYHQLVPNIVWYENWTTVFSDHFEIRKETRVVLEKKGHLLRPSPGGT  538

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            I Q +VQ         N+G     L AVSDPRKGG P+
Sbjct  539  IAQFVVQE-----SGANSGGLS-ELVAVSDPRKGGFPS  570



>ref|XP_006283415.1| hypothetical protein CARUB_v10004464mg [Capsella rubella]
 gb|EOA16313.1| hypothetical protein CARUB_v10004464mg [Capsella rubella]
Length=573

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 147/218 (67%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS P + +
Sbjct  360  KWNQINDHGTSHLSIIDHERNAVSMTSTINGYFGAVMLSPSTGIVLNNEMDDFSIPIKSN  419

Query  181  P--DKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
               D  PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +V+LNH  
Sbjct  420  GNLDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTTEVYLNHFF  479

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN V YENWT +  +H E+    R  LE +GH L     G 
Sbjct  480  LKMDPLSSVLAPRIYHQLIPNRVSYENWTTVFNDHFEIPKATRVVLEKKGHVLSPVAGGT  539

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            I Q +VQ         N+G     L AVSDPRKGG P+
Sbjct  540  IVQFIVQE-----SGANSGRVS-ELVAVSDPRKGGFPS  571



>ref|XP_010446517.1| PREDICTED: gamma-glutamyltranspeptidase 1 [Camelina sativa]
 ref|XP_010446518.1| PREDICTED: gamma-glutamyltranspeptidase 1 [Camelina sativa]
 ref|XP_010446519.1| PREDICTED: gamma-glutamyltranspeptidase 1 [Camelina sativa]
Length=572

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 146/218 (67%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS P + +
Sbjct  359  KWNQIDDHGTSHLSIIDRERNAVSMTSTINGYFGAVMLSPSTGIVLNNEMDDFSIPMKSN  418

Query  181  P--DKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
               D  PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +V+LNH  
Sbjct  419  GNLDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTTEVYLNHFF  478

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN + YENWT +  +H E+    R  LE +GH L     G 
Sbjct  479  LKMDPLSSVLAPRIYHQLIPNRISYENWTTVFNDHFEIPKATRVVLEKKGHVLTPVAGGT  538

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            I Q +VQ      +   N      L AVSDPRKGG P+
Sbjct  539  IVQFIVQ------ESGGNSGGRSELVAVSDPRKGGFPS  570



>ref|XP_006838433.1| hypothetical protein AMTR_s00002p00123410 [Amborella trichopoda]
 gb|ERN01002.1| hypothetical protein AMTR_s00002p00123410 [Amborella trichopoda]
Length=578

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 146/217 (67%), Gaps = 3/217 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            R++Q  DHGTSH  +VD++RNAV++T+T+N  FG    S  TGIVLNN+M DFS P+  +
Sbjct  362  RYNQTVDHGTSHMSVVDSERNAVALTSTINNFFGAWFRSRKTGIVLNNQMDDFSIPSNTT  421

Query  181  PDK-LPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
             +  +PP+PANFI P+KRPLSS  P ++LKD QL AVIG SGG  II    QV LNH V 
Sbjct  422  SNTTMPPAPANFIKPHKRPLSSTMPTIILKDGQLNAVIGASGGPRIIPANIQVLLNHFVH  481

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDP  A+ +PRVYH+LIPN V YE W  + G+HIE+S   R  L  +GH LQA   GA 
Sbjct  482  NMDPFSAILAPRVYHRLIPNFVEYEKWDTVSGDHIEVSLRDRLGLATKGHVLQALAFGAK  541

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            CQ +VQ+LP   +        G LTAVSDPRKGG PA
Sbjct  542  CQFVVQHLPTMAK--GKSIIMGNLTAVSDPRKGGFPA  576



>ref|XP_010431938.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010431939.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X2 [Camelina 
sativa]
Length=572

 Score =   232 bits (591),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 146/218 (67%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS P + +
Sbjct  359  KWNQIDDHGTSHLSIIDRERNAVSMTSTINGYFGAVMLSPSTGIVLNNEMDDFSIPMKSN  418

Query  181  P--DKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
               D  PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +V+LNH  
Sbjct  419  GNLDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTTEVYLNHFF  478

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN + YENWT +  +H E+    R  LE +GH L     G 
Sbjct  479  LKMDPLSSVLAPRIYHQLIPNRISYENWTTVFNDHFEIPKATRVVLEKKGHILTPVAGGT  538

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            I Q +VQ      +   N      L AVSDPRKGG P+
Sbjct  539  IVQFIVQ------ESGGNSGGRSELVAVSDPRKGGFPS  570



>ref|XP_010437081.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Camelina sativa]
 ref|XP_010437082.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Camelina sativa]
Length=572

 Score =   231 bits (590),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 146/218 (67%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS P + +
Sbjct  359  KWNQIDDHGTSHLSIIDRERNAVSMTSTINGYFGAVMLSPSTGIVLNNEMDDFSIPMKSN  418

Query  181  P--DKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
               D  PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +V+LNH  
Sbjct  419  GNLDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTTEVYLNHFF  478

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN + YENWT +  +H E+    R  LE +GH L     G 
Sbjct  479  LKMDPLSSVLAPRIYHQLIPNRISYENWTTVFNDHFEIPKATRVVLEKKGHILTPVAGGT  538

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            I Q +VQ      +   N      L AVSDPRKGG P+
Sbjct  539  IVQFIVQ------ESGGNSGGRSELVAVSDPRKGGFPS  570



>ref|XP_006838434.1| hypothetical protein AMTR_s00002p00124320 [Amborella trichopoda]
 gb|ERN01003.1| hypothetical protein AMTR_s00002p00124320 [Amborella trichopoda]
Length=578

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 146/217 (67%), Gaps = 3/217 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            R++Q  DHGTSH  +VD++RNAV++T+T+N  FG    S  TGIVLNN+M DFS P+  +
Sbjct  362  RYNQTVDHGTSHMSVVDSERNAVALTSTINNFFGAWFRSRRTGIVLNNQMDDFSIPSNTT  421

Query  181  PDK-LPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
             +  +PP+PANFI P+KRPLSS  P ++LKD QL AVIG SGG  II    QV LNH V 
Sbjct  422  SNTTMPPAPANFIKPHKRPLSSTMPTIILKDGQLNAVIGASGGPRIIPANIQVLLNHFVH  481

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDP  A+ +PRVYH+LIPN V YE W  + G+HIE+S   R  L  +GH LQA   GA 
Sbjct  482  NMDPFSAILAPRVYHRLIPNFVEYEKWDTVSGDHIEVSLRDRLGLATKGHVLQALAFGAK  541

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            CQ +VQ+LP   +        G LTAVSDPRKGG PA
Sbjct  542  CQFVVQHLPTMAK--GKSIIMGNLTAVSDPRKGGFPA  576



>emb|CDY41994.1| BnaA01g05660D [Brassica napus]
Length=572

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 147/219 (67%), Gaps = 12/219 (5%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SP+TGIVLNNEM DFS P + S 
Sbjct  360  WNQIDDHGTSHLSIIDRERNAVSMTSTINGYFGAVMLSPTTGIVLNNEMDDFSVPAKSSG  419

Query  184  D--KLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            D    PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +VFLNH  L
Sbjct  420  DLNVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTIEVFLNHFFL  479

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             +DPL +V +PR+YH+LIPN   +ENWT +  +H E+    R  LE +GH L     G I
Sbjct  480  NIDPLSSVLAPRIYHQLIPNRASFENWTTVFNDHFEVPKETRVVLEKKGHVLTPTAGGTI  539

Query  538  CQLLVQNLPKPGQWLNNGTFHGM--LTAVSDPRKGGSPA  648
             Q +VQ         ++G   GM  L AVSDPRKGG P+
Sbjct  540  AQFIVQE--------SDGNAGGMSKLVAVSDPRKGGFPS  570



>ref|XP_006411756.1| hypothetical protein EUTSA_v10024781mg [Eutrema salsugineum]
 gb|ESQ53209.1| hypothetical protein EUTSA_v10024781mg [Eutrema salsugineum]
Length=572

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 147/217 (68%), Gaps = 8/217 (4%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS P + S 
Sbjct  360  WNQIDDHGTSHLSIIDHERNAVSMTSTINGYFGALMLSPSTGIVLNNEMDDFSIPMKTSG  419

Query  184  D--KLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            +    PP+PANFI P KRPLSSMTP +VLKD ++ A +G SGG NIIA   +VFLNH  L
Sbjct  420  NINVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAAVGASGGANIIAGTTEVFLNHFFL  479

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDPL +V +PR+YH+LIPN V +ENWT +  +H E+    R  LE +GH L     G I
Sbjct  480  KMDPLSSVLAPRIYHQLIPNRVTFENWTTVFSDHFEVPKETRVVLEKKGHVLTPIAGGTI  539

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
             Q +V+   + G+   N      L AVSDPRKGG P+
Sbjct  540  AQFIVE---ESGE---NSGGRSELVAVSDPRKGGFPS  570



>dbj|BAC56855.1| gamma-glutamyl transferase [Raphanus sativus]
Length=575

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 146/218 (67%), Gaps = 10/218 (5%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS PT+ S 
Sbjct  363  WNQINDHGTSHLSIIDRERNAVSMTSTINGYFGAVMLSPSTGIVLNNEMDDFSIPTK-ST  421

Query  184  DKL---PPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
              L   PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NII+   +VFLNH  
Sbjct  422  GNLNVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIISGTIEVFLNHFF  481

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN V +ENWT +  +H E+    R  LE +GH L     G 
Sbjct  482  LNMDPLSSVLAPRIYHQLIPNRVSFENWTTVFSDHFEVPKETRVVLEKKGHVLTPIAGGT  541

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            I Q +VQ   +      N      L AVSDPRKGG P+
Sbjct  542  IAQFIVQESDR------NAGGMSKLVAVSDPRKGGFPS  573



>ref|XP_002866872.1| hypothetical protein ARALYDRAFT_490743 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43131.1| hypothetical protein ARALYDRAFT_490743 [Arabidopsis lyrata subsp. 
lyrata]
Length=572

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 144/217 (66%), Gaps = 8/217 (4%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS P + + 
Sbjct  360  WNQIDDHGTSHLSIIDRERNAVSMTSTINGYFGALMLSPSTGIVLNNEMDDFSIPMKSNG  419

Query  184  --DKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
              D  PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +V+LNH  L
Sbjct  420  NLDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTTEVYLNHFFL  479

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDP  +V +PR+YH+LIPN V YENWT +  +H E+    R  LE +GH L     G I
Sbjct  480  KMDPFSSVLAPRIYHQLIPNRVSYENWTTVFNDHFEIPKATRVVLEKKGHVLSPIAGGTI  539

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
             Q +VQ   +      N      L AVSDPRKGG P+
Sbjct  540  AQFIVQESGR------NSGGRSELVAVSDPRKGGFPS  570



>ref|XP_009138098.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Brassica rapa]
Length=557

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 142/213 (67%), Gaps = 18/213 (8%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            ++ QL+D GTSHFC+VD DRN VSMTTTVN+ FG G MS ST I+LNN+M DFS  +E S
Sbjct  342  KYKQLKDEGTSHFCVVDKDRNVVSMTTTVNHAFGSGFMSTSTCIILNNQMADFSITSEES  401

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                   PAN+I  NKRPLSSM P+++ KD++L  VIG SGG  II  V QVFLNH VL 
Sbjct  402  A-----PPANYIEANKRPLSSMMPLIITKDDELVGVIGASGGIYIIPAVIQVFLNHFVLN  456

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M PLEAV+SPRVYHKL PN VLYE+WT+ + +HI L    + FL+ + H+L +   GA  
Sbjct  457  MSPLEAVKSPRVYHKLEPNEVLYEDWTVYNKDHILLKKETQDFLKTKDHKLVSTTMGATV  516

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGG  639
            Q +VQ+               +LTAVSD RK G
Sbjct  517  QFVVQD-------------RQVLTAVSDLRKDG  536



>emb|CAA18750.1| putative gamma-glutamyltransferase [Arabidopsis thaliana]
 emb|CAB80627.1| putative gamma-glutamyltransferase [Arabidopsis thaliana]
Length=577

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 146/217 (67%), Gaps = 8/217 (4%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS P + + 
Sbjct  365  WNQIDDHGTSHLSIIDRERNAVSMTSTINGYFGALMLSPSTGIVLNNEMDDFSIPMKSNG  424

Query  184  --DKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
              D  PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +V+LNH  L
Sbjct  425  NLDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTTEVYLNHFFL  484

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDPL +V +PR+YH+LIPN   YENWT +  +H E+    R  LE +GH L     G I
Sbjct  485  KMDPLSSVLAPRIYHQLIPNRASYENWTTVFNDHFEIPKATRVVLEKKGHVLSPIAGGTI  544

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
             Q +VQ   + G+   N      L AVSDPRKGG P+
Sbjct  545  AQFIVQ---ESGE---NSGGRSELVAVSDPRKGGFPS  575



>dbj|BAH20434.1| AT4G39640 [Arabidopsis thaliana]
Length=572

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 146/217 (67%), Gaps = 8/217 (4%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS P + + 
Sbjct  360  WNQIDDHGTSHLSIIDRERNAVSMTSTINGYFGALMLSPSTGIVLNNEMDDFSIPMKSNG  419

Query  184  --DKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
              D  PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +V+LNH  L
Sbjct  420  NLDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTTEVYLNHFFL  479

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDPL +V +PR+YH+LIPN   YENWT +  +H E+    R  LE +GH L     G I
Sbjct  480  KMDPLSSVLAPRIYHQLIPNRASYENWTTVFNDHFEIPKATRVVLEKKGHVLSPIAGGTI  539

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
             Q +VQ   + G+   N      L AVSDPRKGG P+
Sbjct  540  AQFIVQ---ESGE---NSGGRSELVAVSDPRKGGFPS  570



>ref|XP_006838435.1| hypothetical protein AMTR_s00002p00125660 [Amborella trichopoda]
 gb|ERN01004.1| hypothetical protein AMTR_s00002p00125660 [Amborella trichopoda]
Length=578

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 146/217 (67%), Gaps = 3/217 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            R++Q  DHGTSH  +VD++RNAV +T+TVN  FG    S  TG++LNN+M DFS P+  +
Sbjct  362  RYNQTIDHGTSHMSVVDSERNAVGLTSTVNNFFGAWFRSRRTGMILNNQMDDFSIPSNTT  421

Query  181  PDK-LPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
             +  +PP+PANFI P+KRPLSS  P ++LKD QL AVIG SGG  II    QVFLNH V 
Sbjct  422  SNTTMPPAPANFIVPHKRPLSSTMPTIILKDGQLNAVIGASGGPRIIPANIQVFLNHFVH  481

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDP  A+ +PRVYH+LIPN V YE W  + G+HIE+S   R  L  +GH LQA   GA 
Sbjct  482  NMDPFSAILAPRVYHRLIPNFVEYEKWDTVSGDHIEVSLRDRLGLARKGHVLQALAFGAK  541

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            CQ +VQ+LP   +        G LTAVSDPRKGG PA
Sbjct  542  CQFVVQHLPTMAK--GKSIIMGNLTAVSDPRKGGFPA  576



>emb|CDY19957.1| BnaA09g02940D [Brassica napus]
Length=570

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 146/219 (67%), Gaps = 12/219 (5%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+  HGT HF I+D++RNAVSMTTTVN  FG  ++SPSTGIVLNN+M DF+ P + S 
Sbjct  358  WNQINHHGTCHFSIIDSERNAVSMTTTVNGYFGAVMLSPSTGIVLNNQMDDFTIPAKSSG  417

Query  184  D--KLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            D    PP+PA+FI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +VFLNH  L
Sbjct  418  DLNVPPPAPASFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAATTEVFLNHFFL  477

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDPL +V +PR+YH+LIPN V +EN T +  +H E+    R  LE +GH L       I
Sbjct  478  KMDPLSSVLAPRIYHQLIPNRVSFENLTTVFNDHFEIPKETRVVLEKKGHALTPMTGATI  537

Query  538  CQLLVQNLPKPGQWLNNGTFHGM--LTAVSDPRKGGSPA  648
             Q +VQ          NG+  GM  L AVSDPRKGG P+
Sbjct  538  VQFIVQEF--------NGSSRGMSKLVAVSDPRKGGFPS  568



>emb|CAA89206.1| gamma-glutamyl transpeptidase [Arabidopsis thaliana]
 prf||2124427C gamma-Glu transpeptidase
Length=568

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 146/217 (67%), Gaps = 8/217 (4%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS P + + 
Sbjct  356  WNQIDDHGTSHLSIIDRERNAVSMTSTINGYFGALMLSPSTGIVLNNEMDDFSIPMKSNG  415

Query  184  --DKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
              D  PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +V+LNH  L
Sbjct  416  NLDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTTEVYLNHFFL  475

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDPL +V +PR+YH+LIPN   YENWT +  +H E+    R  LE +GH L     G I
Sbjct  476  KMDPLSSVLAPRIYHQLIPNRASYENWTTVFNDHFEIPKATRVVLEKKGHVLSPIAGGTI  535

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
             Q +VQ   + G+   N      L AVSDPRKGG P+
Sbjct  536  AQFIVQ---ESGE---NSGGRSELVAVSDPRKGGFPS  566



>ref|NP_195674.2| gamma-glutamyl transpeptidase 1 [Arabidopsis thaliana]
 ref|NP_974717.1| gamma-glutamyl transpeptidase 1 [Arabidopsis thaliana]
 sp|Q8VYW6.1|GAGT1_ARATH RecName: Full=Gamma-glutamyltranspeptidase 1; AltName: Full=Gamma-glutamyltransferase 
1; AltName: Full=Glutathione hydrolase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL47428.1| AT4g39640/T19P19_30 [Arabidopsis thaliana]
 gb|AAN18064.1| At4g39640/T19P19_30 [Arabidopsis thaliana]
 gb|AEE87097.1| gamma-glutamyl transpeptidase 1 [Arabidopsis thaliana]
 gb|AEE87098.1| gamma-glutamyl transpeptidase 1 [Arabidopsis thaliana]
Length=572

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 146/217 (67%), Gaps = 8/217 (4%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS P + + 
Sbjct  360  WNQIDDHGTSHLSIIDRERNAVSMTSTINGYFGALMLSPSTGIVLNNEMDDFSIPMKSNG  419

Query  184  --DKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
              D  PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +V+LNH  L
Sbjct  420  NLDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTTEVYLNHFFL  479

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDPL +V +PR+YH+LIPN   YENWT +  +H E+    R  LE +GH L     G I
Sbjct  480  KMDPLSSVLAPRIYHQLIPNRASYENWTTVFNDHFEIPKATRVVLEKKGHVLSPIAGGTI  539

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
             Q +VQ   + G+   N      L AVSDPRKGG P+
Sbjct  540  AQFIVQ---ESGE---NSGGRSELVAVSDPRKGGFPS  570



>emb|CDX90346.1| BnaA08g16380D [Brassica napus]
Length=239

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 147/216 (68%), Gaps = 6/216 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+++ DHGTSHF I+D +RN V+MTTTVN  FG   +SPSTGIVLNN+M DFS P +  
Sbjct  28   RWNEIHDHGTSHFSIIDKERNVVAMTTTVNGYFGATKLSPSTGIVLNNQMDDFSIPMKPQ  87

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD  PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG  II    QVFLNH  L 
Sbjct  88   PDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGLYIIPGATQVFLNHFFLN  147

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR++H+LIPN + YE+W  +  +H EL    R  LE +GH L     GAI 
Sbjct  148  MDPLSSVMAPRIFHQLIPNRISYEDWKTVYDDHFELPKETRDVLEKKGHVLTPIADGAIS  207

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            QL+V  +   G   +NGT    L AVSDPRKGG P+
Sbjct  208  QLIV--VESGGN--SNGT--SRLVAVSDPRKGGFPS  237



>emb|CDY42642.1| BnaC01g00540D [Brassica napus]
Length=572

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 146/219 (67%), Gaps = 12/219 (5%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+ DHGTSH  I+D +RNAVSMT+T+N  FG  ++S STGIVLNNEM DFS P +   
Sbjct  360  WNQIDDHGTSHLSIIDRERNAVSMTSTINGYFGAVMLSTSTGIVLNNEMDDFSVPAKSRG  419

Query  184  DK--LPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            D    PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +VFLNH  L
Sbjct  420  DVNVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAGTIEVFLNHFFL  479

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDPL +V +PR+YH+LIPN   +ENWT M  +H E+    R  LE +GH L     G I
Sbjct  480  DMDPLSSVLAPRIYHQLIPNRASFENWTTMFNDHFEVPKEIRVVLEKKGHVLTPVAGGTI  539

Query  538  CQLLVQNLPKPGQWLNNGTFHGM--LTAVSDPRKGGSPA  648
             Q +VQ         ++G+  GM  L AVSDPRKGG P+
Sbjct  540  AQFIVQE--------SDGSSGGMSKLVAVSDPRKGGFPS  570



>dbj|BAK03021.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   229 bits (583),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 142/216 (66%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ L+DHGTSH  IVD +RNAVSMT+TVN  FG  ++SPSTG++LNNEM DFS P   +
Sbjct  361  RWNILQDHGTSHLSIVDGERNAVSMTSTVNSYFGSLILSPSTGVLLNNEMDDFSMPGNTT  420

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+P NF++P KRPLSSM P +VLKD +L A +G SGG+ I A   +V LNH    
Sbjct  421  ANSPPPAPNNFVAPLKRPLSSMCPTIVLKDGKLKAAVGASGGSMIPAGTIEVLLNHFAKN  480

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT + G+   L    R  L  +GH L+    G I 
Sbjct  481  MDPLSSVMAPRVYHQLIPNVVQYENWTTVTGDRFLLDAATRGDLLKKGHVLKPLAGGTIS  540

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            QL+V N+   G           LTAVSDPRKGG PA
Sbjct  541  QLVVHNVESRGD----------LTAVSDPRKGGVPA  566



>dbj|BAD61113.1| putative gamma-glutamyl transpeptidase [Oryza sativa Japonica 
Group]
Length=606

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 154/221 (70%), Gaps = 23/221 (10%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTE--  174
            +WSQL DHGTSH C+VD DRNAV+MTTT N++FG  ++SPSTGIV+NN+M DFS P E  
Sbjct  406  KWSQLDDHGTSHLCVVDGDRNAVAMTTTENHLFGAHLLSPSTGIVVNNQMDDFSVPAEGT  465

Query  175  VSPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
              PD LPP+PANFI+P KRPLSSMTP ++LK                 +TV QVF+NH +
Sbjct  466  PPPDNLPPAPANFIAPGKRPLSSMTPTIILK----------------ASTVVQVFVNHFI  509

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            +GM PL AV +PR    L+PN V+YEN T++DGE  ELSG  R FL  RGH+L + +SGA
Sbjct  510  VGMHPLAAVLNPR----LVPNEVVYENVTVVDGEVFELSGEAREFLRRRGHRLTSTDSGA  565

Query  535  ICQLLVQNLPKP-GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            +CQ +VQ+L  P     +   FHGMLTAVSDPRK G PA +
Sbjct  566  VCQFIVQDLLTPVAAAGDENVFHGMLTAVSDPRKDGRPAGM  606



>ref|XP_009372518.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=577

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 144/216 (67%), Gaps = 7/216 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQ+ DHGTSH  IVD   NAVSMTTTVN  FG  ++S STGIVLNNEM DFS P  VS
Sbjct  367  RWSQINDHGTSHLSIVDPQGNAVSMTTTVNGYFGAHILSSSTGIVLNNEMDDFSIPGNVS  426

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                P    NFI P KRPLSSMTP +VLKD+QL AV+G SGG  II   A+V LNH   G
Sbjct  427  ASPPPAP-PNFIRPGKRPLSSMTPAIVLKDDQLNAVVGASGGVFIIPATAEVLLNHFARG  485

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+L+PN V YENWT + G+H E+    R+ L+ +GH L+   SG+IC
Sbjct  486  MDPLSSVMAPRVYHQLLPNVVRYENWTSVTGDHFEVPTQIRKSLQKKGHILEPLTSGSIC  545

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +V          N GT    + AVSDPRKGG PA
Sbjct  546  QFIVHKASTE----NEGTPE--ILAVSDPRKGGVPA  575



>gb|KHN31334.1| Alanine--glyoxylate aminotransferase 2 like 1, mitochondrial 
[Glycine soja]
Length=965

 Score =   233 bits (595),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 141/206 (68%), Gaps = 2/206 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q+ DHGTSH  I+D +RNA+SMT+TVN  FG  ++SPSTGIVLNNEM DFS P  V+
Sbjct  373  RWNQIHDHGTSHLSIIDPERNAISMTSTVNAYFGSKILSPSTGIVLNNEMDDFSIPRNVT  432

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             D  PP+PANFI P KRPLSSM+P + LKD +L AV+G SGG  II   A+V LNH V G
Sbjct  433  KDVPPPAPANFIMPGKRPLSSMSPTIALKDGKLKAVVGASGGAFIIGGTAEVLLNHFVKG  492

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP  +V +PRVYH+L+PN V YENWT + GEH EL    R  L+ +GH L+    G IC
Sbjct  493  MDPFSSVTAPRVYHQLLPNVVNYENWTTL-GEHFELPADIREALKSKGHVLKGLAGGTIC  551

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAV  618
            Q +V +   P +  N G  +G L A 
Sbjct  552  QFIVLDNSVPSRQ-NKGIGNGKLVAC  576



>ref|XP_009372517.1| PREDICTED: gamma-glutamyltranspeptidase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=579

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 144/216 (67%), Gaps = 7/216 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQ+ DHGTSH  IVD   NAVSMTTTVN  FG  ++S STGIVLNNEM DFS P  VS
Sbjct  369  RWSQINDHGTSHLSIVDPQGNAVSMTTTVNGYFGAHILSSSTGIVLNNEMDDFSIPGNVS  428

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                P    NFI P KRPLSSMTP +VLKD+QL AV+G SGG  II   A+V LNH   G
Sbjct  429  ASPPPAP-PNFIRPGKRPLSSMTPAIVLKDDQLNAVVGASGGVFIIPATAEVLLNHFARG  487

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+L+PN V YENWT + G+H E+    R+ L+ +GH L+   SG+IC
Sbjct  488  MDPLSSVMAPRVYHQLLPNVVRYENWTSVTGDHFEVPTQIRKSLQKKGHILEPLTSGSIC  547

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +V          N GT    + AVSDPRKGG PA
Sbjct  548  QFIVHKASTE----NEGTPE--ILAVSDPRKGGVPA  577



>emb|CDY41991.1| BnaA01g05630D [Brassica napus]
Length=573

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 148/219 (68%), Gaps = 12/219 (5%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+  HGT HF I+D++RNAVSMT++VN  FG  ++SPSTGIVLNN+M DF+ P + S 
Sbjct  361  WNQINHHGTCHFSIIDSERNAVSMTSSVNGYFGAVMLSPSTGIVLNNQMDDFTIPAKSSG  420

Query  184  D--KLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            D    PP+PA+FI P KRPLSSM+P +VLKD ++ AV+G SGG NIIA   +VFLNH  L
Sbjct  421  DLNVPPPAPASFIRPGKRPLSSMSPTIVLKDGKVKAVVGASGGANIIAATTEVFLNHFFL  480

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDPL +V +PR+YH+LIPN + +EN T + G+H E+    R  LE +GH L       I
Sbjct  481  NMDPLSSVLAPRIYHQLIPNKISFENLTTVFGDHFEIPKETRVVLEKKGHVLTPMTGATI  540

Query  538  CQLLVQNLPKPGQWLNNGTFHGM--LTAVSDPRKGGSPA  648
             Q +VQ         ++G   GM  L AVSDPRKGG P+
Sbjct  541  VQFIVQE--------SDGNVGGMSKLLAVSDPRKGGFPS  571



>ref|XP_006653478.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Oryza brachyantha]
Length=535

 Score =   226 bits (576),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 145/215 (67%), Gaps = 10/215 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ L+DHGTSH  IVD++RNA+SMTTTVN  FG  ++SPSTGI+LNNEM DFS     S
Sbjct  328  RWNILQDHGTSHLSIVDSERNAISMTTTVNAYFGSLILSPSTGILLNNEMDDFSMLANTS  387

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                PP+PANF+ P KRPLSSMTP ++LKD +L A +G SGG+ I A   +V LNH V  
Sbjct  388  ASSPPPAPANFVRPLKRPLSSMTPTIILKDGKLKAAVGASGGSMIPAGTMEVLLNHFVKN  447

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT + G+H EL    R  L+++GH L     G I 
Sbjct  448  MDPLSSVMAPRVYHQLIPNVVQYENWTTVTGDHFELDAATRADLQNKGHVLAPLAGGTIS  507

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSP  645
            Q +V N+ + G           LTAVSDPRKGG P
Sbjct  508  QFVVHNVERRGD----------LTAVSDPRKGGVP  532



>ref|XP_010446520.1| PREDICTED: gamma-glutamyltranspeptidase 2-like [Camelina sativa]
Length=580

 Score =   226 bits (577),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 144/218 (66%), Gaps = 7/218 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH  ++D++RN VSMT+T+N  FG  +MSPSTG+VLNNEM DFS P +  
Sbjct  366  KWNQINDHGTSHLSVMDSERNVVSMTSTINGYFGAHMMSPSTGMVLNNEMDDFSIPMKSG  425

Query  181  PD--KLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
             D    PP+PANFI P KRPLSSMTP +VLKD ++ A +G SGG  IIA   +VFLNH V
Sbjct  426  GDLDVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAALGASGGMYIIAGTTEVFLNHFV  485

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
              MDPL +V +PR+YH+LIPN V YENWT +  +H ++    R  LE +GH L     G 
Sbjct  486  HNMDPLSSVAAPRIYHQLIPNRVQYENWTTVYNDHFKIPKETRLELEKKGHVLAPFAGGT  545

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            I QL+V   P       +      L AVSDPRKGG P+
Sbjct  546  ISQLIVVQEPD-----KSSGGRSKLVAVSDPRKGGYPS  578



>gb|EMT13333.1| Gamma-glutamyltranspeptidase 1 [Aegilops tauschii]
Length=605

 Score =   227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 142/216 (66%), Gaps = 10/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ L+DHGTSH  IVD +RNAVSMT+TVN  FG  ++SPSTG++LNNEM DFS P   +
Sbjct  398  RWNILQDHGTSHLSIVDGERNAVSMTSTVNAYFGSLILSPSTGVLLNNEMDDFSMPANTT  457

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+P NF++P KRPLSSM P +VLKD +L A +G SGG+ I A   +V LNH    
Sbjct  458  ANTPPPAPNNFVAPLKRPLSSMCPTIVLKDGKLKAAVGASGGSMIPAGTIEVLLNHFAKN  517

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT + G+   L    R  L  +GH L+    G I 
Sbjct  518  MDPLSSVMAPRVYHQLIPNEVKYENWTTVTGDVFLLDAATRGDLLKKGHVLEPLAGGTIS  577

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            QL+V N+   G           LTAVSDPRKGG PA
Sbjct  578  QLVVHNVEGRGD----------LTAVSDPRKGGVPA  603



>ref|XP_009126030.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Brassica rapa]
Length=573

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 148/219 (68%), Gaps = 12/219 (5%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+  HGT HF I+D++RNAVSMT++VN  FG  ++SPSTGIVLNN+M DF+ P + S 
Sbjct  361  WNQINHHGTCHFSIIDSERNAVSMTSSVNGYFGAVMLSPSTGIVLNNQMDDFTIPAKSSG  420

Query  184  D--KLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            D    PP+PA+FI P KRPLSSM+P +VLKD ++ AV+G SGG +IIA   +VFLNH  L
Sbjct  421  DLNVPPPAPASFIRPGKRPLSSMSPTIVLKDGKVKAVVGASGGADIIAATTEVFLNHFFL  480

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDPL +V +PR+YH+LIPN + +EN T + G+H E+    R  LE +GH L       I
Sbjct  481  NMDPLSSVLAPRIYHQLIPNKISFENLTTVFGDHFEIPKETRVVLEKKGHVLTPMTGATI  540

Query  538  CQLLVQNLPKPGQWLNNGTFHGM--LTAVSDPRKGGSPA  648
             Q +VQ         ++G   GM  L AVSDPRKGG P+
Sbjct  541  VQFIVQE--------SDGNVGGMSKLLAVSDPRKGGFPS  571



>emb|CDY71484.1| BnaC03g76200D, partial [Brassica napus]
Length=253

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 146/217 (67%), Gaps = 6/217 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+ + DHGTSHF I+D +RN V+MTTT+N  FG   +SPSTGIVLNN+M DFS P +  
Sbjct  42   KWNGIHDHGTSHFSIIDKERNVVAMTTTINGYFGATKLSPSTGIVLNNQMDDFSIPMKPQ  101

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD  PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG  II    QVFLNH  L 
Sbjct  102  PDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGLYIIPGATQVFLNHFFLN  161

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR++H+LIPN + YE+W  +  +H EL    R  LE +GH L     GAI 
Sbjct  162  MDPLSSVMAPRIFHQLIPNRISYEDWRTVYDDHFELPKETRDVLEKKGHVLTPIADGAIS  221

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAA  651
            QL+V  +   G   +NGT    L AVSDPRKGG P+ 
Sbjct  222  QLIV--VESGGN--SNGT--SRLVAVSDPRKGGFPSG  252



>ref|XP_006412863.1| hypothetical protein EUTSA_v10024658mg [Eutrema salsugineum]
 gb|ESQ54316.1| hypothetical protein EUTSA_v10024658mg [Eutrema salsugineum]
Length=553

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFCIVDADRN VSMTTTVNYVFG GV+SPSTGIVLNNEM DFS P E++
Sbjct  408  RWSQLRDQGTSHFCIVDADRNTVSMTTTVNYVFGAGVLSPSTGIVLNNEMDDFSVPAEIT  467

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+P NFI P KRPLSSMTP+V+ KD +  A +GGSGG NII  V QVFLN  VL 
Sbjct  468  PDKLPPAPTNFIEPKKRPLSSMTPLVITKDGEFVAALGGSGGMNIIPAVIQVFLNCFVLK  527

Query  361  MDPLEAVQSPRVYHKLI  411
            M PLEAV+S RVYHK+I
Sbjct  528  MKPLEAVESARVYHKVI  544



>gb|EPS70272.1| hypothetical protein M569_04488, partial [Genlisea aurea]
Length=706

 Score =   226 bits (577),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 118/136 (87%), Gaps = 1/136 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFC+VD DRNAVSMTTTVNY FGGGV+SPSTGI+LNNEM DFS PT+VS
Sbjct  571  RWSQLRDSGTSHFCVVDGDRNAVSMTTTVNYAFGGGVLSPSTGILLNNEMDDFSTPTDVS  630

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVL-KDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            PDKLPP+PANFISP KRPLSSMTP++VL KD +LA VIGGSGG NII  V QVF+NH +L
Sbjct  631  PDKLPPAPANFISPKKRPLSSMTPVIVLKKDGELAGVIGGSGGLNIIPAVVQVFINHFLL  690

Query  358  GMDPLEAVQSPRVYHK  405
            GM P  AV+S RVYHK
Sbjct  691  GMQPRAAVESARVYHK  706



>gb|KFK30534.1| hypothetical protein AALP_AA7G274900 [Arabis alpina]
Length=527

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 148/218 (68%), Gaps = 8/218 (4%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+Q+ DHGTSH  I+D++RNAVSMTTT+N  FG  ++SPSTGIVLNNEM DFS P + +
Sbjct  314  KWNQINDHGTSHLSIIDSERNAVSMTTTINGYFGAIMLSPSTGIVLNNEMDDFSIPMKPN  373

Query  181  PDKLPPSPAN--FISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
             D   P PA   FI P KRPLSSM P +VLKD ++ AV+G SGG  IIA   +VFLNH  
Sbjct  374  GDPNVPPPAPANFIRPGKRPLSSMAPTIVLKDGKVKAVLGASGGKFIIAGTTEVFLNHFF  433

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN +LYENWT +  +H E+    R  LE +GH L+    G 
Sbjct  434  LKMDPLSSVLAPRIYHQLIPNKILYENWTTVYSDHFEIPKETRLVLEKKGHVLKPIAGGT  493

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            I Q +V+   K G   N+G     L AVSDPRKGG P+
Sbjct  494  IAQFIVE---KSGG--NSGKMS-KLVAVSDPRKGGFPS  525



>ref|XP_010540997.1| PREDICTED: gamma-glutamyltranspeptidase 3 isoform X2 [Tarenaya 
hassleriana]
Length=539

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+QLRDHGTSHF IVD+DRN VSMTT+VNYVFG G +SPSTGI+LNNEM DFS PTE +
Sbjct  401  RWNQLRDHGTSHFSIVDSDRNTVSMTTSVNYVFGSGFLSPSTGIILNNEMDDFSVPTEKT  460

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI PNKRPLSSMTP+V+ KD QL A +GGSGG NII  V QVFLN  VLG
Sbjct  461  PDKLPPAPANFIEPNKRPLSSMTPLVITKDGQLVAALGGSGGMNIIPAVVQVFLNCFVLG  520

Query  361  MDPLEAVQSPRVYHKLIPN  417
            M P +AVQS RVYH++  N
Sbjct  521  MKPRDAVQSSRVYHRVCNN  539



>ref|XP_002980264.1| hypothetical protein SELMODRAFT_419937 [Selaginella moellendorffii]
 gb|EFJ18524.1| hypothetical protein SELMODRAFT_419937 [Selaginella moellendorffii]
Length=633

 Score =   222 bits (565),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 149/221 (67%), Gaps = 5/221 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+QL DHGT HF I+D DRNA+SMTTTVN+ FG  ++S STGI+LNNEM DF+ P  V 
Sbjct  411  RWNQLVDHGTCHFGIIDQDRNALSMTTTVNWRFGSMLLSKSTGILLNNEMNDFAVPKAVV  470

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
              + PP+  NF++PNKRPLSSM+P +VL+D QL AV+G SGG  II  VAQVFLN+ V G
Sbjct  471  RGEFPPAEVNFVAPNKRPLSSMSPTIVLQDGQLRAVLGASGGIKIITGVAQVFLNYFVRG  530

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
             D L +V +PRV+H+L+PN V  E+WT++  E +E+    R  L  R H++       + 
Sbjct  531  KDALHSVTTPRVHHQLVPNEVECEDWTLVTNELVEVPEVIRDGLSARQHKVVETTGYCVT  590

Query  541  QLLVQNLPKPG----QWLNNGT-FHGMLTAVSDPRKGGSPA  648
            QL++ +L  P       LNN T + G +T VSD RK GSPA
Sbjct  591  QLVLHDLHVPAINHKPSLNNSTVYFGRITGVSDYRKHGSPA  631



>ref|XP_006391477.1| hypothetical protein EUTSA_v10019745mg [Eutrema salsugineum]
 gb|ESQ28763.1| hypothetical protein EUTSA_v10019745mg [Eutrema salsugineum]
Length=568

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 140/217 (65%), Gaps = 12/217 (6%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAP-TEVS  180
            W+Q+ DHGTSH  I+D  RN VSMT+T+N  FG  ++SPSTGIVLNNEM DFS P T V 
Sbjct  360  WNQIEDHGTSHLSIIDRQRNCVSMTSTINGYFGAWMLSPSTGIVLNNEMDDFSMPMTSVG  419

Query  181  P-DKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
              D  PP+ ANFI P KRPLSSMTP +VLKD ++ A +G SGG  IIA   +VFLNH  L
Sbjct  420  DLDVPPPALANFIRPGKRPLSSMTPTIVLKDGKVKAAVGASGGMYIIAGTTEVFLNHFFL  479

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAI  537
             MDPL +V +PR+YH+LIPN V YENWT    +H E+    R  LE +GH L     G I
Sbjct  480  EMDPLSSVVAPRIYHQLIPNRVSYENWTTAYNDHFEIPKETRHVLEKKGHVLTPLPGGTI  539

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
             Q +V+         + G     L AVSDPRKGG P+
Sbjct  540  SQFIVEE--------SGG--RSKLVAVSDPRKGGFPS  566



>ref|XP_002963073.1| hypothetical protein SELMODRAFT_438309 [Selaginella moellendorffii]
 gb|EFJ36536.1| hypothetical protein SELMODRAFT_438309 [Selaginella moellendorffii]
Length=627

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 149/221 (67%), Gaps = 5/221 (2%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+QL DHGT HF I+D DRNA+SMTTTVN+ FG  ++S STGI+LNNEM DF+ P  V 
Sbjct  405  KWNQLVDHGTCHFGIIDQDRNALSMTTTVNWRFGSMLLSKSTGILLNNEMNDFAVPKAVE  464

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
              + PP+  NF++PNKRPLSSM+P +VL+D QL AV+G SGG  II  VAQVFLN+ V G
Sbjct  465  RGEFPPAEVNFVAPNKRPLSSMSPTIVLQDGQLRAVLGASGGIKIITGVAQVFLNYFVRG  524

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
             D L +V +PRV+H+L+PN V  E+WT++  E +E+    R  L  R H++       + 
Sbjct  525  KDALHSVTTPRVHHQLVPNEVECEDWTLVTNELVEVPEVIRDGLSARQHKVVETTGYCVT  584

Query  541  QLLVQNLPKPG----QWLNNGT-FHGMLTAVSDPRKGGSPA  648
            QL++ +L  P       LNN T + G +T VSD RK GSPA
Sbjct  585  QLVLHDLHVPAINHKPSLNNSTVYFGRITGVSDYRKHGSPA  625



>ref|XP_009109459.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Brassica rapa]
Length=571

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 147/216 (68%), Gaps = 6/216 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+++ DHGTSHF I+D +RN V+MTTTVN  FG   +SPSTGIVLNN+M DFS P +  
Sbjct  360  KWNEIHDHGTSHFSIIDKERNVVAMTTTVNGYFGATKLSPSTGIVLNNQMDDFSIPMKPQ  419

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PD  PP+PANFI P KRPLSSM+P +VLKD ++ A +G SGG  II    QVFLNH  L 
Sbjct  420  PDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGLYIIPGATQVFLNHFFLN  479

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR++H+LIPN + YE+W  +  +H EL    R  LE +GH L     GAI 
Sbjct  480  MDPLSSVMAPRIFHQLIPNRISYEDWKTVYDDHFELPKETRDVLEKKGHVLTPIADGAIS  539

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            QL+V  +   G   +NGT    L AVSDPRKGG P+
Sbjct  540  QLIV--VESGGN--SNGT--SRLVAVSDPRKGGFPS  569



>gb|AAS91713.1| gamma-glutamyl transpeptidase, partial [Allium cepa]
Length=276

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 145/218 (67%), Gaps = 3/218 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFS--APTE  174
            +W+ + DHGTSH  IVD++RN VSMT+TVN  FG G+ S +TGIVLNNEM DFS  + + 
Sbjct  58   KWNVVNDHGTSHLSIVDSERNTVSMTSTVNSYFGAGIASQTTGIVLNNEMDDFSIPSNSS  117

Query  175  VSPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
             + +  PP+P NFI+P KRPLSSM+P ++LKD +L A +G SGG  IIA    +FL    
Sbjct  118  SNNNLPPPAPTNFIAPLKRPLSSMSPTIILKDGKLVASLGASGGGMIIAAATHIFLKLFA  177

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
              +DPL +V SPR YH+LIPN V YE+W  + G+H  ++   R  LE +GH L+    G 
Sbjct  178  EKLDPLSSVLSPRSYHQLIPNVVQYEDWMTVIGDHFLVAENDRTALEKKGHVLKPLAGGT  237

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            ICQ ++Q      + L++G  +G L AVSDPRKGG PA
Sbjct  238  ICQFIIQG-EDDAKELSSGIANGDLMAVSDPRKGGIPA  274



>emb|CAA18751.1| putative gamma-glutamyltransferase [Arabidopsis thaliana]
 emb|CAB80628.1| putative gamma-glutamyltransferase [Arabidopsis thaliana]
 gb|AAT06480.1| At4g39650 [Arabidopsis thaliana]
Length=574

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 149/220 (68%), Gaps = 12/220 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            +W Q++DHGTSH  I+D++RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS PT+  
Sbjct  361  KWGQIKDHGTSHLSIIDSERNAVSMTSTINGYFGAIMLSPSTGIVLNNEMDDFSIPTKSG  420

Query  178  -SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
              PD  PP+PANFI P KRPLSSMTP +VLKD ++ A +G SGG  IIA   QV+LNH  
Sbjct  421  GDPDVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAALGASGGMYIIAGTTQVYLNHFF  480

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN   YENWT +  +H E+    R  LE +G  L     G 
Sbjct  481  LNMDPLSSVVAPRIYHQLIPNKASYENWTTVYSDHFEIPEEIRLVLEKKGQVLTPIAGGT  540

Query  535  ICQLLVQNLPKPGQWLNNGTFHGM--LTAVSDPRKGGSPA  648
            I QL+V+         ++G   G+  L AVSDPRKGG P+
Sbjct  541  ISQLIVEQ--------SDGKSGGISKLVAVSDPRKGGFPS  572



>ref|NP_195675.2| gamma-glutamyl transpeptidase 2 [Arabidopsis thaliana]
 sp|Q680I5.1|GAGT2_ARATH RecName: Full=Gamma-glutamyltranspeptidase 2; AltName: Full=Gamma-glutamyltransferase 
2; AltName: Full=Glutathione hydrolase 
2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAD43645.1| putative gamma-glutamyltransferase [Arabidopsis thaliana]
 dbj|BAD94075.1| putative gamma-glutamyltransferase [Arabidopsis thaliana]
 gb|AEE87099.1| gamma-glutamyl transpeptidase 2 [Arabidopsis thaliana]
Length=578

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 149/220 (68%), Gaps = 12/220 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            +W Q++DHGTSH  I+D++RNAVSMT+T+N  FG  ++SPSTGIVLNNEM DFS PT+  
Sbjct  365  KWGQIKDHGTSHLSIIDSERNAVSMTSTINGYFGAIMLSPSTGIVLNNEMDDFSIPTKSG  424

Query  178  -SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
              PD  PP+PANFI P KRPLSSMTP +VLKD ++ A +G SGG  IIA   QV+LNH  
Sbjct  425  GDPDVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAALGASGGMYIIAGTTQVYLNHFF  484

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN   YENWT +  +H E+    R  LE +G  L     G 
Sbjct  485  LNMDPLSSVVAPRIYHQLIPNKASYENWTTVYSDHFEIPEEIRLVLEKKGQVLTPIAGGT  544

Query  535  ICQLLVQNLPKPGQWLNNGTFHGM--LTAVSDPRKGGSPA  648
            I QL+V+         ++G   G+  L AVSDPRKGG P+
Sbjct  545  ISQLIVEQ--------SDGKSGGISKLVAVSDPRKGGFPS  576



>emb|CDY47779.1| BnaC07g41810D [Brassica napus]
Length=267

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 120/170 (71%), Gaps = 9/170 (5%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            ++QL D GT+HFC+VD DRNAVSMTTTVNY FG G MSPSTGI+LN +M DF+ PT VS 
Sbjct  63   YNQLEDQGTTHFCVVDKDRNAVSMTTTVNYAFGSGFMSPSTGIILNGQMEDFAVPTLVSS  122

Query  184  DKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLGM  363
              LPP+P N+ISP KR LSSM P+++ KDN L  VIG SGG  I   V QVFLNH +  M
Sbjct  123  YSLPPAPTNYISPKKRALSSMMPLIITKDNDLVGVIGASGGPYIFPAVIQVFLNHFIFKM  182

Query  364  DPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQL  513
             PLEAVQ PRVY K         + T+ +G+HI+L+   R FL+ RGH+L
Sbjct  183  SPLEAVQRPRVYPK---------DMTVYNGDHIKLTEETREFLKARGHEL  223



>ref|XP_006833442.1| hypothetical protein AMTR_s00109p00152050 [Amborella trichopoda]
 gb|ERM98720.1| hypothetical protein AMTR_s00109p00152050 [Amborella trichopoda]
Length=463

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 138/217 (64%), Gaps = 6/217 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q  DHGTSH  IVD +RNAV++TTT+N  FG    S  TGIVLNN+M DFS P+  S
Sbjct  250  RWNQTNDHGTSHVSIVDKERNAVALTTTINNNFGALFRSVKTGIVLNNQMHDFSIPSNDS  309

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
               +P  PAN+I PNKRP+SS  P ++L++ QL  V+G SGG  I+    QV+LNH +  
Sbjct  310  --TMPSPPANYIEPNKRPMSSTMPTIILENGQLKGVMGASGGLRIVPANIQVYLNHFIHR  367

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP E++ +PR+YH L+PN + +E W  + G HIE+    R  L  +GH LQA   GA C
Sbjct  368  MDPFESILAPRLYHALVPNILEFEKWDTVSGYHIEVPLEDRAALAKKGHVLQALAFGAKC  427

Query  541  QLLVQNLPKPGQWLNNGT-FHGMLTAVSDPRKGGSPA  648
            Q +V +LP+   W    T     LT VSDPRK G PA
Sbjct  428  QFVVHHLPR---WPQGETVVKAKLTGVSDPRKEGEPA  461



>gb|AAL61611.2|AF401622_1 gamma-glutamyltransferase [Allium cepa]
Length=544

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 145/218 (67%), Gaps = 3/218 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFS--APTE  174
            +W+ + DHGTSH  IVD++RN VSMT+TVN  FG G+ S +TGIVLNNEM DFS  + + 
Sbjct  326  KWNVVNDHGTSHLSIVDSERNTVSMTSTVNSYFGAGIASQTTGIVLNNEMDDFSIPSNSS  385

Query  175  VSPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
             + +  PP+P NFI+P KRPLSSM+P ++LKD +L A +G SGG  IIA    +FL    
Sbjct  386  SNNNLPPPAPTNFIAPLKRPLSSMSPTIILKDGKLVASLGASGGGMIIAAATHIFLKLFA  445

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
              +DPL +V SPR YH+LIPN V YE+W  + G+H  ++   R  LE +GH L+    G 
Sbjct  446  EKLDPLSSVLSPRSYHQLIPNVVQYEDWMTVIGDHFLVAENDRTALEKKGHVLKPLAGGT  505

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            ICQ ++Q      + L++G  +G L AVSDPRKGG PA
Sbjct  506  ICQFIIQG-EDDAKELSSGIANGDLMAVSDPRKGGIPA  542



>ref|XP_006285909.1| hypothetical protein CARUB_v10007420mg [Capsella rubella]
 gb|EOA18807.1| hypothetical protein CARUB_v10007420mg [Capsella rubella]
Length=576

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 142/220 (65%), Gaps = 7/220 (3%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            +WSQ++DHGTSH  I+D++RN VSMT+T+N  FG  ++SPSTGIVLNNEM DFS P +  
Sbjct  362  KWSQIKDHGTSHLSIIDSERNVVSMTSTINGYFGALMLSPSTGIVLNNEMDDFSMPMKSG  421

Query  178  -SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
              PD  PP+PANFI P KRPLSSMTP +V KD ++ A +G SGG  IIA   +VFLNH  
Sbjct  422  GDPDVPPPAPANFIRPGKRPLSSMTPTIVFKDGKVKAALGASGGMYIIAGTTEVFLNHFF  481

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN   YENWT +   H E+    R  LE +GH L     G 
Sbjct  482  LNMDPLSSVVAPRIYHQLIPNKASYENWTTVYNGHFEIPKETRLVLEKKGHVLTPISGGT  541

Query  535  ICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            I Q +V       +   +      L AVSDPRKGG P+  
Sbjct  542  ISQFIVVQ-----ESDKSSGGRSKLVAVSDPRKGGFPSGF  576



>ref|XP_010437083.1| PREDICTED: gamma-glutamyltranspeptidase 2-like [Camelina sativa]
Length=580

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 147/220 (67%), Gaps = 11/220 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            +W+Q+ DHGTSH  ++D++RN VSMT+T+N  FG  ++SPSTG+VLNNEM DFS P +  
Sbjct  366  KWNQINDHGTSHLSVMDSERNVVSMTSTINGYFGAHMISPSTGMVLNNEMDDFSIPMKSR  425

Query  178  -SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
              PD  PP+PANFI P KRPLSSMTP +VLKD ++ A +G SGG  IIA   +VFLNH V
Sbjct  426  GDPDVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAALGASGGMYIIAGTTEVFLNHFV  485

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
              MDPL +V +PR+YH++IPN   YENWT +  +H E+    R  LE +GH L     G 
Sbjct  486  HNMDPLSSVAAPRIYHQVIPNKAQYENWTTVYNDHFEIPKETRLKLEKKGHVLAPIAGGT  545

Query  535  ICQLLVQNLPKPGQWLNNGTFHGM--LTAVSDPRKGGSPA  648
            I QL+V   P       + +  GM  L AVSDPRKGG P+
Sbjct  546  ISQLIVVQEP-------DKSSGGMSKLVAVSDPRKGGYPS  578



>ref|XP_010431940.1| PREDICTED: gamma-glutamyltranspeptidase 2-like [Camelina sativa]
Length=580

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 147/220 (67%), Gaps = 11/220 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            +W+Q+ DHGTSH  ++D++RN VSMT+T+N  FG  ++SPSTG+VLNNEM DFS P +  
Sbjct  366  KWNQINDHGTSHLSVMDSERNVVSMTSTINGYFGAHMISPSTGMVLNNEMDDFSIPRKSG  425

Query  178  -SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
              PD  PP+PANFI P KRPLSSMTP +VLKD ++ A +G SGG  IIA   +VFLNH V
Sbjct  426  GDPDVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAALGASGGMYIIAGTTEVFLNHFV  485

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
              MDPL +V +PR+YH++IPN   YENWT +  +H E+    R  LE +GH L     G 
Sbjct  486  HNMDPLSSVAAPRIYHQVIPNKAQYENWTTVYNDHFEIPKETRLKLEKKGHVLAPIAGGT  545

Query  535  ICQLLVQNLPKPGQWLNNGTFHGM--LTAVSDPRKGGSPA  648
            I QL+V   P       + +  GM  L AVSDPRKGG P+
Sbjct  546  ISQLIVVQEP-------DKSSGGMSKLVAVSDPRKGGYPS  578



>ref|XP_011072102.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Sesamum indicum]
Length=606

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 136/216 (63%), Gaps = 12/216 (6%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQ+ D GT+H C+VD  RN V+MTT++N +FG   MSPSTGI LNN+M DFS     S
Sbjct  401  KWSQVYDQGTTHICVVDNQRNVVTMTTSLNSIFGSKFMSPSTGIFLNNQMCDFSV---TS  457

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
              + PPSPANF+ P KRPLSSM P +++K  Q+ AVIG +GG  I   V QV +NH +L 
Sbjct  458  SHERPPSPANFVQPFKRPLSSMAPTILVKGKQVKAVIGAAGGILIPDAVTQVLINHFILK  517

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDP  AV+ PR+YH L P+ V +E +T   G++ E        L+ RGH L+   S  IC
Sbjct  518  MDPFTAVRIPRLYHMLYPDVVFHEKFTTKAGQY-EYKSKVLNELKKRGHLLRVCSSWTIC  576

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q ++Q L  P          G L AVSDPRKGG+PA
Sbjct  577  QFVIQKLSGPDS--------GQLVAVSDPRKGGAPA  604



>ref|XP_010446509.1| PREDICTED: gamma-glutamyltranspeptidase 2 [Camelina sativa]
Length=581

 Score =   211 bits (536),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 145/220 (66%), Gaps = 11/220 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEV-  177
            +W+Q+ DHGTSH  ++DA+RN VSMT+T+N  FG  ++SPSTG+VLNNEM DFS P +  
Sbjct  367  KWNQINDHGTSHLSVMDAERNVVSMTSTINGYFGAHMISPSTGMVLNNEMDDFSIPMKSR  426

Query  178  -SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
              PD  PP+PANFI P KRPLSSMTP +VLKD ++ A +G SGG  IIA   +VFLNH  
Sbjct  427  GDPDVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAALGASGGMYIIAGTTEVFLNHFF  486

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGA  534
            L MDPL +V +PR+YH+LIPN   YENWT +  +H E+    R  LE +GH L     G 
Sbjct  487  LNMDPLSSVAAPRIYHQLIPNKAQYENWTTVYNDHFEIPKETRLELEKKGHVLAPIAGGT  546

Query  535  ICQLLVQNLPKPGQWLNNGTFHGM--LTAVSDPRKGGSPA  648
            I Q +V   P       + +  GM  L AVSDPRKG  P+
Sbjct  547  ISQFIVVQEP-------DKSSGGMSKLVAVSDPRKGRYPS  579



>gb|EMS55114.1| Gamma-glutamyltranspeptidase 1 [Triticum urartu]
Length=792

 Score =   211 bits (538),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 129/191 (68%), Gaps = 0/191 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+ L+DHGTSH  IVD +RNAVSMT+TVN  FG  ++SPSTG++LNNEM DFS P   +
Sbjct  328  RWNILQDHGTSHLSIVDGERNAVSMTSTVNAYFGSLILSPSTGVLLNNEMDDFSMPANTT  387

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +  PP+P NF++P KRPLSSM P +VLKD +L A +G SGG+ I A   +V LNH    
Sbjct  388  ANTPPPAPNNFVAPLKRPLSSMCPTIVLKDGKLKAAVGASGGSMIPAGTIEVLLNHFAKN  447

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PRVYH+LIPN V YENWT + G+   L    R  L  +GH L+    G I 
Sbjct  448  MDPLSSVMAPRVYHQLIPNVVQYENWTTVTGDVFLLDAATRGDLLKKGHALKLLAGGTIS  507

Query  541  QLLVQNLPKPG  573
            QL+V N+   G
Sbjct  508  QLVVHNVEGRG  518



>gb|AFF18827.1| gamma-glutamyl transferase, partial [Dimocarpus longan]
Length=244

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSHFCIVDADRNAVSMTTTVN+VFG G++SPSTGIVLNNEM DFS PTE+S
Sbjct  122  RWSQLRDHGTSHFCIVDADRNAVSMTTTVNFVFGAGMLSPSTGIVLNNEMDDFSTPTEIS  181

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            PDKLPP+PANFI  NKRPLSSMTP++V KD+Q+  VIGGSGG  II  V QVF+NH VLG
Sbjct  182  PDKLPPAPANFIKSNKRPLSSMTPLIVTKDDQVVGVIGGSGGMYIIPAVTQVFINHFVLG  241

Query  361  MDP  369
            MDP
Sbjct  242  MDP  244



>ref|XP_008344003.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Malus domestica]
Length=144

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 109/144 (76%), Gaps = 7/144 (5%)
 Frame = +1

Query  244  MTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLGMDPLEAVQSPRVYHKLIPNTV  423
            MTP+++ KDNQLA V+GGSGG NII  V QVF+NH VLGMDPL+AVQSPR+YH+LIPN V
Sbjct  1    MTPLIITKDNQLAGVLGGSGGMNIIPAVTQVFVNHFVLGMDPLDAVQSPRIYHRLIPNIV  60

Query  424  LYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAICQLLVQNLPKP-------GQWL  582
             YEN T++DG+HIELS  R+ FL+ RGHQLQAQ  GAI QL+VQ L  P       G+  
Sbjct  61   CYENMTVIDGDHIELSDERKLFLQQRGHQLQAQAGGAITQLIVQTLQNPANIGRKSGKNS  120

Query  583  NNGTFHGMLTAVSDPRKGGSPAAI  654
            N   FHG LTAVSDPRK G PAA+
Sbjct  121  NEQIFHGRLTAVSDPRKDGRPAAV  144



>gb|EYU42482.1| hypothetical protein MIMGU_mgv1a023445mg [Erythranthe guttata]
Length=569

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 134/218 (61%), Gaps = 15/218 (7%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+QL DHGTSH CIVD  RN V+MTT++N  FG  +MSPSTGI LNN+M DFS PT   
Sbjct  365  KWAQLDDHGTSHICIVDQHRNVVTMTTSINTRFGSLIMSPSTGIFLNNQMYDFSIPTS--  422

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                P +PAN++SP KRPLSSM PI++ KD +L  VIG +GG  I   V QV +N  +L 
Sbjct  423  -QVRPGAPANYVSPFKRPLSSMAPIILEKDGRLRVVIGSAGGLLIPDAVTQVLINFFILK  481

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMD-GEHIELSGGRRRFLEDRGHQLQAQESGAI  537
            M+  +AV++PR YHKL PN + +EN+T  + GE  + S      LE +GH+         
Sbjct  482  MNTYDAVKAPRFYHKLYPNEIRFENYTSKNRGETFQYSSTTWTELEKKGHKADRAFGLTT  541

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAA  651
            CQ +VQ L               L A+SDPRKGG PAA
Sbjct  542  CQFVVQKLKS-----------SELIAISDPRKGGFPAA  568



>gb|EYU42487.1| hypothetical protein MIMGU_mgv1a0217831mg, partial [Erythranthe 
guttata]
Length=284

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 135/216 (63%), Gaps = 11/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQ  DHGT+H C VD+ RNAVSMT ++N+  G  VMS STGI+LN++M DFS P   +
Sbjct  78   KWSQSYDHGTTHLCTVDSQRNAVSMTVSLNHFLGSRVMSASTGILLNSQMYDFSIPASST  137

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            P     SPANFI P KRPLSSMTP +V+KD ++ AVIG +GG  I   VAQV +NHL   
Sbjct  138  PPP---SPANFIQPFKRPLSSMTPTIVVKDGRIKAVIGAAGGLLIPDAVAQVLINHLNSK  194

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            M+PL AV  PR+YH L PN + +E++   +G          R L+ +GH L+   + AIC
Sbjct  195  MNPLVAVTVPRLYHTLYPNVLYHEDYKSQNGHQFSYRSKMLRELKKKGHVLKKNTASAIC  254

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
              +VQNL  P          G L AV+D RKGG PA
Sbjct  255  SFVVQNLEGPDS--------GQLIAVTDQRKGGLPA  282



>gb|EYU42483.1| hypothetical protein MIMGU_mgv1a021332mg [Erythranthe guttata]
Length=539

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 134/217 (62%), Gaps = 11/217 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+QL DHGTSH CIVD DRN ++MTT++N  +G  +MSPSTGI LNN+M DFS PT   
Sbjct  333  KWAQLNDHGTSHLCIVDRDRNVITMTTSINTKWGSRIMSPSTGIFLNNQMYDFSVPTSKG  392

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                P +PAN++S  KRPLSSM PI++ K+ ++ AVIG +GG  I   V+QV +N ++  
Sbjct  393  A---PGAPANYVSAYKRPLSSMAPIILEKEGRVRAVIGSAGGILIPDAVSQVLINFIIRK  449

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
                ++V++PR YHKL PN +LYE +T   G+           L  +GH + A  +   C
Sbjct  450  KLSYDSVKAPRFYHKLYPNKLLYEKYTSFSGDEYIYPSATISELSRKGHTVSAVTAMTTC  509

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAA  651
            Q ++Q L         G   G+L A+SDPRK G PAA
Sbjct  510  QFVIQRL--------KGNKSGLLVAISDPRKSGYPAA  538



>ref|XP_010040323.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Eucalyptus grandis]
Length=503

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 115/157 (73%), Gaps = 7/157 (4%)
 Frame = +1

Query  205  ANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLGMDPLEAVQ  384
            ANFI PNKRPLSSMTP+++ KDNQLA VIGGSGG +II  V QVFLNH VLGM+P +AVQ
Sbjct  347  ANFIQPNKRPLSSMTPLIITKDNQLAGVIGGSGGMDIIPAVTQVFLNHFVLGMEPSDAVQ  406

Query  385  SPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAICQLLVQNLP  564
             PRVYH+LIPN V YEN+T ++G HIEL   R+ FL +RGH+L+A+  G I QL+V +L 
Sbjct  407  YPRVYHRLIPNVVYYENYTCINGNHIELVDERKLFLNERGHKLEARAGGGIVQLVVHSLQ  466

Query  565  K-------PGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
                      +  N+G  HG LTAVSDPRK G PAA+
Sbjct  467  STLDSGHMSCEDFNSGVVHGTLTAVSDPRKDGGPAAV  503



>ref|NP_177140.1| gamma-glutamyl transpeptidase 3 [Arabidopsis thaliana]
 sp|Q9CAR5.1|GAGT4_ARATH RecName: Full=Putative inactive gamma-glutamyltranspeptidase 
4; AltName: Full=Gamma-glutamyltranspeptidase 3 [Arabidopsis 
thaliana]
 gb|AAG52560.1|AC010675_8 putative gamma-glutamyltransferase (light chain II); 69213-70035 
[Arabidopsis thaliana]
 gb|AEE34980.1| gamma-glutamyl transpeptidase 3 [Arabidopsis thaliana]
Length=191

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 110/147 (75%), Gaps = 2/147 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW Q+ DHGTSH  I+D++RN VS+T+T+N  FG  ++SPSTGIVLNNEM DFS P + S
Sbjct  45   RWDQINDHGTSHLSIIDSERNVVSLTSTINSYFGALMLSPSTGIVLNNEMDDFSIPMKSS  104

Query  181  PDKL--PPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
             +    PP+PANFI P KRPLSSMTP +VLKD ++ A +G SGG  IIA   +VFLN+  
Sbjct  105  SNLTVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKASVGASGGLYIIAGTTEVFLNYFF  164

Query  355  LGMDPLEAVQSPRVYHKLIPNTVLYEN  435
            L MDPL +V +PR+YH+LIPN V YEN
Sbjct  165  LKMDPLSSVLAPRIYHQLIPNIVSYEN  191



>emb|CDX72677.1| BnaC07g46990D [Brassica napus]
Length=172

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 117/182 (64%), Gaps = 14/182 (8%)
 Frame = +1

Query  109  VMSPSTGIVLNNEMGDFSAPTEV--SPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLA  282
            ++SPSTGIVLNNEM DFS P +     D  PP+PANFI P KRPLSSM P +VLKD ++ 
Sbjct  1    MLSPSTGIVLNNEMDDFSIPMKSIGDHDVPPPAPANFIRPGKRPLSSMAPTIVLKDGKVK  60

Query  283  AVIGGSGGTNIIATVAQVFLNHLVLGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHI  462
            A +G SGG  IIA   +VFLNH  L MDPL +V +PR+YH+LIPN+VLYENWT +  +H 
Sbjct  61   ASVGASGGIFIIAGTTEVFLNHFFLNMDPLSSVLAPRIYHQLIPNSVLYENWTTVYDDHF  120

Query  463  ELSGGRRRFLEDRGHQLQAQESGAICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGS  642
            E+    R  LE +GH L     G I Q +VQ              +G L AVSDPRKGG 
Sbjct  121  EIPKETRDVLEKKGHVLAPIAGGMISQFIVQES------------YGKLVAVSDPRKGGF  168

Query  643  PA  648
            P+
Sbjct  169  PS  170



>emb|CDY00064.1| BnaC09g02370D [Brassica napus]
Length=339

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 118/167 (71%), Gaps = 6/167 (4%)
 Frame = +1

Query  4    WSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSP  183
            W+Q+  HGTSH  I+D +RNAVS+ T+VN  FG  ++SPSTGIVLN +M DF+ P +   
Sbjct  146  WNQIDHHGTSHLSIIDRERNAVSIATSVNSCFGAVMLSPSTGIVLNIQMDDFTVPAKSRS  205

Query  184  D--KLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVL  357
            D    PP+PA+FI P KRPLSSM+P +VLKD ++ A +G SGG NIIA   +VFLNH  L
Sbjct  206  DLNVPPPAPASFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAATTEVFLNHFFL  265

Query  358  GMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIEL----SGGRRR  486
             MDPL +V +PR+YH+LIPN VL+EN T +  +H E+    S G+ R
Sbjct  266  NMDPLSSVLAPRIYHQLIPNRVLFENLTTVLNDHFEIPKETSVGKER  312



>ref|XP_011072100.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Sesamum indicum]
Length=618

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 133/217 (61%), Gaps = 12/217 (6%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQL DHGTSH CIVD  RN V+MTT++N  FG   MSPSTGI LNN+M DFS PT   
Sbjct  369  KWSQLNDHGTSHICIVDRQRNVVTMTTSINTHFGSRFMSPSTGIFLNNQMHDFSIPTS--  426

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                P +P+N++ P KRPLSSM P ++ K  ++ AV+G +GG  I   V+QV +N  VL 
Sbjct  427  -KVRPGAPSNYVGPFKRPLSSMAPAILEKGGRVRAVVGSAGGLLIPDAVSQVLINFFVLK  485

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQ-AQESGAI  537
                 AV++PR YH+L PN +L+EN++   G+    S      L+ +GHQL+ A     +
Sbjct  486  KPSYNAVKAPRFYHRLYPNVLLHENYSSSVGDRYAFSVRTLNELKRKGHQLKRAASVMTV  545

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            CQ +VQ L         G   G L AVSDPRKGG PA
Sbjct  546  CQFVVQVL--------KGKNSGQLIAVSDPRKGGFPA  574



>gb|EYU40496.1| hypothetical protein MIMGU_mgv1a025407mg, partial [Erythranthe 
guttata]
Length=539

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 132/216 (61%), Gaps = 11/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQ+ DHGT+H C VD+ RN V+MT ++N  FG  +MS STGI LNN+M DFS P   +
Sbjct  333  KWSQIYDHGTTHLCAVDSQRNVVTMTISLNSYFGSKIMSASTGIFLNNQMYDFSIPESTT  392

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            P     SPANFI P KRPLSSM P +++KD ++ AVIG +GG  I   VAQV +NH+ L 
Sbjct  393  PPP---SPANFIQPFKRPLSSMAPTILVKDGRIKAVIGAAGGLLIPDAVAQVLINHINLK  449

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AV  PR+YH L PN + +E +   +G          + LE +GH+L+      IC
Sbjct  450  MDPLVAVNVPRLYHTLYPNVLYHEEYISRNGTKYFFHSKMLKELEMKGHELERVSDWTIC  509

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +VQ L         G   G L AVSD RKGG PA
Sbjct  510  QFVVQKL--------EGRDSGQLIAVSDQRKGGFPA  537



>emb|CDX72680.1| BnaC07g47020D [Brassica napus]
Length=530

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 121/216 (56%), Gaps = 47/216 (22%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RW+Q++DHGTSH  I+D +RN VSMT                                  
Sbjct  360  RWNQIKDHGTSHLSIIDHERNCVSMT----------------------------------  385

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
             +K PP+PANFI P KRPLSSMTP +VLKD ++ A +G SGG  IIA   +VFLNH +L 
Sbjct  386  -NKPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAAVGASGGMYIIAGTTEVFLNHFLLN  444

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL +V +PR+YH+LIPN+V YENWT    +H E+  G R  LE +GH L     G I 
Sbjct  445  MDPLSSVVAPRIYHQLIPNSVKYENWTTAFNDHFEIPKGTRHVLEKKGHVLTPFAGGTIS  504

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +VQ               G L AVSDPRKGG P+
Sbjct  505  QFIVQE------------SDGKLVAVSDPRKGGFPS  528



>gb|EYU42484.1| hypothetical protein MIMGU_mgv1a003641mg [Erythranthe guttata]
Length=572

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 135/217 (62%), Gaps = 13/217 (6%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQ+ DHGT+H C VD+ RNAVSMT ++N  FG  VMS STGI LNN+M DFS PT  S
Sbjct  366  KWSQIYDHGTTHLCAVDSQRNAVSMTMSLNSYFGSRVMSYSTGIYLNNQMYDFSIPTLSS  425

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            P     SPANFI P KRPLSSMTP +++K  +L AVIG +GG  I   V QV +N+L L 
Sbjct  426  PPP---SPANFIQPFKRPLSSMTPTILVKGGRLKAVIGAAGGLLIPDAVTQVLINNLNLK  482

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESG-AI  537
            MD L AV +PR+YH L PN VLY      +G          + LE +GH L+   SG  +
Sbjct  483  MDTLTAVNAPRLYHTLYPN-VLYHEVYSRNGSDYYFDSNIVKELEKKGHVLREASSGWTV  541

Query  538  CQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            CQ +VQ+        + G+  G L AVSD RKGG PA
Sbjct  542  CQFVVQS--------SKGSNSGQLIAVSDQRKGGFPA  570



>gb|EYU42485.1| hypothetical protein MIMGU_mgv1a024464mg [Erythranthe guttata]
Length=534

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 130/216 (60%), Gaps = 11/216 (5%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQ+ DHGT+H C+VD+ RN V+MT ++N  FG  +MS STGI LNN+M DFS P   +
Sbjct  328  KWSQIYDHGTTHLCVVDSQRNVVTMTMSLNSYFGSKMMSTSTGIFLNNQMYDFSIPRSSN  387

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
            P     SPANFI P KRPLSSM P + +KD ++ AVIG +GG  I   VAQV +NHL + 
Sbjct  388  PPP---SPANFIQPFKRPLSSMAPTIFVKDGRVKAVIGAAGGLLIPDAVAQVLINHLNIN  444

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
            MDPL AV  PR+YH L PN + +E +   +G          R  + +GH L+      IC
Sbjct  445  MDPLVAVNVPRLYHTLYPNVLYHEKYRSQNGSEYYFPDYMLRQWQRKGHVLKKGYGWTIC  504

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            Q +VQ L  P          G L AVSD RKGG PA
Sbjct  505  QFVVQKLEGPDS--------GQLIAVSDQRKGGFPA  532



>ref|XP_006853587.1| hypothetical protein AMTR_s00056p00019670 [Amborella trichopoda]
 gb|ERN15054.1| hypothetical protein AMTR_s00056p00019670 [Amborella trichopoda]
Length=168

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 111/168 (66%), Gaps = 3/168 (2%)
 Frame = +1

Query  148  MGDFSAPTEVSP-DKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIAT  324
            M DFS P++VS  + +PP+PANFI P+KRPLSS TP V+LKD QL  VIG SGG  II +
Sbjct  1    MNDFSIPSDVSSQNTMPPAPANFIKPHKRPLSSTTPTVILKDGQLKGVIGASGGWRIIPS  60

Query  325  VAQVFLNHLVLGMDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRG  504
              QV LNH +  MDP ++V +PR+YH LIPN + YE+W  + G HIE+    R  LE++G
Sbjct  61   NIQVLLNHFIHQMDPFDSVLAPRLYHSLIPNILQYEDWDTVSGYHIEVPLHDRTALENKG  120

Query  505  HQLQAQESGAICQLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
            H L+   SGAICQ +V +LP   Q          LT VSDPRK G+PA
Sbjct  121  HILEPLASGAICQFVVHHLPTRAQ--GETIVKANLTGVSDPRKEGAPA  166



>ref|XP_008354542.1| PREDICTED: gamma-glutamyltranspeptidase 3-like [Malus domestica]
Length=480

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 104/148 (70%), Gaps = 7/148 (5%)
 Frame = +1

Query  232  PLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLGMDPLEAVQSPRVYHKLI  411
            P  S +  +  +   LA V+GGSGG NII  V QVF+NH VLGMDPL+AVQSPR+YH+LI
Sbjct  333  PFCSSSNSIAYESKSLAGVLGGSGGMNIIPAVTQVFVNHFVLGMDPLDAVQSPRIYHRLI  392

Query  412  PNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAICQLLVQNLPKP-------  570
            PN V YEN T++DG+HIELS  R+ FL+ RGHQLQAQ  GAI QL+VQ L  P       
Sbjct  393  PNIVCYENMTVIDGDHIELSDERKLFLQQRGHQLQAQAGGAITQLIVQTLQNPANIGRKG  452

Query  571  GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            G+  N   FHG LTAVSDPRK G PAA+
Sbjct  453  GKNSNEQIFHGRLTAVSDPRKDGKPAAV  480



>ref|XP_002500977.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO62235.1| predicted protein, partial [Micromonas sp. RCC299]
Length=479

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +W+QL D GT+H  +VD +RNAV++T+T+N  FG  ++SPSTGIVLNNEM DFS+P EV+
Sbjct  335  KWNQLDDSGTTHVSVVDKERNAVALTSTINTEFGSKLVSPSTGIVLNNEMDDFSSPGEVN  394

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
               L P  ANFI+  KRPLSSM+P +V +D +L AV G SGG  II   AQ+ LN +  G
Sbjct  395  HYGLAPHEANFIAAGKRPLSSMSPTIVTRDGKLYAVAGASGGPRIITATAQLLLNVIARG  454

Query  361  MDPLEAVQSPRVYHKLIPNTVLYEN  435
            M PL+AV +PR++H+L+P+    EN
Sbjct  455  MSPLDAVNAPRLHHQLVPHVAFAEN  479



>gb|EEC69963.1| hypothetical protein OsI_00423 [Oryza sativa Indica Group]
Length=566

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 116/225 (52%), Gaps = 75/225 (33%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQL DHGTSH C+VD DRNAV+MTTTVN  FG  V+SPSTGIV               
Sbjct  410  KWSQLNDHGTSHLCVVDGDRNAVAMTTTVNSYFGAHVLSPSTGIV---------------  454

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                                         + QLA V+GGSGGTNIIA   Q         
Sbjct  455  -----------------------------NGQLAGVVGGSGGTNIIAAATQ---------  476

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
                           L+PN V+YEN T++DGE IELSG  R FL  RGH+L++  SGA+C
Sbjct  477  ---------------LVPNEVVYENETVVDGEVIELSGEAREFLRRRGHRLRSTGSGAVC  521

Query  541  QLLVQNLPKP-------GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ+L  P        Q      FHGMLTAVSDPRKGG PA +
Sbjct  522  QFIVQDLLAPVGSATDRRQHGGGNVFHGMLTAVSDPRKGGRPAGM  566



>gb|EAZ10564.1| hypothetical protein OsJ_00396 [Oryza sativa Japonica Group]
Length=401

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 115/219 (53%), Gaps = 69/219 (32%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQL DHGTSH C+VD DRNAV+MTTT N++FG  ++SPSTGIV               
Sbjct  251  KWSQLDDHGTSHLCVVDGDRNAVAMTTTENHLFGAHLLSPSTGIV---------------  295

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                                         D QLA V+GGSGG  IIATV Q         
Sbjct  296  -----------------------------DGQLAGVVGGSGGPFIIATVVQ---------  317

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
                           L+PN V+YEN T++DGE  ELSG  R FL  RGH+L + +SGA+C
Sbjct  318  ---------------LVPNEVVYENVTVVDGEVFELSGEAREFLRRRGHRLTSTDSGAVC  362

Query  541  QLLVQNLPKP-GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ+L  P     +   FHGMLTAVSDPRK G PA +
Sbjct  363  QFIVQDLLTPVAAAGDENVFHGMLTAVSDPRKDGRPAGM  401



>ref|NP_001042040.2| Os01g0151500 [Oryza sativa Japonica Group]
 dbj|BAF03954.2| Os01g0151500 [Oryza sativa Japonica Group]
Length=492

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 115/219 (53%), Gaps = 69/219 (32%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQL DHGTSH C+VD DRNAV+MTTT N++FG  ++SPSTGIV               
Sbjct  342  KWSQLDDHGTSHLCVVDGDRNAVAMTTTENHLFGAHLLSPSTGIV---------------  386

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                                         D QLA V+GGSGG  IIATV Q         
Sbjct  387  -----------------------------DGQLAGVVGGSGGPFIIATVVQ---------  408

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
                           L+PN V+YEN T++DGE  ELSG  R FL  RGH+L + +SGA+C
Sbjct  409  ---------------LVPNEVVYENVTVVDGEVFELSGEAREFLRRRGHRLTSTDSGAVC  453

Query  541  QLLVQNLPKP-GQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q +VQ+L  P     +   FHGMLTAVSDPRK G PA +
Sbjct  454  QFIVQDLLTPVAAAGDENVFHGMLTAVSDPRKDGRPAGM  492



>ref|NP_974636.1| gamma-glutamyl transpeptidase 4 [Arabidopsis thaliana]
 gb|AEE85603.1| gamma-glutamyl transpeptidase 4 [Arabidopsis thaliana]
Length=512

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRD GTSHFC+VDADRN+VSMT+TVNY FG GV+SPSTGIVLNNEM DFS PTE++
Sbjct  409  RWSQLRDQGTSHFCVVDADRNSVSMTSTVNYRFGAGVLSPSTGIVLNNEMDDFSTPTEIT  468

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLK  267
            PD LPP+P NFI PNKRPLSSMTP+V+ K
Sbjct  469  PDMLPPAPTNFIEPNKRPLSSMTPLVITK  497



>gb|KFM26422.1| Gamma-glutamyltranspeptidase 1 [Auxenochlorella protothecoides]
Length=257

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  19   DHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSPDKLPP  198
            D GTSH  +VD    AVS+TTT+N  FG  ++SPSTGI+LNN+M DFS P +++    PP
Sbjct  51   DAGTSHLSVVDDSGMAVSLTTTINTGFGSKILSPSTGILLNNQMADFSTPGQLNVFGYPP  110

Query  199  SPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLGMDPLEA  378
            SP+NFI P K+P SSM+P++V +D +L   +GGSGG  II+ V Q  L  +  G    +A
Sbjct  111  SPSNFIRPGKKPFSSMSPLIVEQDGKLRVCVGGSGGPRIISAVLQTVLRLIAYGEPAFDA  170

Query  379  VQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAICQLLVQN  558
            V +PR++H+L+P+ +  ENW++  G     S      L   GH +Q    GA+ Q +V +
Sbjct  171  VANPRLHHQLVPSILYAENWSV-GGISFNYSTPLLEDLAAHGHDVQLTNWGAVVQAVVVD  229

Query  559  LPKPGQWLNNGTFHGMLTAVSDPRKGGSPAA  651
                       T HG    VSDPRK G+P+ 
Sbjct  230  PVIGVGQSTTPTLHG----VSDPRKDGAPSG  256



>emb|CDM84147.1| unnamed protein product [Triticum aestivum]
Length=403

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 110/221 (50%), Gaps = 71/221 (32%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQLRD+GTSH C+VD DRNAV+MTTTVNY FG  V+SPSTGIV               
Sbjct  251  KWSQLRDNGTSHLCVVDGDRNAVAMTTTVNYYFGAHVLSPSTGIV---------------  295

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
                                         D QLA V+G SGGTNII  V Q         
Sbjct  296  -----------------------------DGQLAGVVGASGGTNIITAVTQ---------  317

Query  361  MDPLEAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAIC  540
                           L+PN V YE+ T+ DGE IE S     FL  RGH L++   GA+C
Sbjct  318  ---------------LVPNVVRYEDVTMADGEVIEFSTEAMEFLRRRGHVLESTSPGAVC  362

Query  541  QLLVQNLPKPGQWLNNG---TFHGMLTAVSDPRKGGSPAAI  654
            QL+VQ+L  P      G    F GMLTAVSDPRK GSPA +
Sbjct  363  QLIVQDLLAPVSGAGGGGENVFRGMLTAVSDPRKDGSPAGV  403



>ref|XP_002888740.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64999.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=156

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 97/154 (63%), Gaps = 6/154 (4%)
 Frame = +1

Query  193  PPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLGMDPL  372
            PP+PANFI P KRPLSSMTP +VLK  ++ A +G SGG NIIA   +VFLN + L MDPL
Sbjct  5    PPAPANFIRPGKRPLSSMTPTIVLKAGKVKAAVGASGGVNIIAGTMEVFLNCIFLKMDPL  64

Query  373  EAVQSPRVYHKLIPNTVLYENWTIMDGEHIELSGGRRRFLEDRGHQLQAQESGAICQLLV  552
             +V +PR+YH+LIPN V YENWT +  +H E+    R  LE +GH L+    G + Q +V
Sbjct  65   SSVLAPRIYHQLIPNIVSYENWTTLFSDHFEVPKETRVVLEKKGHALRPIHVGTMVQFIV  124

Query  553  QNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPAAI  654
            Q      +   N +    L AVSDP KGG P  I
Sbjct  125  Q------ESGANSSGISELVAVSDPIKGGVPFGI  152



>ref|XP_006851797.1| hypothetical protein AMTR_s00814p00012490, partial [Amborella 
trichopoda]
 gb|ERN13264.1| hypothetical protein AMTR_s00814p00012490, partial [Amborella 
trichopoda]
Length=192

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            R   LRDHGTSH C+V   R AVSMTT++N +FG    S  TGI+LNN+M DF+ PT++S
Sbjct  58   RLRLLRDHGTSHLCVVGRHRGAVSMTTSINGLFGALFRSCKTGIILNNQMDDFNIPTDIS  117

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLG  360
               +P + AN+I P KRPLSSM P + LKD +L  VIGGSGG  II T  QV LN+ +  
Sbjct  118  NPTIPSASANYIEPFKRPLSSMMPTIFLKDQELEGVIGGSGGPRIIPTTIQVLLNYFIHQ  177

Query  361  MDPLEAVQSPRVYHK  405
            +DP  +V SPR+YH+
Sbjct  178  LDPGSSVFSPRLYHR  192



>ref|XP_007255036.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Astyanax mexicanus]
Length=572

 Score =   155 bits (393),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 125/215 (58%), Gaps = 30/215 (14%)
 Frame = +1

Query  19   DHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSPDKLPP  198
            DHGTSH  ++  D +AV+ T+T+N  FG  VMS STGI+LNNEM DFS+P   +   +PP
Sbjct  381  DHGTSHMSVLAEDGSAVAATSTINRYFGSKVMSASTGIILNNEMDDFSSPLITNSFGVPP  440

Query  199  SPANFISPNKRPLSSMTPIVVL-KDNQLAAVIGGSGGTNIIATVAQVFLNHLVLGMDPLE  375
            SP NFI P+KRP+SSM P ++  K++++  V+GGSGGT I  +VAQV LN L    D   
Sbjct  441  SPNNFIKPHKRPMSSMCPAILFDKNHKVKMVVGGSGGTKITTSVAQVILNSLSFNYDLKR  500

Query  376  AVQSPRVYHKLIPNTVLYE---NWTIMDGEHIELSGGRRRFLEDRGHQLQAQES-GAICQ  543
            +V  PRV+++L PN  L E   +  + DG            L  + H ++   S GA+  
Sbjct  501  SVVEPRVHNQLSPNITLVEAGFDQAVADG------------LAQKNHVIEVLTSTGAV--  546

Query  544  LLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGGSPA  648
              VQ + + G W+          AVSDPRKGG  A
Sbjct  547  --VQAIERRGMWIE---------AVSDPRKGGYAA  570



>gb|EMT04046.1| hypothetical protein F775_43165 [Aegilops tauschii]
Length=418

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = +1

Query  259  VLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLGMDPLEAVQSPRVYHKLIPNTVLYENW  438
            V     LA V+G SGGTNIIA V QVFLNH VLGM PL AVQSPRVYH L+PN V YE+ 
Sbjct  256  VAMTTTLAGVVGASGGTNIIAAVTQVFLNHFVLGMSPLVAVQSPRVYHSLVPNVVRYEDE  315

Query  439  TIMDGEHIELSGGRRRFLEDRGHQLQAQESGAICQLLVQNLPKPGQWLNNGTFHGMLTAV  618
            T++DGE IEL    R FL  RGH L+     A+CQ++VQ+L  P    +   FHGMLTAV
Sbjct  316  TVVDGEVIELKAEAREFLRRRGHVLKGTVWSAVCQMIVQDLQAPVSSGSENVFHGMLTAV  375

Query  619  SDPRKGG  639
            SDPRK G
Sbjct  376  SDPRKDG  382


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 4/52 (8%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFG--GG--VMSPSTGIVLNN  144
            +WSQLRD+GTSH C+VD DRNAV+MTTT+  V G  GG  +++  T + LN+
Sbjct  234  KWSQLRDNGTSHLCVVDGDRNAVAMTTTLAGVVGASGGTNIIAAVTQVFLNH  285



>gb|KEH27233.1| gamma-glutamyltranspeptidase [Medicago truncatula]
Length=506

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            RWSQLRDHGTSH C+VDADRNAVS+TT+VN+ FG G+ S STGIV+NNEM DFS PT++S
Sbjct  399  RWSQLRDHGTSHLCVVDADRNAVSLTTSVNWHFGAGIRSTSTGIVVNNEMDDFSTPTDIS  458

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLK  267
            PDKLPP+P NFI PNKRPLSSMTPI++ K
Sbjct  459  PDKLPPAPTNFIEPNKRPLSSMTPIIITK  487



>ref|XP_005815351.1| PREDICTED: gamma-glutamyltranspeptidase 1-like [Xiphophorus maculatus]
Length=569

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 125/213 (59%), Gaps = 30/213 (14%)
 Frame = +1

Query  16   RDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSPDKLP  195
             DHGTSH  +V  D +AV+ T+T+N+  G  VMS STGI+LNNEM DFS+P  ++   +P
Sbjct  377  EDHGTSHLSVVSEDGSAVAATSTINHYLGSKVMSGSTGIILNNEMDDFSSPYIINGFGVP  436

Query  196  PSPANFISPNKRPLSSMTPIVVL-KDNQLAAVIGGSGGTNIIATVAQVFLNHLVLGMDPL  372
            PSP+NFI P KRP+SSM P ++L K+N +  V+GGSGGT I  ++AQV LN L    D  
Sbjct  437  PSPSNFIIPGKRPMSSMCPTILLDKNNNVKMVVGGSGGTKITTSIAQVILNALFFNFDVD  496

Query  373  EAVQSPRVYHKLIPNTVLYE---NWTIMDGEHIELSGGRRRFLEDRGHQLQAQES-GAIC  540
            +AV  PR++++L PNT   E   +  I+DG            L  + H+ +   S GA+ 
Sbjct  497  KAVTDPRLHNQLSPNTTQVEPEFDKEIVDG------------LAKKNHETEFLTSFGAVV  544

Query  541  QLLVQNLPKPGQWLNNGTFHGMLTAVSDPRKGG  639
            Q +V++                L A SDPRKGG
Sbjct  545  QAVVRH-------------ENRLFAKSDPRKGG  564



>ref|XP_006826822.1| hypothetical protein AMTR_s00010p00066490 [Amborella trichopoda]
 gb|ERM94059.1| hypothetical protein AMTR_s00010p00066490 [Amborella trichopoda]
Length=399

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVS  180
            +WSQLRDH TS FCIVDA+RNAVSMT+TVNY FGGG++S STGI+LNNEM DFS PTE++
Sbjct  298  QWSQLRDHVTSRFCIVDANRNAVSMTSTVNYPFGGGMVSQSTGILLNNEMADFSTPTEMA  357

Query  181  PDKLPPSPANFISPNKRPLSSMTPIVVLKDNQL  279
            PD+ PP+PANFI+PNKRPLSSM P +VLK  Q+
Sbjct  358  PDRRPPAPANFIAPNKRPLSSMAPFIVLKVYQV  390



>ref|XP_005708855.1| gamma-glutamyltranspeptidase isoform 2 [Galdieria sulphuraria]
 gb|EME32335.1| gamma-glutamyltranspeptidase isoform 2 [Galdieria sulphuraria]
Length=770

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = +1

Query  16   RDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSPDKLP  195
             DHGT+H  +VD + NAV++T+TVN  FG   +S STGI+LNNEM DFS     +   L 
Sbjct  584  EDHGTTHLSVVDEEGNAVAITSTVNLPFGARFVSSSTGILLNNEMDDFSTGNRENSFGLA  643

Query  196  PSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLGMDPLE  375
            P+ AN + P KRPLSSM+P++VLK+ +L  V+GGSGG  II +VAQVFLN    G DP +
Sbjct  644  PAEANEVEPGKRPLSSMSPLIVLKNGRLYMVLGGSGGPRIITSVAQVFLNIATFGDDPAK  703

Query  376  AVQSPRVYHKLIPNTVLYEN  435
            A+ +PR++H+L PNTV  E+
Sbjct  704  AIAAPRLHHQLFPNTVFLES  723



>gb|AAS91712.1| gamma-glutamyl transpeptidase [Allium cepa]
Length=202

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = +1

Query  1    RWSQLRDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFS--APTE  174
            +W+ + DHGTSH  IVD++RN VSMT+TVN  FG G+ S +TGIVLNNEM DFS  + + 
Sbjct  66   KWNVVNDHGTSHLSIVDSERNTVSMTSTVNSYFGAGIASQTTGIVLNNEMDDFSIPSNSS  125

Query  175  VSPDKLPPSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLV  354
             + +  PP+P NFI+P KRPLSSM+P ++LKD +L A +G SGG  IIA    +FL    
Sbjct  126  SNNNLPPPAPTNFIAPLKRPLSSMSPTIILKDGKLVASLGASGGGMIIAAATHIFLKLFA  185

Query  355  LGMDPLEAVQSPRVYHK  405
              +DPL +V SPR YH+
Sbjct  186  EKLDPLSSVLSPRSYHQ  202



>ref|XP_005708856.1| gamma-glutamyltranspeptidase isoform 1 [Galdieria sulphuraria]
 gb|EME32336.1| gamma-glutamyltranspeptidase isoform 1 [Galdieria sulphuraria]
Length=790

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = +1

Query  16   RDHGTSHFCIVDADRNAVSMTTTVNYVFGGGVMSPSTGIVLNNEMGDFSAPTEVSPDKLP  195
             DHGT+H  +VD + NAV++T+TVN  FG   +S STGI+LNNEM DFS     +   L 
Sbjct  601  EDHGTTHLSVVDEEGNAVAITSTVNLPFGARFVSSSTGILLNNEMDDFSTGNRENSFGLA  660

Query  196  PSPANFISPNKRPLSSMTPIVVLKDNQLAAVIGGSGGTNIIATVAQVFLNHLVLGMDPLE  375
            P+ AN + P KRPLSSM+P++VLK+ +L  V+GGSGG  II +VAQVFLN    G DP +
Sbjct  661  PAEANEVEPGKRPLSSMSPLIVLKNGRLYMVLGGSGGPRIITSVAQVFLNIATFGDDPAK  720

Query  376  AVQSPRVYHKLIPNTVLYEN  435
            A+ +PR++H+L PNTV  E+
Sbjct  721  AIAAPRLHHQLFPNTVFLES  740



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1553959698018