BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21256_g1_i3 len=1898 path=[1876:0-897 @4353@!:898-1205
3082:1206-1897]

Length=1898
                                                                      Score     E

emb|CBI35828.3|  unnamed protein product                                471   1e-155   
ref|XP_002272087.2|  PREDICTED: uncharacterized protein LOC100241...    471   1e-154   Vitis vinifera
ref|XP_008228154.1|  PREDICTED: uncharacterized protein LOC103327593    466   9e-154   
ref|XP_011079473.1|  PREDICTED: uncharacterized protein LOC105162982    464   8e-153   
emb|CDO97816.1|  unnamed protein product                                462   1e-152   
ref|XP_010654401.1|  PREDICTED: uncharacterized protein LOC100241...    465   2e-152   
ref|XP_010104607.1|  hypothetical protein L484_005038                   460   2e-151   
ref|XP_009336716.1|  PREDICTED: uncharacterized protein LOC103929275    458   2e-150   
ref|XP_008380771.1|  PREDICTED: uncharacterized protein LOC103443658    457   7e-150   
ref|XP_006465840.1|  PREDICTED: uncharacterized protein LOC102629788    454   3e-149   
ref|XP_006426751.1|  hypothetical protein CICLE_v10025332mg             454   4e-149   
gb|KHG28824.1|  hypothetical protein F383_15620                         452   1e-148   
ref|XP_004305766.1|  PREDICTED: uncharacterized protein LOC101315368    452   2e-148   
ref|XP_009765878.1|  PREDICTED: uncharacterized protein LOC104217350    450   1e-147   
ref|XP_007217868.1|  hypothetical protein PRUPE_ppa021525mg             449   2e-147   
ref|XP_009623979.1|  PREDICTED: uncharacterized protein LOC104115113    447   2e-146   
ref|XP_006362090.1|  PREDICTED: uncharacterized protein LOC102584804    446   4e-146   
ref|XP_007024713.1|  Uncharacterized protein TCM_029205                 445   9e-146   
ref|XP_004252522.1|  PREDICTED: uncharacterized protein LOC101267004    442   1e-144   
ref|XP_002304236.2|  hypothetical protein POPTR_0003s06780g             441   7e-144   Populus trichocarpa [western balsam poplar]
ref|XP_011036498.1|  PREDICTED: uncharacterized protein LOC105133992    440   1e-143   
ref|XP_008342434.1|  PREDICTED: uncharacterized protein LOC103405...    433   1e-140   
ref|XP_008342435.1|  PREDICTED: uncharacterized protein LOC103405...    433   1e-140   
ref|XP_002529183.1|  conserved hypothetical protein                     431   4e-140   Ricinus communis
ref|XP_010061859.1|  PREDICTED: uncharacterized protein LOC104449411    430   1e-139   
ref|XP_009378365.1|  PREDICTED: uncharacterized protein LOC103966867    430   1e-139   
gb|KEH17037.1|  DUF936 family protein                                   428   8e-139   
ref|XP_007139071.1|  hypothetical protein PHAVU_009G262500g             427   1e-138   
gb|KGN47776.1|  hypothetical protein Csa_6G401460                       427   2e-138   
ref|XP_008464802.1|  PREDICTED: uncharacterized protein LOC103502...    426   4e-138   
ref|XP_004146764.1|  PREDICTED: uncharacterized protein LOC101211274    424   1e-137   
ref|XP_004168096.1|  PREDICTED: uncharacterized LOC101211274            424   1e-137   
gb|KHN16378.1|  hypothetical protein glysoja_033782                     422   8e-137   
ref|XP_003520895.2|  PREDICTED: uncharacterized protein LOC100785776    421   4e-136   
ref|XP_006342941.1|  PREDICTED: uncharacterized protein LOC102603463    414   9e-134   
ref|XP_004506285.1|  PREDICTED: uncharacterized protein LOC101502...    413   3e-133   
ref|XP_010685263.1|  PREDICTED: uncharacterized protein LOC104899717    409   5e-131   
ref|XP_004235566.1|  PREDICTED: uncharacterized protein LOC101257349    404   9e-130   
gb|KHN01442.1|  hypothetical protein glysoja_009648                     396   1e-126   
ref|XP_003529845.1|  PREDICTED: uncharacterized protein LOC100811877    389   5e-124   
ref|XP_010534955.1|  PREDICTED: uncharacterized protein LOC104810376    389   1e-123   
ref|XP_006599758.1|  PREDICTED: uncharacterized protein LOC100816179    388   2e-123   
ref|XP_006407119.1|  hypothetical protein EUTSA_v10020538mg             382   3e-121   
ref|XP_007135397.1|  hypothetical protein PHAVU_010G126100g             377   3e-119   
gb|KFK38774.1|  hypothetical protein AALP_AA3G158700                    376   3e-119   
emb|CDY52268.1|  BnaC05g52120D                                          374   2e-118   
ref|XP_002885015.1|  hypothetical protein ARALYDRAFT_478830             367   8e-116   
ref|XP_008782950.1|  PREDICTED: uncharacterized protein LOC103702341    369   9e-116   
ref|XP_010937289.1|  PREDICTED: uncharacterized protein LOC105056...    368   1e-115   
ref|XP_009146406.1|  PREDICTED: uncharacterized protein LOC103870061    366   3e-115   
ref|NP_188033.2|  uncharacterized protein                               362   1e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97548.1|  BnaA05g25310D                                          362   1e-113   
ref|XP_010273897.1|  PREDICTED: uncharacterized protein LOC104609309    362   2e-113   
dbj|BAB02981.1|  unnamed protein product                                351   1e-109   Arabidopsis thaliana [mouse-ear cress]
gb|EYU45903.1|  hypothetical protein MIMGU_mgv1a025981mg                350   1e-108   
ref|XP_006297474.1|  hypothetical protein CARUB_v10013495mg             345   2e-107   
ref|XP_010501681.1|  PREDICTED: uncharacterized protein LOC104778...    337   4e-104   
ref|XP_009408920.1|  PREDICTED: uncharacterized protein LOC103991262    338   4e-104   
ref|XP_010501695.1|  PREDICTED: uncharacterized protein LOC104778...    335   2e-103   
ref|XP_010501688.1|  PREDICTED: uncharacterized protein LOC104778...    335   2e-103   
ref|XP_010501699.1|  PREDICTED: uncharacterized protein LOC104778...    333   1e-102   
ref|XP_010487204.1|  PREDICTED: uncharacterized protein LOC104765224    325   4e-99    
ref|XP_010465301.1|  PREDICTED: uncharacterized protein LOC104745688    324   1e-98    
gb|EPS65300.1|  hypothetical protein M569_09484                         321   5e-98    
ref|XP_006649504.1|  PREDICTED: flocculation protein FLO11-like i...    306   7e-92    
ref|XP_002468395.1|  hypothetical protein SORBIDRAFT_01g045130          300   1e-89    Sorghum bicolor [broomcorn]
gb|KFK38775.1|  hypothetical protein AALP_AA3G158700                    296   7e-89    
ref|XP_004985477.1|  PREDICTED: microtubule-associated protein 1B...    293   1e-86    
ref|XP_006843856.1|  hypothetical protein AMTR_s00007p00263800          290   2e-85    
ref|XP_008651556.1|  PREDICTED: probable serine/threonine-protein...    286   7e-84    
ref|XP_003558662.1|  PREDICTED: uncharacterized protein LOC100833519    282   2e-82    
ref|XP_008464803.1|  PREDICTED: uncharacterized protein LOC103502...    274   8e-81    
ref|XP_003522967.1|  PREDICTED: uncharacterized protein LOC100775456    228   1e-66    
ref|NP_001049172.1|  Os03g0181800                                       223   2e-60    Oryza sativa Japonica Group [Japonica rice]
gb|EAY88795.1|  hypothetical protein OsI_10268                          222   4e-60    Oryza sativa Indica Group [Indian rice]
ref|XP_010937291.1|  PREDICTED: uncharacterized protein LOC105056...    210   5e-57    
ref|XP_008650697.1|  PREDICTED: uncharacterized protein LOC103631604    199   4e-55    
gb|KDP40663.1|  hypothetical protein JCGZ_24662                         198   2e-54    
ref|XP_002965834.1|  hypothetical protein SELMODRAFT_84972              175   5e-44    
ref|XP_002983083.1|  hypothetical protein SELMODRAFT_117469             175   7e-44    
tpg|DAA62321.1|  TPA: hypothetical protein ZEAMMB73_590071              165   2e-43    
ref|XP_002534295.1|  hypothetical protein RCOM_0125920                  165   3e-43    Ricinus communis
ref|XP_001752982.1|  predicted protein                                  175   6e-43    
ref|XP_001772202.1|  predicted protein                                  176   7e-43    
ref|XP_001785292.1|  predicted protein                                  174   1e-42    
gb|EMS45551.1|  hypothetical protein TRIUR3_34607                       168   5e-42    
ref|XP_006842628.1|  hypothetical protein AMTR_s00077p00183470          169   8e-42    
gb|EMT04297.1|  hypothetical protein F775_21349                         169   1e-41    
emb|CBI28115.3|  unnamed protein product                                168   3e-41    
ref|XP_002281524.1|  PREDICTED: uncharacterized protein LOC100245597    169   3e-41    Vitis vinifera
emb|CDX93540.1|  BnaA06g05080D                                          168   4e-41    
ref|XP_009148130.1|  PREDICTED: uncharacterized protein LOC103871617    168   4e-41    
tpg|DAA48319.1|  TPA: hypothetical protein ZEAMMB73_736922              163   5e-41    
dbj|BAJ91471.1|  predicted protein                                      169   5e-41    
ref|XP_006858851.1|  hypothetical protein AMTR_s00066p00185630          168   5e-41    
ref|XP_009336878.1|  PREDICTED: uncharacterized protein LOC103929413    168   6e-41    
emb|CDX95036.1|  BnaC05g06350D                                          168   7e-41    
ref|XP_008222424.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    167   8e-41    
gb|EMT26764.1|  hypothetical protein F775_13435                         164   8e-41    
ref|NP_001063674.1|  Os09g0516700                                       164   9e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008800511.1|  PREDICTED: uncharacterized protein LOC103714852    166   9e-41    
ref|XP_009385130.1|  PREDICTED: uncharacterized protein LOC103972499    167   9e-41    
ref|XP_006417651.1|  hypothetical protein EUTSA_v10006887mg             167   1e-40    
ref|XP_008362937.1|  PREDICTED: uncharacterized protein LOC103426635    167   1e-40    
gb|EMS48402.1|  hypothetical protein TRIUR3_16288                       164   1e-40    
ref|XP_007221873.1|  hypothetical protein PRUPE_ppa001962mg             167   1e-40    
tpg|DAA48320.1|  TPA: hypothetical protein ZEAMMB73_736922              163   1e-40    
ref|XP_010650628.1|  PREDICTED: uncharacterized protein LOC104879471    167   1e-40    
gb|KDP32323.1|  hypothetical protein JCGZ_13248                         167   1e-40    
gb|ACR35155.1|  unknown                                                 163   1e-40    Zea mays [maize]
ref|NP_001130305.1|  hypothetical protein                               164   2e-40    Zea mays [maize]
ref|XP_004306589.1|  PREDICTED: uncharacterized protein LOC101312186    166   2e-40    
ref|XP_010930257.1|  PREDICTED: uncharacterized protein LOC105051...    165   2e-40    
ref|XP_010527195.1|  PREDICTED: uncharacterized protein LOC104804579    166   2e-40    
ref|XP_007033883.1|  Uncharacterized protein TCM_019984                 166   2e-40    
gb|ACR35047.1|  unknown                                                 162   3e-40    Zea mays [maize]
gb|KHF99667.1|  hypothetical protein F383_05395                         166   3e-40    
ref|XP_006372831.1|  hypothetical protein POPTR_0017s05480g             166   3e-40    
ref|XP_011037136.1|  PREDICTED: uncharacterized protein LOC105134...    166   4e-40    
ref|XP_010528796.1|  PREDICTED: uncharacterized protein LOC104805816    166   4e-40    
ref|XP_008369178.1|  PREDICTED: uncharacterized protein LOC103432754    166   4e-40    
ref|XP_010930255.1|  PREDICTED: uncharacterized protein LOC105051...    165   5e-40    
gb|EPS71203.1|  hypothetical protein M569_03555                         165   5e-40    
gb|KDO45103.1|  hypothetical protein CISIN_1g0048902mg                  164   6e-40    
ref|XP_009617563.1|  PREDICTED: uncharacterized protein LOC104109887    165   6e-40    
gb|KHG08949.1|  digeranylgeranylglycerophospholipid reductase           165   6e-40    
ref|XP_009778777.1|  PREDICTED: uncharacterized protein LOC104228069    165   6e-40    
ref|XP_010927900.1|  PREDICTED: uncharacterized protein LOC105049...    164   6e-40    
ref|XP_002889713.1|  hypothetical protein ARALYDRAFT_470949             165   6e-40    
ref|XP_007013268.1|  Serine/arginine repetitive matrix protein 1        165   6e-40    
ref|XP_008342567.1|  PREDICTED: uncharacterized protein LOC103405...    164   7e-40    
ref|NP_172353.1|  uncharacterized protein                               165   7e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150449.1|  hypothetical protein PHAVU_005G154300g             165   7e-40    
ref|XP_010550202.1|  PREDICTED: uncharacterized protein LOC104821115    165   8e-40    
ref|XP_010069275.1|  PREDICTED: uncharacterized protein LOC104456229    165   8e-40    
ref|XP_011073840.1|  PREDICTED: uncharacterized protein LOC105158698    165   8e-40    
ref|XP_006442971.1|  hypothetical protein CICLE_v10018994mg             165   8e-40    
ref|XP_008788220.1|  PREDICTED: uncharacterized protein LOC103706...    164   9e-40    
ref|XP_008788224.1|  PREDICTED: uncharacterized protein LOC103706...    164   9e-40    
ref|XP_003578444.1|  PREDICTED: micronuclear linker histone polyp...    164   1e-39    
ref|XP_004241426.1|  PREDICTED: uncharacterized protein LOC101257082    164   1e-39    
ref|XP_007204628.1|  hypothetical protein PRUPE_ppa002148mg             164   1e-39    
ref|XP_002462666.1|  hypothetical protein SORBIDRAFT_02g029910          164   1e-39    Sorghum bicolor [broomcorn]
gb|KDP43890.1|  hypothetical protein JCGZ_20900                         164   1e-39    
ref|XP_010235357.1|  PREDICTED: PHD finger protein rhinoceros           164   1e-39    
gb|EEE69083.1|  hypothetical protein OsJ_28131                          164   1e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006306848.1|  hypothetical protein CARUB_v10008392mg             164   1e-39    
ref|XP_010927895.1|  PREDICTED: uncharacterized protein LOC105049...    164   1e-39    
ref|XP_008650784.1|  PREDICTED: hypothetical protein isoform X1         164   1e-39    
ref|XP_010258510.1|  PREDICTED: uncharacterized protein LOC104598255    164   1e-39    
gb|KHG07510.1|  CTP synthase                                            164   1e-39    
ref|XP_004957360.1|  PREDICTED: putative GPI-anchored protein PB1...    164   1e-39    
ref|XP_008342565.1|  PREDICTED: uncharacterized protein LOC103405...    164   1e-39    
ref|NP_001062388.1|  Os08g0541500                                       164   1e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009372734.1|  PREDICTED: uncharacterized protein LOC103961...    164   2e-39    
ref|XP_009372744.1|  PREDICTED: uncharacterized protein LOC103961...    164   2e-39    
ref|XP_010908934.1|  PREDICTED: uncharacterized protein LOC105035184    164   2e-39    
ref|XP_008242581.1|  PREDICTED: uncharacterized protein LOC103340896    164   2e-39    
ref|XP_006347312.1|  PREDICTED: muscle M-line assembly protein un...    164   2e-39    
ref|XP_010458138.1|  PREDICTED: uncharacterized protein LOC104739...    164   2e-39    
gb|EEC84887.1|  hypothetical protein OsI_32047                          164   2e-39    Oryza sativa Indica Group [Indian rice]
ref|XP_009393517.1|  PREDICTED: uncharacterized protein LOC103979...    162   2e-39    
ref|XP_011011525.1|  PREDICTED: uncharacterized protein LOC105116060    163   2e-39    
ref|XP_010489346.1|  PREDICTED: uncharacterized protein LOC104767025    164   2e-39    
gb|EYU36722.1|  hypothetical protein MIMGU_mgv1a002034mg                163   2e-39    
ref|XP_010475688.1|  PREDICTED: uncharacterized protein LOC104755062    164   2e-39    
dbj|BAJ87804.1|  predicted protein                                      163   2e-39    
ref|XP_006590928.1|  PREDICTED: uncharacterized protein LOC100775...    163   3e-39    
ref|XP_006590930.1|  PREDICTED: uncharacterized protein LOC100775...    163   3e-39    
gb|EEE70053.1|  hypothetical protein OsJ_30017                          163   3e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010242740.1|  PREDICTED: uncharacterized protein LOC104587013    163   3e-39    
ref|XP_009402685.1|  PREDICTED: uncharacterized protein LOC103986400    163   3e-39    
ref|XP_004486892.1|  PREDICTED: uncharacterized protein LOC101502...    163   3e-39    
ref|XP_004486895.1|  PREDICTED: uncharacterized protein LOC101502...    163   3e-39    
dbj|BAK06401.1|  predicted protein                                      163   3e-39    
ref|XP_004974075.1|  PREDICTED: chitinase-like protein PB1E7.04c-...    163   3e-39    
ref|XP_007131932.1|  hypothetical protein PHAVU_011G052900g             163   3e-39    
ref|XP_007131933.1|  hypothetical protein PHAVU_011G052900g             163   4e-39    
ref|XP_009393516.1|  PREDICTED: uncharacterized protein LOC103979...    163   4e-39    
ref|XP_006592135.1|  PREDICTED: uncharacterized protein LOC100805...    163   4e-39    
ref|XP_008790586.1|  PREDICTED: uncharacterized protein LOC103707...    162   4e-39    
ref|XP_006592134.1|  PREDICTED: uncharacterized protein LOC100805...    163   4e-39    
ref|XP_010278910.1|  PREDICTED: uncharacterized protein LOC104612944    162   4e-39    
ref|XP_010086722.1|  hypothetical protein L484_016153                   164   4e-39    
tpg|DAA48322.1|  TPA: hypothetical protein ZEAMMB73_736922              162   4e-39    
ref|XP_002309785.2|  hypothetical protein POPTR_0007s01680g             162   5e-39    Populus trichocarpa [western balsam poplar]
gb|KHN25310.1|  hypothetical protein glysoja_010227                     162   5e-39    
ref|XP_006659647.1|  PREDICTED: putative GPI-anchored protein PB1...    162   5e-39    
ref|XP_008790585.1|  PREDICTED: uncharacterized protein LOC103707...    162   5e-39    
ref|XP_006595069.1|  PREDICTED: uncharacterized protein LOC100817734    162   5e-39    
gb|KHN30090.1|  hypothetical protein glysoja_010468                     162   5e-39    
ref|XP_009118351.1|  PREDICTED: uncharacterized protein LOC103843380    161   7e-39    
emb|CDY06329.1|  BnaA09g48740D                                          160   8e-39    
ref|XP_011007404.1|  PREDICTED: uncharacterized protein LOC105113084    162   8e-39    
ref|XP_002444655.1|  hypothetical protein SORBIDRAFT_07g025480          161   1e-38    Sorghum bicolor [broomcorn]
ref|NP_001142977.1|  uncharacterized protein LOC100275431               161   1e-38    Zea mays [maize]
tpg|DAA40543.1|  TPA: hypothetical protein ZEAMMB73_654064              162   1e-38    
ref|XP_004507351.1|  PREDICTED: serine-rich adhesin for platelets...    161   1e-38    
ref|XP_008460033.1|  PREDICTED: probable GPI-anchored adhesin-lik...    161   1e-38    
ref|XP_006597218.1|  PREDICTED: muscle M-line assembly protein un...    161   2e-38    
ref|XP_004145034.1|  PREDICTED: uncharacterized protein LOC101214568    160   2e-38    
ref|XP_009383805.1|  PREDICTED: uncharacterized protein LOC103971502    160   2e-38    
ref|XP_009802967.1|  PREDICTED: uncharacterized protein LOC104248...    159   2e-38    
ref|XP_009802966.1|  PREDICTED: uncharacterized protein LOC104248...    159   2e-38    
gb|EPS68799.1|  hypothetical protein M569_05973                         147   2e-38    
ref|XP_004149859.1|  PREDICTED: uncharacterized protein LOC101211203    160   3e-38    
ref|XP_004168200.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    159   3e-38    
ref|XP_008463359.1|  PREDICTED: uncharacterized protein LOC103501535    159   4e-38    
ref|XP_010100472.1|  hypothetical protein L484_027784                   158   5e-38    
ref|XP_011034171.1|  PREDICTED: uncharacterized protein LOC105132...    158   5e-38    
ref|XP_006365225.1|  PREDICTED: uncharacterized protein LOC102601016    158   5e-38    
ref|XP_011034170.1|  PREDICTED: uncharacterized protein LOC105132...    158   5e-38    
ref|XP_002515571.1|  conserved hypothetical protein                     159   6e-38    Ricinus communis
ref|XP_006661436.1|  PREDICTED: uncharacterized protein LOC102700269    160   8e-38    
ref|XP_006372148.1|  hypothetical protein POPTR_0018s12520g             158   8e-38    
ref|XP_002525387.1|  conserved hypothetical protein                     157   8e-38    Ricinus communis
ref|XP_010088873.1|  hypothetical protein L484_020861                   159   8e-38    
gb|KEH39487.1|  DUF936 family protein                                   159   8e-38    
emb|CDY22665.1|  BnaC08g42990D                                          157   9e-38    
ref|XP_010936747.1|  PREDICTED: uncharacterized protein LOC105056300    157   1e-37    
ref|XP_006844956.1|  hypothetical protein AMTR_s00058p00171710          157   1e-37    
ref|XP_009352495.1|  PREDICTED: uncharacterized protein LOC103943858    157   2e-37    
ref|XP_008368252.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    156   2e-37    
ref|XP_009604059.1|  PREDICTED: uncharacterized protein LOC104098912    156   2e-37    
ref|XP_006369113.1|  hypothetical protein POPTR_0001s16570g             152   2e-37    
gb|KDO82437.1|  hypothetical protein CISIN_1g008847mg                   156   2e-37    
ref|XP_002324965.2|  hypothetical protein POPTR_0018s06270g             157   2e-37    Populus trichocarpa [western balsam poplar]
ref|XP_011009205.1|  PREDICTED: uncharacterized protein LOC105114378    157   2e-37    
gb|KDO80434.1|  hypothetical protein CISIN_1g005209mg                   157   2e-37    
ref|XP_006451057.1|  hypothetical protein CICLE_v10007618mg             157   2e-37    
ref|XP_003606816.1|  hypothetical protein MTR_4g068050                  157   2e-37    
ref|XP_004238670.1|  PREDICTED: uncharacterized protein LOC101252685    155   3e-37    
ref|XP_006438396.1|  hypothetical protein CICLE_v10031068mg             155   3e-37    
ref|XP_002264073.1|  PREDICTED: uncharacterized protein LOC100260333    155   5e-37    Vitis vinifera
ref|XP_006483844.1|  PREDICTED: uncharacterized protein LOC102612188    155   5e-37    
emb|CBI32148.3|  unnamed protein product                                154   5e-37    
gb|KHG08389.1|  dicer-like protein 2                                    154   6e-37    
ref|XP_004143072.1|  PREDICTED: uncharacterized protein LOC101212478    154   6e-37    
ref|XP_006838229.1|  hypothetical protein AMTR_s00217p00029330          156   7e-37    
ref|XP_008782438.1|  PREDICTED: uncharacterized protein LOC103701975    154   7e-37    
ref|XP_004301548.1|  PREDICTED: uncharacterized protein LOC101301592    155   8e-37    
gb|KHG13326.1|  RNA polymerase-associated rapA                          155   8e-37    
ref|XP_003613238.1|  hypothetical protein MTR_5g034370                  154   9e-37    
ref|XP_010450218.1|  PREDICTED: uncharacterized protein LOC104732383    155   1e-36    
ref|XP_008444316.1|  PREDICTED: uncharacterized protein LOC103487685    153   1e-36    
emb|CDP00168.1|  unnamed protein product                                154   1e-36    
emb|CDY69222.1|  BnaAnng29710D                                          151   1e-36    
ref|XP_009413194.1|  PREDICTED: uncharacterized protein LOC103994558    153   2e-36    
ref|XP_007044621.1|  Leucine-rich repeat-containing protein 50          153   2e-36    
ref|XP_006380021.1|  hypothetical protein POPTR_0008s19660g             152   2e-36    
ref|XP_004298574.1|  PREDICTED: uncharacterized protein LOC101302833    152   3e-36    
ref|XP_006283246.1|  hypothetical protein CARUB_v10004279mg             154   3e-36    
ref|XP_009363549.1|  PREDICTED: uncharacterized protein LOC103953523    152   4e-36    
ref|XP_006414920.1|  hypothetical protein EUTSA_v10024576mg             153   4e-36    
ref|XP_008787981.1|  PREDICTED: uncharacterized protein LOC103705876    152   4e-36    
ref|XP_004489847.1|  PREDICTED: uncharacterized protein LOC101502...    152   5e-36    
ref|XP_010682560.1|  PREDICTED: uncharacterized protein LOC104897392    152   5e-36    
ref|XP_004489846.1|  PREDICTED: uncharacterized protein LOC101502...    152   5e-36    
ref|XP_002863137.1|  hypothetical protein ARALYDRAFT_497045             153   5e-36    
emb|CDY64935.1|  BnaCnng45570D                                          153   5e-36    
ref|NP_193073.1|  uncharacterized protein                               153   6e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107696.1|  PREDICTED: uncharacterized protein LOC103833...    152   6e-36    
gb|KFK36223.1|  hypothetical protein AALP_AA4G094100                    152   7e-36    
ref|XP_009107695.1|  PREDICTED: uncharacterized protein LOC103833...    152   7e-36    
ref|XP_010044637.1|  PREDICTED: uncharacterized protein LOC104433543    151   8e-36    
ref|XP_010047762.1|  PREDICTED: uncharacterized protein LOC104436628    152   1e-35    
ref|XP_010940037.1|  PREDICTED: uncharacterized protein LOC105058718    151   1e-35    
ref|XP_007199620.1|  hypothetical protein PRUPE_ppa024815mg             150   1e-35    
ref|XP_010440590.1|  PREDICTED: uncharacterized protein LOC104723865    152   1e-35    
ref|XP_007224021.1|  hypothetical protein PRUPE_ppa015102mg             150   1e-35    
ref|XP_011086563.1|  PREDICTED: uncharacterized protein LOC105168255    150   1e-35    
ref|XP_008221808.1|  PREDICTED: uncharacterized protein LOC103321756    150   2e-35    
ref|XP_008389635.1|  PREDICTED: uncharacterized protein LOC103451962    150   2e-35    
ref|XP_010551564.1|  PREDICTED: uncharacterized protein LOC104822139    149   3e-35    
ref|XP_006605276.1|  PREDICTED: uncharacterized protein LOC102659863    141   4e-35    
ref|XP_010672260.1|  PREDICTED: uncharacterized protein LOC104888854    150   7e-35    
ref|XP_010276350.1|  PREDICTED: uncharacterized protein LOC104611119    148   9e-35    
ref|XP_010533105.1|  PREDICTED: uncharacterized protein LOC104808...    147   1e-34    
gb|KFK43187.1|  hypothetical protein AALP_AA1G091200                    149   1e-34    
ref|XP_003524517.2|  PREDICTED: uncharacterized protein LOC100813278    150   1e-34    
emb|CDY61547.1|  BnaA09g29900D                                          147   1e-34    
ref|XP_003519819.1|  PREDICTED: uncharacterized protein LOC100797400    147   2e-34    
ref|XP_010477683.1|  PREDICTED: uncharacterized protein LOC104756742    147   2e-34    
ref|XP_006307206.1|  hypothetical protein CARUB_v10008797mg             147   2e-34    
ref|XP_001780657.1|  predicted protein                                  135   2e-34    
ref|XP_009115501.1|  PREDICTED: uncharacterized protein LOC103840736    146   3e-34    
gb|KDP26579.1|  hypothetical protein JCGZ_17737                         147   3e-34    
ref|XP_010460155.1|  PREDICTED: uncharacterized protein LOC104741079    146   3e-34    
ref|XP_010498887.1|  PREDICTED: uncharacterized protein LOC104776...    145   3e-34    
ref|XP_011015348.1|  PREDICTED: uncharacterized protein LOC105118980    146   4e-34    
ref|XP_011012166.1|  PREDICTED: uncharacterized protein LOC105116478    146   4e-34    
ref|XP_006378206.1|  hypothetical protein POPTR_0010s04810g             146   5e-34    
ref|XP_010498886.1|  PREDICTED: uncharacterized protein LOC104776...    145   5e-34    
ref|XP_010924223.1|  PREDICTED: uncharacterized protein LOC105047111    145   6e-34    
ref|XP_003549799.1|  PREDICTED: uncharacterized protein LOC100789274    147   6e-34    
emb|CDP03374.1|  unnamed protein product                                147   7e-34    
ref|XP_010931415.1|  PREDICTED: uncharacterized protein LOC105052338    147   7e-34    
gb|EPS68118.1|  hypothetical protein M569_06648                         147   8e-34    
ref|XP_010242992.1|  PREDICTED: uncharacterized protein LOC104587189    145   1e-33    
gb|KHN12102.1|  hypothetical protein glysoja_039392                     145   1e-33    
ref|XP_003517727.1|  PREDICTED: uncharacterized protein LOC100808883    145   1e-33    
ref|XP_009620869.1|  PREDICTED: uncharacterized protein LOC104112605    145   2e-33    
ref|XP_009792715.1|  PREDICTED: uncharacterized protein LOC104239...    144   2e-33    
ref|XP_009792714.1|  PREDICTED: uncharacterized protein LOC104239...    144   2e-33    
emb|CDY47633.1|  BnaC05g18890D                                          144   2e-33    
gb|KFK44453.1|  hypothetical protein AALP_AA1G258800                    143   2e-33    
ref|XP_011094202.1|  PREDICTED: uncharacterized protein LOC105173958    145   2e-33    
emb|CDY43695.1|  BnaC08g47020D                                          145   2e-33    
ref|NP_173791.2|  uncharacterized protein                               143   2e-33    
ref|XP_002890596.1|  hypothetical protein ARALYDRAFT_313236             143   3e-33    
ref|XP_008800880.1|  PREDICTED: uncharacterized protein LOC103715...    143   3e-33    
ref|XP_009416979.1|  PREDICTED: uncharacterized protein LOC103997472    145   3e-33    
gb|EPS58470.1|  hypothetical protein M569_16343                         138   5e-33    
ref|XP_008800879.1|  PREDICTED: uncharacterized protein LOC103715...    143   5e-33    
ref|XP_006416055.1|  hypothetical protein EUTSA_v10007309mg             142   5e-33    
ref|XP_006359180.1|  PREDICTED: uncharacterized protein LOC102604790    144   5e-33    
ref|XP_009395974.1|  PREDICTED: uncharacterized protein LOC103981097    144   6e-33    
ref|XP_009110080.1|  PREDICTED: uncharacterized protein LOC103835647    142   8e-33    
ref|XP_004508565.1|  PREDICTED: uncharacterized protein LOC101503442    144   8e-33    
emb|CDY57317.1|  BnaA08g20310D                                          142   1e-32    
emb|CDX91723.1|  BnaC08g06420D                                          141   1e-32    
gb|EYU31264.1|  hypothetical protein MIMGU_mgv1a003743mg                142   1e-32    
ref|XP_010323483.1|  PREDICTED: uncharacterized protein LOC101256626    142   2e-32    
ref|NP_001172124.1|  Os01g0108800                                       135   2e-32    
ref|XP_010659606.1|  PREDICTED: uncharacterized protein LOC100257...    140   2e-32    
gb|EYU18159.1|  hypothetical protein MIMGU_mgv1a002127mg                142   3e-32    
ref|XP_009627666.1|  PREDICTED: uncharacterized protein LOC104118180    142   3e-32    
ref|XP_009415818.1|  PREDICTED: uncharacterized protein LOC103996607    140   3e-32    
ref|XP_001756331.1|  predicted protein                                  130   4e-32    
gb|KEH32094.1|  DUF936 family protein                                   141   4e-32    
ref|XP_008788040.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    142   5e-32    
ref|XP_006300914.1|  hypothetical protein CARUB_v10021284mg             139   5e-32    
ref|XP_006849340.1|  hypothetical protein AMTR_s00164p00057870          140   5e-32    
ref|XP_010427804.1|  PREDICTED: uncharacterized protein LOC104712579    139   5e-32    
ref|XP_007157465.1|  hypothetical protein PHAVU_002G071800g             140   5e-32    
ref|XP_002888769.1|  predicted protein                                  139   6e-32    
ref|XP_009410492.1|  PREDICTED: uncharacterized protein LOC103992498    141   7e-32    
emb|CBI18661.3|  unnamed protein product                                139   7e-32    
gb|KFK41454.1|  hypothetical protein AALP_AA2G132500                    139   8e-32    
emb|CDP07657.1|  unnamed protein product                                140   9e-32    
emb|CAN82511.1|  hypothetical protein VITISV_002152                     138   9e-32    
ref|XP_009803644.1|  PREDICTED: uncharacterized protein LOC104248981    140   1e-31    
ref|XP_010659605.1|  PREDICTED: uncharacterized protein LOC100257...    139   1e-31    
gb|EAZ10241.1|  hypothetical protein OsJ_00073                          138   1e-31    
ref|XP_010415709.1|  PREDICTED: uncharacterized protein LOC104701672    137   2e-31    
ref|NP_177191.1|  uncharacterized protein                               137   3e-31    
gb|KDP20372.1|  hypothetical protein JCGZ_05255                         138   3e-31    
dbj|BAD44294.1|  unknown protein                                        135   1e-30    
ref|XP_010688140.1|  PREDICTED: uncharacterized protein LOC104902...    137   1e-30    
ref|XP_001759868.1|  predicted protein                                  125   1e-30    
ref|XP_006406480.1|  hypothetical protein EUTSA_v10022420mg             137   1e-30    
emb|CDM80016.1|  unnamed protein product                                135   1e-30    
ref|XP_004252055.1|  PREDICTED: uncharacterized protein LOC101262597    137   2e-30    
ref|XP_006353453.1|  PREDICTED: uncharacterized protein LOC102590897    136   2e-30    
ref|XP_010688138.1|  PREDICTED: uncharacterized protein LOC104902...    136   2e-30    
ref|XP_002314216.2|  hypothetical protein POPTR_0009s02970g             135   4e-30    
gb|EMT05071.1|  hypothetical protein F775_52397                         134   4e-30    
ref|XP_011041983.1|  PREDICTED: uncharacterized protein LOC105137801    134   5e-30    
gb|EEC83968.1|  hypothetical protein OsI_30093                          135   8e-30    
ref|XP_002966428.1|  hypothetical protein SELMODRAFT_39369              122   3e-29    
ref|XP_010556015.1|  PREDICTED: uncharacterized protein LOC104825...    132   4e-29    
ref|XP_010556014.1|  PREDICTED: uncharacterized protein LOC104825...    132   5e-29    
ref|XP_003564889.1|  PREDICTED: uncharacterized protein LOC100831114    130   5e-29    
ref|XP_011093404.1|  PREDICTED: uncharacterized protein LOC105173388    131   6e-29    
ref|NP_001140343.1|  hypothetical protein                               130   9e-29    
ref|XP_008236357.1|  PREDICTED: uncharacterized protein LOC103335133    131   9e-29    
ref|XP_010420051.1|  PREDICTED: uncharacterized protein LOC104705691    131   1e-28    
ref|XP_011086847.1|  PREDICTED: uncharacterized protein LOC105168452    130   1e-28    
ref|XP_002457510.1|  hypothetical protein SORBIDRAFT_03g008530          130   1e-28    
ref|XP_009139634.1|  PREDICTED: uncharacterized protein LOC103863...    130   1e-28    
ref|XP_009139633.1|  PREDICTED: uncharacterized protein LOC103863...    130   1e-28    
ref|XP_007042635.1|  Uncharacterized protein TCM_007222                 130   2e-28    
ref|XP_010466115.1|  PREDICTED: uncharacterized protein LOC104746357    130   3e-28    
ref|XP_010489946.1|  PREDICTED: uncharacterized protein LOC104767648    129   3e-28    
ref|XP_002298771.2|  hypothetical protein POPTR_0001s30180g             130   3e-28    
ref|XP_002527510.1|  conserved hypothetical protein                     130   4e-28    
ref|XP_004967964.1|  PREDICTED: uncharacterized protein LOC101784596    129   4e-28    
gb|KDO57888.1|  hypothetical protein CISIN_1g0436291mg                  126   4e-28    
ref|XP_011012437.1|  PREDICTED: uncharacterized protein LOC105116688    129   5e-28    
ref|XP_010030626.1|  PREDICTED: uncharacterized protein LOC104420485    128   5e-28    
emb|CDX82287.1|  BnaA03g35340D                                          129   6e-28    
ref|XP_009136046.1|  PREDICTED: uncharacterized protein LOC103860201    129   7e-28    
ref|XP_002885318.1|  hypothetical protein ARALYDRAFT_479477             128   8e-28    
ref|NP_188595.2|  uncharacterized protein                               128   9e-28    
ref|XP_010942836.1|  PREDICTED: uncharacterized protein LOC105060727    127   1e-27    
ref|XP_011030347.1|  PREDICTED: uncharacterized protein LOC105129814    128   2e-27    
emb|CDY22966.1|  BnaC03g41030D                                          127   2e-27    
emb|CDY05811.1|  BnaA10g06090D                                          118   2e-27    
ref|XP_006422826.1|  hypothetical protein CICLE_v10029833mg             126   2e-27    
ref|XP_011088071.1|  PREDICTED: microtubule-associated protein fu...    127   2e-27    
dbj|BAB02546.1|  unnamed protein product                                127   3e-27    
ref|XP_009395197.1|  PREDICTED: uncharacterized protein LOC103980482    121   5e-27    
emb|CDY01127.1|  BnaA04g06920D                                          126   6e-27    
ref|XP_006297200.1|  hypothetical protein CARUB_v10013208mg             125   7e-27    
ref|XP_010474256.1|  PREDICTED: uncharacterized protein LOC104753751    124   1e-26    
ref|XP_009396677.1|  PREDICTED: uncharacterized protein LOC103981660    123   4e-26    
emb|CDO97276.1|  unnamed protein product                                122   1e-25    
gb|KDP44488.1|  hypothetical protein JCGZ_16321                         121   2e-25    
gb|KFK39288.1|  hypothetical protein AALP_AA3G225300                    120   3e-25    
ref|XP_009611791.1|  PREDICTED: uncharacterized protein LOC104105239    120   5e-25    
ref|XP_004248764.1|  PREDICTED: uncharacterized protein LOC101255740    119   7e-25    
ref|XP_006353971.1|  PREDICTED: uncharacterized protein LOC102584423    119   1e-24    
ref|XP_009799193.1|  PREDICTED: uncharacterized protein LOC104245300    117   3e-24    
ref|XP_004292133.1|  PREDICTED: uncharacterized protein LOC101314722    117   5e-24    
ref|XP_004158831.1|  PREDICTED: uncharacterized protein LOC101227731    115   5e-24    
ref|XP_004136106.1|  PREDICTED: uncharacterized protein LOC101207708    115   7e-24    
ref|XP_008461225.1|  PREDICTED: uncharacterized protein LOC103499875    115   1e-23    
ref|XP_009760181.1|  PREDICTED: uncharacterized protein LOC104212576    115   1e-23    
ref|XP_004488583.1|  PREDICTED: uncharacterized protein LOC101492701    112   1e-22    
ref|XP_010111944.1|  Elongation factor 1-delta                          113   1e-22    
ref|XP_006598238.1|  PREDICTED: uncharacterized protein LOC102669473    110   7e-22    
gb|KHN49061.1|  hypothetical protein glysoja_031272                     110   7e-22    
ref|XP_009598408.1|  PREDICTED: uncharacterized protein LOC104094237    110   8e-22    
gb|EMT25697.1|  hypothetical protein F775_22613                         110   9e-22    
ref|XP_003532890.1|  PREDICTED: uncharacterized protein LOC100782697    109   9e-22    
ref|XP_008231405.1|  PREDICTED: uncharacterized protein LOC103330585    108   2e-21    
ref|XP_004230698.1|  PREDICTED: uncharacterized protein LOC101265870    108   3e-21    
gb|EYU37570.1|  hypothetical protein MIMGU_mgv1a025002mg                108   4e-21    
gb|EEC67560.1|  hypothetical protein OsI_34900                          104   4e-20    
ref|NP_001066016.1|  Os12g0120000                                       104   4e-20    
ref|NP_001065607.1|  Os11g0120200                                       104   5e-20    
gb|EMS48445.1|  hypothetical protein TRIUR3_05034                       104   5e-20    
emb|CDY60513.1|  BnaC04g54240D                                          100   5e-19    
ref|NP_180751.1|  uncharacterized protein                               100   1e-18    
ref|XP_010510137.1|  PREDICTED: uncharacterized protein LOC104786420  98.2    1e-18    
ref|XP_011037137.1|  PREDICTED: uncharacterized protein LOC105134...  99.8    2e-18    
ref|XP_007219217.1|  hypothetical protein PRUPE_ppa017356mg           99.0    2e-18    
ref|XP_010557046.1|  PREDICTED: uncharacterized protein LOC104826177  99.0    2e-18    
ref|XP_009144019.1|  PREDICTED: uncharacterized protein LOC103867672  99.0    2e-18    
ref|XP_002881205.1|  predicted protein                                98.6    3e-18    
ref|XP_003595829.1|  hypothetical protein MTR_2g062300                98.2    4e-18    
ref|XP_010469653.1|  PREDICTED: uncharacterized protein LOC104749675  97.4    7e-18    
ref|XP_010414064.1|  PREDICTED: uncharacterized protein LOC104700271  97.4    8e-18    
emb|CDY42075.1|  BnaA05g11110D                                        96.3    2e-17    
dbj|BAK05917.1|  predicted protein                                    96.3    2e-17    
ref|XP_007149121.1|  hypothetical protein PHAVU_005G042800g           95.1    4e-17    
ref|XP_006410324.1|  hypothetical protein EUTSA_v10016478mg           94.0    1e-16    
ref|XP_003577859.1|  PREDICTED: uncharacterized protein LOC100834049  94.0    1e-16    
dbj|BAD44860.1|  unknown protein                                      86.7    1e-16    
ref|XP_006295439.1|  hypothetical protein CARUB_v10024538mg           93.2    2e-16    
gb|KEH16931.1|  DUF936 family protein                                 87.0    2e-16    
gb|KFK31170.1|  hypothetical protein AALP_AA6G078100                  92.4    3e-16    
ref|XP_010229625.1|  PREDICTED: uncharacterized protein LOC100838344  90.1    2e-15    
ref|XP_002460946.1|  hypothetical protein SORBIDRAFT_02g037980        87.8    9e-15    
gb|ADE77354.1|  unknown                                               82.0    1e-14    
tpg|DAA41277.1|  TPA: hypothetical protein ZEAMMB73_378736            87.0    2e-14    
ref|XP_002457512.1|  hypothetical protein SORBIDRAFT_03g008550        84.0    2e-14    
emb|CDY08643.1|  BnaC04g19520D                                        79.7    7e-14    
gb|EAZ04530.1|  hypothetical protein OsI_26680                        83.2    3e-13    
dbj|BAC83261.1|  hypothetical protein                                 83.2    3e-13    
ref|NP_001060141.2|  Os07g0588300                                     83.2    3e-13    
gb|KHN15143.1|  hypothetical protein glysoja_011761                   80.5    9e-13    
gb|KHN10410.1|  hypothetical protein glysoja_030846                   80.5    9e-13    
emb|CDX91320.1|  BnaC02g27310D                                        75.5    1e-12    
ref|XP_004977406.1|  PREDICTED: uncharacterized protein LOC101781021  79.7    3e-12    
ref|XP_004978500.1|  PREDICTED: uncharacterized protein LOC101778747  79.3    6e-12    
ref|XP_007155136.1|  hypothetical protein PHAVU_003G176500g           78.2    1e-11    
gb|AFW84247.1|  hypothetical protein ZEAMMB73_791280                  73.6    5e-11    
ref|XP_008378174.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  72.0    4e-10    
gb|AFW64646.1|  hypothetical protein ZEAMMB73_388688                  70.9    2e-09    
ref|XP_006664289.1|  PREDICTED: uncharacterized protein LOC102705212  70.1    3e-09    
ref|XP_006663166.1|  PREDICTED: uncharacterized protein LOC102715704  69.7    4e-09    
ref|XP_008353585.1|  PREDICTED: uncharacterized protein LOC103417171  68.6    5e-09    
ref|XP_002450163.1|  hypothetical protein SORBIDRAFT_05g001370        67.4    2e-08    
ref|XP_008342566.1|  PREDICTED: uncharacterized protein LOC103405...  67.4    2e-08    
ref|NP_001146267.1|  uncharacterized protein LOC100279842             64.7    1e-07    
gb|EMT10828.1|  hypothetical protein F775_12321                       64.7    1e-07    
emb|CDY69908.1|  BnaUnng03500D                                        59.3    6e-07    
ref|XP_002512197.1|  hypothetical protein RCOM_1776060                58.5    2e-06    
gb|KGN46307.1|  hypothetical protein Csa_6G081480                     60.8    3e-06    
ref|XP_002534294.1|  conserved hypothetical protein                   58.2    9e-06    
ref|XP_007150448.1|  hypothetical protein PHAVU_005G154300g           58.2    2e-05    
gb|EYU42247.1|  hypothetical protein MIMGU_mgv1a018220mg              53.5    1e-04    
dbj|BAH57658.1|  expressed protein                                    52.0    2e-04    
dbj|BAH57652.1|  expressed protein                                    52.0    2e-04    
dbj|BAH57584.1|  expressed protein                                    51.6    2e-04    



>emb|CBI35828.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   471 bits (1212),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 290/536 (54%), Positives = 362/536 (68%), Gaps = 26/536 (5%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ+INS  +K+RGEYRSVLLQVISIVPA+SGSELWP+HGFFIKVSDSS
Sbjct  1     MASLTPGVLLKLLQSINS-NIKVRGEYRSVLLQVISIVPALSGSELWPNHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FYVDR+E GTPVP+L+GVRP+PGR+PF G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILNNKLQLGQFFYVDRVEAGTPVPILVGVRPVPGRNPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsn-snskkkkKIVIKEEKVGVASRYMQGVLTT--  1218
             QM+    E   +V  E    S  +          ++KIVIKEEKV VASRYMQGVLT+  
Sbjct  120   QML-VPSEGPVQVDHEGINGSKLSELLEPKEESPRQKIVIKEEKVVVASRYMQGVLTSNS  178

Query  1217  ----AQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTP-SARSDALLTSDSTII  1053
                       G +    NGG    VG L+G+QQE+K Q R  TP  ++ DAL++     +
Sbjct  179   KVNGVDCNGGGKNNENENGGAGKKVGLLKGRQQELKGQTRSMTPMRSQQDALVSKPEVAV  238

Query  1052  NGVNTNTLP------KR-TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGM  894
             +    + +P      KR T+KQEN++ N + N   +N  SS  + W SLP NL+KPGKGM
Sbjct  239   SNAKESAVPVKGTTTKRPTSKQENINSNCLLNLKDKN-HSSEKISWMSLPANLLKPGKGM  297

Query  893   LRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQP  714
             LR + LASLIAAEAQ EA  A  L++CL MFA+LCSS+S ENPHLS+TKFF LH LI+QP
Sbjct  298   LRRRNLASLIAAEAQKEASTAAVLVKCLGMFANLCSSSSMENPHLSLTKFFTLHQLIDQP  357

Query  713   KKA--LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWAR  540
                  L D          N  +P ++      G+  GK         ++L G EKLEWA+
Sbjct  358   NATTQLKDKSLH----LPNNSSPQADKSSKKTGLIHGKSALKSAKPSIELSGTEKLEWAK  413

Query  539   GDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQ-EEANHIGLT  363
             GDG K  KEL+E L NET  WFLKFL+ +LD GF+++    K  +  GR+ E  NHI +T
Sbjct  414   GDGAKEIKELKEILLNETQSWFLKFLEGALDAGFRISTMEKKSKEIVGRRMEPDNHIAVT  473

Query  362   LSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRS  195
             LS LK ANEWLDK+  + S E  +E+   +++LKQK+Y CLL HVDSAASAL++RS
Sbjct  474   LSQLKHANEWLDKLRSKLSSE-NNELVKTIDRLKQKIYACLLSHVDSAASALESRS  528



>ref|XP_002272087.2| PREDICTED: uncharacterized protein LOC100241213 isoform X2 [Vitis 
vinifera]
Length=595

 Score =   471 bits (1211),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 290/536 (54%), Positives = 362/536 (68%), Gaps = 26/536 (5%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ+INS  +K+RGEYRSVLLQVISIVPA+SGSELWP+HGFFIKVSDSS
Sbjct  67    MASLTPGVLLKLLQSINS-NIKVRGEYRSVLLQVISIVPALSGSELWPNHGFFIKVSDSS  125

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FYVDR+E GTPVP+L+GVRP+PGR+PF G+PKDLM
Sbjct  126   HSTYVSLSKEDNELILNNKLQLGQFFYVDRVEAGTPVPILVGVRPVPGRNPFVGNPKDLM  185

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsn-snskkkkKIVIKEEKVGVASRYMQGVLTT--  1218
             QM+    E   +V  E    S  +          ++KIVIKEEKV VASRYMQGVLT+  
Sbjct  186   QML-VPSEGPVQVDHEGINGSKLSELLEPKEESPRQKIVIKEEKVVVASRYMQGVLTSNS  244

Query  1217  ----AQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTP-SARSDALLTSDSTII  1053
                       G +    NGG    VG L+G+QQE+K Q R  TP  ++ DAL++     +
Sbjct  245   KVNGVDCNGGGKNNENENGGAGKKVGLLKGRQQELKGQTRSMTPMRSQQDALVSKPEVAV  304

Query  1052  NGVNTNTLP------KR-TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGM  894
             +    + +P      KR T+KQEN++ N + N   +N  SS  + W SLP NL+KPGKGM
Sbjct  305   SNAKESAVPVKGTTTKRPTSKQENINSNCLLNLKDKN-HSSEKISWMSLPANLLKPGKGM  363

Query  893   LRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQP  714
             LR + LASLIAAEAQ EA  A  L++CL MFA+LCSS+S ENPHLS+TKFF LH LI+QP
Sbjct  364   LRRRNLASLIAAEAQKEASTAAVLVKCLGMFANLCSSSSMENPHLSLTKFFTLHQLIDQP  423

Query  713   KKA--LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWAR  540
                  L D          N  +P ++      G+  GK         ++L G EKLEWA+
Sbjct  424   NATTQLKDKSLH----LPNNSSPQADKSSKKTGLIHGKSALKSAKPSIELSGTEKLEWAK  479

Query  539   GDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQ-EEANHIGLT  363
             GDG K  KEL+E L NET  WFLKFL+ +LD GF+++    K  +  GR+ E  NHI +T
Sbjct  480   GDGAKEIKELKEILLNETQSWFLKFLEGALDAGFRISTMEKKSKEIVGRRMEPDNHIAVT  539

Query  362   LSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRS  195
             LS LK ANEWLDK+  + S E  +E+   +++LKQK+Y CLL HVDSAASAL++RS
Sbjct  540   LSQLKHANEWLDKLRSKLSSE-NNELVKTIDRLKQKIYACLLSHVDSAASALESRS  594



>ref|XP_008228154.1| PREDICTED: uncharacterized protein LOC103327593 [Prunus mume]
Length=531

 Score =   466 bits (1199),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 297/539 (55%), Positives = 354/539 (66%), Gaps = 28/539 (5%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ+INS  VK+RGEYRSVLLQVISIVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPGVLLKLLQSINS-NVKVRGEYRSVLLQVISIVPALNGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN++ILNNKLQLGQ FYVDRME GTPVP+L+GVRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSKEDNEIILNNKLQLGQFFYVDRMEAGTPVPILIGVRPVPGRHPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
             QM+E +       ++ S    +  S    +   ++  VIKEEK  VASRYMQGVLT+   
Sbjct  120   QMLEPSESPVQADQQGSNSLKSRESFDAKDENSRQTFVIKEEKAAVASRYMQGVLTS-NS  178

Query  1208  KAKGSDe-----nenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTS--DSTIIN  1050
             KA G D      N +N  G   V  L+GKQQE   QAR  TPS      L+S  DS + N
Sbjct  179   KASGPDSNGGGKNHDNESGAKKVSMLKGKQQEHNGQARSITPSHNRPGALSSKLDSVVSN  238

Query  1049  GVNT-----NTLPKRT-NKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLR  888
                T     +T  KRT NK EN++ N +S + +    S   VLW+ LP N +K GKGMLR
Sbjct  239   TKETAAPYRSTSAKRTSNKHENMNSNCLS-SRKDKSQSPEAVLWACLPANFLKLGKGMLR  297

Query  887   MKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK-  711
              + LASL+AAEAQ EA  A  L++CLSMFADLCSSASP+NPHL + KFF LH LI+QP  
Sbjct  298   RRNLASLVAAEAQKEASTAATLVKCLSMFADLCSSASPDNPHLPLNKFFILHQLIDQPNI  357

Query  710   -KALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGD  534
               AL D        T     PD   L    G+  GK     P    +L GAEKLEWA+GD
Sbjct  358   AAALKDNSIP--LTTKQLMPPDVEKLSKRTGLIHGKSTLKSPKAPAELSGAEKLEWAKGD  415

Query  533   GLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NHIGLTLS  357
               K   EL+E L NET  WFLKFL+ +LD GF +     K   S GR+ E  NHI +TLS
Sbjct  416   SAKEIAELKEILINETRSWFLKFLEEALDTGFHLKPQEKKGKDSAGRRNEPDNHIAVTLS  475

Query  356   LLKQANEWLDKMMMRGSLELGSEMHGFVE---KLKQKVYGCLLVHVDSAASALDTRSHR  189
              LK+ANEWLDK+       + S  +G VE   +LKQKVY CLLVHV+SAASAL+ RS R
Sbjct  476   QLKKANEWLDKLKN----NINSGNNGLVENVDRLKQKVYACLLVHVESAASALENRSDR  530



>ref|XP_011079473.1| PREDICTED: uncharacterized protein LOC105162982 [Sesamum indicum]
 ref|XP_011079481.1| PREDICTED: uncharacterized protein LOC105162982 [Sesamum indicum]
Length=530

 Score =   464 bits (1193),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 291/533 (55%), Positives = 359/533 (67%), Gaps = 22/533 (4%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVLIKLLQ+INS  +K+RGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS
Sbjct  1     MASLVPGVLIKLLQSINS-NLKVRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS+ D DLILNNKLQLGQ FYV++MEPGTPVP+L+GVRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSREDTDLILNNKLQLGQFFYVEKMEPGTPVPILVGVRPVPGRHPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsn-snsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTT--  1218
             Q++EA+ E   +V +E+  N   +          KK+IVIKEEK  VASRYMQG L    
Sbjct  120   QLLEAS-EGTLQVDQENGVNVKLNELLDTKEETAKKRIVIKEEKTAVASRYMQGFLKQKS  178

Query  1217  ----AQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPS-ARSDALL-TSDSTI  1056
                 +     G D    +GG    VG LRGKQ E+K Q+R ++PS AR DAL   SD+  
Sbjct  179   EGKESDQSGGGKDSENESGGAAKKVGPLRGKQNELKGQSRASSPSRARPDALTQKSDTDS  238

Query  1055  INGVNTNT-----LPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGML  891
              +     T     + K TNKQEN++ N + N++ +   S   + WS+LPP L+KPGKGML
Sbjct  239   FSSKPDVTASKFLVVKCTNKQENINFNCLPNSSNKK-QSPEALSWSNLPPTLLKPGKGML  297

Query  890   RMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK  711
             R   LASL+AAEAQ EA  A NL +CLSMFADL SSASPENPHLS++KFF L  LIE+  
Sbjct  298   RRGNLASLVAAEAQKEANTAANLAKCLSMFADLYSSASPENPHLSLSKFFTLQQLIEKAD  357

Query  710   KALDDY-CFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGD  534
              A+     +  L V    +  D +    G    +   +  +   EL   GA+KLEW++GD
Sbjct  358   VAIPTKDVWENLQVNSTPQEKDKSSKKCGPLHRRSVNRTLRTSSELT--GADKLEWSKGD  415

Query  533   GLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR-QEEANHIGLTLS  357
             G+K   ELR+ L+NE   WFL FL  +L++GF+  +   K  +S  R  E+ NHI  TLS
Sbjct  416   GMKEITELRKILANEMQSWFLNFLGEALEIGFRGGSQEKKGKESAARVVEQNNHIASTLS  475

Query  356   LLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTR  198
              LKQANEWLDK+    S E  SE+   +++LKQKVY CLLVHVDSAASAL+ R
Sbjct  476   QLKQANEWLDKLRSNSSSE-KSELLETIDRLKQKVYACLLVHVDSAASALECR  527



>emb|CDO97816.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   462 bits (1190),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 288/527 (55%), Positives = 352/527 (67%), Gaps = 16/527 (3%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQTINS +VK+RGEYRS+LLQVISIVPA+SGSELWP HGFFIKVSDSS
Sbjct  1     MASLTPGVLLKLLQTINS-SVKVRGEYRSILLQVISIVPALSGSELWPCHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FYVDRME GTPVPVL+GVRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSKDDNELILNNKLQLGQFFYVDRMEAGTPVPVLVGVRPLPGRHPFIGNPKDLM  119

Query  1388  QMME-AAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQ  1212
             Q++E + G ++ + + E + + +        + ++KKI+IKE+K  V+SRYMQGVL T  
Sbjct  120   QVLEPSEGPVQVDQEGEDS-SVSVEPPEAKENGQRKKIIIKEDKAVVSSRYMQGVL-TPN  177

Query  1211  MKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPS-ARSDALLT-SDSTIINGVNT  1038
              KA G+D    N       G L+GKQ EIKVQ R  TPS  R D L T SD   +NG   
Sbjct  178   GKANGADPGGENAVAGKRNGFLKGKQAEIKVQTRTLTPSRTRPDGLTTNSDIDTLNGKEA  237

Query  1037  NTLPK------RTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKl  876
                 K       ++KQEN+D N +  NNR    SS  + WS+LP NL+KPGKG+LR K L
Sbjct  238   FASSKYPAIKHTSSKQENIDSNCLP-NNRDKHQSSEGICWSNLPANLLKPGKGLLRRKNL  296

Query  875   asliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDD  696
             AS +AAEAQ EA  A NL++CLS+FADLCSSASP NPHL ++ FF LH LI+ P  A + 
Sbjct  297   ASSVAAEAQKEASTAANLVKCLSIFADLCSSASPTNPHLYLSMFFTLHQLIKHP-NATNS  355

Query  695   YCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGLKATK  516
                T    T N    +++  G  I     + +        DL G +KLEWA  DG K  K
Sbjct  356   SKDTPDHFTVNSSMQNTDKYGKRISSSVSRDRMKLSKSPTDLTGTDKLEWANVDGSKEIK  415

Query  515   ELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEE-ANHIGLTLSLLKQAN  339
             ELRE + NET  WFLKFL+ +LD GFQ    N K       Q +  N I LTLS LK AN
Sbjct  416   ELREIVLNETQAWFLKFLEEALDSGFQGGKQNKKGKDYLINQTDPGNQIALTLSQLKHAN  475

Query  338   EWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTR  198
             EWLD++      E   E+   V++LKQK+Y CLL+HVDSAA AL++R
Sbjct  476   EWLDQLRNDADSE-KKELGEIVDRLKQKIYSCLLLHVDSAAVALESR  521



>ref|XP_010654401.1| PREDICTED: uncharacterized protein LOC100241213 isoform X1 [Vitis 
vinifera]
Length=602

 Score =   465 bits (1196),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 290/543 (53%), Positives = 363/543 (67%), Gaps = 33/543 (6%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ+INS  +K+RGEYRSVLLQVISIVPA+SGSELWP+HGFFIKVSDSS
Sbjct  67    MASLTPGVLLKLLQSINS-NIKVRGEYRSVLLQVISIVPALSGSELWPNHGFFIKVSDSS  125

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FYVDR+E GTPVP+L+GVRP+PGR+PF G+PKDLM
Sbjct  126   HSTYVSLSKEDNELILNNKLQLGQFFYVDRVEAGTPVPILVGVRPVPGRNPFVGNPKDLM  185

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsn-snskkkkKIVIKEEKVGVASRYMQGVLTT--  1218
             QM+    E   +V  E    S  +          ++KIVIKEEKV VASRYMQGVLT+  
Sbjct  186   QML-VPSEGPVQVDHEGINGSKLSELLEPKEESPRQKIVIKEEKVVVASRYMQGVLTSNS  244

Query  1217  ----AQMKAKGSDenenngggqgvvgGLRGKQQEIK-------VQARPTTP-SARSDALL  1074
                       G +    NGG    VG L+G+QQE+K       +Q R  TP  ++ DAL+
Sbjct  245   KVNGVDCNGGGKNNENENGGAGKKVGLLKGRQQELKGQPLVLALQTRSMTPMRSQQDALV  304

Query  1073  TSDSTIINGVNTNTLP------KR-TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNL  915
             +     ++    + +P      KR T+KQEN++ N + N   +N  SS  + W SLP NL
Sbjct  305   SKPEVAVSNAKESAVPVKGTTTKRPTSKQENINSNCLLNLKDKN-HSSEKISWMSLPANL  363

Query  914   VKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFAL  735
             +KPGKGMLR + LASLIAAEAQ EA  A  L++CL MFA+LCSS+S ENPHLS+TKFF L
Sbjct  364   LKPGKGMLRRRNLASLIAAEAQKEASTAAVLVKCLGMFANLCSSSSMENPHLSLTKFFTL  423

Query  734   HALIEQPKKA--LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGA  561
             H LI+QP     L D          N  +P ++      G+  GK         ++L G 
Sbjct  424   HQLIDQPNATTQLKDKSLH----LPNNSSPQADKSSKKTGLIHGKSALKSAKPSIELSGT  479

Query  560   EKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQ-EE  384
             EKLEWA+GDG K  KEL+E L NET  WFLKFL+ +LD GF+++    K  +  GR+ E 
Sbjct  480   EKLEWAKGDGAKEIKELKEILLNETQSWFLKFLEGALDAGFRISTMEKKSKEIVGRRMEP  539

Query  383   ANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALD  204
              NHI +TLS LK ANEWLDK+  + S E  +E+   +++LKQK+Y CLL HVDSAASAL+
Sbjct  540   DNHIAVTLSQLKHANEWLDKLRSKLSSE-NNELVKTIDRLKQKIYACLLSHVDSAASALE  598

Query  203   TRS  195
             +RS
Sbjct  599   SRS  601



>ref|XP_010104607.1| hypothetical protein L484_005038 [Morus notabilis]
 gb|EXC01338.1| hypothetical protein L484_005038 [Morus notabilis]
Length=530

 Score =   460 bits (1184),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 289/535 (54%), Positives = 359/535 (67%), Gaps = 22/535 (4%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ++NS  VK+RG+YRSVLLQVISIVPAI+GSELWPDHGFF+KVSDSS
Sbjct  1     MASLTPGVLLKLLQSMNS-NVKVRGDYRSVLLQVISIVPAITGSELWPDHGFFLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTY++LSK DN+LILNNKLQLGQ FYVDR+E G PVP+L+GVRP+ GRH F G+PKDLM
Sbjct  60    HSTYLSLSKEDNELILNNKLQLGQFFYVDRVEAGRPVPILVGVRPVLGRHAFVGNPKDLM  119

Query  1388  QMME-AAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQ  1212
             Q++E +   ++ +  + +  +             ++KIVIKEEK  VASRYMQGV TT+ 
Sbjct  120   QILEPSESPVQADHHEGNNGSKTKELMEVKEENSRQKIVIKEEKSVVASRYMQGV-TTSN  178

Query  1211  MKAKGSDenenngggq------gvvgGLRGKQQEIKVQARPTTPSA-RSDALLTSDSTI-  1056
              KA G D N + G            G ++GKQ E+  QARP TPS  R D  L+S     
Sbjct  179   SKASGQDSNGSVGKSNDNENGVKRTGFMKGKQHELNGQARPVTPSRNRPDHALSSRPEFS  238

Query  1055  INGVNTNTLPKR-------TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKG  897
             ++      LP +       ++KQEN+++N  SNN  +N L    +LWSSLPPNL+KPGKG
Sbjct  239   VSSTKDTVLPSKSTPAKRMSSKQENLNLNLSSNNKERNSL-PEALLWSSLPPNLLKPGKG  297

Query  896   MLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQ  717
             MLR + LAS +A EAQ EA  A NL++CLSMFADLCSSASPENPHLS T FF L  +I+Q
Sbjct  298   MLRRRNLASSVATEAQKEASRAANLVKCLSMFADLCSSASPENPHLSFTTFFKLDQIIDQ  357

Query  716   PKKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARG  537
             P +         L +T     P+        G    K+ P      ++L G EKLEWA+G
Sbjct  358   PNET-SPLKNKSLPLTTISSPPNVEKPIKKTGSDHSKIIPRLGKTHVELSGGEKLEWAKG  416

Query  536   DGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NHIGLTL  360
             DG K  KELRE L NET  WFLKFL+A+LDVGF++N    K   S GR+ E  NHI +TL
Sbjct  417   DGAKEIKELRELLLNETRSWFLKFLEAALDVGFRLNGQEKKGKNSTGRRTEPDNHIAITL  476

Query  359   SLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRS  195
             S LK ANEWL+K+    S E   E+   +++LKQKVY CLLVHV+SAASAL+ RS
Sbjct  477   SQLKNANEWLEKLKSNSSFE-NDELSETIDRLKQKVYSCLLVHVESAASALENRS  530



>ref|XP_009336716.1| PREDICTED: uncharacterized protein LOC103929275 [Pyrus x bretschneideri]
Length=555

 Score =   458 bits (1178),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 290/541 (54%), Positives = 361/541 (67%), Gaps = 32/541 (6%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVLIK LQ+INS  VK+RGEYRSVLLQVISIVPA+SGSELWP+ GFFIKVSDSS
Sbjct  27    MASLTPGVLIKFLQSINS-NVKVRGEYRSVLLQVISIVPALSGSELWPNQGFFIKVSDSS  85

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS+ DN++ILNNKLQLGQ FYVDRME GTPVP+L+GVRP+PGRHPF G+PKDLM
Sbjct  86    HSTYVSLSREDNEIILNNKLQLGQFFYVDRMEAGTPVPILVGVRPVPGRHPFVGNPKDLM  145

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
             QM+E + E   +   E   N++S S    +   ++K+VIKEEKV VASRYMQGV +T+  
Sbjct  146   QMLEPS-ENPVQADHE-GTNNSSKSREPFDENPRQKLVIKEEKVAVASRYMQGV-STSNS  202

Query  1208  KAKGSDe-----nenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDSTI-ING  1047
             KA  +D      N +N  G   VG ++GKQQE+  QAR   P       L S++ + ++ 
Sbjct  203   KASAADSYGGGKNNDNETGAKKVGMVKGKQQELNGQARSIAPPRNRPRGLASEADVAVSN  262

Query  1046  VNTNTLPKR-------TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLR  888
                  +P R       + KQE ++ N +SN   ++  S+  VLW SLP N VK GKGMLR
Sbjct  263   TKETAVPSRSASAKRTSGKQETMNTNCLSNRKDKSN-SAEAVLWPSLPANFVKLGKGMLR  321

Query  887   MKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK-  711
              + LASL+AAEAQ EA  A  L++C+SMFADLCSSASP+NPH+S+ KFF LH LI+QP  
Sbjct  322   RRNLASLVAAEAQKEASTAATLVKCVSMFADLCSSASPDNPHISLNKFFILHQLIDQPNM  381

Query  710   -KALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGD  534
                L D     + +T  +  PD   L    G+  GK       +  +L GAEKLEWA+GD
Sbjct  382   TAPLKD---NSIPLTTKQLPPDVETLSKKTGLIHGKGTLKSSKVPAELSGAEKLEWAKGD  438

Query  533   GLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKG--RQEEANHIGLTL  360
               K   ELRE+L NET  WFLKFL+ +LD GF++     K+ K     R E  N I +TL
Sbjct  439   SAKEITELREALLNETRSWFLKFLEEALDSGFRLKTPQEKKGKDSAGRRNEPENQIAVTL  498

Query  359   SLLKQANEWLDKMMMRGSLELGSEMHGFVE---KLKQKVYGCLLVHVDSAASALDTRSHR  189
             S LK+ NEWLDK+    S    SE +G VE   +LKQKVY CL VHV+SAASAL+ RS+ 
Sbjct  499   SQLKKGNEWLDKLKNSQS----SENNGLVETIDRLKQKVYSCLFVHVESAASALENRSNH  554

Query  188   N  186
             N
Sbjct  555   N  555



>ref|XP_008380771.1| PREDICTED: uncharacterized protein LOC103443658 [Malus domestica]
Length=555

 Score =   457 bits (1175),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 292/542 (54%), Positives = 361/542 (67%), Gaps = 32/542 (6%)
 Frame = -1

Query  1751  TMASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDS  1572
              MASLTPGVLIK LQ+INS  VK+RGEYRSVLLQVISIVPA+SGSELWP+ GFFIKVSDS
Sbjct  26    AMASLTPGVLIKFLQSINS-NVKVRGEYRSVLLQVISIVPALSGSELWPNQGFFIKVSDS  84

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHSTYV+LS+ DN++ILNNKLQLGQ FYVDRME GTPVP+L+GVRP+PGRHPF G+PKDL
Sbjct  85    SHSTYVSLSREDNEIILNNKLQLGQFFYVDRMEAGTPVPILVGVRPVPGRHPFVGNPKDL  144

Query  1391  MQMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQ  1212
             MQM+E + E   +   E   N++S S    +   ++K+VIKEEKV VASRYM+GV +T+ 
Sbjct  145   MQMLEPS-ENPVQADHEXX-NNSSKSREPFDENPRQKLVIKEEKVAVASRYMKGV-STSN  201

Query  1211  MKAKGSDe-----nenngggqgvvgGLRGKQQEIKVQARPTT-PSARSDALLTSDSTIIN  1050
              KA  +D      N +N  G   VG ++GKQQE+  QAR    P  R  AL +     ++
Sbjct  202   SKASAADSNGGGKNNDNETGAKKVGMVKGKQQELNGQARSIAPPRNRPRALASEADVAVS  261

Query  1049  GVNTNTLPKR-------TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGML  891
                   +P R       + KQE ++ N +SN   ++  S+  VLW SLP N +K GKGML
Sbjct  262   NTKETAVPSRSASAKRTSGKQETMNTNCLSNRKDKSN-SAEAVLWPSLPANFMKLGKGML  320

Query  890   RMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK  711
             R + LASL+AAEAQ EA  A  L++ LSMFADLCSSASP+NPH+S+ KFF LH LI+QP 
Sbjct  321   RRRNLASLVAAEAQKEASTAATLVKSLSMFADLCSSASPDNPHISLNKFFILHQLIDQPN  380

Query  710   KA--LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARG  537
              A  L D       +T  +  PD   L    G+  GK       +  +L GAEKLEWA+G
Sbjct  381   IAAPLKD---NSTPLTTKQLPPDVETLSKKTGLIHGKGTLKSSKVPAELSGAEKLEWAKG  437

Query  536   DGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKG--RQEEANHIGLT  363
             DG K   ELRE+L N+T  WFLKFL+ +LD GF++     K+ K     R E  N I +T
Sbjct  438   DGAKEIAELREALLNKTRSWFLKFLEEALDSGFRLKTPQEKKGKDSAGRRNEPENQIAVT  497

Query  362   LSLLKQANEWLDKMMMRGSLELGSEMHGFVE---KLKQKVYGCLLVHVDSAASALDTRSH  192
             LS LK+ NEWLDK+    S    SE +G VE   +LKQKVY CLLVHV+SAASAL+ RS 
Sbjct  498   LSQLKKGNEWLDKLKNSQS----SENNGLVETVDRLKQKVYSCLLVHVESAASALENRSD  553

Query  191   RN  186
             RN
Sbjct  554   RN  555



>ref|XP_006465840.1| PREDICTED: uncharacterized protein LOC102629788 [Citrus sinensis]
Length=534

 Score =   454 bits (1169),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 296/543 (55%), Positives = 360/543 (66%), Gaps = 33/543 (6%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ++NS  VK+RGEYRSVLLQVISIVPA+SGSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPGVLLKLLQSMNS-NVKVRGEYRSVLLQVISIVPALSGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS  DN+LILNNKLQLGQ FYVDR+E GTPVP+L GVRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSTEDNELILNNKLQLGQFFYVDRVEAGTPVPILAGVRPVPGRHPFVGNPKDLM  119

Query  1388  QMME-AAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQ  1212
             Q++E +   M  + +  +       S +   S +K+KI+IKEEK  V+SRYMQGVL T  
Sbjct  120   QILEPSESPMSADHEGVNGSKLKELSEAKEESPRKQKIIIKEEKSVVSSRYMQGVL-TGN  178

Query  1211  MKAKGSDenenngggqgvvg--------GLRGKQQEIKVQARPTTPS-ARSDA------L  1077
              K  G+D N N                  L+GKQQE+K QARP TPS +R DA      +
Sbjct  179   SKINGTDSNNNVRINTDNENGGAGKKLGSLKGKQQELKGQARPVTPSRSRPDAASLKPEV  238

Query  1076  LTSDSTIINGVNTNTLPKR-TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGK  900
             + SD+      + N   KR ++KQEN+++N +S ++R    SS    WSSLP NL+K GK
Sbjct  239   VVSDTKETMVYSKNVASKRISSKQENMNLNCLS-SSRDKSNSSEVTSWSSLPANLMKQGK  297

Query  899   GMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIE  720
             GMLR   LASL+AAEAQ EA +A  L+  LSMFADLCSSASPENPHL +TKFF L  LI+
Sbjct  298   GMLRRGNLASLVAAEAQKEASSAATLVHSLSMFADLCSSASPENPHLYLTKFFTLQQLID  357

Query  719   QPKKA--LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEW  546
             QP     L D  F  L     ++T   +      G+  GK         ++L G+EKLEW
Sbjct  358   QPNATTPLKDKSFQSLIQHSGQET---DTFSKRTGLIHGKSIMKSTKSSVELSGSEKLEW  414

Query  545   ARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NHIG  369
             A+GDG K  KELR+ L NET  WFLKFL+ +LD GF+V N   K   + GR  EA N I 
Sbjct  415   AKGDGGKEIKELRDILLNETRSWFLKFLEVALDTGFRVGNQEKKGKYTAGRLLEADNQIA  474

Query  368   LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVE---KLKQKVYGCLLVHVDSAASALDTR  198
             L LS LK AN WLDK+       L S+ +G VE   +LKQKVY CLL+HVDSAASAL+ R
Sbjct  475   LALSQLKHANGWLDKLRS----NLSSDNNGIVETIDRLKQKVYACLLLHVDSAASALENR  530

Query  197   SHR  189
             S R
Sbjct  531   SDR  533



>ref|XP_006426751.1| hypothetical protein CICLE_v10025332mg [Citrus clementina]
 gb|ESR39991.1| hypothetical protein CICLE_v10025332mg [Citrus clementina]
 gb|KDO45715.1| hypothetical protein CISIN_1g009440mg [Citrus sinensis]
Length=534

 Score =   454 bits (1168),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 295/543 (54%), Positives = 360/543 (66%), Gaps = 33/543 (6%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ++NS  VK+RGEYRSVLLQVISIVPA+SGSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPGVLLKLLQSMNS-NVKVRGEYRSVLLQVISIVPALSGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS  DN+LILNNKLQLGQ FYVDR+E GTPVP+L GVRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSTEDNELILNNKLQLGQFFYVDRVEAGTPVPILAGVRPVPGRHPFVGNPKDLM  119

Query  1388  QMME-AAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQ  1212
             Q++E +   M  + +  +       S +   S +K+KI+IKEEK  V+SRYMQGVL T  
Sbjct  120   QILEPSESPMSADHEGVNGSKLKELSEAKEESPRKQKIIIKEEKSVVSSRYMQGVL-TGN  178

Query  1211  MKAKGSDenenngggqgvvg--------GLRGKQQEIKVQARPTTPS-ARSDA------L  1077
              K  G D N N                  L+GKQQE+K QARP TPS +R DA      +
Sbjct  179   SKINGMDSNNNVRINTDNENGGAGKKLGSLKGKQQELKGQARPVTPSRSRPDAASLKPEV  238

Query  1076  LTSDSTIINGVNTNTLPKR-TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGK  900
             + SD+      + N   KR ++KQEN+++N +S++  ++  S     WSSLP NL+K GK
Sbjct  239   VVSDTKETMVYSKNVASKRISSKQENMNLNCLSSSRDKSNSSG-VTSWSSLPANLMKQGK  297

Query  899   GMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIE  720
             GMLR   LASL+AAEAQ EA +A  L+  LSMFADLCSSASPENPHL +TKFF L  LI+
Sbjct  298   GMLRRGNLASLVAAEAQKEASSAATLVHSLSMFADLCSSASPENPHLYLTKFFTLQQLID  357

Query  719   QPKKA--LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEW  546
             QP     L D  F  L     ++T   +      G+  GK         ++L G+EKLEW
Sbjct  358   QPNATTPLKDKSFQSLIQHSAQET---DTFSKKTGLIHGKSIMKSTKSSVELSGSEKLEW  414

Query  545   ARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NHIG  369
             A+GDG K  KELR+ L NET  WFLKFL+A+LD GF+V N   K   + GR  EA N I 
Sbjct  415   AKGDGGKEIKELRDILLNETRSWFLKFLEAALDTGFRVGNQEKKGKYTAGRLLEADNQIA  474

Query  368   LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVE---KLKQKVYGCLLVHVDSAASALDTR  198
             L LS LK AN WLDK+       L S+ +G VE   +LKQKVY CLL+HVDSAASAL+ R
Sbjct  475   LALSQLKHANGWLDKLRSN----LSSDNNGIVETIDRLKQKVYACLLLHVDSAASALENR  530

Query  197   SHR  189
             S R
Sbjct  531   SDR  533



>gb|KHG28824.1| hypothetical protein F383_15620 [Gossypium arboreum]
Length=525

 Score =   452 bits (1164),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 283/539 (53%), Positives = 352/539 (65%), Gaps = 37/539 (7%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ++NS  VK+ GEYRSVLLQVISIVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPGVLLKLLQSMNS-NVKVLGEYRSVLLQVISIVPALTGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS+ DN+LILNNKLQLGQ FYV+R+EPGTPVP+L+GVRP+PGR+PF G+PKDLM
Sbjct  60    HSTYVSLSQEDNELILNNKLQLGQFFYVERVEPGTPVPILVGVRPVPGRNPFIGNPKDLM  119

Query  1388  QMM-EAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQ  1212
             QM+  + G M  + +  S  +    S        +KKIVIKEEK  VASRYMQGVL +  
Sbjct  120   QMLVPSEGLMVADNEGNSNGSKAKESVEVREESPRKKIVIKEEKASVASRYMQGVLPS-N  178

Query  1211  MKAKGSDenenngggqgvv----gGLRGKQQEIKVQARPTTPSARSDALLTSDSTIINGV  1044
              KA G D N +               + KQQE K QARP +PS     +  S   ++   
Sbjct  179   PKASGPDSNHSCKNTDNENGGAGKKAKSKQQEPKGQARPASPSRSRLEVPVSKPEVVVAP  238

Query  1043  NT---------NTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGML  891
             NT          T+ + ++K EN++ N  +NN  +N L      W+SLP +L+KPGKGML
Sbjct  239   NTKETTVPAKSTTVKRSSSKHENMNSNCSANNKEKNSLPETGS-WNSLPASLLKPGKGML  297

Query  890   RMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK  711
             R + LASL+AAEAQ+EA  A NL++CLSMF+DLCSSASPENPHL++TKFFAL  LI+QP 
Sbjct  298   RRRNLASLVAAEAQSEASMAANLVKCLSMFSDLCSSASPENPHLTLTKFFALQQLIDQPS  357

Query  710   KALDDYCFTKL----SVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWA  543
                      +L    SV D +K+            G    K       + L GAEKLEWA
Sbjct  358   VTSHKDKHHQLPNLPSVVDTEKS--------NKRKGLIHDKRMSTRSSVQLSGAEKLEWA  409

Query  542   RGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR-QEEANHIGL  366
             +GDG K  KELRE+L +ET  WFLKFL+ +LDVGF++ +   K      R  E+ NHI +
Sbjct  410   KGDGAKERKELRETLLHETRTWFLKFLEVALDVGFRIGSQEKKGKTGTARLTEQDNHIAV  469

Query  365   TLSLLKQANEWLDKMMMRGSLELGSEMHGF---VEKLKQKVYGCLLVHVDSAASALDTR  198
             TLS LK ANEWL K+       L S+ +G    VE+L QKVY CLL HVDSAASAL+ R
Sbjct  470   TLSQLKFANEWLGKVKNN----LSSDNNGMMETVERLNQKVYACLLSHVDSAASALENR  524



>ref|XP_004305766.1| PREDICTED: uncharacterized protein LOC101315368 [Fragaria vesca 
subsp. vesca]
Length=528

 Score =   452 bits (1164),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 291/539 (54%), Positives = 359/539 (67%), Gaps = 33/539 (6%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ++NS  +K+ GEYRSVLLQVISIVPA+SGSELWP+ GFF+KVSDSS
Sbjct  1     MASLTPGVLLKLLQSMNS-NIKVLGEYRSVLLQVISIVPALSGSELWPNQGFFVKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FYVDR+E GTPVP+L GVRP+ GRHPF G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILNNKLQLGQFFYVDRLEAGTPVPILQGVRPVLGRHPFVGNPKDLM  119

Query  1388  QMME-AAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQ  1212
             QM++ +   ++ +    S       S+       ++KIVIKEEK  VASRYMQG  +T+ 
Sbjct  120   QMVDPSESPVQADDHGGSNSLKPRESSDGKEETSRQKIVIKEEKTAVASRYMQG-FSTSN  178

Query  1211  MKAK-----GSDenenngggqgvvgGLRGKQQEIKVQARPTTPS-ARSDALLTSDSTIIN  1050
              KA      GS +  +N  G   VG  +GKQQE+  QAR  TPS +R+ ALL+      +
Sbjct  179   SKANSQDCSGSGKQNDNESGGKKVGMTKGKQQELNGQARSITPSNSRAGALLSKPEAAAS  238

Query  1049  GVNTNTLP-KRT------NKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGML  891
                   +P KRT      +KQEN++ N +S N ++  L     LW SLP NL+KPGKGML
Sbjct  239   NTKQTAVPSKRTSEKRASSKQENINYNCLS-NRKEKTLPPEVALWGSLPANLLKPGKGML  297

Query  890   RMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK  711
             R + LASL+A EAQ EA  A  L++CLS+FADLCSSASP+NPHLS+TKFF LH LI+QP 
Sbjct  298   RRRNLASLVAVEAQKEASRAATLVKCLSIFADLCSSASPQNPHLSLTKFFRLHQLIDQPN  357

Query  710   KA--LDDYCFTKLS-VTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWAR  540
              A  L D    KL+ +T  +  PD        G   G+     P L ++L  AEKLEWA+
Sbjct  358   IAAPLKD----KLTPLTTKQLPPDIGKFSKRSGTIHGQSALKPPKLPIELSEAEKLEWAK  413

Query  539   GDGLKATKELRESLSNETHLWFLKFLDASLDV-GFQVnnnnnkenksKGRQEEA-NHIGL  366
             G+  K   EL+E L NET  WFLKFL+A LD  GF +N    K  +S  R+ E  NHI +
Sbjct  414   GESTKGIAELQELLLNETRSWFLKFLEAELDAGGFHLNTQEKKGKESAARRNEPDNHIAV  473

Query  365   TLSLLKQANEWLDKMMMRGSLELGSEMHGFVE---KLKQKVYGCLLVHVDSAASALDTR  198
             TLS LK +NEWLDK+       L SE  G VE   +LKQKVY CLLVHV+SAASAL+ R
Sbjct  474   TLSQLKNSNEWLDKLKT----SLSSESSGLVETVDRLKQKVYACLLVHVESAASALENR  528



>ref|XP_009765878.1| PREDICTED: uncharacterized protein LOC104217350 [Nicotiana sylvestris]
Length=521

 Score =   450 bits (1158),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 281/535 (53%), Positives = 358/535 (67%), Gaps = 40/535 (7%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL P VLIKLLQ++NS  VK+RGEYRSVLLQVISIVPA+SGSELWP+HGFFIKVSDSS
Sbjct  1     MASLVPDVLIKLLQSMNS-NVKVRGEYRSVLLQVISIVPALSGSELWPNHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYVTLSK DN+LILNNKLQLGQ FYVDRME GTPVPVL+GVRPIPGRHPF G+PKDLM
Sbjct  60    HSTYVTLSKEDNELILNNKLQLGQFFYVDRMEAGTPVPVLVGVRPIPGRHPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKE-SAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQ  1212
             QM+E++ E+  +  KE ++    +         +KKK+VIKEEK  VASRYMQG L+   
Sbjct  120   QMLESS-EVSVKTDKEDNSGQKCNELAELKKENRKKKLVIKEEKAVVASRYMQG-LSNHN  177

Query  1211  MKAKGSDe-------nenngggqgvvgGLRGKQQEIKVQARPTTPS-ARSDALL-TSDST  1059
              K+ G+D+          + G       L+GKQ E K Q RPTTPS +RSDA    SD  
Sbjct  178   TKSGGNDQGNGAKGVENESNGSDHKAVPLKGKQPEAKGQTRPTTPSRSRSDAFSPNSDVN  237

Query  1058  IINGV------NTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKG  897
             ++N        N +TL + ++KQEN+  N           S   + WSSLP NL KPGKG
Sbjct  238   VLNSRELLTTPNISTLKRTSSKQENITENGQ--------FSEKLIPWSSLPANLAKPGKG  289

Query  896   MLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQ  717
             +LR +KLASLIAAEAQ EA+ A NLL C  MFA+LCSSASPE+PHL++ KFF L+ L++Q
Sbjct  290   ILRRRKLASLIAAEAQEEALTATNLLHCFRMFAELCSSASPESPHLNLAKFFTLNQLMQQ  349

Query  716   PKKALDDYCF----TKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLE  549
             P    +D       +KLS+ + +K         G    K           +++  AEK+E
Sbjct  350   PNTKTNDQILDNFASKLSLQEKEKVGKETRSFNGKSTPKSMKPL------IEVSVAEKVE  403

Query  548   WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANH-I  372
             W +GDG +  +ELRE L NE   WFLKFL+ +LDVGF+++  + K+     +Q+++N+ I
Sbjct  404   WTKGDGSRGMRELREVLFNEIQSWFLKFLEEALDVGFRLDEQDQKKKVRAVQQKDSNNQI  463

Query  371   GLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
              L LS LK AN+WLDK+  + +  L  ++   V++LKQK+Y CLL+HVDSAASAL
Sbjct  464   ALALSQLKHANDWLDKLRCKST--LNKDVVETVDRLKQKLYACLLLHVDSAASAL  516



>ref|XP_007217868.1| hypothetical protein PRUPE_ppa021525mg [Prunus persica]
 gb|EMJ19067.1| hypothetical protein PRUPE_ppa021525mg [Prunus persica]
Length=505

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 290/531 (55%), Positives = 346/531 (65%), Gaps = 38/531 (7%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ+INS  VK+RGEYRSVLLQVISIVPA+SGSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPGVLLKLLQSINS-NVKVRGEYRSVLLQVISIVPALSGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN++ILNNKLQLGQ FYVDRME GTPVP+L+GVRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSKEDNEIILNNKLQLGQFFYVDRMEAGTPVPILIGVRPVPGRHPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKE-SAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQ  1212
             QM+E + E   +V +E S       S    +   ++  VIKEE+  VASRYMQGVLT+  
Sbjct  120   QMLEPS-ESPVQVDQEGSNSLKLRESFDAKDENSRQTFVIKEERAAVASRYMQGVLTS-N  177

Query  1211  MKAKGSDe-----nenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDSTIING  1047
              KA G D      N +N  G   V  L+GKQQE   Q   T    RS             
Sbjct  178   SKASGPDSNGGGKNHDNESGARKVSMLKGKQQEHNGQE--TAVPYRS-------------  222

Query  1046  VNTNTLPKRT-NKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlas  870
                 T  KRT +KQEN++ N +S + +    S   VLW+ LP N +K GKGMLR + LAS
Sbjct  223   ----TSAKRTSSKQENMNSNCLS-SRKDKSQSPEAVLWACLPANFLKLGKGMLRRRNLAS  277

Query  869   liaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYC  690
             L+AAEAQ EA  A  L++CLSMFADLCS+ASP+NPHL + KFF LH LI+QP  A     
Sbjct  278   LVAAEAQKEASTAATLVKCLSMFADLCSTASPDNPHLPLNKFFILHQLIDQPNIAAPFKD  337

Query  689   FTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGLKATKEL  510
              +  S T     PD   L    G+  GK     P    +L GAEKLEWA+GD  K   EL
Sbjct  338   NSIPSTTKQLVPPDVEKLSKRTGLIHGKSTLKSPKAPAELSGAEKLEWAKGDSAKEIAEL  397

Query  509   RESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NHIGLTLSLLKQANEW  333
             +E L NET  WFLKFL+ +LD GF +     K   S GR+ E  NHI +TLS LK+ANEW
Sbjct  398   KEILINETRSWFLKFLEEALDTGFHLKPQEKKGKDSAGRRNEPDNHIAVTLSQLKKANEW  457

Query  332   LDKMMMRGSLELGSEMHGFVE---KLKQKVYGCLLVHVDSAASALDTRSHR  189
             LDK+       + S  +G VE   +LKQKVY CLLVHV+SAASAL+ RS R
Sbjct  458   LDKLKN----NMSSGNNGLVENVDRLKQKVYACLLVHVESAASALENRSDR  504



>ref|XP_009623979.1| PREDICTED: uncharacterized protein LOC104115113 [Nicotiana tomentosiformis]
 ref|XP_009623980.1| PREDICTED: uncharacterized protein LOC104115113 [Nicotiana tomentosiformis]
 ref|XP_009623981.1| PREDICTED: uncharacterized protein LOC104115113 [Nicotiana tomentosiformis]
Length=521

 Score =   447 bits (1150),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 284/539 (53%), Positives = 360/539 (67%), Gaps = 48/539 (9%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL P VLIKLLQ++NS  VK+RGEYRSVLLQVISIVPA+SGSELWP+HGFFIKVSDSS
Sbjct  1     MASLVPDVLIKLLQSMNS-NVKVRGEYRSVLLQVISIVPALSGSELWPNHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYVTLSK DN+LILNNKLQLGQ FYVDRME GTPVPVL+GVRPIPGRHPF G+PKDLM
Sbjct  60    HSTYVTLSKEDNELILNNKLQLGQFFYVDRMEAGTPVPVLVGVRPIPGRHPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVK---KESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTT  1218
             QM+E++   E  VK   +++     +         +KKK+VIKEEK  VASRYMQG L+ 
Sbjct  120   QMLESS---EVSVKTDQEDNTGQKCNELPELKKENRKKKLVIKEEKAVVASRYMQG-LSN  175

Query  1217  AQMKAKGSDenenngggqgvvgG-------LRGKQQEIKVQARPTTPS-ARSDALLTSDS  1062
                K  G+D+     G +    G       L+GKQ E+K Q RPTTPS  RSDA   S +
Sbjct  176   QNTKTGGNDQGNGAKGVENESNGSDHKVGPLKGKQPEVKGQTRPTTPSRGRSDAF--SPN  233

Query  1061  TIINGVNT---------NTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVK  909
             + +N  N+         +TL + ++KQEN+  N        +  S   + WSSLP NL K
Sbjct  234   SDVNEFNSRELLITPRFSTLKRTSSKQENITEN--------SPFSEKLIPWSSLPANLAK  285

Query  908   PGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHA  729
             PGKG+LR KKLASLIAAEAQ E + A NLL  LSMFA+LCSSASPE+PHL++ KFF L+ 
Sbjct  286   PGKGILRRKKLASLIAAEAQEEELTATNLLHSLSMFAELCSSASPESPHLNLAKFFTLNQ  345

Query  728   LIEQPKKALDDYCF----TKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGA  561
             L++Q     +D       +KLS+ + +K         G    K           +++  A
Sbjct  346   LMQQSNAKTNDQILDNFASKLSLQEKEKAGKETRSLNGKSTPKSMKPL------IEVSVA  399

Query  560   EKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA  381
             EK+EWA+GDG +  +ELRE L NE   WFLKFL+ +LD+GF+++  ++K+     +Q+E+
Sbjct  400   EKVEWAKGDGSRGMRELREVLFNEIQSWFLKFLEEALDIGFRLDEQDHKKKVRAVQQKES  459

Query  380   NH-IGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
             N+ I L LS LK AN+WLDK+  + +  L  EM   V++LKQK+Y CLL+HVDSAASAL
Sbjct  460   NNQIALALSQLKHANDWLDKLRCKST--LNKEMVQTVDRLKQKLYACLLLHVDSAASAL  516



>ref|XP_006362090.1| PREDICTED: uncharacterized protein LOC102584804 [Solanum tuberosum]
Length=520

 Score =   446 bits (1147),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 284/537 (53%), Positives = 359/537 (67%), Gaps = 45/537 (8%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL P VLIKLLQ++NS  VK+RGEYRSVLLQVISIVPA+SGSELWP+HGFFIKVSDSS
Sbjct  1     MASLVPEVLIKLLQSMNS-NVKVRGEYRSVLLQVISIVPALSGSELWPNHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYVTLSK DN+ ILNNKLQLGQ FYVD+ME GTPVPVL+GVRPIPGRHPF G+PKDLM
Sbjct  60    HSTYVTLSKEDNEFILNNKLQLGQFFYVDKMEAGTPVPVLVGVRPIPGRHPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
             QM+E + E+  +    +    N        ++KKKK VIKEEK  VASRYMQGV +    
Sbjct  120   QMLEQS-EVPDQENSTTGPKLNELPEMKKENEKKKKFVIKEEKAVVASRYMQGV-SNQNA  177

Query  1208  KAKGSDe-------nenngggqgvvgGLRGKQQEIKVQARPTTPS-ARSDALL-TSDSTI  1056
             K  G+D+          + G    V  L+GKQ E+K Q +PTTPS +RSDA    SD  +
Sbjct  178   KIGGNDQGTGAKGVENESNGADHKVVHLKGKQPEVKSQTQPTTPSRSRSDAFSPNSDVNV  237

Query  1055  INGVNTNTLP-----KRT-NKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGM  894
             +N    +T P     KRT +K EN+  N           S   + WSSLP NL KPGKG+
Sbjct  238   LNSRELSTTPRFSTLKRTSSKPENIREN--------GPFSETLIPWSSLPANLAKPGKGI  289

Query  893   LRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQP  714
             LR KKLASLIAAEAQ EA+ A NLL C SMFA+LCSSASPE+PHL+++KFF L+ L++QP
Sbjct  290   LRRKKLASLIAAEAQEEALTATNLLHCFSMFAELCSSASPESPHLNLSKFFTLNQLMDQP  349

Query  713   -------KKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEK  555
                    ++ LD++  +KLS+ D +K+                L        +++  +EK
Sbjct  350   NNTNKTNEQILDNFA-SKLSLQDKEKSSKKTRSLNDTKNTPKSL--------IEISVSEK  400

Query  554   LEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANH  375
             +EWA+GDG K  KELR+ L NE   WFLKF+D +LDVGFQ++   +K+     +Q + N+
Sbjct  401   VEWAKGDGSKGIKELRDVLFNEMQSWFLKFMDEALDVGFQLSEQEHKKKTRVVQQTDTNN  460

Query  374   -IGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
              I L LS LK AN+WLDK+  + +  L  ++   V++LKQK+Y CLL+H+DSAASAL
Sbjct  461   QIALALSQLKHANDWLDKLQSKST--LNKDVAETVDRLKQKLYACLLLHIDSAASAL  515



>ref|XP_007024713.1| Uncharacterized protein TCM_029205 [Theobroma cacao]
 gb|EOY27335.1| Uncharacterized protein TCM_029205 [Theobroma cacao]
Length=524

 Score =   445 bits (1145),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 282/537 (53%), Positives = 352/537 (66%), Gaps = 32/537 (6%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ+INS  VK+RGEYRSVLLQVISIVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPGVLLKLLQSINS-NVKVRGEYRSVLLQVISIVPALTGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS+ DN+LILNNKLQLGQ FYV+R+E GTPVPVL+GVRP+PGR+ F G+PKDLM
Sbjct  60    HSTYVSLSQEDNELILNNKLQLGQFFYVERVEAGTPVPVLVGVRPVPGRNAFIGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKE-SAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQ  1212
             QM+    E    V  E +  +         +   ++KIVIKEEK  VASRYMQGVL +  
Sbjct  120   QML-VPSEGPVAVDNEGNNGSKGKELVEAKDESPRQKIVIKEEKAVVASRYMQGVLPS-N  177

Query  1211  MKAKGSDe----nenngggqgvvgGLRGKQQEIKVQARPTTPS-ARSDALLTSDSTIING  1047
              KA G D                   + KQQE K QARP TPS +R +  L+    + + 
Sbjct  178   PKASGPDSNSCLKSTENENGAAGKKAKSKQQEPKGQARPATPSRSRPEVPLSKPEAVASN  237

Query  1046  VNTNTLPKRT-------NKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLR  888
                  +P++        +K EN++ N + NN  +N L      W+SLP +L+KPGKGMLR
Sbjct  238   TKETMVPQKGTTVRRSLSKLENMNSNCLPNNKEKNNLPETNS-WNSLPASLLKPGKGMLR  296

Query  887   MKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKK  708
              + LASL+AA+AQ EA  A NL++CLSMF+DLC SASPENP LS+TKFF L  LI+QP  
Sbjct  297   RRNLASLVAADAQREASMATNLVKCLSMFSDLCYSASPENPQLSLTKFFTLQKLIDQPSV  356

Query  707   A--LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGD  534
                L D  F +LS+  + +  D+       G+   K     P   + LGGAEKL WA+GD
Sbjct  357   TAHLKDKTF-QLSILPSGQ--DTEKSNKRKGLTHEKSALKSPKPSMQLGGAEKLGWAKGD  413

Query  533   GLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR-QEEANHIGLTLS  357
             G +  KELRE L +ET  WFLKFL+ +L+VGF+  +   K   + GR  E+ NHI +TLS
Sbjct  414   GAREIKELREILLHETRTWFLKFLEVALEVGFR--SQEKKGKSATGRVMEQDNHIAVTLS  471

Query  356   LLKQANEWLDKMMMRGSLELGSEMHGF---VEKLKQKVYGCLLVHVDSAASALDTRS  195
              LK ANEWLDK+       L S+ +G    VE+LKQKVY CLL HVDSAASAL+ RS
Sbjct  472   QLKYANEWLDKLRS----NLNSDNNGLMETVERLKQKVYACLLSHVDSAASALENRS  524



>ref|XP_004252522.1| PREDICTED: uncharacterized protein LOC101267004 [Solanum lycopersicum]
 ref|XP_010314330.1| PREDICTED: uncharacterized protein LOC101267004 [Solanum lycopersicum]
 ref|XP_010314331.1| PREDICTED: uncharacterized protein LOC101267004 [Solanum lycopersicum]
Length=523

 Score =   442 bits (1137),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 281/537 (52%), Positives = 358/537 (67%), Gaps = 43/537 (8%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL P VLIKLLQ++NS  VK+RGEYRSVLLQVISIVPA+SGSELWP+HGFFIKVSDSS
Sbjct  1     MASLVPEVLIKLLQSMNS-NVKVRGEYRSVLLQVISIVPALSGSELWPNHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYVTLSK DN+ ILNNKLQLGQ FYVD+ME GTPVPVL+GVRPIPGRHPF G+PKDLM
Sbjct  60    HSTYVTLSKEDNEFILNNKLQLGQFFYVDKMEAGTPVPVLVGVRPIPGRHPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
             QM+E +   + E    +    N          K KK VIKEEK  VASRYMQGV +   +
Sbjct  120   QMLEQSEVPDQENSSTTDPKLNELVEMKKEIDKTKKFVIKEEKAVVASRYMQGV-SNQNV  178

Query  1208  KAKGSD-------enenngggqgvvgGLRGKQQEIK-VQARPTTPS-ARSDALL-TSDST  1059
             K  G+D          ++ G    V  L+GKQ E+K  Q +PTTPS +RSDA    +D  
Sbjct  179   KIGGNDHGTGAKGVENDSNGADHKVVPLKGKQPEVKSTQTQPTTPSRSRSDAFSPNTDVN  238

Query  1058  IINGVNTNTLP-----KRTN-KQENVDVNFMSNNNRQNILSSHPVL-WSSLPPNLVKPGK  900
             ++N    +T P     KRT+ KQEN+         R+N   S  ++ WSSLP NL KPGK
Sbjct  239   VLNSRELSTTPKFSTLKRTSTKQENI---------RENCPFSETLIPWSSLPANLAKPGK  289

Query  899   GMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIE  720
             G+LR KKLASLIAAEAQ EA+ A NLL C+SMFA+LCSS SPE+PHL+++KFF L+ L++
Sbjct  290   GILRRKKLASLIAAEAQDEALTATNLLHCISMFAELCSSVSPESPHLNLSKFFTLNQLMD  349

Query  719   QP-----KKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEK  555
             Q      ++ LD++  +KLS+ D +    S                      +++  +E+
Sbjct  350   QTNTKSNEQILDNFA-SKLSLQDKELIKSSKKTRSLNDTKNTPKSL------IEVSVSER  402

Query  554   LEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANH  375
             +EWA+GDG K  KELR+ L NE   WFLKF+D +LDVGFQ++   +K+ K   +Q + N+
Sbjct  403   VEWAKGDGSKGVKELRDVLFNEMQSWFLKFMDEALDVGFQLSEQEHKKKKRIVQQTDTNN  462

Query  374   -IGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
              I L LS LK AN+WLDK+  + +  L  ++   V++LKQK+Y CLL+H+DSAASAL
Sbjct  463   QIALALSQLKHANDWLDKLQSKSA--LNKDVAAKVDRLKQKLYACLLLHIDSAASAL  517



>ref|XP_002304236.2| hypothetical protein POPTR_0003s06780g [Populus trichocarpa]
 gb|EEE79215.2| hypothetical protein POPTR_0003s06780g [Populus trichocarpa]
Length=533

 Score =   441 bits (1133),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 275/541 (51%), Positives = 349/541 (65%), Gaps = 30/541 (6%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLL++INS  V++RGEYRSVLLQVISIVPA+SGSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPGVLLKLLRSINS-NVRVRGEYRSVLLQVISIVPALSGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FYVDR+E GTPVP L GVRP+ GR+PF G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILNNKLQLGQFFYVDRVEAGTPVPTLSGVRPVAGRNPFIGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTA--  1215
             QM+    E    V      +     +       ++KIVIKEEK GVASRYMQGVLT +  
Sbjct  120   QML-VPSEGPVPVNDGVNSSKPRELSEVKGENARQKIVIKEEKAGVASRYMQGVLTGSLK  178

Query  1214  ----QMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTP--------SARSDALLT  1071
                      G     +N G    VG + GKQQE K QARP TP        S++ D  ++
Sbjct  179   VGEVDSSGIGKSNESDNSGPGKKVGLMNGKQQENKGQARPATPYQNQPDALSSKPDVAVS  238

Query  1070  SDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGML  891
             S+          +  + +NKQ++ + N +S+NN + I       W+SLP NL+KPGKGML
Sbjct  239   SNKEFPASSKRTSAKRLSNKQDDTNFNSLSSNNNK-IPFPEATSWTSLPSNLMKPGKGML  297

Query  890   RMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK  711
             R + LA+L+AAEAQ EA  A +L++CL+MFA+LC+SASPENPHL++TKFF L  LI+QP 
Sbjct  298   RRRYLATLVAAEAQKEASTAASLIKCLNMFAELCASASPENPHLTLTKFFTLQQLIDQPN  357

Query  710   --KALDD---YCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEW  546
                 L D     FT  S      +P++        + K K     P   ++L   EK EW
Sbjct  358   VTAPLKDKSLQSFTHFS------SPETQKTSKKTSLSKAKATLKSPKPSMELSATEKQEW  411

Query  545   ARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR--QEEANHI  372
             A+GDG K  KEL+++L NET  WFL+FL+ +LD GF V     K      +  + E NHI
Sbjct  412   AKGDGKKEIKELQQTLLNETRAWFLRFLEGALDAGFHVAAQEKKGKDFATQRMEPENNHI  471

Query  371   GLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRSH  192
              + LS LK ANEWLD +  + S E  +E+   V++LKQK+Y CLL HVDSAASAL+ RS+
Sbjct  472   AVALSQLKHANEWLDILRSKLSSEDNNELVETVDRLKQKIYACLLAHVDSAASALENRSN  531

Query  191   R  189
             R
Sbjct  532   R  532



>ref|XP_011036498.1| PREDICTED: uncharacterized protein LOC105133992 [Populus euphratica]
Length=533

 Score =   440 bits (1131),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 271/537 (50%), Positives = 338/537 (63%), Gaps = 22/537 (4%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLL++INS  V++RGEYRSVLLQVISIVPA+SGSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPGVLLKLLRSINS-NVRVRGEYRSVLLQVISIVPALSGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FYVDR+E GTPVP L GVRP+ GR+PF G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILNNKLQLGQFFYVDRVEAGTPVPTLSGVRPVAGRNPFIGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTA--  1215
             QM+    E    V      +     +       ++KIVIKEEK GVASRYMQGVLT +  
Sbjct  120   QML-VPSEGPVPVNDGVNSSKPRELSEVKGENARQKIVIKEEKAGVASRYMQGVLTGSLK  178

Query  1214  ----QMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDSTIING  1047
                      G     +N G    VG + GKQQE K QARP TP       L+S   +   
Sbjct  179   VGEVDSSGIGKSNESDNSGPGKKVGLMNGKQQENKGQARPATPYQNQPDALSSKPEVAVS  238

Query  1046  VNTN-------TLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLR  888
              N         T  KR + ++N       ++N   I       W SLP NL+KPGKGMLR
Sbjct  239   SNKEFPASSKRTSTKRLSNKQNDTNFNSLSSNNNKIPFPEATAWISLPSNLMKPGKGMLR  298

Query  887   MKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK-  711
              + LASL+AAEAQ EA  A +L++CL+MFA+LC+SASPENPHL++TKFF L  LI+QP  
Sbjct  299   RRYLASLVAAEAQKEASTAASLIKCLNMFAELCASASPENPHLTLTKFFTLQQLIDQPNV  358

Query  710   -KALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGD  534
                L D      ++     +P++          K K     P   ++L   EK EWA+GD
Sbjct  359   TAPLKDKSLQSFTLFS---SPETQKTSKKTSPSKAKATLKSPKPSMELSATEKQEWAKGD  415

Query  533   GLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR--QEEANHIGLTL  360
             G K  KEL+++L NET +WFL+FL+ +LD GF V     K      +  + E NHI + L
Sbjct  416   GKKEIKELQQTLLNETRVWFLRFLEGALDAGFHVAAQEKKGKDFATQRMEPENNHIAVAL  475

Query  359   SLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRSHR  189
             S LK ANEWLD +  + S E  +E+   V++LKQK+Y CLL HVDSAASAL+ RS+R
Sbjct  476   SQLKHANEWLDILRSKLSSEDNNELVETVDRLKQKIYACLLAHVDSAASALENRSNR  532



>ref|XP_008342434.1| PREDICTED: uncharacterized protein LOC103405235 isoform X1 [Malus 
domestica]
Length=551

 Score =   433 bits (1114),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 277/540 (51%), Positives = 350/540 (65%), Gaps = 32/540 (6%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVLIKLLQ+INS  VK+RGEYRSVLLQVISIVP +SGSELWP+ GFFIKVSDSS
Sbjct  22    MASLTPGVLIKLLQSINS-NVKVRGEYRSVLLQVISIVPVLSGSELWPNQGFFIKVSDSS  80

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV LS+ DN++ILNNKLQLGQ FYVDRME GTPVP+L+GVRP+PGRHPF G+PKDLM
Sbjct  81    HSTYVLLSREDNEIILNNKLQLGQFFYVDRMEAGTPVPILVGVRPVPGRHPFMGNPKDLM  140

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTT---  1218
             QM+E +   E  V+ +    S+  S  + +   ++  VIKEEKV VASRYM GV T+   
Sbjct  141   QMLELS---ESLVQADPEGTSSLKSRDSFDENPRQTFVIKEEKVAVASRYMHGVSTSNSK  197

Query  1217  -AQMKAKG---SDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDSTIIN  1050
              + + + G   +++NE+      +V  L G++  I        P  R  AL        +
Sbjct  198   PSAVDSNGGGKNNDNESGAKKVAMVQKLNGQECSI------APPHNRPGALALKAEVDAS  251

Query  1049  GVNTNTLPKR-------TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGML  891
                   +P R       ++KQE ++ N +SN   ++  S+  VLW SLP N +K GKGML
Sbjct  252   NTKKTXVPSRSTSAKRTSSKQETMNSNCLSNRKDKSN-SAESVLWPSLPANFMKLGKGML  310

Query  890   RMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK  711
             R + LASL+AAEAQ EA  A +L++CLSMF+DLCSSASP+NPH+S+ KFF LH LI+QP 
Sbjct  311   RRRNLASLVAAEAQKEASTAASLVKCLSMFSDLCSSASPDNPHISLNKFFILHQLIDQPN  370

Query  710   KA--LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARG  537
              A  L D     + +T  +  PD   L    G+  GK       +  +L GAEKLEWA+G
Sbjct  371   IAAPLKDGL---IPLTTKQLPPDVERLSKTTGLIHGKGTLKSSKVPAELSGAEKLEWAKG  427

Query  536   DGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEE-ANHIGLTL  360
             D  K   ELRE+L NE   WFL FL+ +LD GF++     K   S GR+ E  N I  TL
Sbjct  428   DSAKERAELREALVNEIRSWFLNFLEEALDSGFRLKTQEKKGKDSGGRRNEPENQIAATL  487

Query  359   SLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRSHRN*F  180
             S LK+ANEWLDK+    S E    +   V++LKQKVY CLL HV+SAA+AL+ RS RN F
Sbjct  488   SQLKKANEWLDKLKKSLSSENNIPVET-VDRLKQKVYICLLAHVESAATALENRSDRNSF  546



>ref|XP_008342435.1| PREDICTED: uncharacterized protein LOC103405235 isoform X2 [Malus 
domestica]
Length=550

 Score =   433 bits (1114),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 277/540 (51%), Positives = 350/540 (65%), Gaps = 32/540 (6%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVLIKLLQ+INS  VK+RGEYRSVLLQVISIVP +SGSELWP+ GFFIKVSDSS
Sbjct  21    MASLTPGVLIKLLQSINS-NVKVRGEYRSVLLQVISIVPVLSGSELWPNQGFFIKVSDSS  79

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV LS+ DN++ILNNKLQLGQ FYVDRME GTPVP+L+GVRP+PGRHPF G+PKDLM
Sbjct  80    HSTYVLLSREDNEIILNNKLQLGQFFYVDRMEAGTPVPILVGVRPVPGRHPFMGNPKDLM  139

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTT---  1218
             QM+E +   E  V+ +    S+  S  + +   ++  VIKEEKV VASRYM GV T+   
Sbjct  140   QMLELS---ESLVQADPEGTSSLKSRDSFDENPRQTFVIKEEKVAVASRYMHGVSTSNSK  196

Query  1217  -AQMKAKG---SDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDSTIIN  1050
              + + + G   +++NE+      +V  L G++  I        P  R  AL        +
Sbjct  197   PSAVDSNGGGKNNDNESGAKKVAMVQKLNGQECSI------APPHNRPGALALKAEVDAS  250

Query  1049  GVNTNTLPKR-------TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGML  891
                   +P R       ++KQE ++ N +SN   ++  S+  VLW SLP N +K GKGML
Sbjct  251   NTKKTXVPSRSTSAKRTSSKQETMNSNCLSNRKDKSN-SAESVLWPSLPANFMKLGKGML  309

Query  890   RMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK  711
             R + LASL+AAEAQ EA  A +L++CLSMF+DLCSSASP+NPH+S+ KFF LH LI+QP 
Sbjct  310   RRRNLASLVAAEAQKEASTAASLVKCLSMFSDLCSSASPDNPHISLNKFFILHQLIDQPN  369

Query  710   KA--LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARG  537
              A  L D     + +T  +  PD   L    G+  GK       +  +L GAEKLEWA+G
Sbjct  370   IAAPLKDGL---IPLTTKQLPPDVERLSKTTGLIHGKGTLKSSKVPAELSGAEKLEWAKG  426

Query  536   DGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEE-ANHIGLTL  360
             D  K   ELRE+L NE   WFL FL+ +LD GF++     K   S GR+ E  N I  TL
Sbjct  427   DSAKERAELREALVNEIRSWFLNFLEEALDSGFRLKTQEKKGKDSGGRRNEPENQIAATL  486

Query  359   SLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRSHRN*F  180
             S LK+ANEWLDK+    S E    +   V++LKQKVY CLL HV+SAA+AL+ RS RN F
Sbjct  487   SQLKKANEWLDKLKKSLSSENNIPVET-VDRLKQKVYICLLAHVESAATALENRSDRNSF  545



>ref|XP_002529183.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33197.1| conserved hypothetical protein [Ricinus communis]
Length=540

 Score =   431 bits (1109),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 278/553 (50%), Positives = 353/553 (64%), Gaps = 47/553 (8%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ++NS  +K+RGEYRSVLLQVISIVPA++GSELWP+ GFF+KVSDSS
Sbjct  1     MASLTPGVLLKLLQSMNS-NIKVRGEYRSVLLQVISIVPALTGSELWPNQGFFVKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS+ DN+LILNNKLQLGQ FYVDR+E GTPVP+L+GVRP+PGR+PF G+PKDLM
Sbjct  60    HSTYVSLSREDNELILNNKLQLGQFFYVDRIEAGTPVPILVGVRPLPGRNPFVGNPKDLM  119

Query  1388  QM-MEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQ  1212
             QM + + G +  + K  +  +             ++KIVIKEEK  VASRYMQGVLT++ 
Sbjct  120   QMVVPSEGPVPFDDKGVNG-SKLRELIEGKEENSRQKIVIKEEKAVVASRYMQGVLTSSP  178

Query  1211  MKAKGSDenenngggqgvvgG--------LRGKQQEIKVQ----ARPTTPSARSDALLTS  1068
              K  GSD N      +    G         +G+QQE K Q    A  +  S +  +   S
Sbjct  179   -KWSGSDSNGGGKSNETESNGSGNKKPGLAKGRQQENKGQLSGIAGTSNYSYQKSSESLS  237

Query  1067  DSTIINGVNTNTLP---------KRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNL  915
               + +   N    P            NKQE  ++N +S+N  +N L      W+SLPP+L
Sbjct  238   SKSEVAVSNVKEAPMLSRSKSAKSSLNKQETTNLNSLSSNADKNFLPETSS-WASLPPSL  296

Query  914   VKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFAL  735
             +KPGKGMLR + LASL+AAEAQ EA  A  L++CL+MFADL SSAS ENPHLS+TKFFAL
Sbjct  297   LKPGKGMLRRRYLASLVAAEAQKEASTAALLIKCLNMFADLRSSASLENPHLSLTKFFAL  356

Query  734   HALIEQPKKA---------LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppL  582
               LI+QP            L  +CF   +   +K+T  S+           K     P  
Sbjct  357   QQLIDQPNVTTPLKDKSLQLSTHCFIADTERTSKRTGLSH----------AKSTLKTPKS  406

Query  581   ELDLGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenks  402
              ++    EKLEWA+GDG K  KELRE++ NET  WFLKFL+ +L+VGF+V     K   S
Sbjct  407   SIESSSTEKLEWAKGDGAKEIKELREAVLNETRTWFLKFLEGALEVGFRVAIQEKKGKHS  466

Query  401   KGR--QEEANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV  228
              GR  + E NHI +TLS LK ANEWLDK+    +LE  + +   +++LKQKVY CLL HV
Sbjct  467   AGRRMEPENNHIAVTLSQLKHANEWLDKLRNNLNLENNNGLVETIDRLKQKVYACLLAHV  526

Query  227   DSAASALDTRSHR  189
             DSAASAL+ RS R
Sbjct  527   DSAASALENRSDR  539



>ref|XP_010061859.1| PREDICTED: uncharacterized protein LOC104449411 [Eucalyptus grandis]
 ref|XP_010061860.1| PREDICTED: uncharacterized protein LOC104449411 [Eucalyptus grandis]
 ref|XP_010061861.1| PREDICTED: uncharacterized protein LOC104449411 [Eucalyptus grandis]
 gb|KCW68891.1| hypothetical protein EUGRSUZ_F02476 [Eucalyptus grandis]
Length=533

 Score =   430 bits (1106),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 276/543 (51%), Positives = 356/543 (66%), Gaps = 34/543 (6%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ+I+S  VK+RGEYRSVLLQVISIVPA+SGSELWP+ GFF+KVSDSS
Sbjct  1     MASLTPGVLLKLLQSIHS-NVKVRGEYRSVLLQVISIVPALSGSELWPNQGFFVKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FYVDR E GTPVP+L+GVRPIPGR+PF G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILNNKLQLGQFFYVDRAEAGTPVPILVGVRPIPGRNPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKE---SAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTT  1218
             Q++E   E    ++ E   S K +        +   K+K VIKEEKV VASRYMQGVL +
Sbjct  120   QILEPP-EGPSPLQGEAISSTKLNEQTERKEKDETVKQKFVIKEEKVAVASRYMQGVLVS  178

Query  1217  AQMKAKGSDenenngggq----gvvgGLRGKQQEIKVQARPTT-PSARSDAL-LTSDSTI  1056
              ++    S+  +             G  R KQ E+K Q RP+T P +R +AL L  D+ I
Sbjct  179   HKVGESDSNGGKACESENGGSGKRAGLARCKQPELKDQTRPSTPPRSRPEALALKPDALI  238

Query  1055  IN----GVNTNTLPKRT-NKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGML  891
              N         ++PKR  +KQEN+  N +   N++ I SS  ++W+SLPP+L+K GK ML
Sbjct  239   PNMRDAAAPLKSMPKRAISKQENMHAN-LPPVNKERIYSSESMMWASLPPSLLKSGKEML  297

Query  890   RMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK  711
             + + +ASL+AAEAQ EA AA  L++CLSMF DL SS + E+PH S+TKFF LH LI+Q  
Sbjct  298   KRRNVASLVAAEAQKEASAAGTLIKCLSMFVDLSSSTAAEDPHGSLTKFFTLHQLIDQ--  355

Query  710   KALDDYCF---TKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWAR  540
               L+       T L ++ +  T              G+         L++   EKLEWA+
Sbjct  356   --LNQSTLLRNTVLPLSSHSPTTKIEKPNNNGVTTPGRGILKSSKPNLEITVTEKLEWAK  413

Query  539   GDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA--NHIGL  366
             GDG +  KE+R++L  ET  WFLKFL+  LD GF+ +   +K   + GR+ E   NHI +
Sbjct  414   GDGAREIKEMRQTLLQETECWFLKFLEGVLDTGFRASAPESKGKDAFGRRAETKNNHIAV  473

Query  365   TLSLLKQANEWLDKMMMRGSLELGSEMHGF----VEKLKQKVYGCLLVHVDSAASALDTR  198
             TLS LKQA+EWLD+   RG L+  S+  G     V++LKQKVY  LLVHV+SAA+AL+TR
Sbjct  474   TLSQLKQASEWLDR--FRGKLQ--SQNSGLQLETVDRLKQKVYSSLLVHVESAATALETR  529

Query  197   SHR  189
             S R
Sbjct  530   SDR  532



>ref|XP_009378365.1| PREDICTED: uncharacterized protein LOC103966867 [Pyrus x bretschneideri]
Length=550

 Score =   430 bits (1106),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 271/538 (50%), Positives = 343/538 (64%), Gaps = 26/538 (5%)
 Frame = -1

Query  1751  TMASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDS  1572
              MASLTPGVLIKLLQ+INS  VK+RGEYRSVLLQVISIVP +SGSELWP+ GFFIKVSDS
Sbjct  20    AMASLTPGVLIKLLQSINS-NVKVRGEYRSVLLQVISIVPVLSGSELWPNQGFFIKVSDS  78

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHSTYV LS+ DN++ILNNKLQLGQ FYVDRME GTPVP+L+GVRP+PGRHPF G+PKDL
Sbjct  79    SHSTYVLLSREDNEIILNNKLQLGQFFYVDRMEAGTPVPILVGVRPVPGRHPFMGNPKDL  138

Query  1391  MQMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTT-A  1215
             MQM+E +   E  V+ +    S+     + +   ++  VIKE+KV VASRYM GV T+ +
Sbjct  139   MQMLELS---ESLVQADPEGTSSLKLRDSIDENPRQTFVIKEDKVAVASRYMHGVSTSNS  195

Query  1214  QMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDSTIINGVNTN  1035
             +     S+    N   +     +   Q+ I        P  R  AL       ++     
Sbjct  196   KASTVDSNGGGKNNDNESGAKKVAMVQKLIGQGCSIVPPHNRPGALALKAEVDVSNTKKT  255

Query  1034  TLPKR-------TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKl  876
              +P R       ++KQE ++ N +SN   ++  ++  VLW SLP N +K GKGMLR + L
Sbjct  256   AVPSRSTSAKRTSSKQETMNSNCLSNRKDKSN-AAESVLWPSLPANFMKLGKGMLRRRNL  314

Query  875   asliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKA--L  702
             ASL+AAEAQ EA  A +L++CLSMF+DLCSSASP+NPH+S  KFF LH LI+QP  A  L
Sbjct  315   ASLVAAEAQKEASTAASLVKCLSMFSDLCSSASPDNPHISFNKFFILHQLIDQPNIAAPL  374

Query  701   DDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGLKA  522
              D     + +   +  PD   L    G+  GK       +  +L GAEKLEWA+GD +K 
Sbjct  375   KDSL---IPLPTKQLPPDDERLSKKTGLIHGKGTLKSLKVPAELSGAEKLEWAKGDSVKE  431

Query  521   TKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEE-ANHIGLTLSLLKQ  345
               ELRE+L NE   WFL FL+ +L+ GF++     K   S GR+ E  N I  TLS LK+
Sbjct  432   RAELREALVNEIRSWFLNFLEEALESGFRLKTQEKKGKDSGGRRNEPENQIAATLSQLKK  491

Query  344   ANEWLDKMMMRGSLELGSEMHGFVE---KLKQKVYGCLLVHVDSAASALDTRSHRN*F  180
             ANEWLDK+       L SE +  VE   +LKQKVY CLL HV+SAA+AL+ RS RN F
Sbjct  492   ANEWLDKLKN----SLSSENNILVETVDRLKQKVYICLLAHVESAATALENRSDRNSF  545



>gb|KEH17037.1| DUF936 family protein [Medicago truncatula]
Length=533

 Score =   428 bits (1100),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 267/549 (49%), Positives = 348/549 (63%), Gaps = 47/549 (9%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQT+NS  VK+RGE+RSVLLQVISIVPA+SGSELWP+HGFFIKVSDSS
Sbjct  1     MASLIPGVLLKLLQTMNS-NVKVRGEHRSVLLQVISIVPALSGSELWPNHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FY+D+ME GTPVPVL+ VRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILNNKLQLGQFFYIDKMEAGTPVPVLVSVRPVPGRHPFEGNPKDLM  119

Query  1388  QMMEAA-GEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVL----  1224
             QMME++   M  E        S     +  N+  ++KIVIKEEKV VASRYM+GVL    
Sbjct  120   QMMESSESRMHPENDGVDGSKSTDKIEAKENTSSRQKIVIKEEKVSVASRYMKGVLNPNS  179

Query  1223  ----TTAQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPS-ARSDALLTS---  1068
                 +   + +KG+D      G +      +GKQ EIK Q  PTT +  R +AL T    
Sbjct  180   KVNASDTNIGSKGNDFENGVDGRKMGST--KGKQLEIKGQVPPTTSTRTRFEALSTKQDI  237

Query  1067  -----DSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHP--VLWSSLPPNLVK  909
                    T+I    + +    + KQEN+++NF+S++  +   S++P  + WS+LP NL+K
Sbjct  238   SQSNIQETVIKPSKSTSAKHSSTKQENLNLNFLSHSQEK---SNYPETISWSALPANLLK  294

Query  908   PGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHA  729
             PGKG+LR K+LAS +A EAQ EA  A  +++CLS FA++CSSA+ ENPH+ + KFFAL  
Sbjct  295   PGKGILRRKQLASQVAIEAQKEASEAAKIIKCLSTFANICSSAASENPHVILDKFFALLQ  354

Query  728   LIEQPKKALDDYCFTKLSV----TDNKKTPDSNHlgigigigkgklkpskppLEL-DLGG  564
             L+++P         T+L      + N ++P   H              SK    L +L G
Sbjct  355   LMDRPNGT------TQLKAESLESHNIQSPAEKHKYGKKAGLAHAKNTSKTAKSLPELSG  408

Query  563   AEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQ--VnnnnnkenksKGRQ  390
              EK EWA+ +G+K   EL+E   NET  WF+K+L+ +LD GF         +     GR+
Sbjct  409   NEKQEWAKENGIKQINELKEVFLNETRSWFIKYLEKTLDAGFSRVFQEKGKESKVIAGRE  468

Query  389   -EEANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVE---KLKQKVYGCLLVHVDS  222
                ANHI +TLS LK ANEWL+ +       L SE  G VE   +LKQK+Y  LLVH+DS
Sbjct  469   MAHANHIAVTLSHLKNANEWLENLRR----ALNSESDGLVETIDRLKQKIYSSLLVHIDS  524

Query  221   AASALDTRS  195
             AA AL+ R+
Sbjct  525   AAVALENRA  533



>ref|XP_007139071.1| hypothetical protein PHAVU_009G262500g [Phaseolus vulgaris]
 gb|ESW11065.1| hypothetical protein PHAVU_009G262500g [Phaseolus vulgaris]
Length=530

 Score =   427 bits (1098),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 272/543 (50%), Positives = 347/543 (64%), Gaps = 38/543 (7%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ++NS  VK+RGEYRSVLLQVISIVPA+SGSELWP+ GFFIKVSDSS
Sbjct  1     MASLVPGVLLKLLQSMNS-NVKVRGEYRSVLLQVISIVPALSGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DNDLILNNKLQLGQ FYVDRME GTPVP+L+GVRPIPGRHPF G+PKDLM
Sbjct  60    HSTYVSLSKEDNDLILNNKLQLGQFFYVDRMEAGTPVPILVGVRPIPGRHPFEGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
             QM+E +     +    +   S   + +  N   ++KIVIKEEK+GVASRYMQGVL     
Sbjct  120   QMLEQSENSHND--GVNGSKSTDLTEAKENPSSRQKIVIKEEKLGVASRYMQGVL-NPNS  176

Query  1208  KAK------GSDenenngggqgvvgGLRGKQQEIKVQARPTTPSA--------RSDALLT  1071
             KA       GS  +   G     VG  +G+Q EIK Q  P T +A        + D   +
Sbjct  177   KANVPEANVGSKNDLEIGVDGKKVGSAKGRQLEIKGQVLPMTQTATRLEALSPKQDVTQS  236

Query  1070  SDSTIINGVNTNTLPKRTN--KQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKG  897
             +   ++   +  T  K ++  KQEN+++N +S    ++  S+  + WSSLP  L++PGK 
Sbjct  237   NIREVVTAPSMRTSAKHSSSTKQENLNMNLLSRAKDKS-KSTETIPWSSLPAKLLRPGKV  295

Query  896   MLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQ  717
             +LR K LAS +  +AQ EA AA   ++CLSMFA++CSSAS ENPH ++ KFFAL  L++Q
Sbjct  296   ILRRKHLASQVVVQAQKEASAATTTVKCLSMFANICSSASSENPHATLNKFFALQQLMDQ  355

Query  716   PKKA--LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLEL-DLGGAEKLEW  546
             P  A  L+D       ++    TP   H  +           +K P  L +L G +K EW
Sbjct  356   PNGAAQLNDKSLQLYRIS----TPLEKHKSVSTAGLMPAKNTAKSPKPLTELSGTDKQEW  411

Query  545   ARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenks--KGRQ-EEANH  375
             A+G G+K   EL E L NET  WFL +L+ +LD GF V ++   ++     GRQ E+AN+
Sbjct  412   AKGGGMKEINELGELLLNETRSWFLIYLEKTLDAGFSVGSSEKGKDSKDIAGRQIEQANN  471

Query  374   IGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVE---KLKQKVYGCLLVHVDSAASALD  204
             I LTLS LK ANEWLDK     +    +E  G VE   +LKQKVY CLLVH+DSAA AL 
Sbjct  472   IALTLSHLKHANEWLDKQRSSSN----TESEGLVETVDRLKQKVYSCLLVHIDSAALALG  527

Query  203   TRS  195
              R+
Sbjct  528   NRA  530



>gb|KGN47776.1| hypothetical protein Csa_6G401460 [Cucumis sativus]
Length=534

 Score =   427 bits (1097),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 262/538 (49%), Positives = 351/538 (65%), Gaps = 23/538 (4%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PG+L+KLLQ++NS  VK+RGEYRSVLLQVISIVPA++GSELWP+ GFF+KVSDSS
Sbjct  1     MASLIPGILLKLLQSMNS-NVKVRGEYRSVLLQVISIVPALNGSELWPNQGFFVKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS+PDN+LILNNKLQLGQ FYVD+MEPGTPVPVL+G+RP+PGR P  G+PKDLM
Sbjct  60    HSTYVSLSRPDNELILNNKLQLGQFFYVDKMEPGTPVPVLVGIRPVPGRQPCIGTPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
             QMME +       ++          +       + K+VIKEEK  V+SRYMQGVL+ +  
Sbjct  120   QMMEPSENPVQAYQEGKGGAKPKEMSEGKIDSMRHKVVIKEEKTNVSSRYMQGVLSLSSR  179

Query  1208  K--------AKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDSTII  1053
                       + ++  +   G + VVG ++GK  ++K Q +      R D + +    + 
Sbjct  180   SGRFDSSAVGRSNENEDGEAGKKVVVGPVKGKSNDLKGQVQAANLQNRLDEVSSKTEALQ  239

Query  1052  NGV-----NTNTLPKR--TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGM  894
               V     ++ ++P +  + KQEN++VN +  N R    SS  + W+SLP NL+K GKGM
Sbjct  240   LSVKEASASSKSIPAKGSSTKQENLNVNCLP-NRRDKTHSSETISWASLPSNLLKTGKGM  298

Query  893   LRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQP  714
             +R K +AS++A EAQ EA+AA +L++CLS+FADLCSSASPENP L +TKFF L  LI + 
Sbjct  299   VRRKNIASMVAIEAQKEAIAAASLIKCLSVFADLCSSASPENPQLPLTKFFTLQQLISE-  357

Query  713   KKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpsk-ppLELDLGGAEKLEWARG  537
               + D      L +T N   P++N    G  +   K   SK     ++L  +EK EWARG
Sbjct  358   TNSKDGVKDKSLLLTANSSLPEANKSTKGSSLFMSKNASSKPAKAPIELRDSEKQEWARG  417

Query  536   DGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NHIGLTL  360
             DG K    LR+ L  E+  WFL FL+ +LD GF++ N + K   + G+Q EA NHI + L
Sbjct  418   DGAKEITLLRDVLLKESTTWFLNFLEKALDAGFRIGNQDKKGRNNAGQQTEAGNHIAVAL  477

Query  359   SLLKQANEWLDKMMMRGSLELGSE-MHGFVEKLKQKVYGCLLVHVDSAASALDTRSHR  189
             S LKQANEWLD+  ++ +L  G   +   +E+LKQKVY CLLVHV+SAASAL+ R  R
Sbjct  478   SQLKQANEWLDR--LKDNLSSGDNGLRESIERLKQKVYSCLLVHVESAASALEGRFDR  533



>ref|XP_008464802.1| PREDICTED: uncharacterized protein LOC103502603 isoform X1 [Cucumis 
melo]
Length=534

 Score =   426 bits (1095),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 260/538 (48%), Positives = 350/538 (65%), Gaps = 23/538 (4%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ++NS  VK+RGEYRSVLLQVISIVPA++GSELWP+ GFF+KVSDSS
Sbjct  1     MASLIPGVLLKLLQSMNS-NVKVRGEYRSVLLQVISIVPALNGSELWPNQGFFVKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS+ DN+LILNNKLQLGQ FYVD+MEPGTPVP+L+G+RP+PGR PF G+PKDLM
Sbjct  60    HSTYVSLSRQDNELILNNKLQLGQFFYVDKMEPGTPVPILVGIRPVPGRQPFIGTPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
             QMME +  +    ++  +       +       + K+VIKEEK+ V+SRYMQGVL+ +  
Sbjct  120   QMMEQSENLVQAYQEGKSGAKPKEMSEGKIESIRHKVVIKEEKINVSSRYMQGVLSLSSR  179

Query  1208  KA--------KGSDenenngggqgvvgGLRGKQQEIKVQARPTT-------PSARSDALL  1074
                       + ++  +  GG +  VG ++GK  ++K Q +           S++++AL 
Sbjct  180   SGRFDSNAVRRSNENEDGEGGKKVAVGAVKGKSNDLKGQVQAANLQNGLDEVSSKTEALQ  239

Query  1073  TSDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGM  894
              S         +      + KQEN++VN +  N R    SS  + W+SLP NL+K GKGM
Sbjct  240   LSVKEASGSSRSIPAKGTSTKQENLNVNCLP-NRRDKTHSSETISWASLPTNLLKTGKGM  298

Query  893   LRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQP  714
             +R + +AS++A EAQ EA+AA +L++CLS+FADLCSSASPENP L +TKFF L  LI + 
Sbjct  299   VRRRNIASMVAIEAQKEAIAAASLIKCLSVFADLCSSASPENPQLPLTKFFTLQQLISET  358

Query  713   KKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpsk-ppLELDLGGAEKLEWARG  537
               + D      L +T N   P++N    G  +   K   SK     ++L  +EK EWARG
Sbjct  359   -NSKDGVKDKSLLLTANSSLPEANKSTKGSSLFMSKSASSKPAKAPIELRESEKQEWARG  417

Query  536   DGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQ-EEANHIGLTL  360
             DG K    LR+ L  E+  WFL FL+ +LD GF++ N + K   + G+Q E  NHI + L
Sbjct  418   DGAKEITLLRDVLLKESTSWFLNFLEKALDAGFRIGNQDKKGRNNAGQQIEVGNHIAVAL  477

Query  359   SLLKQANEWLDKMMMRGSLELGSE-MHGFVEKLKQKVYGCLLVHVDSAASALDTRSHR  189
             S LKQANEWLD+  ++ +L  G   +   +E+LKQKVY CLLVHV+SAASAL+ R  R
Sbjct  478   SQLKQANEWLDR--LKDNLNSGDNGLREAIERLKQKVYSCLLVHVESAASALEGRFDR  533



>ref|XP_004146764.1| PREDICTED: uncharacterized protein LOC101211274 [Cucumis sativus]
Length=520

 Score =   424 bits (1091),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 265/533 (50%), Positives = 348/533 (65%), Gaps = 27/533 (5%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PG+L+KLLQ++NS  VK+RGEYRSVLLQVISIVPA++GSELWP+ GFF+KVSDSS
Sbjct  1     MASLIPGILLKLLQSMNS-NVKVRGEYRSVLLQVISIVPALNGSELWPNQGFFVKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS+PDN+LILNNKLQLGQ FYVD+MEPGTPVPVL+G+RP+PGR P  G+PKDLM
Sbjct  60    HSTYVSLSRPDNELILNNKLQLGQFFYVDKMEPGTPVPVLVGIRPVPGRQPCIGTPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
             QMME +       ++          +       + K+VIKEEK  V+SRYMQGVL+ +  
Sbjct  120   QMMEPSENPVQAYQEGKGGAKPKEMSEGKIDSMRHKVVIKEEKTNVSSRYMQGVLSLSSR  179

Query  1208  K--------AKGSDenenngggqgvvgGLRGKQQEIK--VQARPTTPSARSDALLTSDST  1059
                       + ++  +   G + VVG ++GK  ++K  VQ      S + +A  +S S 
Sbjct  180   SGRFDSSAVGRSNENEDGEAGKKVVVGPVKGKSNDLKGQVQTEALQLSVK-EASASSKSI  238

Query  1058  IINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKK  879
                G +T        KQEN++VN +  N R    SS  + W+SLP NL+K GKGM+R K 
Sbjct  239   PAKGSST--------KQENLNVNCLP-NRRDKTHSSETISWASLPSNLLKTGKGMVRRKN  289

Query  878   lasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALD  699
             +AS++A EAQ EA+AA +L++CLS+FADLCSSASPENP L +TKFF L  LI +   + D
Sbjct  290   IASMVAIEAQKEAIAAASLIKCLSVFADLCSSASPENPQLPLTKFFTLQQLISE-TNSKD  348

Query  698   DYCFTKLSVTDNKKTPDSNHlgigigigkgklkpsk-ppLELDLGGAEKLEWARGDGLKA  522
                   L +T N   P++N    G  +   K   SK     ++L  +EK EWARGDG K 
Sbjct  349   GVKDKSLLLTANSSLPEANKSTKGSSLFMSKNASSKPAKAPIELRDSEKQEWARGDGAKE  408

Query  521   TKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NHIGLTLSLLKQ  345
                LR+ L  E+  WFL FL+ +LD GF++ N + K   + G+Q EA NHI + LS LKQ
Sbjct  409   ITLLRDVLLKESTTWFLNFLEKALDAGFRIGNQDKKGRNNAGQQTEAGNHIAVALSQLKQ  468

Query  344   ANEWLDKMMMRGSLELGSE-MHGFVEKLKQKVYGCLLVHVDSAASALDTRSHR  189
             ANEWLD+  ++ +L  G   +   +E+LKQKVY CLLVHV+SAASAL+ R  R
Sbjct  469   ANEWLDR--LKDNLSSGDNGLRESIERLKQKVYSCLLVHVESAASALEGRFDR  519



>ref|XP_004168096.1| PREDICTED: uncharacterized LOC101211274 [Cucumis sativus]
Length=520

 Score =   424 bits (1090),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 265/533 (50%), Positives = 348/533 (65%), Gaps = 27/533 (5%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PG+L+KLLQ++NS  VK+RGEYRSVLLQVISIVPA++GSELWP+ GFF+KVSDSS
Sbjct  1     MASLIPGILLKLLQSMNS-NVKVRGEYRSVLLQVISIVPALNGSELWPNQGFFVKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS+PDN+LILNNKLQLGQ FYVD+MEPGTPVPVL+G+RP+PGR P  G+PKDLM
Sbjct  60    HSTYVSLSRPDNELILNNKLQLGQFFYVDKMEPGTPVPVLVGIRPVPGRQPCIGTPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
             QMME +       ++          +       + K+VIKEEK  V+SRYMQGVL+ +  
Sbjct  120   QMMEPSENPVQAYQEGKGGAKPKEMSEGKIDSMRHKVVIKEEKTNVSSRYMQGVLSLSSR  179

Query  1208  K--------AKGSDenenngggqgvvgGLRGKQQEIK--VQARPTTPSARSDALLTSDST  1059
                       + ++  +   G + VVG ++GK  ++K  VQ      S + +A  +S S 
Sbjct  180   SGRFDSSAVGRSNENEDGEAGKKVVVGPVKGKSNDLKGQVQTEALQLSVK-EASASSKSI  238

Query  1058  IINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKK  879
                G +T        KQEN++VN +  N R    SS  + W+SLP NL+K GKGM+R K 
Sbjct  239   PAKGSST--------KQENLNVNCLP-NRRDKTHSSETISWASLPSNLLKTGKGMVRRKN  289

Query  878   lasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALD  699
             +AS++A EAQ EA+AA +L++CLS+FADLCSSASPENP L +TKFF L  LI +   + D
Sbjct  290   IASMVAIEAQKEAIAAASLIKCLSVFADLCSSASPENPQLPLTKFFTLQQLISE-TNSKD  348

Query  698   DYCFTKLSVTDNKKTPDSNHlgigigigkgklkpsk-ppLELDLGGAEKLEWARGDGLKA  522
                   L +T N   P++N    G  +   K   SK     ++L  +EK EWARGDG K 
Sbjct  349   GVKDKSLLLTANSSLPEANKSTKGSSLFMSKNASSKPAKAPIELRDSEKQEWARGDGAKE  408

Query  521   TKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NHIGLTLSLLKQ  345
                LR+ L  E+  WFL FL+ +LD GF++ N + K   + G+Q EA NHI + LS LKQ
Sbjct  409   ITLLRDVLLKESTTWFLNFLEKALDAGFRIGNQDKKGRNNAGQQTEAGNHIAVALSQLKQ  468

Query  344   ANEWLDKMMMRGSLELGSE-MHGFVEKLKQKVYGCLLVHVDSAASALDTRSHR  189
             ANEWLD+  ++ +L  G   +   +E+LKQKVY CLLVHV+SAASAL+ R  R
Sbjct  469   ANEWLDR--LKDNLSSGDNGLREAIERLKQKVYSCLLVHVESAASALEGRFDR  519



>gb|KHN16378.1| hypothetical protein glysoja_033782 [Glycine soja]
Length=527

 Score =   422 bits (1086),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 268/542 (49%), Positives = 339/542 (63%), Gaps = 39/542 (7%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ++NS  VK+RGEYRSVLLQVISIVP++SGSELWP+ GFFIKVSDSS
Sbjct  1     MASLVPGVLLKLLQSMNS-NVKVRGEYRSVLLQVISIVPSLSGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+ ILNNKLQLGQ FYVDR+E GTPVP L+GVRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSKDDNEFILNNKLQLGQFFYVDRIEAGTPVPTLVGVRPVPGRHPFEGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVL-----  1224
             Q++E     + +    +   S   + +  N   ++KIVIKEEKVGVASRYMQGVL     
Sbjct  120   QILE-----QSDNDGVNGSKSMDLTEAKENPSSRQKIVIKEEKVGVASRYMQGVLNPNSR  174

Query  1223  ---TTAQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSA-RSDALLTSD---  1065
                    + +KG+D        +      +GKQ EIK Q  P TP+  R +AL       
Sbjct  175   VNGADTNIGSKGNDSENGVDSKKVESS--KGKQLEIKGQVLPITPTGTRLEALSPKQDIP  232

Query  1064  -----STIINGVNTNTLPKRTNKQENVDVNFMSN-NNRQNILSSHPVLWSSLPPNLVKPG  903
                   T+I      +    + KQEN+++N +S   ++ N   + P  WS+LP  L+KPG
Sbjct  233   QCNIRETVIAPSKRTSAKHSSTKQENLNMNLLSRGKDKSNNTEAIP--WSALPVKLLKPG  290

Query  902   KGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALI  723
             K +LR K LAS +  EAQ EA AA ++++CLSMFA++CSSAS ENPH ++ KFFAL  L+
Sbjct  291   KVILRRKHLASQVVVEAQKEASAAASIVKCLSMFANICSSASSENPHATLNKFFALQQLM  350

Query  722   EQPKKA--LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLEL-DLGGAEKL  552
             +QP     L D       +     TP   H              SK P  L +L   EK 
Sbjct  351   DQPNGTTQLKDKPIQLYKIP----TPAEKHKSGKTAGVMPVKSTSKSPKPLNELSRTEKQ  406

Query  551   EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnn--nkenksKGRQ-EEA  381
             EWA+ DG K   EL+E L NET  WFL +L+  LD GF V +     +   + GRQ E+A
Sbjct  407   EWAKEDGTKKINELKEVLLNETRSWFLMYLEKILDAGFSVGSQEMGKESKDNAGRQMEQA  466

Query  380   NHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDT  201
             NHI LTLS LK ANEWLDK+    + E   E+   V++LKQKVY CLLVH+DSAA AL+ 
Sbjct  467   NHIALTLSHLKHANEWLDKLRSSSNTE-SEELVETVDRLKQKVYSCLLVHIDSAALALEN  525

Query  200   RS  195
             R+
Sbjct  526   RA  527



>ref|XP_003520895.2| PREDICTED: uncharacterized protein LOC100785776 [Glycine max]
Length=542

 Score =   421 bits (1082),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 268/542 (49%), Positives = 339/542 (63%), Gaps = 39/542 (7%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ++NS  VK+RGEYRSVLLQVISIVP++SGSELWP+ GFFIKVSDSS
Sbjct  16    MASLVPGVLLKLLQSMNS-NVKVRGEYRSVLLQVISIVPSLSGSELWPNQGFFIKVSDSS  74

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+ ILNNKLQLGQ FYVDR+E GTPVP L+GVRP+PGRHPF G+PKDLM
Sbjct  75    HSTYVSLSKDDNEFILNNKLQLGQFFYVDRIEAGTPVPTLVGVRPVPGRHPFEGNPKDLM  134

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVL-----  1224
             Q++E     + +    +   S   + +  N   ++KIVIKEEKVGVASRYMQGVL     
Sbjct  135   QILE-----QSDNDGVNGSKSMDLTEAKENPSSRQKIVIKEEKVGVASRYMQGVLNPNSR  189

Query  1223  ---TTAQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSA-RSDALLTSD---  1065
                    + +KG+D        +      +GKQ EIK Q  P TP+  R +AL       
Sbjct  190   VNGADTNIGSKGNDSENGVDSKKVESS--KGKQLEIKGQVLPITPTGTRLEALSPKQDIP  247

Query  1064  -----STIINGVNTNTLPKRTNKQENVDVNFMSN-NNRQNILSSHPVLWSSLPPNLVKPG  903
                   T+I      +    + KQEN+++N +S   ++ N   + P  WS+LP  L+KPG
Sbjct  248   QCNIRETVIAPSKRTSAKHSSTKQENLNMNLLSRGKDKSNNTEAIP--WSALPVKLLKPG  305

Query  902   KGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALI  723
             K +LR K LAS +  EAQ EA AA ++++CLSMFA++CSSAS ENPH ++ KFFAL  L+
Sbjct  306   KVILRRKHLASQVVVEAQKEASAAASIVKCLSMFANICSSASSENPHATLNKFFALQQLM  365

Query  722   EQPKKA--LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLEL-DLGGAEKL  552
             +QP     L D       +     TP   H              SK P  L +L   EK 
Sbjct  366   DQPNGTTQLKDKPIQLYKIP----TPAEKHKSGKTAGVMPVKSTSKSPKPLNELSRTEKQ  421

Query  551   EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnn--nkenksKGRQ-EEA  381
             EWA+ DG K   EL+E L NET  WFL +L+  LD GF V +     +   + GRQ E+A
Sbjct  422   EWAKEDGTKKINELKEVLLNETRSWFLMYLEKILDAGFSVGSQEMGKESKDNAGRQMEQA  481

Query  380   NHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDT  201
             NHI LTLS LK ANEWLDK+    + E   E+   V++LKQKVY CLLVH+DSAA AL+ 
Sbjct  482   NHIALTLSHLKHANEWLDKLRSSSNTE-SEELVETVDRLKQKVYSCLLVHIDSAALALEN  540

Query  200   RS  195
             R+
Sbjct  541   RA  542



>ref|XP_006342941.1| PREDICTED: uncharacterized protein LOC102603463 [Solanum tuberosum]
Length=518

 Score =   414 bits (1064),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 280/537 (52%), Positives = 349/537 (65%), Gaps = 47/537 (9%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVLIKLLQ+++S   K+RGEYRS+LLQVISIVPA++GSELWP+HGFF+KVSDSS
Sbjct  1     MAALVPGVLIKLLQSMHS-NKKVRGEYRSILLQVISIVPALNGSELWPNHGFFVKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYVTLSK +N+LILNNKLQLGQLFYV+RMEPGTPVPVL+GVRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVTLSKEENELILNNKLQLGQLFYVERMEPGTPVPVLVGVRPLPGRHPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
             QM+E +       +++   +  + S   + +  K K VIKE+K  VASRYM+GVL T+  
Sbjct  120   QMLEPSEVTVRNAQEDVNGSKLNESPELNKADTKNKFVIKEQKTVVASRYMRGVL-TSNT  178

Query  1208  KAKGSDe-------nenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDSTIIN  1050
             K  G D+          + G       L+ KQ E+K Q R +TP  RS     SD+ +IN
Sbjct  179   KIGGLDQGTGVKGIENESSGAAKKAVPLKEKQCELKGQTRSSTP-FRSQ----SDAFVIN  233

Query  1049  -GVNTN-------TLPKRTNKQENVDVNFMSNNNRQNILSSHPVL-WSSLPPNLVKPGKG  897
              G+N +       TL   T+KQE++         R+N  SS   + WSSLP NL KPGKG
Sbjct  234   SGINKHMKTPIFSTLKLTTSKQESI---------RENSQSSEAYMPWSSLPTNLAKPGKG  284

Query  896   MLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQ  717
             +LR   LASL+AAEAQ EA  A  LL CL MFA+LC+SASPE PH+S++KFF L+ LIE 
Sbjct  285   ILRRGLLASLVAAEAQEEAKEAAKLLHCLRMFAELCTSASPECPHISLSKFFTLNNLIEL  344

Query  716   P-----KKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKL  552
             P     K+   D   TKLSV +  K       G       GK         ++L GAEKL
Sbjct  345   PSTVKTKELTPDNFATKLSVHEKVK------EGKMTCFLNGKATSKSLKPSVELSGAEKL  398

Query  551   EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NH  375
             EWA+GDG K   ELRE L NE   WFLKFL+ +L+VGF  N    K   S  RQ E+ N 
Sbjct  399   EWAKGDGSKDIVELRELLLNEIQSWFLKFLEGALEVGFWQNKQEQKTKVSVPRQTESKNQ  458

Query  374   IGLTLSLLKQANEWLDKMMMRGSL-ELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
             I  TLS LK ANEWLDK  +R +L    + +   V++LKQK+Y CLL+++DSAASAL
Sbjct  459   IAFTLSQLKHANEWLDK--VRSTLCSDKNNVADRVDRLKQKLYTCLLLYLDSAASAL  513



>ref|XP_004506285.1| PREDICTED: uncharacterized protein LOC101502265 isoform X1 [Cicer 
arietinum]
 ref|XP_004506286.1| PREDICTED: uncharacterized protein LOC101502265 isoform X2 [Cicer 
arietinum]
Length=533

 Score =   413 bits (1062),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 268/542 (49%), Positives = 347/542 (64%), Gaps = 33/542 (6%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQT++S  VK+RGEYRSVLLQVISIVPA+SGSELWP+ GFFIKVSDSS
Sbjct  1     MASLIPGVLLKLLQTMDS-NVKVRGEYRSVLLQVISIVPALSGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FYVD++EPGTPVPVL+G+RP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILNNKLQLGQFFYVDKIEPGTPVPVLVGIRPVPGRHPFEGNPKDLM  119

Query  1388  QMMEAA-GEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQ  1212
             QM+E++ G    E     +K+++    +  N+  ++KIVIKEEKVGV+SRYMQGV+    
Sbjct  120   QMLESSEGRTHPENGVNGSKSTDIIIEAKENTSSRQKIVIKEEKVGVSSRYMQGVV-NPN  178

Query  1211  MKAKGSDenenngggqg-------vvgGLRGKQQEIKVQARPTTPS-ARSDALLT-SDST  1059
             +K    D N  +             VG  +GKQQEIK Q   TT +  R +A  T  D  
Sbjct  179   LKVNFPDTNVGSKVNDSENGVDGKKVGSTKGKQQEIKGQVLQTTSTRTRLEAFSTKQDVA  238

Query  1058  IINGVNTNTLP------KRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKG  897
               N   T  LP      KR++ +         +NN+   + +  + WS+LP  L++PGKG
Sbjct  239   QSNIQETAMLPSKSTSIKRSSTKHENSNLNFLSNNQDKRICNETISWSNLPAKLLRPGKG  298

Query  896   MLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQ  717
             +LR K+LAS +  EAQ EA  A  +++CLSMFA++CSSA+ ENPH+++ KFFAL   +EQ
Sbjct  299   ILRRKQLASQVVVEAQKEASEAAKIVKCLSMFANICSSAASENPHVTLEKFFALQQFMEQ  358

Query  716   PKKALDDYCFTKLSVTDNK-KTPDSNHlgigigigkgklkpskppLEL-DLGGAEKLEWA  543
             P            S+  +K ++P   H              SK P  L +L   EK EWA
Sbjct  359   PNGTTQSKS---KSIQLHKIQSPAEKHKNGKTAGLVHAKSTSKSPKPLTELSITEKQEWA  415

Query  542   RGDGLKATKELRESLSNETHLWFLKFLDASLDVGF--QVnnnnnkenksKGRQ-EEANHI  372
             + +G+K   EL+E L NET  WF+++L+ +LDVGF         +     GRQ  +ANHI
Sbjct  416   KENGIKQINELKEVLLNETRSWFIRYLENTLDVGFPRAFQEKGKESKDVAGRQMAQANHI  475

Query  371   GLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVE---KLKQKVYGCLLVHVDSAASALDT  201
              LTLS LK ANEWL+K  +R S  L SE  G VE   +LKQK+Y  LL+HVDSAA AL+ 
Sbjct  476   ALTLSHLKHANEWLEK--LRSS--LNSENEGLVETIDRLKQKIYSSLLLHVDSAAFALEN  531

Query  200   RS  195
             R+
Sbjct  532   RA  533



>ref|XP_010685263.1| PREDICTED: uncharacterized protein LOC104899717 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010685264.1| PREDICTED: uncharacterized protein LOC104899717 [Beta vulgaris 
subsp. vulgaris]
Length=571

 Score =   409 bits (1051),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 269/579 (46%), Positives = 356/579 (61%), Gaps = 66/579 (11%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ I+S  VK+RGEYRSVLLQVISIVPA+SG ELWP+HGFF+KVSDSS
Sbjct  1     MASLTPGVLLKLLQNIDS-KVKVRGEYRSVLLQVISIVPALSGGELWPNHGFFLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK D +LILNNKLQLGQ FYVDR+E GTPVP ++GVRP+PGR+PF G+PKDLM
Sbjct  60    HSTYVSLSKEDIELILNNKLQLGQFFYVDRLEAGTPVPTIVGVRPLPGRNPFIGNPKDLM  119

Query  1388  QMMEAA-GEMECEVKK-ESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTA  1215
             Q+ + + G +  +     +   ++  S + S S +  ++VIKEEK GV+SRYM G +T  
Sbjct  120   QIFDPSQGPVRVDSNSVGNGSKTSRTSETKSMSSRVHRLVIKEEKSGVSSRYMDGFVTHH  179

Query  1214  QMKAKGSDenenng----------ggqgvvgGLRGKQQEIKV-----------QARPTTP  1098
             ++ +  S   +++             +  V   +G+ Q +             +ARPTTP
Sbjct  180   RVSSSDSISMKSSDPECFGGGKVGASKARVHESKGQWQSLPATPNNSRPVTPSRARPTTP  239

Query  1097  S-----------------ARSDALL----TSDSTIINGVNTNTLPKRTNKQENVDVNFMS  981
             S                  R D+ L     S    +  + T T  K  +KQEN+++N  +
Sbjct  240   SRVRPTVPSRPRPMTPTRTRPDSTLEAKFESAREKLQSIKTTTR-KSVSKQENINLNCST  298

Query  980   NNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMF  801
             N   +N  S     W+SLP +L+KPGK ML+ + LASL+AAEAQ EA AA  L++C+ MF
Sbjct  299   NGKDKNQTSEQTSPWNSLPASLLKPGKVMLKRRDLASLVAAEAQKEATAATILVKCIDMF  358

Query  800   ADLCSSASPENPHLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKKTPDSN--Hlgig  627
             ADLCS ASP NPH+S+TKFFAL+ +++Q   + +      L +  N  +P SN  + GI 
Sbjct  359   ADLCSCASPTNPHVSLTKFFALYQVMDQSGSSKEKL----LIIQTNSSSPTSNKPNTGIT  414

Query  626   igigkgklkpskppLELDLGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLD  447
                   K+        L+L  A+KLEW++G G    K++RE+L  ET  WFLKFLD +LD
Sbjct  415   TQPLNPKINTKISKRPLELSLADKLEWSKGHGTTEIKDIRETLLKETRSWFLKFLDVALD  474

Query  446   VGFQVnnnnnkenksKGRQ--EEANHIGLTLSLLKQANEWLDKMMMRGSLE-------LG  294
              GF+V           GR+  E  NHI LTLS LKQANEWLDK  ++GS+        L 
Sbjct  475   TGFRVPEIRKSNADHSGRRSLEPNNHIALTLSQLKQANEWLDK--LKGSMSSSNNNTALS  532

Query  293   SEMHGF---VEKLKQKVYGCLLVHVDSAASALDTRSHRN  186
              +  G    V+KLK+KVY CLLVH+DSAASAL+ RS  N
Sbjct  533   DDNDGISERVDKLKKKVYACLLVHIDSAASALENRSDHN  571



>ref|XP_004235566.1| PREDICTED: uncharacterized protein LOC101257349 [Solanum lycopersicum]
Length=518

 Score =   404 bits (1037),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 278/537 (52%), Positives = 344/537 (64%), Gaps = 47/537 (9%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVLIKLLQ ++S   K+RGE+RSVLLQVISIVPA++GSELWP+HGFFIKVSDSS
Sbjct  1     MAALVPGVLIKLLQNMHS-NKKVRGEHRSVLLQVISIVPALNGSELWPNHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYVTLSK +N+ ILNNKLQLGQ FYV+RMEPGTPVPVL+GVR +PGRHPF G+PKDLM
Sbjct  60    HSTYVTLSKEENEFILNNKLQLGQFFYVERMEPGTPVPVLVGVRRLPGRHPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
             QM+E +       +++   +  + S   +    K K VIKE+K  VASRYM+GVLT+   
Sbjct  120   QMLEPSEVTVRNAQEDVNGSKLNESPELNKEDSKNKFVIKEQKTVVASRYMRGVLTS-NT  178

Query  1208  KAKGSDe-------nenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDSTIIN  1050
             K  G D+          N G       L+ KQ E+K Q R +TP  RS     SD+ +IN
Sbjct  179   KIGGLDQGTGVKGIENENRGAAKKAVPLKEKQCELKGQTRSSTP-FRSQ----SDAFVIN  233

Query  1049  -GVNTN-------TLPKRTNKQENVDVNFMSNNNRQNILSSHPVL-WSSLPPNLVKPGKG  897
              G+N +       TL   T+KQE++         R+N  SS   + WSSLP NL KPGKG
Sbjct  234   SGINKHMKTPRFSTLKLTTSKQESI---------RENSQSSEAYMPWSSLPTNLAKPGKG  284

Query  896   MLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQ  717
             +LR   LASL+AAEAQ EA  A  LL CL MFA+LC+SASPE PH+S++KFFAL+ LIE 
Sbjct  285   ILRRGLLASLVAAEAQEEAKEAAKLLHCLRMFAELCTSASPECPHISLSKFFALNNLIEL  344

Query  716   P-----KKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKL  552
             P     K+   D   TKLSV +  K       G       GK         ++L G+EKL
Sbjct  345   PSTVKTKELTPDDFATKLSVHEKVK------EGKMTCFMNGKATSKSLKPSVELSGSEKL  398

Query  551   EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NH  375
             EWA+GDG K   ELRE L NE   WFLKFL+ +L+VG   N    K   S  RQ E+ N 
Sbjct  399   EWAKGDGSKDIVELRELLLNEIQYWFLKFLEGALEVGLWQNKQEQKTKVSVPRQTESKNQ  458

Query  374   IGLTLSLLKQANEWLDKMMMRGSL-ELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
             I  TLS LK ANEWLDK  +R +L    + +   V++LKQK+Y CLL+++DSAASAL
Sbjct  459   IAFTLSQLKHANEWLDK--VRSTLCSDKNNVADRVDRLKQKLYTCLLLYMDSAASAL  513



>gb|KHN01442.1| hypothetical protein glysoja_009648 [Glycine soja]
Length=528

 Score =   396 bits (1017),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 255/549 (46%), Positives = 350/549 (64%), Gaps = 52/549 (9%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ+++S  VK+ GEYRSVLLQVISIVPAI+GSELWP+ GFF+KVSDSS
Sbjct  1     MASLIPGVLLKLLQSMDS-DVKVNGEYRSVLLQVISIVPAITGSELWPNQGFFLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FYVDR+E GTPVP+L+ VRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILNNKLQLGQFFYVDRIEAGTPVPILVDVRPVPGRHPFIGNPKDLM  119

Query  1388  QMME-AAGEMECEVK-KESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGV----  1227
             Q++E + G ++ +   + +   S +++ S  +   ++KIVIKEEK  VASRYM+GV    
Sbjct  120   QLLEPSEGPVQSDHNHRVNRSKSMNSTKSKESKSPRQKIVIKEEKAAVASRYMRGVRSPT  179

Query  1226  ----LTTAQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDST  1059
                 +  A  + KG+D        +     ++ K+ ++ +Q    +P  R      + S 
Sbjct  180   SNVNVQDANEERKGNDFENGVDSKKVASAKVKLKKLQVSLQLEIPSPRQR-----VAQSN  234

Query  1058  IINGVNTNTLPKR------TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKG  897
             I   V +   PKR      + KQE  ++N +S++  ++  S+  + WSSLP +L++PGK 
Sbjct  235   IQENVMS---PKRISAKRNSTKQETTNLNVLSSSEDKS-YSTEAIPWSSLPASLLRPGKE  290

Query  896   MLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQ  717
             +LR K LAS +A EAQ E  A   L++ LSMFA++C+SA+ ENPH ++ KFF+   L++Q
Sbjct  291   LLRRKHLASQVAVEAQREVTATAVLVKFLSMFANICASAASENPHGTLNKFFSFQELMDQ  350

Query  716   PK---------KALDDYCFTKLSVTD--NKKTPDSNHlgigigigkgklkpskppLELDL  570
                        K+L  Y F+  + TD  +KK+           +  GK     P    +L
Sbjct  351   SNFTSTTPHKDKSLQLYKFSSPTETDKTDKKS----------DLVPGKSSSKSPKYSPEL  400

Query  569   GGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnk---enksK  399
               AEK EW  G+GLK   ELRE+L  ET  WFLK+L+ +LDV F  ++ + +      S 
Sbjct  401   SEAEKQEWVTGNGLKEINELREALLIETRSWFLKYLEKTLDVWFSTSSRDKRGKMSKDSA  460

Query  398   GRQ-EEANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDS  222
             GRQ E AN+I LTLS LKQANEWL+K+    +LE   E+   V++LKQKVY CLL+HVDS
Sbjct  461   GRQMEHANNIALTLSHLKQANEWLEKLRSTSNLE-NDELVETVDRLKQKVYSCLLLHVDS  519

Query  221   AASALDTRS  195
             AA AL+ R+
Sbjct  520   AAFALENRA  528



>ref|XP_003529845.1| PREDICTED: uncharacterized protein LOC100811877 [Glycine max]
Length=535

 Score =   389 bits (1000),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 255/551 (46%), Positives = 350/551 (64%), Gaps = 49/551 (9%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ+++S  VK+ GEYRSVLLQVISIVPAI+GSELWP+ GFF+KVSDSS
Sbjct  1     MASLIPGVLLKLLQSMDS-DVKVNGEYRSVLLQVISIVPAITGSELWPNQGFFLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FYVDR+E GTPVP+L+ VRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILNNKLQLGQFFYVDRIEAGTPVPILVDVRPVPGRHPFIGNPKDLM  119

Query  1388  QMME-AAGEMECEVK-KESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGV----  1227
             Q++E + G ++ +   + +   S +++ S  +   ++KIVIKEEK  VASRYM+GV    
Sbjct  120   QLLEPSEGPVQSDHNHRVNRSKSMNSTKSKESKSPRQKIVIKEEKAAVASRYMRGVRSPT  179

Query  1226  ----LTTAQMKAKGSDenenngggqgvvgGLRGKQ-QEIKVQARPTTPSARSDALLTSDS  1062
                 +  A  + KG+D        +     ++ K+ Q + V    TT S + +       
Sbjct  180   SNVNVQDANEERKGNDFENGVDSKKVASAKVKLKKLQTLSVN---TTRSLQLEIPSPRQR  236

Query  1061  TIINGVNTNTL-PKR------TNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPG  903
                + +  N + PKR      + KQE  ++N +S++  ++  S+  + WSSLP +L++PG
Sbjct  237   VAQSNIQENVMSPKRISAKRNSTKQETTNLNVLSSSEDKS-YSTEAIPWSSLPASLLRPG  295

Query  902   KGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALI  723
             K +LR K LAS +A EAQ E  A   L++ LSMFA++C+SA+ ENPH ++ KFF+   L+
Sbjct  296   KELLRRKHLASQVAVEAQREVTATAVLVKFLSMFANICASAASENPHGTLNKFFSFQELM  355

Query  722   EQPK---------KALDDYCFTKLSVTD--NKKTPDSNHlgigigigkgklkpskppLEL  576
             +Q           K+L  Y F+  + TD  +KK+           +  GK     P    
Sbjct  356   DQSNFTSTTPHKDKSLQLYKFSSPTETDKTDKKS----------DLVPGKSSSKSPKYSP  405

Query  575   DLGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnk---enk  405
             +L  AEK EW  G+GLK   ELRE+L  ET  WFLK+L+ +LDV F  ++ + +      
Sbjct  406   ELSEAEKQEWVTGNGLKEINELREALLIETRSWFLKYLEKTLDVWFSTSSRDKRGKMSKD  465

Query  404   sKGRQ-EEANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV  228
             S GRQ E AN+I LTLS LKQANEWL+K+    +LE   E+   V++LKQKVY CLL+HV
Sbjct  466   SAGRQMEHANNIALTLSHLKQANEWLEKLRSTSNLE-NDELVETVDRLKQKVYSCLLLHV  524

Query  227   DSAASALDTRS  195
             DSAA AL+ R+
Sbjct  525   DSAAFALENRA  535



>ref|XP_010534955.1| PREDICTED: uncharacterized protein LOC104810376 [Tarenaya hassleriana]
 ref|XP_010534956.1| PREDICTED: uncharacterized protein LOC104810376 [Tarenaya hassleriana]
Length=537

 Score =   389 bits (998),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 257/553 (46%), Positives = 340/553 (61%), Gaps = 48/553 (9%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQT+NS  VK+RGEYRSVLLQVISIVPA+SGSELWP+HGFFIKVSDSS
Sbjct  1     MASLTPGVLLKLLQTMNS-NVKVRGEYRSVLLQVISIVPALSGSELWPNHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+L+  DN+LIL NKL LGQ FYVD++E GTPVPVL GVRPIPGRHPF G+PKDLM
Sbjct  60    HSTYVSLTNEDNELILTNKLGLGQFFYVDKLESGTPVPVLAGVRPIPGRHPFVGNPKDLM  119

Query  1388  QMM---EAAGEMECEVKKESAknsnsnsnsnsnskkkkK---IVIKEEKVGVASRYMQGV  1227
             QM+   E + + +   KK+ A +    +      K  +    IVIKEEK GVASRYMQGV
Sbjct  120   QMLVPSEGSVQRKPNHKKDDASSKLRETVKAKEEKSSRHHQPIVIKEEKTGVASRYMQGV  179

Query  1226  ---------LTTAQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALL  1074
                       ++    +  ++ +   G  +G+ G ++GKQQE++ QARP  P+      +
Sbjct  180   SNPKASGSDTSSGGSSSSSTEGDNGAGPAKGLGGSVKGKQQELRGQARPAGPARSRPEPV  239

Query  1073  TSDSTIINGVNTNT------LPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLV  912
              ++ST               L + T+KQEN  ++   +   +N  +S  V WSSLP  L 
Sbjct  240   KAESTEPKAREAAARSKAMLLKRPTSKQENRSISSRPDCVGRNGDASEAVSWSSLPVTLS  299

Query  911   KPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALH  732
             K GKGMLR + LA+LIAAEAQ EA+AA +L++CLSMFA+L S ASPE+PH  ++KFF L 
Sbjct  300   KLGKGMLRRRNLAALIAAEAQREALAASHLVRCLSMFAELSSVASPEDPHTYLSKFFMLQ  359

Query  731   ALIEQPKKALDDYCFTKLSVTDNKKTP-------DSNHlgigigigkgklkpskppLELD  573
               I+Q             + T  ++ P       +  +          K           
Sbjct  360   NCIDQSH-----------ATTSTREKPLQLSSPTEPENRSKKTKQVSSKTTAKNSKSPTV  408

Query  572   LGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR  393
             L  AEKLEW +G+G + TKELR ++S ET  WFL+FL+ ++D   +     NK     GR
Sbjct  409   LTEAEKLEWVQGNGTEDTKELRNTISFETRSWFLRFLEEAIDARSRDKALENKGKARGGR  468

Query  392   -QEEANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGF---VEKLKQKVYGCLLVHVD  225
               E  NHI  TLS LKQANEWL+++      +L  + +     +E+LK+K+Y CLL++VD
Sbjct  469   VPEPDNHIAETLSQLKQANEWLERVKT----DLNPKDNALAETIERLKKKMYSCLLLYVD  524

Query  224   SAASALDTRSHRN  186
             SAAS L+ R+ R+
Sbjct  525   SAASVLENRNARD  537



>ref|XP_006599758.1| PREDICTED: uncharacterized protein LOC100816179 [Glycine max]
 gb|KHN39599.1| hypothetical protein glysoja_020677 [Glycine soja]
Length=534

 Score =   388 bits (997),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 244/542 (45%), Positives = 337/542 (62%), Gaps = 34/542 (6%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ+++S  VK+ GEYRSVLLQVISIVPAI+GSELWP+ GFF+KVSDSS
Sbjct  1     MASLIPGVLLKLLQSMDS-DVKVNGEYRSVLLQVISIVPAITGSELWPNQGFFLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FYVDR+E GTPVP+L+ VRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILNNKLQLGQFFYVDRIETGTPVPILVDVRPVPGRHPFIGNPKDLM  119

Query  1388  QMME-AAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLT---  1221
             QM+E + G ++ +  + +   S +++ +  +   ++KIVIKEEK  VASRYM+GV T   
Sbjct  120   QMLEPSEGPVQSDNHRVNRSKSMNSTKAKESKSPRQKIVIKEEKAAVASRYMRGVRTPTS  179

Query  1220  -----TAQMKAKGSDenenngggqgvvgGLRGKQ-QEIKVQARPT----TPSARSDALLT  1071
                   A  + KG+D        +     ++ K+ Q + V    +     PS R     +
Sbjct  180   NVNVQDANEERKGNDFENGVDSKKVASAKVKLKKLQTLSVNTTRSLQLEIPSPRQRVAQS  239

Query  1070  SDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGML  891
             +    +         + + KQE  ++N +S++  ++  S+  + WSSLP +L++PGK +L
Sbjct  240   NIQETVMSPKRILTKRNSTKQETTNLNVLSSSEDKS-YSTEAIPWSSLPSSLLRPGKELL  298

Query  890   RMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQ--  717
             R K LAS +A EAQ+E  A   L++ LSMFA++C+SA+ ENPH+++ KFF+   L+++  
Sbjct  299   RRKHLASQVAVEAQSEVTATSVLVKFLSMFANICTSAASENPHVTLNKFFSFQELMDRSN  358

Query  716   -----PKKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKL  552
                  P K      +   S T+  KT   + L  G    K            +L  AEK 
Sbjct  359   CISTTPHKDKSFQLYKTSSPTETDKTDKKSDLVPGKSSSKSPKYSP------ELSEAEKQ  412

Query  551   EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnn---nkenksKGRQ-EE  384
             EW  G+GLK   ELRE LS ET  WFL +++ +LDV F   +          + GRQ + 
Sbjct  413   EWVTGNGLKEINELREVLSIETRSWFLIYMEKTLDVWFSTISREKRGKTNKDTAGRQMQH  472

Query  383   ANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALD  204
             AN+I LTLS LKQANEWL+K+    ++E   E+   V++LKQ VY CLL+HVDSAA AL+
Sbjct  473   ANNIALTLSHLKQANEWLEKLRSTSNME-NEELVETVDRLKQNVYSCLLLHVDSAAFALE  531

Query  203   TR  198
              R
Sbjct  532   NR  533



>ref|XP_006407119.1| hypothetical protein EUTSA_v10020538mg [Eutrema salsugineum]
 gb|ESQ48572.1| hypothetical protein EUTSA_v10020538mg [Eutrema salsugineum]
Length=511

 Score =   382 bits (980),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 258/534 (48%), Positives = 324/534 (61%), Gaps = 49/534 (9%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLLQT+++  +K+RGEYRSVLLQVISIVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPRVLIKLLQTMDT-NIKVRGEYRSVLLQVISIVPALAGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+L   DN+LILNNKL LGQ FYVD++E GTPVPV++GVRPI GRHPF G+PKDLM
Sbjct  60    HSTYVSLRNEDNELILNNKLGLGQFFYVDKLEAGTPVPVMVGVRPISGRHPFVGNPKDLM  119

Query  1388  QMM---EAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTT  1218
             QM+   E A   E   K++  K   + SN   N ++ +  VIKEEK GVASRYM+GV TT
Sbjct  120   QMLVPSETAPMQEQNHKQK--KKDGARSNVVVNLRRHQHFVIKEEKTGVASRYMKGVSTT  177

Query  1217  AQMKAKGSDenenngggqgvvgGL-------RGKQQEIKVQARPTTPSARSDALLTSDST  1059
                 +  S    NN    G++          +GKQ+E K QAR   P     A      T
Sbjct  178   KASGSDSSSGGSNNESETGLMMATKKVGGLAKGKQREHKDQARQAGPPESRPA------T  231

Query  1058  IINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKK  879
                 V    LP  +       V+F+  N + NI  S    WSSLP +L K GKGMLR + 
Sbjct  232   APTKVEPKKLPLSST------VSFI--NRKSNI--SEDASWSSLPVSLSKMGKGMLRRRN  281

Query  878   lasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALI--EQPKKA  705
             +A L++ E Q EA+AA +LL+C+SMFADL SSASP+NPH S+  FF L +L+  EQ   A
Sbjct  282   IAVLLSTEVQREALAASHLLKCISMFADLSSSASPKNPHTSLRNFFTLQSLLDQEQVTAA  341

Query  704   LDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGLK  525
               D  F  ++V      PD   L     +   +           L  AEKLEW +G+G +
Sbjct  342   SKDKAFQLMNVHSLLNEPDK--LSKKASLISSRTTTKFSKSSKTLTEAEKLEWVKGNGTE  399

Query  524   ATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR-QEEANHIGLTLSLLK  348
               K+LR ++  ET  WFLKFL+ ++D GFQ +    K     GR  E  NHI  TLS LK
Sbjct  400   EIKQLRNTMKQETRSWFLKFLEEAIDTGFQASVLEKKGKTKGGRVAEPDNHIAETLSQLK  459

Query  347   QANEWLDKMMMRGSLELGSEMHGF-------VEKLKQKVYGCLLVHVDSAASAL  207
             QANEWLDK        + SE H         +E+LK+K+Y CLL +VDSAASA+
Sbjct  460   QANEWLDK--------VKSEHHSTDNSLLENIERLKKKIYSCLLHYVDSAASAI  505



>ref|XP_007135397.1| hypothetical protein PHAVU_010G126100g [Phaseolus vulgaris]
 gb|ESW07391.1| hypothetical protein PHAVU_010G126100g [Phaseolus vulgaris]
Length=536

 Score =   377 bits (968),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 240/539 (45%), Positives = 329/539 (61%), Gaps = 24/539 (4%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ+++S  VK  GEYRSVLLQVISIVPAI+GSELWP+ GFF+K+SDSS
Sbjct  1     MASLIPGVLLKLLQSMDS-NVKFNGEYRSVLLQVISIVPAITGSELWPNQGFFLKISDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LILNNKLQLGQ FYVD +E GTPVP+L+ VRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILNNKLQLGQFFYVDGIEAGTPVPILVDVRPVPGRHPFIGNPKDLM  119

Query  1388  QMMEAA-GEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGV-----  1227
             QM+EA+ G ++ +  + +   S +++ S  +     KIVIKE+K  VASRYMQGV     
Sbjct  120   QMLEASEGPVQSDNPRINRSKSMNSTTSKESRSPWHKIVIKEDKSAVASRYMQGVRIPTS  179

Query  1226  ---LTTAQMKAKGSDenenngggqg--vvgGLRGKQQEIKVQARPT----TPSARSDALL  1074
                +  A  + KG+D   +    +          K Q + V    T    T S R     
Sbjct  180   NVNVYDAIEERKGNDFQNDVDSTKKVGSAKVKLQKLQALSVNTTRTLLLETSSPRQRVAQ  239

Query  1073  TSDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGM  894
              +   +++     +    + K E  ++N + ++  ++  S+  V WSSLP  L++PGK +
Sbjct  240   CNTEHVMSASKRISTKHNSTKLETTNLNVLPSSEDKS-WSTEAVPWSSLPAKLLRPGKEL  298

Query  893   LRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQP  714
             LR K LAS++  EAQ E  AA  L++ LSMF+++C+SA+ ENPH+++ KFF+   L+   
Sbjct  299   LRRKHLASMVVVEAQKEVTAATVLVKFLSMFSNICTSAASENPHVTLNKFFSFQELMMNH  358

Query  713   KKALDDYCFTK--LSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWAR  540
                      T   L++       +++       +  GK     P    DL   EK EWA 
Sbjct  359   SNGTSTVPHTDKLLNLYKTSSPTETDKNYKKSVLVPGKSSSKSPKYSPDLSDTEKQEWAT  418

Query  539   GDGLKATKELRESLSNETHLWFLKFLDASLDVGF----QVnnnnnkenksKGRQEEANHI  372
             G+GL+   ELRE L  ET LWFLK+L+ +LD  F    Q       +  +  ++  ANHI
Sbjct  419   GNGLEEINELREVLLMETKLWFLKYLEKTLDFWFSTSSQEKRGKTSKETAGKKKNHANHI  478

Query  371   GLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRS  195
              LTLS LKQANEWL+K+    +LE   EM   V++LKQ+VY CLL+HVDSAA AL++R+
Sbjct  479   ALTLSHLKQANEWLEKLRNTTNLE-NEEMFETVDRLKQRVYSCLLLHVDSAAFALESRA  536



>gb|KFK38774.1| hypothetical protein AALP_AA3G158700 [Arabis alpina]
Length=512

 Score =   376 bits (966),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 248/538 (46%), Positives = 328/538 (61%), Gaps = 43/538 (8%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLLQT+N+  +K+RGEYRSVLLQVISIVPA++GS+LWP+ GFFIKVSDSS
Sbjct  1     MASLTPRVLIKLLQTMNT-NIKVRGEYRSVLLQVISIVPALAGSDLWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+L   DN+LILNNKL LGQ FYVD++E GTPVPV++GVRPI GRHPF G+PKDLM
Sbjct  60    HSTYVSLKNEDNELILNNKLGLGQFFYVDKLEAGTPVPVMVGVRPISGRHPFVGNPKDLM  119

Query  1388  QMMEAA------GEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGV  1227
             QM+  +       E   + KK+ A      SN+  N ++ +  VIKEEK GVASRYM+GV
Sbjct  120   QMLVPSETTPLQEENHNKKKKDGA-----ISNAVDNQRRHQDFVIKEEKAGVASRYMKGV  174

Query  1226  -------LTTAQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTS  1068
                      ++   +    E       + V G  +GKQ+E K QAR   P     A    
Sbjct  175   SNPKGSGTDSSSGSSNNESETGLMMATKKVGGLAKGKQREHKDQARQVGPPQSRPAT---  231

Query  1067  DSTIINGVNTNTLPKRTNKQENVD-VNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGML  891
                      T   PK+     NV+ +N  SN       SS    WSSLP NL K GKGML
Sbjct  232   -------APTKAEPKKLPLSANVNYINRKSN-------SSEEASWSSLPVNLSKMGKGML  277

Query  890   RMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK  711
             R + +A+LI+ E Q EA+AA +L++C+SMFADL S ASP+NPH S+  FF L ++++Q +
Sbjct  278   RRRNMAALISTEVQREALAASHLVKCISMFADLSSRASPKNPHTSLKNFFNLQSVLDQAQ  337

Query  710   KALD--DYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARG  537
                +  D  F  ++V   K  P+   L     +   +           L  A+KLEW +G
Sbjct  338   VTAESKDKSFQLMNVHLLKTEPEK--LSKKASLTSNRTTTKSSKSSKTLTEADKLEWVKG  395

Query  536   DGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NHIGLTL  360
             +G +  KELR+++  ET  WFLKFL+ ++D GF  + +  K      RQ E  NHI  TL
Sbjct  396   NGTEEIKELRDTMKQETRSWFLKFLEDAIDTGFHASVSEKKGKTKGARQAEPDNHIAETL  455

Query  359   SLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRSHRN  186
             S LKQANEWL+K+         S +   +E+LK+K+Y CLL++VDSAASA++ +  R+
Sbjct  456   SQLKQANEWLEKVKNDHQSSDNSLLEN-IERLKKKIYSCLLLYVDSAASAMEYQQARD  512



>emb|CDY52268.1| BnaC05g52120D [Brassica napus]
Length=507

 Score =   374 bits (961),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 238/533 (45%), Positives = 312/533 (59%), Gaps = 51/533 (10%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLLQT+N+  +K+RGEYRSVLLQVISIVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPRVLIKLLQTMNT-NIKVRGEYRSVLLQVISIVPALAGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+L   DN+LILNNKL LGQ FYVD++EPGTPVPV++GVRPI GRHPF G+PKDLM
Sbjct  60    HSTYVSLRNEDNELILNNKLGLGQFFYVDKLEPGTPVPVMVGVRPISGRHPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsn---snsnsnsnskkkkKIVIKEEKVGVASRYMQGV---  1227
             QM+           +E         + SN+  + ++++  VIKEEK GVASRYMQGV   
Sbjct  120   QMLVPTETTTTPPMQEDNHKQKKDGARSNAVESLRRRQDFVIKEEKTGVASRYMQGVSNA  179

Query  1226  ----LTTAQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDST  1059
                   ++   +    E  +    + V G  +GKQ+E K Q R   P        T+ + 
Sbjct  180   RVSGSDSSSGGSNNESEAGSVKASKRVGGLAKGKQREHKDQVRQACPPQSQSRPATAPTK  239

Query  1058  IINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKK  879
                 +N               +N  SN       SS    W SLP NL K GKGMLR + 
Sbjct  240   AEQKIN--------------HINRKSN-------SSEDASWRSLPANLTKMGKGMLRRRN  278

Query  878   lasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALD  699
             +A L+AAEAQ +A+AA +LL+C++MFADL SSASP+NPH S+  FF L +L++Q      
Sbjct  279   IAVLLAAEAQRDALAASHLLKCINMFADLSSSASPKNPHTSLRSFFNLQSLLDQ------  332

Query  698   DYCFTKLSVTDNKKT--------PDSNHlgigigigkgklkpskppLELDLGGAEKLEWA  543
                  +L+   +K+         P                  +       L  AEKLEW 
Sbjct  333   ----AQLTAAPSKEKPLQLLNIHPVCTEPEKLSKRASLASSRATTKSSKTLTEAEKLEWV  388

Query  542   RGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NHIGL  366
              G+G K  K +R++++ ET  WF++FL+ ++D GF  +    K      R EE  NHI  
Sbjct  389   TGNGTKEIKAMRDTMTQETRSWFMRFLEEAIDTGFHASVQVKKGKTKGSRAEEPDNHIAE  448

Query  365   TLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
             TLS LKQANEWLDK+           +   +E+LK+K+Y CLL++VDSAASA+
Sbjct  449   TLSQLKQANEWLDKVKSDHHSSDDDSLLENIERLKKKIYSCLLLYVDSAASAI  501



>ref|XP_002885015.1| hypothetical protein ARALYDRAFT_478830 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61274.1| hypothetical protein ARALYDRAFT_478830 [Arabidopsis lyrata subsp. 
lyrata]
Length=506

 Score =   367 bits (943),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 241/540 (45%), Positives = 329/540 (61%), Gaps = 62/540 (11%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLL+T+N+  +K+RGEYRSVLLQVISIVPA++G+ELWP+ GFFIKVSDSS
Sbjct  1     MASLTPRVLIKLLETMNT-NIKVRGEYRSVLLQVISIVPALAGAELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+L   DN+LILNNKL LGQ FYVD++E GTPVPVL+GVRPI GRHPF G+PKDLM
Sbjct  60    HSTYVSLRNEDNELILNNKLGLGQFFYVDKLEAGTPVPVLVGVRPISGRHPFVGNPKDLM  119

Query  1388  QMMEAA------GEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGV  1227
             QM+  +       E   + KK+ A      S    N++K +  VIKEEK GVASRYM+G+
Sbjct  120   QMLVPSETTPLQEENHNQKKKDGA-----RSKMVENTRKHQPFVIKEEKTGVASRYMKGI  174

Query  1226  LTTAQMKAKGSDenenngggqgvvgGL--------RGKQQEIKVQA--------RPTTPS  1095
             ++ ++     S    +N   +     +        +GKQ+E K QA        RP T  
Sbjct  175   VSNSKASGSDSSSGGSNNESETGSIMVAKKAGGLAKGKQREHKDQARQANPPQSRPATAP  234

Query  1094  ARSDALLTSDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNL  915
              ++++   S S+ +N +N     +++N  E+                     WSSLP +L
Sbjct  235   TKAESKKLSLSSTVNYIN-----RKSNSSEDAS-------------------WSSLPASL  270

Query  914   VKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFAL  735
              K GKG+LR + +A+LIA EAQ EA+ A +L++C+SMFADL S+ASP+NP+ S+  FF L
Sbjct  271   SKLGKGILRRRNIAALIATEAQREALVASHLIKCISMFADLSSNASPKNPNTSLRNFFTL  330

Query  734   HALIEQPK---KALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGG  564
              ++++Q +    A  D  F  +++      P+       +   +   K SK   E     
Sbjct  331   QSILDQAQVTVAASKDKSFQPVNIHSLWTEPEKLSKKTSLASSRTTTKSSKTLTE-----  385

Query  563   AEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR-QE  387
             AEKLEW +G+G +  KELR +L  ET  WFLKFL+ +LD G   +    K      R  E
Sbjct  386   AEKLEWVKGNGTEEIKELRNTLKRETRSWFLKFLEDALDTGLHASVPEKKGKTKGARLAE  445

Query  386   EANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               NHI  TLS LKQANEWL+K +   +L   + +   +E+LK+K+Y CLL++VDSAASA+
Sbjct  446   PDNHIAETLSQLKQANEWLEK-VKNDNLSSDNSLLENIERLKKKIYSCLLLYVDSAASAI  504



>ref|XP_008782950.1| PREDICTED: uncharacterized protein LOC103702341 [Phoenix dactylifera]
Length=553

 Score =   369 bits (946),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 252/575 (44%), Positives = 348/575 (61%), Gaps = 78/575 (14%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVLIKLL+ INS  VK+ GEYRS+LLQVISIVPAI+GSELWPDHGFFIKVSDSS
Sbjct  1     MASLTPGVLIKLLKNINS-DVKVCGEYRSILLQVISIVPAITGSELWPDHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LIL NKLQLGQ  YVDR+E GTPVPVL+GVRP+PGR+P  G+PKDLM
Sbjct  60    HSTYVSLSKDDNELILTNKLQLGQFIYVDRIEAGTPVPVLIGVRPLPGRNPCMGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
              M+    ++      E+    +S  +       K+++VIKEEK  V+SRYMQGV ++   
Sbjct  120   HMI-VPPDIPQAQDNETNTFKSSELSDGEKESPKRRVVIKEEKAVVSSRYMQGV-SSINA  177

Query  1208  KAKGSDenenngggqgvvgGLRGK--------QQEIKVQARPTT----------------  1101
             K+ GSD N       G    +  +        +QE+K Q  P+T                
Sbjct  178   KSAGSDSNAAGDKVNGNASDVEPQKKIVASKSKQELKSQVWPSTTTTSGYQNNIKVKQES  237

Query  1100  --------PSAR--SDALLTSDSTIINGVNTNTLPKRTNKQENVDV-------NF---MS  981
                     P+ R  S+A+              + P + +  +N  +       NF     
Sbjct  238   SEGSQKESPTLRNQSNAVKVKQDYTEGSQKEASTPTKNSSTKNTSIIKQRTPSNFHSSSL  297

Query  980   NNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMF  801
             +N+R+ ++ + P  W SLP NL+KPGKG++R K +A L+AAEAQ EA AA  L++ LS+F
Sbjct  298   SNSRRRVVDNMP--WDSLPSNLIKPGKGIVRRKNMAFLVAAEAQREATAAAALVKGLSIF  355

Query  800   ADLCSSASPENPHLSITKFFALHALIEQPKKAL---DDYCFTKLSVTD----NKKT--PD  648
             ADL  SA+ +NPH+S+TKFF+LH LI+ P  A+   + +   K + +D    +KKT  P+
Sbjct  356   ADLRKSATEDNPHVSLTKFFSLHRLIDHPNIAIQKDNSFQMPKQAPSDKEKLSKKTSLPN  415

Query  647   SNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGLKATKELRESLSNETHLWFLK  468
             S ++       +               G EKLEWARGDG K  +E+R++L  ET  WFL 
Sbjct  416   SRNVINAPKFPEESY------------GNEKLEWARGDGFKEIQEVRDTLRKETQSWFLN  463

Query  467   FLDASLDVGFQVnnnnn--kenksKGRQEEAN-HIGLTLSLLKQANEWLDKMMMRGSLEL  297
             FL+ +LD GF   +      ++++ G  +E++  I +TLS LK AN+WL+++      E+
Sbjct  464   FLEGALDTGFHAESRVKKGAKDRAGGHSKESDERIAVTLSQLKDANDWLEQLRN----EV  519

Query  296   GSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRSH  192
             G+E    +++LKQK+Y CLL HV+SAASAL++RS+
Sbjct  520   GTETE-TIDRLKQKIYACLLGHVESAASALESRSN  553



>ref|XP_010937289.1| PREDICTED: uncharacterized protein LOC105056691 isoform X1 [Elaeis 
guineensis]
Length=551

 Score =   368 bits (945),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 258/567 (46%), Positives = 344/567 (61%), Gaps = 64/567 (11%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVLIKLL+ INS  VK+ GEYRS+LLQVISIVPAI+GSELWPDHGFFIKVSDSS
Sbjct  1     MASLTPGVLIKLLKNINS-DVKVCGEYRSILLQVISIVPAITGSELWPDHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LIL NKLQLGQ  YVD++E GTPVP L+GVRP+PGR+P  G+PKDLM
Sbjct  60    HSTYVSLSKDDNELILTNKLQLGQFIYVDKIEAGTPVPALVGVRPVPGRNPCIGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
              M+    ++      E+    +S+ +       K+++VIKEEKV VASRYMQG+ +T  +
Sbjct  120   HMI-VPSDIPQAQDNEANTFKSSDLSEGEKESPKRRVVIKEEKVVVASRYMQGISST-NI  177

Query  1208  KAKGSDenenngggqgvvgGLRGK--------QQEIKVQARPTT----------------  1101
             K+ G D N       G    +  +        +QE+K QA P+T                
Sbjct  178   KSAGLDSNAAGDKVNGNASDVEPQKKIVSSKSKQELKSQAWPSTTTSCNQNNIKVKQEPS  237

Query  1100  -------PSAR--SDALLTSDSTIINGVNTNTLPKRTNKQENVDV-------NFMS--NN  975
                    P+ R  S A+      +       + P + +  +N  +       NF S  NN
Sbjct  238   EGSQKESPTLRNQSIAVKVKQEYMEGNQKEASTPTKNSSTKNTSIVKQRTPSNFHSSLNN  297

Query  974   NRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFAD  795
             +++ ++ S P  W SLP NL+KPGKG++R K +A L+AAEAQ EA AA  L++ LS+FAD
Sbjct  298   SKRRLVDSIP--WDSLPANLIKPGKGIVRRKNIAFLVAAEAQREATAAAALVKGLSIFAD  355

Query  794   LCSSASPENPHLSITKFFALHALIEQPKKALD-DYCFT--KLSVTDNKKTPDSNHlgigi  624
             L  SA+ +NPH+S+TKFF+LH LI+QP  A+  DY F   K + +D  K    N L    
Sbjct  356   LRKSATEDNPHVSLTKFFSLHRLIDQPNVAIQKDYSFQIHKEAPSDKAKLSRKNSLPNSR  415

Query  623   gigkgklkpskppLELDLGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDV  444
              +        +        G EKLEWARGDG K  +E+R +L  ET  WFL FL+ +LD 
Sbjct  416   NVINPPKFSEESY------GNEKLEWARGDGFKEIQEVRATLRKETQSWFLNFLEGALDT  469

Query  443   GFQVnnnnnkenksKG---RQEEANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFV  273
             GF   +   K  K +     +E    I +TLS LK AN+WL+++    S E+G+E    +
Sbjct  470   GFHAESRVKKGTKDRAAVHSKESDERIAVTLSQLKDANDWLEQL----SSEVGTEAET-I  524

Query  272   EKLKQKVYGCLLVHVDSAASALDTRSH  192
             ++LKQK+Y CLL HV+SAASAL++RS+
Sbjct  525   DRLKQKIYACLLGHVESAASALESRSN  551



>ref|XP_009146406.1| PREDICTED: uncharacterized protein LOC103870061 [Brassica rapa]
Length=510

 Score =   366 bits (939),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 247/541 (46%), Positives = 325/541 (60%), Gaps = 64/541 (12%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLLQT+N+  +K+RGEYRSVLLQVISIVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPRVLIKLLQTMNT-NIKVRGEYRSVLLQVISIVPALAGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+L   DN+LILNNKL LGQ FYVD++E GTPVPV++GVRPI GRHPF G+PKDLM
Sbjct  60    HSTYVSLRNEDNELILNNKLGLGQFFYVDKLEAGTPVPVMVGVRPISGRHPFVGNPKDLM  119

Query  1388  QMMEAA-------GEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQG  1230
             QM+           E   + KK+ A      SN+  + ++++  VIKEEK GVASRYMQG
Sbjct  120   QMLVPTETTTPPMQEDNHKQKKDGA-----RSNAVESLRRRQDFVIKEEKTGVASRYMQG  174

Query  1229  VLTTAQMKAKGSDenenngggqgvvgGLR----------GKQQEIK--------VQARPT  1104
             V   +  +A GSD +      +   G +R          GKQ+E K         Q+RP 
Sbjct  175   V---SNARASGSDSSSGGSNNESEAGSVRASKRVGGLAKGKQREHKDQLHQAAPPQSRPA  231

Query  1103  TPSARSDALLTSDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLP  924
             T   R++    S S+ +N VN     ++++  E+                     W SL 
Sbjct  232   TAPTRAETKKLSLSSNVNCVN-----RKSSFSEDAS-------------------WRSLT  267

Query  923   PNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKF  744
              NL K GKGMLR + +A+L+AAEAQ EA+AA +LL+C+SMFADL SSASP+NPH S+  F
Sbjct  268   ANLTKMGKGMLRRRNIAALLAAEAQREALAASHLLKCISMFADLSSSASPKNPHTSLRSF  327

Query  743   FALHALIEQPKKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGG  564
             F L +L++Q  +     C  K S   N   P                  +       L  
Sbjct  328   FTLQSLLDQA-QVTAAPCKEKSSQLLNIH-PICTEPEKPSKRASLASSRATTKSSKTLTE  385

Query  563   AEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEE  384
             AEKLEW  G+G +  K +R++++ ET  WF++FL+ ++D GF  +    K      R EE
Sbjct  386   AEKLEWVTGNGTEEIKAMRDAMTQETRSWFMRFLEEAIDTGFHASVQVKKGKTKGSRAEE  445

Query  383   A-NHIGLTLSLLKQANEWLDKMMMRGSLELGSE-MHGFVEKLKQKVYGCLLVHVDSAASA  210
               NHI  TLS LKQANEWLDK  ++     G + +   +E+LK+K+Y CLL++VDSAASA
Sbjct  446   PDNHIAETLSQLKQANEWLDK--VKSDHHSGDDSLLENIERLKKKIYSCLLLYVDSAASA  503

Query  209   L  207
             +
Sbjct  504   I  504



>ref|NP_188033.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAS47625.1| At3g14170 [Arabidopsis thaliana]
 gb|AAT06444.1| At3g14170 [Arabidopsis thaliana]
 gb|AEE75480.1| uncharacterized protein AT3G14170 [Arabidopsis thaliana]
Length=505

 Score =   362 bits (928),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 245/539 (45%), Positives = 328/539 (61%), Gaps = 61/539 (11%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLL+T+N+  +K+RGEYRSVLLQVISIVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPRVLIKLLETMNT-NIKVRGEYRSVLLQVISIVPALAGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS  DN+LILNNKL +GQ FYVD+++ GTPVPVL+GVRPI GRHPF G+PKDLM
Sbjct  60    HSTYVSLSNEDNELILNNKLGIGQFFYVDKLDAGTPVPVLVGVRPISGRHPFVGNPKDLM  119

Query  1388  QMMEAA------GEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGV  1227
             QM+  +       E   + KK+ A      SN   N +K +  VIKEEK GVASRYM+G+
Sbjct  120   QMLVPSETTPREEEYHNQKKKDGA-----RSNIVENIRKHQPFVIKEEKTGVASRYMKGI  174

Query  1226  LTT-------AQMKAKGSDenenngggqgvvgGLRGKQQEIKVQA--------RPTTPSA  1092
               +       +   +    E  +    + V    +GKQ+E K QA        RP T   
Sbjct  175   SNSKASGSDSSSGGSNNEGETGSIMVAKKVGVLAKGKQREHKDQARQAGPLQCRPATAPT  234

Query  1091  RSDALLTSDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLV  912
             +++    S S+ +N +N     +++N  E+                     WSSLP +L 
Sbjct  235   KAEPKKLSLSSTVNYIN-----RKSNSAEDAS-------------------WSSLPVSLS  270

Query  911   KPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALH  732
             K GKGMLR + LA+LIAAE Q EA+AA +L++C+SMFA+L S+ASP+NPH S+  FF L 
Sbjct  271   KLGKGMLRRRNLAALIAAEVQREALAASHLIKCISMFAELSSNASPKNPHTSLRNFFTLQ  330

Query  731   ALIEQPK---KALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGA  561
             ++++Q +    A  D  F  +++      P+       +   +  +KPSK   E     A
Sbjct  331   SILDQVQVTVVASKDKSFQPVNIHSLWMEPEKLSKKASLSSSRATMKPSKALTE-----A  385

Query  560   EKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR-QEE  384
             EKLEW +G+G +  KEL  +L  ET  WFLKFL+ +LD G        K      R  E 
Sbjct  386   EKLEWVKGNGTEEIKELTNTLKRETRSWFLKFLEDALDTGLHATVPEKKGKTKGARLAEP  445

Query  383   ANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
              NHI  TLS LKQANEWL+K +   +L   + +   +E+LK+K+Y CLL++VDSAASA+
Sbjct  446   DNHIAETLSQLKQANEWLEK-VKNDNLSSDNSLLENIERLKKKIYSCLLLYVDSAASAI  503



>emb|CDX97548.1| BnaA05g25310D [Brassica napus]
Length=507

 Score =   362 bits (928),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 234/536 (44%), Positives = 311/536 (58%), Gaps = 57/536 (11%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLLQT+N+  +K+RGEYRSVLLQVISIVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPRVLIKLLQTMNT-NIKVRGEYRSVLLQVISIVPALAGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+L   DN+LILNNKL LGQ FYVD++EPGTPVPV++GVRPI GRHPF G+PKDLM
Sbjct  60    HSTYVSLRNEDNELILNNKLGLGQFFYVDKLEPGTPVPVMVGVRPISGRHPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsn--snskkkkKIVIKEEKVGVASRYMQGVLTTA  1215
             QM+         +++++ K     + SN   + ++++  VIKEEK GVASRYMQGV   +
Sbjct  120   QMLVPTETTTPPLQEDNHKQKKDGARSNPMESVRRRQDFVIKEEKTGVASRYMQGV---S  176

Query  1214  QMKAKGSDenenngggqgvvgGLR----------GKQQEIK--------VQARPTTPSAR  1089
               +A GSD +      +   G +R          GKQ+E K         Q+RP T   +
Sbjct  177   NARASGSDSSSGGSNNESEAGSVRASKRVGGLAKGKQREHKDQLHQAAPPQSRPATAPTK  236

Query  1088  SDALLTSDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVK  909
             ++    S S+ +N VN     ++++  E+                     W SLP NL K
Sbjct  237   AETKNLSLSSTVNSVN-----RKSSFSEDAS-------------------WRSLPANLTK  272

Query  908   PGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHA  729
              GKGMLR +    + A  A      A      L+MFADL SSASP+NPH S+  FF L +
Sbjct  273   MGKGMLRRRN---IAALLAAEAQREALAASHLLNMFADLSSSASPKNPHTSLRSFFNLQS  329

Query  728   LIEQPKKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLE  549
             L++Q  +     C  K S   N   P                  +       L  AEKLE
Sbjct  330   LLDQ-AQVTAAPCKEKSSQLLNIH-PICTEPEKPSKRASLASSRATTKSSKTLTEAEKLE  387

Query  548   WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NHI  372
             W  G+G +  K +R++++ ET  WF++FL+ ++D GF  +    K      R EE  NHI
Sbjct  388   WVTGNGTEEIKAMRDAMTQETRSWFMRFLEEAIDTGFHASVQVKKGKTKGSRAEEPDNHI  447

Query  371   GLTLSLLKQANEWLDKMMMRGSLELGSE-MHGFVEKLKQKVYGCLLVHVDSAASAL  207
               TLS LKQANEWLDK  ++     G + +   +E+LK+K+Y CLL++VDSAASA+
Sbjct  448   AETLSQLKQANEWLDK--VKSDHHSGDDSLLENIERLKKKIYSCLLLYVDSAASAI  501



>ref|XP_010273897.1| PREDICTED: uncharacterized protein LOC104609309 [Nelumbo nucifera]
Length=517

 Score =   362 bits (928),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 235/519 (45%), Positives = 312/519 (60%), Gaps = 26/519 (5%)
 Frame = -1

Query  1688  VKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSSHSTYVTLSKPDNDLILNNKL  1509
              ++ GEYRSVLLQVISIVPA+SGSELW + GFFIKVSDSSHSTYV+LS  DN+LIL NKL
Sbjct  5     ARVCGEYRSVLLQVISIVPALSGSELWSNRGFFIKVSDSSHSTYVSLSDEDNELILTNKL  64

Query  1508  QLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLMQMMEAAGEMECEVKKESAkn  1329
             QLGQ  YVDR+E GTPVP L+GVRP+PGR+P  G+PKDLM+M+  +         +   +
Sbjct  65    QLGQFIYVDRVEAGTPVPTLVGVRPVPGRNPCVGTPKDLMRMLVPSESPTSSPNHDGTAS  124

Query  1328  snsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVL-TTAQMKAKGSDenenngggqgvvg  1152
              +   +       +KKIVIKEEKV VASRYMQGVL + +   +KGS+ + NNGG      
Sbjct  125   KSIELSEAKEESPRKKIVIKEEKVVVASRYMQGVLSSNSNSNSKGSEVDSNNGGKPNGND  184

Query  1151  GLRGK--------QQEIKVQARPTTPSARSDALLTSDSTII-------NGVNTNTLPKRT  1017
                 K        ++E+K Q RPTTP        T D   +           + T PK+ 
Sbjct  185   SYETKNLASSKSNKKELKGQTRPTTPKPEVYGASTKDREAVVPAIKSSKAKQSTTTPKQD  244

Query  1016  NKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeam  837
             N   +  +   + N  ++ +S     W SLP NL+KPGKGMLR + LASLIA EAQ EA 
Sbjct  245   NSNSHSSLKSRNKNQARDSIS-----WDSLPANLLKPGKGMLRRRNLASLIATEAQKEAS  299

Query  836   aaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKK  657
             +A  L++CL MFADL +SA+P +PHL ++KFFALH LI+Q +  +        +V  N  
Sbjct  300   SAATLVKCLGMFADLRTSAAPSSPHLPMSKFFALHRLIDQ-QTVVTASKEVSTNVYTNSL  358

Query  656   TPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGLKATKELRESLSNETHLW  477
               D +  G       G+     P   ++L  +E+LEWA+GDG K  KELRE L  E+  W
Sbjct  359   PLDKDKSGKNTTPTSGRNVHKSPKPPMELSASERLEWAKGDGDKEIKELREVLLKESQSW  418

Query  476   FLKFLDASLDVGFQVnnnnnkenksKGRQE---EANHIGLTLSLLKQANEWLDKMMMRGS  306
             FLKFL+ +L  GFQ++    K     G +        I + LS LK A++WLD++  + S
Sbjct  419   FLKFLEGALTAGFQMSAREKKGKDGAGGRRMGSSEGQIAVMLSQLKTASDWLDQLRSKAS  478

Query  305   LELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRSHR  189
              E  + +   +++LKQK+Y CLL  VDSAASAL++RS R
Sbjct  479   PE-NNGLVDTIDRLKQKIYECLLSQVDSAASALESRSDR  516



>dbj|BAB02981.1| unnamed protein product [Arabidopsis thaliana]
Length=498

 Score =   351 bits (900),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 239/535 (45%), Positives = 321/535 (60%), Gaps = 60/535 (11%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLL+T+N+  +K+RGEYRSVLLQVISIVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPRVLIKLLETMNT-NIKVRGEYRSVLLQVISIVPALAGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS  DN+LILNNKL +GQ FYVD+++ GTPVPVL+GVRPI GRHPF G+PKDLM
Sbjct  60    HSTYVSLSNEDNELILNNKLGIGQFFYVDKLDAGTPVPVLVGVRPISGRHPFVGNPKDLM  119

Query  1388  QMM--EAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTT-  1218
             QM+        E E   +  +   + SN   N +K +  VIKEEK GVASRYM+G+  + 
Sbjct  120   QMLVPSETTPREEEYHNQKKQKDGARSNIVENIRKHQPFVIKEEKTGVASRYMKGISNSK  179

Query  1217  ------AQMKAKGSDenenngggqgvvgGLRGKQQEIKVQA--------RPTTPSARSDA  1080
                   +   +    E  +    + V    +GKQ+E K QA        RP T   +++ 
Sbjct  180   ASGSDSSSGGSNNEGETGSIMVAKKVGVLAKGKQREHKDQARQAGPLQCRPATAPTKAEP  239

Query  1079  LLTSDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGK  900
                S S+ +N +N     +++N  E+                     WSSLP        
Sbjct  240   KKLSLSSTVNYIN-----RKSNSAEDAS-------------------WSSLP--------  267

Query  899   GMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIE  720
             GMLR + LA+LIAAE Q EA+AA +L++C+SMFA+L S+ASP+NPH S+  FF L ++++
Sbjct  268   GMLRRRNLAALIAAEVQREALAASHLIKCISMFAELSSNASPKNPHTSLRNFFTLQSILD  327

Query  719   QPK---KALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLE  549
             Q +    A  D  F  +++      P+       +   +  +KPSK   E     AEKLE
Sbjct  328   QVQVTVVASKDKSFQPVNIHSLWMEPEKLSKKASLSSSRATMKPSKALTE-----AEKLE  382

Query  548   WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR-QEEANHI  372
             W +G+G +  KEL  +L  ET  WFLKFL+ +LD G        K      R  E  NHI
Sbjct  383   WVKGNGTEEIKELTNTLKRETRSWFLKFLEDALDTGLHATVPEKKGKTKGARLAEPDNHI  442

Query  371   GLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               TLS LKQANEWL+K +   +L   + +   +E+LK+K+Y CLL++VDSAASA+
Sbjct  443   AETLSQLKQANEWLEK-VKNDNLSSDNSLLENIERLKKKIYSCLLLYVDSAASAI  496



>gb|EYU45903.1| hypothetical protein MIMGU_mgv1a025981mg [Erythranthe guttata]
Length=539

 Score =   350 bits (897),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 269/556 (48%), Positives = 338/556 (61%), Gaps = 57/556 (10%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVLIKLLQTI+S  +KIRGE+RS+LLQVISIVPAI+GSELWP++GFF+KVSDSS
Sbjct  1     MATLVPGVLIKLLQTIDS-NLKIRGEHRSILLQVISIVPAITGSELWPENGFFVKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK D DLILNNKLQLGQ  YVDRME GTPVP+L+GVRPIPGRHPF G+PKDLM
Sbjct  60    HSTYVSLSKNDTDLILNNKLQLGQFLYVDRMEGGTPVPILVGVRPIPGRHPFVGNPKDLM  119

Query  1388  QMME-AAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQ  1212
             Q+++   G+ +  V                 S  KKKIVIKEEK GVASRYMQG     +
Sbjct  120   QLVDNDGGDGDVAV----------VGVDGDESGGKKKIVIKEEKGGVASRYMQGNYLKHK  169

Query  1211  MKAKGSDenenngggqgvvgGLRGK-----------QQEIKVQARPTTPSARSDALLT--  1071
             +  K  D++   GGG G  GG  G              + +++ +P  P+A  +   T  
Sbjct  170   IDVKEIDQSSFIGGGGGGGGGGGGGGGASFKATTKLNTDHQLKGQPGAPAASPEVGQTHN  229

Query  1070  ---SDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQ--NILSSHPVLWSSLPPNLVKP  906
                +DS       T++  K TNKQEN++ N  SNN +Q  +        WS+LPP LVK 
Sbjct  230   KPDTDSASSKPEFTSSRIKSTNKQENINFNSFSNNKKQLSSPEPIISSSWSTLPPTLVKS  289

Query  905   GKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHAL  726
              KGMLR   LASL+AA+AQ EA  A NL +CLS+FADL SSASPENPHL ++KFF L  L
Sbjct  290   AKGMLRRGNLASLVAAQAQKEANLAANLAKCLSIFADLYSSASPENPHLHLSKFFTLQHL  349

Query  725   IEQPKKAL---DDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEK  555
             I++   A    D + F         +TP      +    G       +       G +++
Sbjct  350   IDKADTATPTPDSWQFL--------QTPPLQKHHLSKKPGSSSSLQHRKTSMKKPGSSDQ  401

Query  554   LEWARG-DGLKATKELRESLSNETHLWFLKFLDASLDVGF---------QVnnnnnkenk  405
              EWA+G D  K   ELR+ L +ET  WFL FL  +L++GF         Q+     KE  
Sbjct  402   AEWAKGDDASKEALELRKLLESETQSWFLGFLADALEIGFRCGGGGGGGQLEKKGFKEVG  461

Query  404   sKGR-QEEANHIGLTLSLLKQANEWLDKM-----MMRGSLELGSEMHGFVEKLKQKVYGC  243
             S  R  E+ N I LTLSLLKQA EWLDK+        G+     ++   V+ LKQKVYGC
Sbjct  462   SAARIVEQNNQIALTLSLLKQATEWLDKVRSAAAGGGGAPPGSEKLVESVDGLKQKVYGC  521

Query  242   LLVHVDSAASALDTRS  195
             LL+H+DSAASAL+TR+
Sbjct  522   LLLHIDSAASALETRN  537



>ref|XP_006297474.1| hypothetical protein CARUB_v10013495mg [Capsella rubella]
 gb|EOA30372.1| hypothetical protein CARUB_v10013495mg [Capsella rubella]
Length=505

 Score =   345 bits (886),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 242/528 (46%), Positives = 324/528 (61%), Gaps = 39/528 (7%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLLQTIN+  +K+RGEYRSVLLQVI IVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPRVLIKLLQTINT-NIKVRGEYRSVLLQVIGIVPALAGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+L   DN+LILNNKL LGQ FYVD++E GTPVPV++GVRPI GRHPF G+PKDLM
Sbjct  60    HSTYVSLRNEDNELILNNKLGLGQFFYVDKLEAGTPVPVMVGVRPISGRHPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkK-IVIKEEKVGVASRYMQGV-----  1227
             QM+  +     + +  S K  +   ++   + +K +  VIKEEK GVASRYM+G+     
Sbjct  120   QMLIPSETTSLQEENNSQKKKDGERSNKVENLRKHQPFVIKEEKTGVASRYMKGISNPKT  179

Query  1226  --LTTAQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTP--SARSDALLTSDST  1059
                 ++   +    E  +    + V G  +GKQ+E   QAR   P  S  S AL      
Sbjct  180   NGSDSSSGGSNNESETGSIMATKKVAGLAKGKQREHTNQARQAGPPQSRPSTAL------  233

Query  1058  IINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKK  879
                   T   PK+ +      VN+++    +   SS    WSSLP NL K GKGMLR + 
Sbjct  234   ------TKAEPKKLSLSST--VNYIT----RKSSSSEDASWSSLPINLSKMGKGMLRRRN  281

Query  878   lasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK---K  708
             +A+LIA E Q EA+AA +L++C+S+FADL S++SP++PH S+  FF L ++++Q +    
Sbjct  282   IAALIATEVQREALAASHLIKCISIFADLSSNSSPKSPHTSLRNFFTLQSILDQAQVTTA  341

Query  707   ALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGL  528
             A  D     +++      PD       +   +  LKPSK   E     AEKLEW +G+G 
Sbjct  342   APKDKPIQPVNINSLCLEPDKLRKKASLTSSRATLKPSKALTE-----AEKLEWVKGNGT  396

Query  527   KATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR-QEEANHIGLTLSLL  351
             +  KELR +L  ET  WFLKFL+ +LD GF  + +  K         E  NHI  TLS L
Sbjct  397   EEIKELRNTLKQETRSWFLKFLEDALDTGFHASVSEKKGKTKGAHPAEPENHITETLSQL  456

Query  350   KQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
             ++ANEWL+K+         S +   +E+LK+K+Y CLL++VDSAASA+
Sbjct  457   RKANEWLEKVKSDHHSSDSSLLEN-IERLKKKIYSCLLLYVDSAASAI  503



>ref|XP_010501681.1| PREDICTED: uncharacterized protein LOC104778976 isoform X1 [Camelina 
sativa]
Length=508

 Score =   337 bits (864),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 246/530 (46%), Positives = 321/530 (61%), Gaps = 40/530 (8%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLLQT+N+  +K+RGEYRSVLLQVI IVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPKVLIKLLQTMNT-NIKVRGEYRSVLLQVIGIVPALAGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+L   DN+LILNNKL LGQ FYVD++E GTPVPV++GVRPI GRHPF G+PKDLM
Sbjct  60    HSTYVSLRNEDNELILNNKLGLGQFFYVDKLEAGTPVPVVVGVRPISGRHPFVGNPKDLM  119

Query  1388  QMM---EAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGV---  1227
             QM+   E     E    +E  +     SN   N +K +  VIKEEK GVASRYM+G+   
Sbjct  120   QMLVPNETTPLQEENHSQEKVQKDGERSNKVENLRKHQPFVIKEEKTGVASRYMKGISNP  179

Query  1226  LTTAQMKAKGSDenenngggqgvvgGL-----RGKQQEIKVQAR-PTTPSARSDALLTSD  1065
              T+    + G    E   G   V   L     +GKQ+E K Q R P  P +R        
Sbjct  180   KTSGSDSSSGGSNTEGETGSIMVTKKLGGGLAKGKQREHKDQTRQPGPPQSRPAT-----  234

Query  1064  STIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRM  885
                     T   PK+ +      VN+++  +     SS    WSSLP NL K GKG+LR 
Sbjct  235   ------APTKAEPKKLSLSST--VNYINKKS----CSSEDASWSSLPVNLSKMGKGILRR  282

Query  884   KKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK--  711
             + +A+LIA E Q EA+AA +L++C+SMFADL S+ASP+NPH S+  FF L ++++Q +  
Sbjct  283   RNIAALIATEVQKEALAASHLIKCISMFADLSSNASPKNPHTSLKNFFTLQSILDQAQAT  342

Query  710   -KALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGD  534
               A  D     +++      P+       +   +  +KP K   E     AEKLEW +G+
Sbjct  343   AAASKDKSIQPVNIHSLWTEPEKLSKKASLTSSRATMKPPKTLTE-----AEKLEWVKGN  397

Query  533   GLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR-QEEANHIGLTLS  357
             G +  +ELR +L  ET  WFLKFL+ +LD GF  +    K      +  E  NHI  TLS
Sbjct  398   GTEEIRELRNTLKRETRSWFLKFLEDALDSGFHASVLEKKGKTKGAQPAEPENHITETLS  457

Query  356   LLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
              LKQANEWL+K+         S +   +E+LK+K+Y CLL++VDSAASA+
Sbjct  458   QLKQANEWLEKVKSDNHSSDSSLLEN-IERLKKKIYSCLLLYVDSAASAI  506



>ref|XP_009408920.1| PREDICTED: uncharacterized protein LOC103991262 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408928.1| PREDICTED: uncharacterized protein LOC103991262 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408936.1| PREDICTED: uncharacterized protein LOC103991262 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408946.1| PREDICTED: uncharacterized protein LOC103991262 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408954.1| PREDICTED: uncharacterized protein LOC103991262 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408963.1| PREDICTED: uncharacterized protein LOC103991262 [Musa acuminata 
subsp. malaccensis]
Length=535

 Score =   338 bits (866),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 230/544 (42%), Positives = 324/544 (60%), Gaps = 39/544 (7%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVLIKLL+ +N+  +KI GEYRSVLLQVISIVPA++GSELWPDHGFFIKVSDSS
Sbjct  1     MASLTPGVLIKLLKNLNT-DIKICGEYRSVLLQVISIVPALTGSELWPDHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DNDLIL NKLQLGQ  Y+D++E GTPVPVL+GVRP+PGR+P  G+PKDLM
Sbjct  60    HSTYVSLSKDDNDLILMNKLQLGQFIYIDKVEAGTPVPVLVGVRPVPGRNPCIGNPKDLM  119

Query  1388  QMM--EAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTA  1215
              M+    A +    +K  S    +           K ++ IKEEK  VASRYMQGVL + 
Sbjct  120   NMLVFSDASDTADHLKNTS---RSYELFEGEKESPKHRVDIKEEKNVVASRYMQGVLRS-  175

Query  1214  QMKAKGSDenenngggqgvvgGLRGKQQEIK-----------VQARPTTPSARSD-----  1083
              +K+ GS+    N   +     +  +++ I            +Q +PT P  ++      
Sbjct  176   NVKSSGSESYSINDKIEENSSVIEPEKKTIPSRVKHETKRQVLQPKPTIPCIQNKTVNEK  235

Query  1082  -----ALLTSDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPN  918
                  A L  D+  +  ++  + P       +  ++   ++N++ +  + P  W SLP +
Sbjct  236   QENYVATLKDDAKPLKNMSVKSNPIIKKMSSSNTMSSSLSSNKRRVADAIP--WDSLPAS  293

Query  917   LVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFA  738
             L+ PGKGM++ K++A L+AAEAQ EA  A  L++ LS+FADL  S+  E  H+S+ KFF+
Sbjct  294   LINPGKGMVKRKEIAFLVAAEAQREAATAAALVKGLSIFADLRKSSMEEKLHVSLAKFFS  353

Query  737   LHALIEQPKKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLG-GA  561
             LH L+ QP  A++    T +     K+        I         +    P   +   G 
Sbjct  354   LHQLLNQPNIAIEKDNLTGIP----KQLAQEGEKLIMKTALPNSRRVLNAPNPAEASCGN  409

Query  560   EKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGF--QVnnnnnkenksKGRQE  387
             EK+ W+RGDGLK  +ELR +L  E+  WFL FL+ +L+ GF  +       +++S G  +
Sbjct  410   EKITWSRGDGLKEIQELRANLRQESRSWFLSFLENALNSGFYAESRTKKGVKDRSGGHSK  469

Query  386   EANH-IGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASA  210
             E++  I +TLS LK A+ WLD++      E    + G +++LKQK+Y CLL HV+SAASA
Sbjct  470   ESDELIAVTLSQLKDASTWLDQLRKDAGTE-ADGLLGTIDRLKQKIYVCLLEHVESAASA  528

Query  209   LDTR  198
             L+ R
Sbjct  529   LEVR  532



>ref|XP_010501695.1| PREDICTED: uncharacterized protein LOC104778976 isoform X3 [Camelina 
sativa]
Length=507

 Score =   335 bits (860),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 244/529 (46%), Positives = 321/529 (61%), Gaps = 39/529 (7%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLLQT+N+  +K+RGEYRSVLLQVI IVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPKVLIKLLQTMNT-NIKVRGEYRSVLLQVIGIVPALAGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+L   DN+LILNNKL LGQ FYVD++E GTPVPV++GVRPI GRHPF G+PKDLM
Sbjct  60    HSTYVSLRNEDNELILNNKLGLGQFFYVDKLEAGTPVPVVVGVRPISGRHPFVGNPKDLM  119

Query  1388  QMM--EAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGV---L  1224
             QM+       ++ E   +  +     SN   N +K +  VIKEEK GVASRYM+G+    
Sbjct  120   QMLVPNETTPLQEENHSQEKQKDGERSNKVENLRKHQPFVIKEEKTGVASRYMKGISNPK  179

Query  1223  TTAQMKAKGSDenenngggqgvvgGL-----RGKQQEIKVQAR-PTTPSARSDALLTSDS  1062
             T+    + G    E   G   V   L     +GKQ+E K Q R P  P +R         
Sbjct  180   TSGSDSSSGGSNTEGETGSIMVTKKLGGGLAKGKQREHKDQTRQPGPPQSRPAT------  233

Query  1061  TIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMK  882
                    T   PK+ +      VN+++  +     SS    WSSLP NL K GKG+LR +
Sbjct  234   -----APTKAEPKKLSLSST--VNYINKKS----CSSEDASWSSLPVNLSKMGKGILRRR  282

Query  881   KlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK---  711
              +A+LIA E Q EA+AA +L++C+SMFADL S+ASP+NPH S+  FF L ++++Q +   
Sbjct  283   NIAALIATEVQKEALAASHLIKCISMFADLSSNASPKNPHTSLKNFFTLQSILDQAQATA  342

Query  710   KALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDG  531
              A  D     +++      P+       +   +  +KP K   E     AEKLEW +G+G
Sbjct  343   AASKDKSIQPVNIHSLWTEPEKLSKKASLTSSRATMKPPKTLTE-----AEKLEWVKGNG  397

Query  530   LKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR-QEEANHIGLTLSL  354
              +  +ELR +L  ET  WFLKFL+ +LD GF  +    K      +  E  NHI  TLS 
Sbjct  398   TEEIRELRNTLKRETRSWFLKFLEDALDSGFHASVLEKKGKTKGAQPAEPENHITETLSQ  457

Query  353   LKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
             LKQANEWL+K+         S +   +E+LK+K+Y CLL++VDSAASA+
Sbjct  458   LKQANEWLEKVKSDNHSSDSSLLEN-IERLKKKIYSCLLLYVDSAASAI  505



>ref|XP_010501688.1| PREDICTED: uncharacterized protein LOC104778976 isoform X2 [Camelina 
sativa]
Length=507

 Score =   335 bits (858),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 244/529 (46%), Positives = 320/529 (60%), Gaps = 39/529 (7%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLLQT+N+  +K+RGEYRSVLLQVI IVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPKVLIKLLQTMNT-NIKVRGEYRSVLLQVIGIVPALAGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+L   DN+LILNNKL LGQ FYVD++E GTPVPV++GVRPI GRHPF G+PKDLM
Sbjct  60    HSTYVSLRNEDNELILNNKLGLGQFFYVDKLEAGTPVPVVVGVRPISGRHPFVGNPKDLM  119

Query  1388  QMM--EAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGV---L  1224
             QM+       ++ E   +        SN   N +K +  VIKEEK GVASRYM+G+    
Sbjct  120   QMLVPNETTPLQEENHSQEKVKDGERSNKVENLRKHQPFVIKEEKTGVASRYMKGISNPK  179

Query  1223  TTAQMKAKGSDenenngggqgvvgGL-----RGKQQEIKVQAR-PTTPSARSDALLTSDS  1062
             T+    + G    E   G   V   L     +GKQ+E K Q R P  P +R         
Sbjct  180   TSGSDSSSGGSNTEGETGSIMVTKKLGGGLAKGKQREHKDQTRQPGPPQSRPAT------  233

Query  1061  TIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMK  882
                    T   PK+ +      VN+++  +     SS    WSSLP NL K GKG+LR +
Sbjct  234   -----APTKAEPKKLSLSST--VNYINKKS----CSSEDASWSSLPVNLSKMGKGILRRR  282

Query  881   KlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK---  711
              +A+LIA E Q EA+AA +L++C+SMFADL S+ASP+NPH S+  FF L ++++Q +   
Sbjct  283   NIAALIATEVQKEALAASHLIKCISMFADLSSNASPKNPHTSLKNFFTLQSILDQAQATA  342

Query  710   KALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDG  531
              A  D     +++      P+       +   +  +KP K   E     AEKLEW +G+G
Sbjct  343   AASKDKSIQPVNIHSLWTEPEKLSKKASLTSSRATMKPPKTLTE-----AEKLEWVKGNG  397

Query  530   LKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR-QEEANHIGLTLSL  354
              +  +ELR +L  ET  WFLKFL+ +LD GF  +    K      +  E  NHI  TLS 
Sbjct  398   TEEIRELRNTLKRETRSWFLKFLEDALDSGFHASVLEKKGKTKGAQPAEPENHITETLSQ  457

Query  353   LKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
             LKQANEWL+K+         S +   +E+LK+K+Y CLL++VDSAASA+
Sbjct  458   LKQANEWLEKVKSDNHSSDSSLLEN-IERLKKKIYSCLLLYVDSAASAI  505



>ref|XP_010501699.1| PREDICTED: uncharacterized protein LOC104778976 isoform X4 [Camelina 
sativa]
Length=506

 Score =   333 bits (854),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 241/528 (46%), Positives = 321/528 (61%), Gaps = 38/528 (7%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLLQT+N+  +K+RGEYRSVLLQVI IVPA++GSELWP+ GFFIKVSDSS
Sbjct  1     MASLTPKVLIKLLQTMNT-NIKVRGEYRSVLLQVIGIVPALAGSELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+L   DN+LILNNKL LGQ FYVD++E GTPVPV++GVRPI GRHPF G+PKDLM
Sbjct  60    HSTYVSLRNEDNELILNNKLGLGQFFYVDKLEAGTPVPVVVGVRPISGRHPFVGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkK-IVIKEEKVGVASRYMQGV---LT  1221
             QM+        + +  S +  +   ++   + +K +  VIKEEK GVASRYM+G+    T
Sbjct  120   QMLVPNETTPLQEENHSQEKKDGERSNKVENLRKHQPFVIKEEKTGVASRYMKGISNPKT  179

Query  1220  TAQMKAKGSDenenngggqgvvgGL-----RGKQQEIKVQAR-PTTPSARSDALLTSDST  1059
             +    + G    E   G   V   L     +GKQ+E K Q R P  P +R          
Sbjct  180   SGSDSSSGGSNTEGETGSIMVTKKLGGGLAKGKQREHKDQTRQPGPPQSRPAT-------  232

Query  1058  IINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKK  879
                   T   PK+ +      VN+++  +     SS    WSSLP NL K GKG+LR + 
Sbjct  233   ----APTKAEPKKLSLSST--VNYINKKS----CSSEDASWSSLPVNLSKMGKGILRRRN  282

Query  878   lasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK---K  708
             +A+LIA E Q EA+AA +L++C+SMFADL S+ASP+NPH S+  FF L ++++Q +    
Sbjct  283   IAALIATEVQKEALAASHLIKCISMFADLSSNASPKNPHTSLKNFFTLQSILDQAQATAA  342

Query  707   ALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGL  528
             A  D     +++      P+       +   +  +KP K   E     AEKLEW +G+G 
Sbjct  343   ASKDKSIQPVNIHSLWTEPEKLSKKASLTSSRATMKPPKTLTE-----AEKLEWVKGNGT  397

Query  527   KATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR-QEEANHIGLTLSLL  351
             +  +ELR +L  ET  WFLKFL+ +LD GF  +    K      +  E  NHI  TLS L
Sbjct  398   EEIRELRNTLKRETRSWFLKFLEDALDSGFHASVLEKKGKTKGAQPAEPENHITETLSQL  457

Query  350   KQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
             KQANEWL+K+         S +   +E+LK+K+Y CLL++VDSAASA+
Sbjct  458   KQANEWLEKVKSDNHSSDSSLLEN-IERLKKKIYSCLLLYVDSAASAI  504



>ref|XP_010487204.1| PREDICTED: uncharacterized protein LOC104765224 [Camelina sativa]
Length=548

 Score =   325 bits (833),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 238/544 (44%), Positives = 316/544 (58%), Gaps = 57/544 (10%)
 Frame = -1

Query  1772  SHSYLSLTMASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGF  1593
             SH+     MASL P VLIKLLQT+N+  +K+RGEYRSVLLQVI IVPA++GSELWP+ GF
Sbjct  38    SHTVQYSRMASLIPRVLIKLLQTMNT-NIKVRGEYRSVLLQVIGIVPALAGSELWPNQGF  96

Query  1592  FIKVSDSSHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPF  1413
             FIKVSDSSHSTYV+L   DN+LILNNKL LGQ FYVD++E GTPVPV++GVRPI GRHPF
Sbjct  97    FIKVSDSSHSTYVSLRNEDNELILNNKLGLGQFFYVDKLEAGTPVPVVVGVRPISGRHPF  156

Query  1412  FGSPKDLMQMM--EAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRY  1239
              G+PKDLMQM+       ++ E   +  +   + SN   N +K +  +IKEEK GVASRY
Sbjct  157   VGNPKDLMQMLVPNETTPLQEENHSQKKEKDAARSNMVENLRKHQPFIIKEEKTGVASRY  216

Query  1238  MQGV-------LTTAQMKAKGSDenenngggqgvvgGLRGKQQEIK--------VQARPT  1104
             M+G+         ++   +    E  +    + + G  +GKQ+E K        +Q+RP 
Sbjct  217   MKGISNPRTSGSDSSSGGSNNEGETGSIMVTKKLGGLAKGKQREHKDQARQPVPLQSRPA  276

Query  1103  TPSARSDALLTSDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLP  924
             T   +++    S S+ +N +N                        +   SS    WSSLP
Sbjct  277   TAPTKAEPKKLSLSSTVNYIN------------------------KKSSSSEDASWSSLP  312

Query  923   PNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKF  744
              NL K GKGMLR + +A LIA E Q EA+AA +L++C+SMFADL S+ASP+NPH S+  F
Sbjct  313   VNLSKMGKGMLRRRHIAGLIATEVQREALAASHLIKCISMFADLSSNASPKNPHTSLRNF  372

Query  743   FALHALIEQPKKALDDYCFTKLSVTDNKKTPDSNHl-----gigigigkgklkpskppLE  579
             F L ++++Q +        T  +  D    P + H                   +     
Sbjct  373   FTLQSILDQTQA-------TAAASKDKSIQPVNIHALWTEPEKLSKKASLTSSRATIKPS  425

Query  578   LDLGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksK  399
               L  AEKLEW +G+G +  KEL  +L  ET  WFLKFL+ +LD GF  + +  K     
Sbjct  426   KTLTEAEKLEWIKGNGTEEIKELINTLKRETRSWFLKFLEDALDTGFHASVSEKKGKTKG  485

Query  398   GRQEEANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSA  219
                E  NHI  TLS LKQANEWLDK+         S +   +E+LK+K+Y CLL++VDSA
Sbjct  486   AEPE--NHITETLSQLKQANEWLDKVKSDNHSSDSSSLEN-IERLKKKIYSCLLLYVDSA  542

Query  218   ASAL  207
             ASA+
Sbjct  543   ASAI  546



>ref|XP_010465301.1| PREDICTED: uncharacterized protein LOC104745688 [Camelina sativa]
Length=543

 Score =   324 bits (830),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 242/542 (45%), Positives = 323/542 (60%), Gaps = 53/542 (10%)
 Frame = -1

Query  1772  SHSYLSLTMASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGF  1593
             SH+     MASL P VLIKLLQT+N+  +K+RGEYRSVLLQVI IVPA++GSELWP+ GF
Sbjct  33    SHTVQYSRMASLIPRVLIKLLQTMNT-NIKVRGEYRSVLLQVIGIVPALAGSELWPNQGF  91

Query  1592  FIKVSDSSHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPF  1413
             FIKVSDSSHSTYV+L   DN+LILNNKL LGQ FYVD++E GTPVPV++GVRPI GRHPF
Sbjct  92    FIKVSDSSHSTYVSLRNEDNELILNNKLGLGQFFYVDKLEAGTPVPVVVGVRPISGRHPF  151

Query  1412  FGSPKDLMQMM--EAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRY  1239
              G+PKDLMQM+       ++ E   +  +     SN   N +K +  VIKEEK GVASRY
Sbjct  152   VGNPKDLMQMLVPNETTPLQEENHSQKKEKDGERSNMVENLRKHQPFVIKEEKTGVASRY  211

Query  1238  MQGV-------LTTAQMKAKGSDenenngggqgvvgGLRGKQQEIK--------VQARPT  1104
             M+G+         ++   +    E  +    + + G  +GKQ+E K         Q+RP 
Sbjct  212   MKGISNPKTSGSDSSSGGSNNEGETGSIVVTKKLGGLAKGKQREHKDLARQPGPPQSRPA  271

Query  1103  TPSARSDALLTSDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLP  924
             T   +++    S S+ ++ +N                        +   SS    WSSLP
Sbjct  272   TAPTKAEPKKLSLSSTVSYIN------------------------KKSSSSEDASWSSLP  307

Query  923   PNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKF  744
              NL K GKGMLR + +A+LIA E Q EA+AA +L++C+SMFADL S+ASP+NPH S+  F
Sbjct  308   VNLSKMGKGMLRRRNIAALIATEVQREALAASHLIKCISMFADLSSNASPKNPHTSLRNF  367

Query  743   FALHALIEQPK---KALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELD  573
             F L +L++Q +    A  D     +++      P+       +   K  +KPSK   E  
Sbjct  368   FTLQSLLDQAQATTAASKDKSIQPVNIHSLWTEPEKLSKKASLTSSKATMKPSKTLTE--  425

Query  572   LGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR  393
                AEKLEW +G+G +  +ELR +L  ET  WFLKFL+ +LD GF  + +  K       
Sbjct  426   ---AEKLEWVKGNGTEEIRELRNTLKRETRSWFLKFLEDALDTGFHASVSEKKGKTKGAE  482

Query  392   QEEANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAAS  213
              E  NHI  TLS LKQANEWL+K+         S +   +E+LK+K+Y CLL++VDSAAS
Sbjct  483   PE--NHITETLSQLKQANEWLEKVKSDNHSSDSSLLEN-IERLKKKIYSCLLLYVDSAAS  539

Query  212   AL  207
             A+
Sbjct  540   AI  541



>gb|EPS65300.1| hypothetical protein M569_09484, partial [Genlisea aurea]
Length=515

 Score =   321 bits (823),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 217/544 (40%), Positives = 321/544 (59%), Gaps = 57/544 (10%)
 Frame = -1

Query  1745  ASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSSH  1566
             ASL PGVLI+LL+T++S   K+RG +RSVLLQV++IVPAI+GS+ WPDHGFFIK+SDSSH
Sbjct  1     ASLVPGVLIELLRTVDSDH-KVRGRHRSVLLQVVAIVPAITGSDFWPDHGFFIKISDSSH  59

Query  1565  STYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPG---RHPFFGSPKD  1395
             STYV+LS+ D++LILNN+L+LGQ FYVDR+  G PVPVL+G+RP+PG   RHPF G+PKD
Sbjct  60    STYVSLSRDDDELILNNELRLGQFFYVDRLRSGIPVPVLVGIRPLPGLRQRHPFVGNPKD  119

Query  1394  LMQMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTA  1215
             LMQ++E  G  +        + S+S+   +     KKK+VI+EEK  V SRYM+ V++ A
Sbjct  120   LMQLLEVKGAAQ--------QRSSSSMEVSQTQSGKKKVVIREEKRVVGSRYMKAVVSKA  171

Query  1214  QMKAKGSDenenngggqgvvgGLRGKQQ---EIKVQARPTTPSARS-------------D  1083
             +   K           +     LR + Q   ++ +Q+  +  + +S             +
Sbjct  172   KPDVKDE--------ARSSSETLRRQSQHRHQVWIQSSSSNIAIKSGEKKHNTILLEMFN  223

Query  1082  ALLTSD-STIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKP  906
              L +S  S     V     P  T K  N   + + N +     S   + WSSLP  LVKP
Sbjct  224   HLFSSTISRFSRDVKDAQNPYHTAKATNKQPDIIRNKH-----SKETIQWSSLPTALVKP  278

Query  905   GKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHAL  726
             GKG+++ + LAS++AAEA+ EA  A ++ +CL MFADL SSA+ E PH   +KF+AL  L
Sbjct  279   GKGLIKRRNLASMVAAEAEKEANVASDIAKCLEMFADLISSATSEKPHAHFSKFYALQQL  338

Query  725   IEQ-----PKKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGA  561
             I++     P +  +D    K S  + +K+       I     +GK     P     L  +
Sbjct  339   IDKRRITFPVEEENDGSIRKNSTQEKEKS------SIKCVKSQGKSINRSPESMQQLTVS  392

Query  560   EKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQ---  390
             +++EW++ +G    +E+ + L++E   WF+ FLD ++D G +   N ++++  +      
Sbjct  393   DRVEWSKENGGHYVREVLKKLTDEMRFWFMNFLDEAIDNGLKGGKNIHEKHGKESSNQFL  452

Query  389   EEANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASA  210
             E+ N I LTLS LKQA EWLDK+    S    +E    V+ LK+K+Y CLL++ DSAAS+
Sbjct  453   EDDNSIALTLSQLKQATEWLDKIRS-SSSSESTEYFERVDSLKKKLYSCLLIYADSAASS  511

Query  209   LDTR  198
             ++ +
Sbjct  512   IEKK  515



>ref|XP_006649504.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006649505.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Oryza 
brachyantha]
Length=564

 Score =   306 bits (785),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 219/573 (38%), Positives = 307/573 (54%), Gaps = 65/573 (11%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+K+L+ INS  VK+ GEYRS+LLQVISIVPAI+GSELWPDHGFFIKVSDSS
Sbjct  1     MASLTPGVLLKVLKNINS-DVKVCGEYRSILLQVISIVPAITGSELWPDHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LIL+NKLQLGQ  YV++++   PVP+L+GVRP+PGR+P  G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILSNKLQLGQFIYVEKVQSSIPVPILVGVRPVPGRNPCIGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLT----  1221
             QM   +G  E  + ++     ++  + +     ++K+VIKE+K  VASRYM G+ +    
Sbjct  120   QMSTPSGVSEA-LDQQRKAAKSAELSESEKENSQRKVVIKEQKAVVASRYMLGISSNNSK  178

Query  1220  ----TAQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDSTII  1053
                  + + +  S+   +           + K QE K Q RP TPS RS A + S    I
Sbjct  179   ITNLNSSIDSDKSNGGSSICSANQKSAPPKFK-QEPKPQERPNTPS-RSPAKIVSAKQEI  236

Query  1052  NG---VNTNTLPK------------RTNKQENVDVN------------------------  990
             N     N+ +LP             + +K+E+                            
Sbjct  237   NKDTHKNSASLPSQNGSAVVKKQIPKESKRESASAKSSPPKIYRTSPPTPTPPLPSTTSP  296

Query  989   FMSNNNRQNILS--------SHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeama  834
                N     + S        +  V W SLP +L+K GK ++R K +A ++AAEAQ EA A
Sbjct  297   AKPNGTSSTVTSVLNVKRRVTETVSWDSLPTSLIKSGKAVVRRKNIALVVAAEAQREATA  356

Query  833   aknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKKT  654
             A +L++ L +FA++  SA  E+PH +ITKFF L  LI Q      DY    +  +  +K 
Sbjct  357   AASLVKGLGIFAEIRKSAE-EDPHATITKFFQLSRLIIQQSVVWKDYSSDSVKESRPEKE  415

Query  653   PDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGLKATKELRESLSNETHLWF  474
               S                       D   +EK++WAR DG K        L  E+  WF
Sbjct  416   KPSRKASASQNKTVASSTTKNSD---DAYTSEKIDWAREDGFKEICRSWVILKKESQSWF  472

Query  473   LKFLDASLDVGFQVnnnnnkenksKGRQEEAN-HIGLTLSLLKQANEWLDKMMMRGSLEL  297
             L FL+ +L+ GF+    N    +     +  +  I + LS LK+ + WLD++        
Sbjct  473   LNFLEDALEAGFKFEGQNKNTKERVRHSKGGDGQIAVRLSQLKETSNWLDQLHAEADKSQ  532

Query  296   GSEMHGFVEKLKQKVYGCLLVHVDSAASALDTR  198
              + +   +E+LKQKVY CLL  V++AASAL+ R
Sbjct  533   DA-LVATIEQLKQKVYTCLLGTVETAASALEAR  564



>ref|XP_002468395.1| hypothetical protein SORBIDRAFT_01g045130 [Sorghum bicolor]
 gb|EER95393.1| hypothetical protein SORBIDRAFT_01g045130 [Sorghum bicolor]
Length=566

 Score =   300 bits (769),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 216/573 (38%), Positives = 303/573 (53%), Gaps = 63/573 (11%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+K+L+ INS  VK+ GEYRS+LLQVISIVPAI+GSELWPDHGFFIKVSDSS
Sbjct  1     MASLTPGILLKVLKNINS-DVKVCGEYRSILLQVISIVPAITGSELWPDHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LIL+NKLQLGQ  YV++++   PVPVL+GVRP+PGR+P  G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILSNKLQLGQFIYVEKVQSSIPVPVLVGVRPVPGRNPCIGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYM------QGV  1227
             QM   +G ME  +  +   + +++ + +     ++K+VIKE+K  VASRYM       G 
Sbjct  120   QMSTPSGVMEA-LDHQRKTSKSADLSESEKENLQRKVVIKEQKTVVASRYMLGVSSNNGK  178

Query  1226  LTTAQMKAKGSDenenngggqgvvgGLRGK-QQEIKVQARPTTPSARSDALLTSDSTIIN  1050
             +T           N  +   +     +  K +QE K Q RP   S  +  L+++   I  
Sbjct  179   ITNLNSSIDSDKSNGGSTISESNQKSVAPKVRQEAKPQERPNNTSPSNAKLVSTKQEISK  238

Query  1049  GVNTNT---------------LPKRTNKQENVDVN-----FMS------------NNNRQ  966
                 N+               +PK   K+   +       + S            N+  +
Sbjct  239   DTRKNSGTSPSPNGSAVVKKQMPKEGKKESATERKSPPKLYRSSPMPARTSPTKLNSPAK  298

Query  965   NILSSHPV--------------LWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaak  828
                ++ PV               W SLP +L+K GK ++R K +A ++AAEAQ EA AA 
Sbjct  299   QTGNTGPVPSAATVKRRVTETISWDSLPTSLIKSGKAVVRRKNIALIVAAEAQREAAAAA  358

Query  827   nlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKKTPD  648
              L++ L +FA++  S S  +PH +ITKFF LH LI Q       Y          +  P+
Sbjct  359   YLVKGLGIFAEIRES-SEVDPHAAITKFFQLHRLIIQQSAVWKAYS----PEPSKESRPE  413

Query  647   SNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGLKATKELRESLSNETHLWFLK  468
                              +      D  G+EK EWAR DG K       +L  E+  WFL+
Sbjct  414   KEKPSRKASASHQNKAGNTAKNPEDAQGSEKTEWAREDGFKEICRSWIALKKESRSWFLR  473

Query  467   FLDASLDVGFQVnnnnnkenksKGRQEEAN---HIGLTLSLLKQANEWLDKMMMRGSLEL  297
             FL+ +L+ GF   +      +    Q +      I + LS LK+ + WLD++    +   
Sbjct  474   FLEDALESGFMFESQTKNTRERVRGQPKGGGDGRIAVRLSQLKETSNWLDQLQDEAADSS  533

Query  296   GSEMHGFVEKLKQKVYGCLLVHVDSAASALDTR  198
                +   VE+LKQKVY CLL  V++AASAL+ R
Sbjct  534   ADGLAETVEQLKQKVYKCLLGTVETAASALEGR  566



>gb|KFK38775.1| hypothetical protein AALP_AA3G158700 [Arabis alpina]
Length=477

 Score =   296 bits (758),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 220/538 (41%), Positives = 295/538 (55%), Gaps = 78/538 (14%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTP VLIKLLQT+N+  +K+RGEYRSVLLQ                           
Sbjct  1     MASLTPRVLIKLLQTMNT-NIKVRGEYRSVLLQ---------------------------  32

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
                       DN+LILNNKL LGQ FYVD++E GTPVPV++GVRPI GRHPF G+PKDLM
Sbjct  33    --------NEDNELILNNKLGLGQFFYVDKLEAGTPVPVMVGVRPISGRHPFVGNPKDLM  84

Query  1388  QMMEAA------GEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGV  1227
             QM+  +       E   + KK+ A      SN+  N ++ +  VIKEEK GVASRYM+GV
Sbjct  85    QMLVPSETTPLQEENHNKKKKDGA-----ISNAVDNQRRHQDFVIKEEKAGVASRYMKGV  139

Query  1226  -------LTTAQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTS  1068
                      ++   +    E       + V G  +GKQ+E K QAR   P     A    
Sbjct  140   SNPKGSGTDSSSGSSNNESETGLMMATKKVGGLAKGKQREHKDQARQVGPPQSRPAT---  196

Query  1067  DSTIINGVNTNTLPKRTNKQENVD-VNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGML  891
                      T   PK+     NV+ +N  SN       SS    WSSLP NL K GKGML
Sbjct  197   -------APTKAEPKKLPLSANVNYINRKSN-------SSEEASWSSLPVNLSKMGKGML  242

Query  890   RMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK  711
             R + +A+LI+ E Q EA+AA +L++C+SMFADL S ASP+NPH S+  FF L ++++Q +
Sbjct  243   RRRNMAALISTEVQREALAASHLVKCISMFADLSSRASPKNPHTSLKNFFNLQSVLDQAQ  302

Query  710   KALD--DYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARG  537
                +  D  F  ++V   K  P+   L     +   +           L  A+KLEW +G
Sbjct  303   VTAESKDKSFQLMNVHLLKTEPEK--LSKKASLTSNRTTTKSSKSSKTLTEADKLEWVKG  360

Query  536   DGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA-NHIGLTL  360
             +G +  KELR+++  ET  WFLKFL+ ++D GF  + +  K      RQ E  NHI  TL
Sbjct  361   NGTEEIKELRDTMKQETRSWFLKFLEDAIDTGFHASVSEKKGKTKGARQAEPDNHIAETL  420

Query  359   SLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRSHRN  186
             S LKQANEWL+K+         S +   +E+LK+K+Y CLL++VDSAASA++ +  R+
Sbjct  421   SQLKQANEWLEKVKNDHQSSDNSLLEN-IERLKKKIYSCLLLYVDSAASAMEYQQARD  477



>ref|XP_004985477.1| PREDICTED: microtubule-associated protein 1B-like isoform X1 
[Setaria italica]
 ref|XP_004985478.1| PREDICTED: microtubule-associated protein 1B-like isoform X2 
[Setaria italica]
 ref|XP_004985479.1| PREDICTED: microtubule-associated protein 1B-like isoform X3 
[Setaria italica]
Length=565

 Score =   293 bits (750),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 219/589 (37%), Positives = 309/589 (52%), Gaps = 96/589 (16%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+K+L+ INS  VK+ GEYRS+LLQVISIVPAI+GSELWPDHGFFIKVSDSS
Sbjct  1     MASLTPGILLKVLKNINS-DVKVCGEYRSILLQVISIVPAITGSELWPDHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LIL+NKLQLGQ  YV++++   PVPVL+GVRP+PGR+P  G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILSNKLQLGQFIYVEKVQSSIPVPVLVGVRPVPGRNPCIGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGV------  1227
             QM   +G ME  +  +   + +++ + +     ++K+VIKE+K  VASRYM GV      
Sbjct  120   QMSTPSGVMEA-LDHQRKTSKSADLSESEKENLQRKVVIKEQKSVVASRYMLGVSSNNGK  178

Query  1226  LTTAQMKAKGSDenenngggqgvvgGLRGK-QQEIKVQARPTTPSARSDALLTSDSTIIN  1050
             +T           N  +   +     +  K +QE K + RP   S  +  L+++   I  
Sbjct  179   ITNLNSSIDSDKSNGGSSVCESNQKSVAPKVRQEAKPKERPNNTSPSNAKLVSTKQEINK  238

Query  1049  GVNTNT---------------LPKRTNKQE-----------------------NVDVNFM  984
               + N+               +PK + K+                        N+     
Sbjct  239   DAHKNSGTSPSSNGSAVVKKQMPKESKKESATERRSPPKLYRSSPTPVRTSPTNLSSPAK  298

Query  983   SNNNRQNILS--------SHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaak  828
              N N   + S        +  + W SLP +L+K GK ++R K +A ++AAEAQ EA AA 
Sbjct  299   QNGNSGPVPSVSSVKRRVTEAISWDSLPTSLIKSGKAVVRRKNIALIVAAEAQREAAAAA  358

Query  827   nlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYC--------------  690
              L++ L +FA++  S S  +PH +ITKFF LH LI Q       Y               
Sbjct  359   YLVKGLGIFAEIRES-SEVDPHAAITKFFQLHRLIVQQSAVWKAYSPEPGKESRSEKEKP  417

Query  689   FTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGLKATKEL  510
               K+S + NK                     +      D   +EK+EWA+ DG K     
Sbjct  418   LRKVSASQNK-----------------AALCNTTKNSEDARTSEKMEWAQDDGFKEICRS  460

Query  509   RESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA--NHIGLTLSLLKQANE  336
               +L  E+  WFL FL+ +L+ GF+  +      +    Q +     I + LS LK+ + 
Sbjct  461   WVALKKESQSWFLSFLEDALESGFKFEDQTKNTRERLRGQSKGGDGRIAVRLSQLKETSN  520

Query  335   WLDKMMMRGSLELGSEMHGFV---EKLKQKVYGCLLVHVDSAASALDTR  198
             WLD++      E  +  +G V   E+LKQKVY CLL  V++AASAL+ R
Sbjct  521   WLDQLQD----EAVNPENGLVETIEQLKQKVYKCLLGTVETAASALEGR  565



>ref|XP_006843856.1| hypothetical protein AMTR_s00007p00263800 [Amborella trichopoda]
 gb|ERN05531.1| hypothetical protein AMTR_s00007p00263800 [Amborella trichopoda]
Length=586

 Score =   290 bits (743),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 233/603 (39%), Positives = 316/603 (52%), Gaps = 101/603 (17%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ++NS  V++ GEYRSVLLQVISIVPA++G ELWP+HGFF+KVSDSS
Sbjct  1     MASLTPGVLLKLLQSLNS-DVRVCGEYRSVLLQVISIVPALTGGELWPNHGFFVKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HS+YV+LSK DN+LIL +KLQLGQ  Y+D MEPGTPVP+++GVRP+PGRHP  G+PKDLM
Sbjct  60    HSSYVSLSKEDNELILTDKLQLGQFIYIDNMEPGTPVPIIVGVRPLPGRHPCVGTPKDLM  119

Query  1388  QMM----------------EAAGEMECEVKKES---AknsnsnsnsnsnskkkkKIVIKE  1266
              M+                E   E   +VK +     +       +  +   K KIVIKE
Sbjct  120   HMLVPLQDEKLPISLKGSKENDHEEVAKVKADEYKIGEVERETEVNGESENIKPKIVIKE  179

Query  1265  EKVGVASRYMQGVLTTAQMKA-------------KGSDenenngggq-------------  1164
             EKV VASRYMQG ++  ++               KG+     +                 
Sbjct  180   EKVTVASRYMQGCMSAKRVNGDSNGNEKAGLSEKKGAKVPPRSSESVVSSGNKGLRKSWD  239

Query  1163  -------------gvvgGLRGKQQEIKVQARPTTPSARSDAL-------LTSD--STIIN  1050
                             G L  K Q  +V+A  TTP+ +   L         SD    ++ 
Sbjct  240   GAGLSSNELKCKNSSTGKLETKGQAPRVKASSTTPTRKRPDLSFMKVEAAGSDIKEAVVA  299

Query  1049  GVNTNTLPKRTN--KQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKl  876
                 +  PK     KQ  +     SN  +    S   V W SLP NLVK GKG++R + L
Sbjct  300   PPKVSVAPKTQTLEKQARLLSTIASNAKK----SEGKVTWDSLPVNLVKLGKGIVRRRNL  355

Query  875   asliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPK-KALD  699
             ASL  AEA  EA AA+ L++CL +FA L +SA+ ENPH+SI+KFF+LH ++ QP   + +
Sbjct  356   ASLAVAEALQEASAAEALVKCLRIFASLHASAATENPHISISKFFSLHQILNQPPLSSQE  415

Query  698   DYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWAR-GDGLKA  522
                F K  +      P S        +G          + ++    E  E    GDG++ 
Sbjct  416   KPHFPKAPI------PPSPLRERPNKMGSQVPSKMPIKIHIETQPKEYNEGITIGDGIRE  469

Query  521   TKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKG--RQ----------EEAN  378
              ++LR+ L  ++ +WFL +L+  LD G Q+     +     G  R+          E+ N
Sbjct  470   IEDLRDLLVRDSEVWFLNYLEGPLDAGLQMPRLKGERKVPGGGLRKAPEDVDRKILEDGN  529

Query  377   HIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTR  198
              I + LS LK+ +EWLD +         SE    V +LK KVY CLL HV+SAAS L++R
Sbjct  530   QIAVALSHLKRVSEWLDSLG-------ASENKEVVSRLKHKVYSCLLGHVESAASVLESR  582

Query  197   SHR  189
               R
Sbjct  583   IDR  585



>ref|XP_008651556.1| PREDICTED: probable serine/threonine-protein kinase dyrk2 [Zea 
mays]
 ref|XP_008651558.1| PREDICTED: probable serine/threonine-protein kinase dyrk2 [Zea 
mays]
 ref|XP_008651563.1| PREDICTED: probable serine/threonine-protein kinase dyrk2 [Zea 
mays]
 ref|XP_008651570.1| PREDICTED: probable serine/threonine-protein kinase dyrk2 [Zea 
mays]
 ref|XP_008651575.1| PREDICTED: probable serine/threonine-protein kinase dyrk2 [Zea 
mays]
 tpg|DAA43709.1| TPA: hypothetical protein ZEAMMB73_099943 [Zea mays]
Length=572

 Score =   286 bits (731),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 213/576 (37%), Positives = 299/576 (52%), Gaps = 63/576 (11%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+K+L+ INS  VK+ GEYRS+LLQVISIVPAI+GSELWPDHGFFIKVSDSS
Sbjct  1     MASLTPGILLKVLKHINS-DVKVCGEYRSILLQVISIVPAITGSELWPDHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LIL+NKLQLGQ  YV++++   PVPVL+GVRP+PGR+P  G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILSNKLQLGQFIYVEKVQSSIPVPVLVGVRPVPGRNPCIGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYM------QGV  1227
             QM   +G ME  +  +   + +++ + +     ++K+VIKE+K  VASRYM       G 
Sbjct  120   QMSTPSGVMEA-LDHQRTTSKSADLSESEKENLQRKVVIKEQKTVVASRYMLGVSSNNGK  178

Query  1226  LTT--AQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDSTII  1053
             +T   + + ++ S+              L+ +Q E K Q R    S  +  L+++   I 
Sbjct  179   ITNLNSSIDSEKSNGGSTISESNKKSVALKVRQ-EAKPQERSNNTSPSNAKLVSTKQEIS  237

Query  1052  NGVNTN---------------TLPKRTNKQ------------------ENVDVNFMSNNN  972
                  N                +PK + K+                         +S   
Sbjct  238   KDTRKNIGTSPSPNGSAVVKKQMPKESKKEVATERRSPPKLHRSSPTPARTSPTKLSPAA  297

Query  971   RQNILS-------------SHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaa  831
             +QN  S             S  + W SLP +L+  GK ++R K +A ++AAEAQ EA AA
Sbjct  298   KQNGNSGPVSSVSTVKKRVSETISWDSLPTSLINSGKAVVRRKNIALIVAAEAQREAAAA  357

Query  830   knlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKKTP  651
               L++ L +F+++  S S  +P  +ITKFF LH LI Q       Y       +  +K  
Sbjct  358   AYLVKGLGIFSEIRES-SEVDPQAAITKFFELHRLIVQQSAVWKAYTPEPSKESRPEKEK  416

Query  650   DSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGLKATKELRESLSNETHLWFL  471
              S                          G+EK EWAR DG K        L  E+  WFL
Sbjct  417   PSRKASASHHHQNKAGTRDTAKNPEGAQGSEKTEWAREDGFKEICRSWIVLRKESRSWFL  476

Query  470   KFLDASLDVGFQVnnnnnkenksKGRQEEA-----NHIGLTLSLLKQANEWLDKMMMRGS  306
              FL+ +L+ GF       K  + + R +         I + LS LK+ + WLD+++   +
Sbjct  477   SFLEDALESGFMSEGQTTKNTRERVRGQPKPKGGDGRIAVLLSQLKETSNWLDQLLQDEA  536

Query  305   LELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTR  198
                   +   V++LKQKVY CLL  V++AASAL  R
Sbjct  537   DTSADGLAETVDQLKQKVYKCLLGTVETAASALGGR  572



>ref|XP_003558662.1| PREDICTED: uncharacterized protein LOC100833519 [Brachypodium 
distachyon]
 ref|XP_010229084.1| PREDICTED: uncharacterized protein LOC100833519 [Brachypodium 
distachyon]
 ref|XP_010229085.1| PREDICTED: uncharacterized protein LOC100833519 [Brachypodium 
distachyon]
Length=572

 Score =   282 bits (722),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 211/580 (36%), Positives = 314/580 (54%), Gaps = 75/580 (13%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+K+L+ INS  VK+ GEYRS+LLQVISIVPAI+GSELWPDHGFFIKVSDSS
Sbjct  1     MASLTPGILLKVLKNINS-DVKVCGEYRSILLQVISIVPAITGSELWPDHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LIL+NKLQLGQ  YV++++   PVP+L+GVR +PGR+PF G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILSNKLQLGQFIYVEKVQSSVPVPILVGVRAVPGRNPFIGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLT-TAQ  1212
             QM   +G +E  + ++      +  + +     ++K+VIKE+K GVASRYM G+ +   +
Sbjct  120   QMSTPSGVLEA-LDQQRRTTKPAELSESEKENSQRKVVIKEQKAGVASRYMLGISSNNGK  178

Query  1211  MKAKGSDenenngggqgvvgGLRGK--------QQEIKVQARPTTPSARSDALLTSDSTI  1056
             +    S  + +   G   V  L  K        +QE K Q +P   S     L+++   +
Sbjct  179   ITNLNSSVDSDKSNGGSSVCDLNHKLVSGATKVKQEPKSQEQPNITSPNHAKLISAKQEV  238

Query  1055  INGVNTNT-LPKRTNKQENVDVNFMSNNNRQNIL--SSHPVLWSSLPP------------  921
                 + N   P   N    V      ++ +++    SS P L+ S PP            
Sbjct  239   NKDTHKNNGRPPSQNGSAVVKKQMPKDSKKESATERSSPPKLYKSSPPTPARTSPSKVRM  298

Query  920   --------------------------------NLVKPGKGMLRMKKlasliaaeaqaeam  837
                                             +L+K GK ++R K +A ++AAEAQ EA 
Sbjct  299   AAKPNGTSNSAASVPTVKRRVTENISWDSLPTSLIKSGKAVVRRKTIALIVAAEAQREAT  358

Query  836   aaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKK  657
             AA +L++ L +FA++  S + E+ H ++ KFF L+ LI      +    F K +  ++ K
Sbjct  359   AAASLVKGLGIFAEIRQS-TEEDLHGTVNKFFQLNRLI------IQQNIFWKDNSQESGK  411

Query  656   T--PDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGLKATKELRESLSNETH  483
                P+       +   + K   S      D   + KLEWAR DG +  ++   +L  E+ 
Sbjct  412   ESRPEKEKPSRKVSASQNKAAGSTAKNPDDAYTSGKLEWAREDGFQEIRKSWVTLKKESQ  471

Query  482   LWFLKFLDASLDVGFQVnnnnnkenksKGRQEEA---NHIGLTLSLLKQANEWLDKMM--  318
              WFL FL+ +L+ GF+  +      + + R +       I + LS LK+ + WLD++   
Sbjct  472   SWFLNFLEDALESGFKFEDRTKNNTRERVRGQSKGGDGQIAVRLSQLKETSNWLDQLQSE  531

Query  317   MRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTR  198
             +  S ++  E    +E+LKQK Y CLL  V++AASAL++R
Sbjct  532   VDKSADVLVET---IERLKQKTYSCLLGTVETAASALESR  568



>ref|XP_008464803.1| PREDICTED: uncharacterized protein LOC103502603 isoform X2 [Cucumis 
melo]
Length=445

 Score =   274 bits (700),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 189/450 (42%), Positives = 271/450 (60%), Gaps = 26/450 (6%)
 Frame = -1

Query  1478  MEPGTPVPVLLGVRPIPGRHPFFGSPKDLMQMMEAAGEMECEVKKESAknsnsnsnsnsn  1299
             MEPGTPVP+L+G+RP+PGR PF G+PKDLMQMME +  +    ++  +       +    
Sbjct  1     MEPGTPVPILVGIRPVPGRQPFIGTPKDLMQMMEQSENLVQAYQEGKSGAKPKEMSEGKI  60

Query  1298  skkkkKIVIKEEKVGVASRYMQGVLTTAQMKA--------KGSDenenngggqgvvgGLR  1143
                + K+VIKEEK+ V+SRYMQGVL+ +            + ++  +  GG +  VG ++
Sbjct  61    ESIRHKVVIKEEKINVSSRYMQGVLSLSSRSGRFDSNAVRRSNENEDGEGGKKVAVGAVK  120

Query  1142  GKQQEIKVQARPTT-------PSARSDALLTSDSTIINGVNTNTLPKR--TNKQENVDVN  990
             GK  ++K Q +           S++++AL  S        ++ ++P +  + KQEN++VN
Sbjct  121   GKSNDLKGQVQAANLQNGLDEVSSKTEALQLSVKEASG--SSRSIPAKGTSTKQENLNVN  178

Query  989   FMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCL  810
              +  N R    SS  + W+SLP NL+K GKGM+R + +AS++A EAQ EA+AA +L++CL
Sbjct  179   CLP-NRRDKTHSSETISWASLPTNLLKTGKGMVRRRNIASMVAIEAQKEAIAAASLIKCL  237

Query  809   SMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKKTPDSNHlgi  630
             S+FADLCSSASPENP L +TKFF L  LI +   + D      L +T N   P++N    
Sbjct  238   SVFADLCSSASPENPQLPLTKFFTLQQLISET-NSKDGVKDKSLLLTANSSLPEANKSTK  296

Query  629   gigigkgklkpsk-ppLELDLGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDAS  453
             G  +   K   SK     ++L  +EK EWARGDG K    LR+ L  E+  WFL FL+ +
Sbjct  297   GSSLFMSKSASSKPAKAPIELRESEKQEWARGDGAKEITLLRDVLLKESTSWFLNFLEKA  356

Query  452   LDVGFQVnnnnnkenksKGRQ-EEANHIGLTLSLLKQANEWLDKMMMRGSLELGSE-MHG  279
             LD GF++ N + K   + G+Q E  NHI + LS LKQANEWLD+  ++ +L  G   +  
Sbjct  357   LDAGFRIGNQDKKGRNNAGQQIEVGNHIAVALSQLKQANEWLDR--LKDNLNSGDNGLRE  414

Query  278   FVEKLKQKVYGCLLVHVDSAASALDTRSHR  189
              +E+LKQKVY CLLVHV+SAASAL+ R  R
Sbjct  415   AIERLKQKVYSCLLVHVESAASALEGRFDR  444



>ref|XP_003522967.1| PREDICTED: uncharacterized protein LOC100775456 [Glycine max]
Length=185

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 139/175 (79%), Gaps = 6/175 (3%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL  GVL+KLLQ++NS  VK+ GEYRSVLLQVISIV A+SG ELWP+ GFFIKVSDSS
Sbjct  1     MASLVQGVLLKLLQSMNS-NVKVHGEYRSVLLQVISIVLALSGFELWPNQGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+ ILNNKLQLGQ FYVDR+E GT VP+L+GVRP+PGRHPF G+PKDLM
Sbjct  60    HSTYVSLSKEDNEFILNNKLQLGQFFYVDRIESGTLVPILVGVRPVPGRHPFEGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVL  1224
             QM+E +  +     K     S   + +  N   ++KIVIKEEKVGVASRYMQGVL
Sbjct  120   QMLEQSDNVGVNGSK-----SMDLTEAKENPSSRQKIVIKEEKVGVASRYMQGVL  169



>ref|NP_001049172.1| Os03g0181800 [Oryza sativa Japonica Group]
 gb|AAN65445.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF94319.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11086.1| Os03g0181800 [Oryza sativa Japonica Group]
 gb|EAZ25823.1| hypothetical protein OsJ_09663 [Oryza sativa Japonica Group]
 dbj|BAG91929.1| unnamed protein product [Oryza sativa Japonica Group]
Length=573

 Score =   223 bits (567),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 161/241 (67%), Gaps = 12/241 (5%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+K+L+ INS  VK+ GEYRS+LLQVISIVPAI+GSELWPDHGFFIKVSDSS
Sbjct  1     MASLTPGVLLKVLKNINS-DVKVCGEYRSILLQVISIVPAITGSELWPDHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LIL+NKLQLGQ  YV++++   PVPVL+GVRP+PGR+P  G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILSNKLQLGQFIYVEKVQSSIPVPVLVGVRPVPGRNPCIGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLT----  1221
             QM    G  E    +  A   ++  + +     ++K+VIKE+K  VASRYM G+ +    
Sbjct  120   QMSTPTGISEALAHQRKA-TKSAELSESEKENSQRKVVIKEQKAVVASRYMLGISSNNSK  178

Query  1220  ----TAQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDSTII  1053
                  + + +  S+   +           + K QE K Q RP TPS RS A + S    I
Sbjct  179   ITNLNSSIDSDKSNGGSSICSANQKSAPTKFK-QESKPQERPNTPS-RSPAKIVSAKQEI  236

Query  1052  N  1050
             N
Sbjct  237   N  237


 Score =   103 bits (257),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 90/254 (35%), Positives = 127/254 (50%), Gaps = 13/254 (5%)
 Frame = -1

Query  944  VLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENP  765
            V W SLP +L+K  K + R K +A ++AAEAQ EA AA +LL+ L +FA++  SA  E+P
Sbjct  328  VSWDSLPTSLIKSVKVVARRKTIALVVAAEAQREATAAASLLKGLGIFAEIRKSAE-EDP  386

Query  764  HLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskpp  585
            H +ITKFF L+ LI Q      DY    +  +  +K   S                    
Sbjct  387  HAAITKFFQLNRLIIQQSVFWKDYSSEPVKESRPEKEKPSRKASASQNKAVAGSTAKNSD  446

Query  584  LELDLGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenk  405
               D   +EK++WAR DG K        L  E+  WFL FL+ +L+ GF+    N    +
Sbjct  447  ---DAYTSEKIDWAREDGFKEISRSWIILKKESQSWFLSFLEDALEAGFKFEGQNKNTRE  503

Query  404  sKGRQEEA--NHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFV---EKLKQKVYGCL  240
                  +     I + LS LK+ + WLD++      E+       V   E+LKQKVY CL
Sbjct  504  RVRGHSKGGDGQIAVRLSQLKETSNWLDQLHS----EVDKSQDALVETIEQLKQKVYTCL  559

Query  239  LVHVDSAASALDTR  198
            L  V++AASAL+ R
Sbjct  560  LGTVETAASALEAR  573



>gb|EAY88795.1| hypothetical protein OsI_10268 [Oryza sativa Indica Group]
Length=573

 Score =   222 bits (565),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 161/241 (67%), Gaps = 12/241 (5%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+K+L+ INS  VK+ GEYRS+LLQVISIVPAI+GSELWPDHGFFIKVSDSS
Sbjct  1     MASLTPGILLKVLKNINS-DVKVCGEYRSILLQVISIVPAITGSELWPDHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LIL+NKLQLGQ  YV++++   PVPVL+GVRP+PGR+P  G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILSNKLQLGQFIYVEKVQSSIPVPVLVGVRPVPGRNPCIGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLT----  1221
             QM    G  E    +  A   ++  + +     ++K+VIKE+K  VASRYM G+ +    
Sbjct  120   QMSTPTGISEALAHQRKA-TKSAELSESEKENSQRKVVIKEQKAVVASRYMLGISSNNSK  178

Query  1220  ----TAQMKAKGSDenenngggqgvvgGLRGKQQEIKVQARPTTPSARSDALLTSDSTII  1053
                  + + +  S+   +           + K QE K Q RP TPS RS A + S    I
Sbjct  179   ITNLNSSIDSDKSNGGSSICSANQKSAPTKFK-QESKPQERPNTPS-RSPAKIVSAKQEI  236

Query  1052  N  1050
             N
Sbjct  237   N  237


 Score =   102 bits (255),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 90/254 (35%), Positives = 127/254 (50%), Gaps = 13/254 (5%)
 Frame = -1

Query  944  VLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENP  765
            V W SLP +L+K  K + R K +A ++AAEAQ EA AA +LL+ L +FA++  SA  E+P
Sbjct  328  VSWDSLPTSLIKSVKVVSRRKTIALVVAAEAQREATAAASLLKGLGIFAEIRKSAE-EDP  386

Query  764  HLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskpp  585
            H +ITKFF L+ LI Q      DY    +  +  +K   S                    
Sbjct  387  HAAITKFFQLNRLIIQQSIFWKDYSSEPVKESRPEKEKPSRKASASQNKAVAGSTAKNSD  446

Query  584  LELDLGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenk  405
               D   +EK++WAR DG K        L  E+  WFL FL+ +L+ GF+    N    +
Sbjct  447  ---DAYTSEKIDWAREDGFKEISRSWIILKKESQSWFLSFLEDALEAGFKFEGQNKNTRE  503

Query  404  sKGRQEEA--NHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFV---EKLKQKVYGCL  240
                  +     I + LS LK+ + WLD++      E+       V   E+LKQKVY CL
Sbjct  504  RVRGHSKGGDGQIAVRLSQLKETSNWLDQLHS----EVDKSQDALVETIEQLKQKVYTCL  559

Query  239  LVHVDSAASALDTR  198
            L  V++AASAL+ R
Sbjct  560  LGTVETAASALEAR  573



>ref|XP_010937291.1| PREDICTED: uncharacterized protein LOC105056691 isoform X2 [Elaeis 
guineensis]
Length=447

 Score =   210 bits (534),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 145/186 (78%), Gaps = 3/186 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVLIKLL+ INS  VK+ GEYRS+LLQVISIVPAI+GSELWPDHGFFIKVSDSS
Sbjct  1     MASLTPGVLIKLLKNINS-DVKVCGEYRSILLQVISIVPAITGSELWPDHGFFIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LIL NKLQLGQ  YVD++E GTPVP L+GVRP+PGR+P  G+PKDLM
Sbjct  60    HSTYVSLSKDDNELILTNKLQLGQFIYVDKIEAGTPVPALVGVRPVPGRNPCIGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGVLTTAQM  1209
              M+    ++      E+    +S+ +       K+++VIKEEKV VASRYMQG+ +T  +
Sbjct  120   HMI-VPSDIPQAQDNEANTFKSSDLSEGEKESPKRRVVIKEEKVVVASRYMQGISST-NI  177

Query  1208  KAKGSD  1191
             K+ G D
Sbjct  178   KSAGLD  183


 Score =   150 bits (379),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 127/213 (60%), Gaps = 17/213 (8%)
 Frame = -1

Query  812  LSMFADLCSSASPENPHLSITKFFALHALIEQPKKALD-DYCFT--KLSVTDNKKTPDSN  642
            LS+FADL  SA+ +NPH+S+TKFF+LH LI+QP  A+  DY F   K + +D  K    N
Sbjct  246  LSIFADLRKSATEDNPHVSLTKFFSLHRLIDQPNVAIQKDYSFQIHKEAPSDKAKLSRKN  305

Query  641  HlgigigigkgklkpskppLELDLGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFL  462
             L     +        +        G EKLEWARGDG K  +E+R +L  ET  WFL FL
Sbjct  306  SLPNSRNVINPPKFSEESY------GNEKLEWARGDGFKEIQEVRATLRKETQSWFLNFL  359

Query  461  DASLDVGFQVnnnnnkenksKG---RQEEANHIGLTLSLLKQANEWLDKMMMRGSLELGS  291
            + +LD GF   +   K  K +     +E    I +TLS LK AN+WL+++    S E+G+
Sbjct  360  EGALDTGFHAESRVKKGTKDRAAVHSKESDERIAVTLSQLKDANDWLEQL----SSEVGT  415

Query  290  EMHGFVEKLKQKVYGCLLVHVDSAASALDTRSH  192
            E    +++LKQK+Y CLL HV+SAASAL++RS+
Sbjct  416  EAET-IDRLKQKIYACLLGHVESAASALESRSN  447



>ref|XP_008650697.1| PREDICTED: uncharacterized protein LOC103631604 [Zea mays]
Length=250

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 134/174 (77%), Gaps = 2/174 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+K+L+ INS  VK+ GEYRS+LLQVISIVPAI+GSELW DHGFFI+VSDSS
Sbjct  1     MASLTPGILLKVLKNINS-DVKVCGEYRSILLQVISIVPAITGSELWLDHGFFIRVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LSK DN+LIL+NKLQL Q  YV++++   PVPVL+GV P+PGR+P  G+PKDLM
Sbjct  60    HSTYVSLSKEDNELILSNKLQLEQFIYVEKVQSSIPVPVLVGVHPVPGRNPCIGNPKDLM  119

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVASRYMQGV  1227
             QM    G  E     +   + +++ + +     ++K++I+E+K  VASRYM GV
Sbjct  120   QMSTPFGITEAP-DHQWRTSKSADMSESEKENLQRKVIIEEQKTVVASRYMLGV  172



>gb|KDP40663.1| hypothetical protein JCGZ_24662 [Jatropha curcas]
Length=287

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 177/286 (62%), Gaps = 17/286 (6%)
 Frame = -1

Query  1016  NKQENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeam  837
             NK E+ ++  +SN++ +N  +S    W+SLP  L K GKGMLR + LASL+AAEAQ EA 
Sbjct  8     NKLESTNLISLSNSSDKN-FASESTSWTSLPAGLSKLGKGMLRRRYLASLVAAEAQKEAS  66

Query  836   aaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQ-----PKKALDD---YCFTK  681
              A +L++CL+MFADL SSASPENPHLS+TKFF L  LI+Q     P K   D     FT 
Sbjct  67    TAASLIKCLNMFADLRSSASPENPHLSLTKFFTLQQLIDQLNTTTPLKDKSDKSVQIFTH  126

Query  680   LSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWARGDGLKATKELRES  501
              S  + +KT         IG+   K         +++   E+LEWA+GD  K  KELRES
Sbjct  127   FSFQETQKTS------KKIGLSHAKSILKTRKSSMEVNTTERLEWAKGDCAKDIKELRES  180

Query  500   LSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGR--QEEANHIGLTLSLLKQANEWLD  327
             L N+T  WFLKFL+ +LD GF+V   + K  +S GR  + E NHI +TLS LK AN WLD
Sbjct  181   LLNDTRTWFLKFLEGALDTGFRVATQDKKGKESAGRRMEPENNHIAVTLSQLKHANVWLD  240

Query  326   KMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRSHR  189
             K+    S E    +   V++LKQKVY CLL HV SAASAL+ R+ R
Sbjct  241   KLRNNLSSETNDGLLEIVDRLKQKVYSCLLAHVGSAASALENRTDR  286



>ref|XP_002965834.1| hypothetical protein SELMODRAFT_84972 [Selaginella moellendorffii]
 gb|EFJ33254.1| hypothetical protein SELMODRAFT_84972 [Selaginella moellendorffii]
Length=528

 Score =   175 bits (444),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ ++S T K+ GEYRSVLLQVI IVPA++G ELWP+HGF++KVSDSS
Sbjct  1     MASLTPGVLVKLLQNMSSET-KVAGEYRSVLLQVIGIVPALAGGELWPNHGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L++  +DLIL++KLQLGQ  +VDR+E G+PVP+L GVR +PGRH   G+P+DL+
Sbjct  60    HATYVSLAEEHDDLILSDKLQLGQFIHVDRLEYGSPVPLLKGVRALPGRHQCVGTPEDLV  119


 Score =   102 bits (253),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 136/260 (52%), Gaps = 15/260 (6%)
 Frame = -1

Query  944  VLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENP  765
            V W SLP NL + GK  +R +  AS  A+EA  EA  A+ +++ +SMFA+LCS++ P+ P
Sbjct  263  VSWDSLPANLAELGKEAVRRRDAASAAASEALQEASVAECVIRSISMFAELCSTSKPQLP  322

Query  764  HLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskpp  585
              S+ +FF  H  + Q          TK + TD  +  DS            K   ++P 
Sbjct  323  QPSVEQFFDFHQRLGQAFTTAQALAVTKKTETDQNE--DSTVPARSTLKSSTKTSSNEPS  380

Query  584  LELDLGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenk  405
                      +EW RG+GLK T EL   L  E   WF+K ++ +LD GFQ +   + E  
Sbjct  381  GPKPAPEPVAMEWVRGNGLKETAELAMQLQLEAQSWFVKHIEEALDNGFQASGAMDAEQV  440

Query  404  sKGRQEEA------NHIGLTLSLLKQANEWLDKMMMRGSLELGSEMH-GFVE---KLKQK  255
            +  +Q++       + + L LS LK+ N+WLD     GS +  S +   FVE   +LK+K
Sbjct  441  TGAQQQQQQQQLHNSQLALMLSQLKRVNDWLDAT---GSGKDESSLEPQFVETLARLKRK  497

Query  254  VYGCLLVHVDSAASALDTRS  195
            +Y  LL HV+SAASAL ++S
Sbjct  498  IYEFLLQHVESAASALGSQS  517



>ref|XP_002983083.1| hypothetical protein SELMODRAFT_117469 [Selaginella moellendorffii]
 gb|EFJ15892.1| hypothetical protein SELMODRAFT_117469 [Selaginella moellendorffii]
Length=528

 Score =   175 bits (443),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ ++S T K+ GEYRSVLLQVI IVPA++G ELWP+HGF++KVSDSS
Sbjct  1     MASLTPGVLVKLLQNMSSET-KVAGEYRSVLLQVIGIVPALAGGELWPNHGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L++  +DLIL++KLQLGQ  +VDR+E G+PVP+L GVR +PGRH   G+P+DL+
Sbjct  60    HATYVSLAEEHDDLILSDKLQLGQFIHVDRLEYGSPVPLLKGVRALPGRHQCVGTPEDLV  119


 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 134/257 (52%), Gaps = 9/257 (4%)
 Frame = -1

Query  944  VLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENP  765
            V W SLP NL + GK  +R +  AS  A+EA  EA  A+ +++ +SMFA+LCS++ P+ P
Sbjct  263  VSWDSLPANLAELGKEAVRRRDAASAAASEALQEASVAECVIRSISMFAELCSTSKPQLP  322

Query  764  HLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskpp  585
              S+ +FF  H  + Q          TK + TD  +  DS            K   ++P 
Sbjct  323  QPSVEQFFDFHQRLGQAFTTAQALAVTKKTETDQNE--DSTVPARSTLKSSTKTSSNEPS  380

Query  584  LELDLGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenk  405
            +         +EW RG+GLK T EL   L  E   WF+K ++ +LD GFQ +   + E  
Sbjct  381  VPKPAPEPVAMEWVRGNGLKDTAELAMQLQLEAQSWFVKHIEEALDNGFQASGAMDAEQV  440

Query  404  sKGRQEEA------NHIGLTLSLLKQANEWLDKM-MMRGSLELGSEMHGFVEKLKQKVYG  246
            +  +Q++       + + L LS LK+ N+WLD     +G   L  +    + +LK+K+Y 
Sbjct  441  TGAQQQQQQQQLHNSQLALMLSQLKRVNDWLDATGSGKGESSLEPQFVETLARLKRKIYE  500

Query  245  CLLVHVDSAASALDTRS  195
             LL HV+SAASAL ++S
Sbjct  501  FLLQHVESAASALGSQS  517



>tpg|DAA62321.1| TPA: hypothetical protein ZEAMMB73_590071, partial [Zea mays]
Length=210

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNKGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++K+QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPEEQHDLILSDKIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGTPEDLV  119



>ref|XP_002534295.1| hypothetical protein RCOM_0125920 [Ricinus communis]
 gb|EEF28087.1| hypothetical protein RCOM_0125920 [Ricinus communis]
Length=230

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GEYRS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEYRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLESASPVPILRGVRPVPGRHPCVGSPEDIV  119



>ref|XP_001752982.1| predicted protein [Physcomitrella patens]
 gb|EDQ82023.1| predicted protein [Physcomitrella patens]
Length=829

 Score =   175 bits (443),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+LTPG+LIKLLQ INS  VK  GE+RS LLQVISIVPA++  ELWP+HGF+IKVSDSS
Sbjct  1     MATLTPGILIKLLQHINS-DVKATGEHRSALLQVISIVPALANGELWPNHGFYIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L++  +DLIL++KLQLGQ  ++DR+E G+PVP+L GVRP+PGRH   G+P++L+
Sbjct  60    HATYVSLAEEHDDLILSDKLQLGQFIHIDRLEAGSPVPLLRGVRPLPGRHQCVGTPENLI  119


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 10/117 (9%)
 Frame = -1

Query  542  RGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANH--IG  369
            R   L+   EL + +  E   WFL F++++LD GF+++ NN K  +  G    A++  I 
Sbjct  700  RASRLQQMVELGKQVQLEAQRWFLIFMESALDSGFRISMNNGKAGEGNGVVSRADNSQIA  759

Query  368  LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVE---KLKQKVYGCLLVHVDSAASAL  207
              LS LK  N+WLD     G  E G E    V+   +LK+K+Y  LL HV+SAASAL
Sbjct  760  SMLSQLKHVNDWLD-----GVREQGEEDERIVDTKGRLKRKIYEFLLQHVESAASAL  811



>ref|XP_001772202.1| predicted protein [Physcomitrella patens]
 gb|EDQ63015.1| predicted protein [Physcomitrella patens]
Length=995

 Score =   176 bits (446),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+LTPGVLIKLLQ INS  VK  GE+RS LLQVISIVPA++  +LWP+HGF+IKVSDSS
Sbjct  166   MATLTPGVLIKLLQHINS-DVKATGEHRSALLQVISIVPALANGDLWPNHGFYIKVSDSS  224

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L++  +DLIL++KLQLGQ  ++DR+E G+PVP+L GVRP+PGRH   GSP+DL+
Sbjct  225   HATYVSLAEEHDDLILSDKLQLGQFIHIDRLEAGSPVPLLRGVRPLPGRHQCVGSPEDLV  284

Query  1388  QMM  1380
               +
Sbjct  285   ATV  287


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 59/113 (52%), Gaps = 5/113 (4%)
 Frame = -1

Query  542  RGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksK-GRQEEANHIGL  366
            R   L+   EL + +  E   WFL+F++ +LD GF+++    K  ++    Q E   I  
Sbjct  868  RASRLQQMVELGKQVQIEAQRWFLQFMEGALDSGFRISTLGGKGEENGFVSQAENCQIAS  927

Query  365  TLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
             LS LK  N+WLD +       +    +    +LK+K+Y  LL HV+SAASAL
Sbjct  928  VLSQLKHVNDWLDGVREEFEERVVETKN----RLKRKIYEFLLQHVESAASAL  976



>ref|XP_001785292.1| predicted protein [Physcomitrella patens]
 gb|EDQ49909.1| predicted protein [Physcomitrella patens]
Length=860

 Score =   174 bits (442),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+LTPGVL+KLL+ INS  VK+ GE+RS LLQVISIVPA++G ELWP+ GF+IKVSDSS
Sbjct  1     MATLTPGVLLKLLKHINS-DVKVTGEHRSALLQVISIVPALAGGELWPNQGFYIKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++KLQLGQ  +VDR+E G+PVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLGEEHDDLILSDKLQLGQFIHVDRLEAGSPVPLLRGVRPLPGRHQCVGNPEDLV  119

Query  1388  QMM  1380
               +
Sbjct  120   ATV  122


 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 68/119 (57%), Gaps = 9/119 (8%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnken-----ksKGRQEE  384
            W RG G+  T EL + + NE+  WFL F++ +LDVGF +  +   E           Q+E
Sbjct  730  WVRGKGVAETSELAKKVQNESQRWFLNFMEGALDVGFHIATSGIGEREDIYGAKVMSQQE  789

Query  383  ANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
             +HI   LS LK+ N+WLD++       L +++     +LK+K+Y  LL HV+SAA+AL
Sbjct  790  NSHIATMLSQLKRVNDWLDQV----GDGLDTKLIETKARLKRKIYDFLLQHVESAAAAL  844



>gb|EMS45551.1| hypothetical protein TRIUR3_34607 [Triticum urartu]
Length=476

 Score =   168 bits (426),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA+SGS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALSGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYVTL +  +DLIL++K+QLGQ  +VDR+E  TPVP+L GVRP+PGRHP  G+P+DL+
Sbjct  60    HATYVTLPEEQHDLILSDKIQLGQFIHVDRLEAATPVPILWGVRPVPGRHPCVGNPEDLV  119



>ref|XP_006842628.1| hypothetical protein AMTR_s00077p00183470 [Amborella trichopoda]
 gb|ERN04303.1| hypothetical protein AMTR_s00077p00183470 [Amborella trichopoda]
Length=594

 Score =   169 bits (429),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 103/127 (81%), Gaps = 1/127 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ++N+ T K+ GE+RSVLLQVISIVPA++G+ELWP+ GFF+++SDSS
Sbjct  1     MASLTPGILLKLLQSMNTDT-KVAGEHRSVLLQVISIVPALAGTELWPNRGFFLQLSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HST+V+LS  D +LIL NKLQLGQ  YV ++E  +PVP + G+RPI GRHPF GSP+ L+
Sbjct  60    HSTFVSLSHHDVELILTNKLQLGQFVYVQKLEFASPVPRVAGIRPISGRHPFVGSPEPLI  119

Query  1388  QMMEAAG  1368
                   G
Sbjct  120   ARFSNGG  126


 Score = 79.0 bits (193),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 74/119 (62%), Gaps = 3/119 (3%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W +G+G+K T +L + +  E  LWFL +++ +L  GF V  N +   K  G   + + + 
Sbjct  473  WMQGNGVKETGDLAKLVVREACLWFLSYVEEALGRGFPVTRNKDSGTKI-GCCRDGSQVA  531

Query  368  LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRSH  192
            + LS LK+ N+WLDK+  + ++E G       E+LK+K+YG L+ HV+SAASALD +++
Sbjct  532  VILSQLKRVNDWLDKVG-KETME-GEPFDKMTERLKRKIYGFLIEHVESAASALDLQAN  588



>gb|EMT04297.1| hypothetical protein F775_21349 [Aegilops tauschii]
Length=571

 Score =   169 bits (428),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA+SGS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALSGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYVTL +  +DLIL++K+QLGQ  +VDR+E  TPVP+L GVRP+PGRHP  G+P+DL+
Sbjct  60    HATYVTLPEEQHDLILSDKIQLGQFIHVDRLEAATPVPILWGVRPVPGRHPCVGNPEDLV  119



>emb|CBI28115.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   168 bits (426),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ++NS T K+ GE+RS LLQVI IVPA++GS+LWP+HGF++++SDS 
Sbjct  1     MASLTPGILLKLLQSMNSNT-KVAGEHRSALLQVIGIVPALAGSDLWPNHGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS  D DLIL N+LQLGQ  YVDR +  +PVP + G+RPI GRHPF GSP+ L+
Sbjct  60    NSTYVSLSDRDTDLILTNRLQLGQFVYVDRFDFDSPVPRVCGIRPIAGRHPFVGSPEPLI  119

Query  1388  QMM  1380
               +
Sbjct  120   ARI  122


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 94/211 (45%), Gaps = 46/211 (22%)
 Frame = -1

Query  818  QCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYCFTK-LSVTDNKKTP-DS  645
            + LSMF++LCS     NP  +I +F +++       + +    F + +S       P DS
Sbjct  472  RSLSMFSELCSKCKVGNPLPTIDRFLSIY------DEVMRSTAFAESVSTCHRSDIPHDS  525

Query  644  NHlgi--gigigkgklkpskppLELDLGGAEKLE-------WARGDGLKATKELRESLSN  492
            ++             L        L++     L+       W RG+G+K T EL  +L +
Sbjct  526  SNSTSLWVEAALATDLGIVSLLTGLNIDSQPTLQKNPTIGSWTRGNGMKETIELAMNLQS  585

Query  491  ETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIGLTLSLLKQANEWLDKMMMR  312
            E  +WF+KF++ SLD                            LS LK+ N+WLD++  +
Sbjct  586  EMQMWFVKFVEESLDAAI-------------------------LSQLKRVNDWLDRVASK  620

Query  311  GSLELGSEMHGFVEKLKQKVYGCLLVHVDSA  219
               EL +E    +E+LK+K+YG ++ HV ++
Sbjct  621  QD-ELLTEK---IERLKRKIYGFVIHHVGTS  647



>ref|XP_002281524.1| PREDICTED: uncharacterized protein LOC100245597 [Vitis vinifera]
Length=710

 Score =   169 bits (427),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ++NS T K+ GE+RS LLQVI IVPA++GS+LWP+HGF++++SDS 
Sbjct  1     MASLTPGILLKLLQSMNSNT-KVAGEHRSALLQVIGIVPALAGSDLWPNHGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS  D DLIL N+LQLGQ  YVDR +  +PVP + G+RPI GRHPF GSP+ L+
Sbjct  60    NSTYVSLSDRDTDLILTNRLQLGQFVYVDRFDFDSPVPRVCGIRPIAGRHPFVGSPEPLI  119

Query  1388  QMM  1380
               +
Sbjct  120   ARI  122


 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 67/110 (61%), Gaps = 5/110 (5%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W RG+G+K T EL  +L +E  +WF+KF++ SLD GF+V   +  +  S     E   I 
Sbjct  591  WTRGNGMKETIELAMNLQSEMQMWFVKFVEESLDAGFRVFRESKADVCSM-LPPECGPIA  649

Query  368  LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSA  219
              LS LK+ N+WLD++  +   EL +E    +E+LK+K+YG ++ HV ++
Sbjct  650  AILSQLKRVNDWLDRVASKQD-ELLTEK---IERLKRKIYGFVIHHVGTS  695



>emb|CDX93540.1| BnaA06g05080D [Brassica napus]
Length=736

 Score =   168 bits (426),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQVISIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKIAGEHRSSLLQVISIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++KLQLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKLQLGQFIHVDRVESSSPVPILRGVRPVPGRHPCLGTPEDIV  119



>ref|XP_009148130.1| PREDICTED: uncharacterized protein LOC103871617 [Brassica rapa]
Length=736

 Score =   168 bits (426),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQVISIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKIAGEHRSSLLQVISIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++KLQLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKLQLGQFIHVDRVESSSPVPILRGVRPVPGRHPCLGTPEDIV  119



>tpg|DAA48319.1| TPA: hypothetical protein ZEAMMB73_736922 [Zea mays]
Length=358

 Score =   163 bits (412),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   GSP+DL+
Sbjct  60    HATYVSLPDEQHDLILSDVIQLGQFVHVDRLEAATPVPILRGVRPVPGRHACVGSPEDLV  119



>dbj|BAJ91471.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96188.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   169 bits (427),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA+SGS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALSGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYVTL +  +DLIL++K+QLGQ  +VDR+E  TPVP+L GVRP+PGRHP  G+P+DL+
Sbjct  60    HATYVTLPEEQHDLILSDKIQLGQFIHVDRLEAATPVPILWGVRPVPGRHPCVGNPEDLV  119



>ref|XP_006858851.1| hypothetical protein AMTR_s00066p00185630 [Amborella trichopoda]
 gb|ERN20318.1| hypothetical protein AMTR_s00066p00185630 [Amborella trichopoda]
Length=755

 Score =   168 bits (426),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RSVLLQVI IVPA++G ELWP+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKIAGEHRSVLLQVIGIVPALAGGELWPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++KLQLGQ  YV+R+E  +PVP+L GV+P+ GRHP  G+P+DL+
Sbjct  60    HATYVSLPDEQDDLILSDKLQLGQFMYVERLESASPVPILRGVKPVAGRHPCIGTPEDLV  119


 Score = 59.3 bits (142),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 63/119 (53%), Gaps = 17/119 (14%)
 Frame = -1

Query  551  EWARG-DGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQE---E  384
            EWARG  GL+    L +SL  ++  WFL FL+  LD G       +      GR+    +
Sbjct  633  EWARGLGGLEEAVGLAKSLRAQSQSWFLCFLERFLDAG-------SIGGPLNGREADPTD  685

Query  383  ANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
            +  +   LS LK+ N+WLD++       LG  +   ++ L++K+Y  LL+HV+ A+ AL
Sbjct  686  STRVAAMLSQLKRVNDWLDEVG------LGDGLTDRLDGLRKKIYDYLLIHVELASVAL  738



>ref|XP_009336878.1| PREDICTED: uncharacterized protein LOC103929413 [Pyrus x bretschneideri]
Length=710

 Score =   168 bits (425),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ++NS T K+ G++RS LLQVI IVPA++GS+LWP+ GF++++SDS 
Sbjct  1     MASLTPGILLKLLQSMNSAT-KVTGDHRSALLQVIGIVPALAGSDLWPNQGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS  D DLIL N+LQLGQ  YVDR +  +PVP ++G+RPI GRHPF G+P+ L+
Sbjct  60    NSTYVSLSDRDTDLILTNRLQLGQFAYVDRFDFDSPVPRVVGIRPIAGRHPFLGTPEPLV  119

Query  1388  QMMEAA  1371
               + A+
Sbjct  120   ARISAS  125


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 61/107 (57%), Gaps = 7/107 (7%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W +G G+K T EL   L +E  +WFL+F++ +LD GF+V      +        +   I 
Sbjct  598  WTKGHGMKDTVELATHLQSEMQMWFLQFVEKALDAGFRVFGECAADGGKL--PIDCGSIA  655

Query  368  LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV  228
              LS LK+ NEWLD+ + +      +E++  V++LK+K+YG ++ HV
Sbjct  656  AVLSQLKRVNEWLDRAVSK-----RNELNAKVDRLKRKIYGFVIQHV  697



>emb|CDX95036.1| BnaC05g06350D [Brassica napus]
Length=735

 Score =   168 bits (425),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKIAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++KLQLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKLQLGQFIHVDRVESSSPVPILRGVRPVPGRHPCLGTPEDIV  119



>ref|XP_008222424.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103322298 
[Prunus mume]
Length=718

 Score =   167 bits (424),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR++  TPVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRLQAATPVPILHGVRPVPGRHPCVGSPEDIV  119


 Score = 52.8 bits (125),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 61/96 (64%), Gaps = 2/96 (2%)
 Frame = -1

Query  986  MSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLS  807
            +S NNR+    S P  W+SLP ++ K GK +LR +  A + A EA  EA AA++LL+CLS
Sbjct  390  VSLNNRKLTDGSFP--WASLPSSVAKLGKEVLRHRDAAQIAAIEAMQEASAAESLLRCLS  447

Query  806  MFADLCSSASPENPHLSITKFFALHALIEQPKKALD  699
            ++++L +SA  +NP  ++ +F ALHA +   +   D
Sbjct  448  IYSELTTSAKEDNPQPAVEQFLALHASLNNARVVAD  483



>gb|EMT26764.1| hypothetical protein F775_13435 [Aegilops tauschii]
Length=441

 Score =   164 bits (415),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPEDQHDLILSDTIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGTPEDLV  119



>ref|NP_001063674.1| Os09g0516700 [Oryza sativa Japonica Group]
 dbj|BAF25588.1| Os09g0516700 [Oryza sativa Japonica Group]
 dbj|BAG92979.1| unnamed protein product [Oryza sativa Japonica Group]
Length=463

 Score =   164 bits (416),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++K+QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPEDQHDLILSDKIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGNPEDLV  119



>ref|XP_008800511.1| PREDICTED: uncharacterized protein LOC103714852 [Phoenix dactylifera]
 ref|XP_008800519.1| PREDICTED: uncharacterized protein LOC103714852 [Phoenix dactylifera]
Length=613

 Score =   166 bits (421),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PG L+KLLQ +N+  VK+ GE+RSVLLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MAALVPGALLKLLQHMNT-DVKVAGEHRSVLLQVVSIVPALAGGELYPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GV+P+PGRHP  GSP+DL+
Sbjct  60    HATYVSLPDEQDDLILSDKIQLGQFIHVERLEAASPVPILRGVKPVPGRHPCVGSPEDLV  119



>ref|XP_009385130.1| PREDICTED: uncharacterized protein LOC103972499 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385131.1| PREDICTED: uncharacterized protein LOC103972499 [Musa acuminata 
subsp. malaccensis]
Length=746

 Score =   167 bits (424),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PG+LIKLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+++ + GF++KVSDSS
Sbjct  1     MASLVPGILIKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDIFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    NDLIL++K+QLGQ  +VDR+E G+PVP+L GVRP+PGRHP  G+P+DL+
Sbjct  60    HATYVSLPDEHNDLILSDKIQLGQFIHVDRLEAGSPVPILKGVRPLPGRHPCVGNPEDLV  119


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 58/127 (46%), Gaps = 23/127 (18%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG GL+    L  +L  E  +WFL F++  LD        +           +   +
Sbjct  609  EWQRGGGLEEGAALARALEGEAQVWFLGFVERFLDTDAAAPGPS-----------DREQV  657

Query  371  GLTLSLLKQANEWLDKMMMRGSL-ELGSEMHG-----------FVEKLKQKVYGCLLVHV  228
               LS LK+ N+WL+ +  R S  E  SE               VE+L++K+Y  LL HV
Sbjct  658  AAMLSQLKRVNDWLEAIGRRRSEGEADSEPEDGEGPGEGVPTETVERLRKKIYEYLLTHV  717

Query  227  DSAASAL  207
            +SAA AL
Sbjct  718  ESAAVAL  724



>ref|XP_006417651.1| hypothetical protein EUTSA_v10006887mg [Eutrema salsugineum]
 dbj|BAJ34479.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36004.1| hypothetical protein EUTSA_v10006887mg [Eutrema salsugineum]
Length=760

 Score =   167 bits (424),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKIAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++KLQLGQ  +VDR+E  +PVP+L GVRPIPGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKLQLGQFIHVDRVESSSPVPILRGVRPIPGRHPCLGTPEDIV  119



>ref|XP_008362937.1| PREDICTED: uncharacterized protein LOC103426635 [Malus domestica]
Length=710

 Score =   167 bits (423),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ++NS T K+ G++RS LLQVI IVPA++GS+LWP+ GF++++SDS 
Sbjct  1     MASLTPGILLKLLQSMNSST-KVTGDHRSALLQVIGIVPALAGSDLWPNQGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS  D DLIL N+LQLGQ  YVDR +  +PVP ++G+RPI GRHPF G+P+ L+
Sbjct  60    NSTYVSLSDHDTDLILTNRLQLGQFAYVDRFDFDSPVPRVVGIRPIAGRHPFLGTPEPLV  119

Query  1388  QMMEAA  1371
               + A+
Sbjct  120   ARISAS  125


 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 60/107 (56%), Gaps = 7/107 (7%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W +G G+K T EL   L +E  +W L+F++ +LD GF+V      +        +   I 
Sbjct  598  WTKGHGMKDTVELATHLQSEMQMWXLQFVEKALDAGFRVFGECAADGGKL--PIDXGSIA  655

Query  368  LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV  228
              LS LK+ NEWLD+++ +       E++  V++LK+K+YG ++ HV
Sbjct  656  AVLSQLKRVNEWLDRVVSK-----RXELNXKVDRLKRKIYGFVIQHV  697



>gb|EMS48402.1| hypothetical protein TRIUR3_16288 [Triticum urartu]
Length=472

 Score =   164 bits (415),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPEDQHDLILSDTIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGTPEDLV  119



>ref|XP_007221873.1| hypothetical protein PRUPE_ppa001962mg [Prunus persica]
 gb|EMJ23072.1| hypothetical protein PRUPE_ppa001962mg [Prunus persica]
Length=736

 Score =   167 bits (423),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR++  TPVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRLQAATPVPILHGVRPVPGRHPCVGSPEDIV  119


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 61/119 (51%), Gaps = 18/119 (15%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL    +L E L  ++  WFL F++  LD     +  +           +   I
Sbjct  613  EWNRGNGLDEAVDLAEMLQLQSQDWFLGFVERFLDADVDTSALS-----------DNGQI  661

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGF----VEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD +   GS +  +E +      +E+L++K+Y  LL HV+SAA+AL
Sbjct  662  AGMLTQLKSVNDWLDDI---GSSKDEAETNAVSAETIERLRKKIYEYLLTHVESAAAAL  717


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  1022  RTNKQ-----ENVDVNF--------MSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMK  882
             R+NKQ     ++ D N         +S NNR+    S P  W+SLP ++ K GK +LR +
Sbjct  365   RSNKQRVVGKKSTDANHGFPGNLVKVSLNNRKLTDGSFP--WASLPSSVAKLGKEVLRHR  422

Query  881   KlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKAL  702
               A + A EA  EA AA++LL+CLS++++L +SA  +NP  ++ +F ALHA +   +   
Sbjct  423   DAAQIAAIEAVQEASAAESLLRCLSVYSELTTSAKEDNPQPAVEQFLALHASLNNARVVA  482

Query  701   DDYCFT  684
             D    T
Sbjct  483   DSLSKT  488



>tpg|DAA48320.1| TPA: hypothetical protein ZEAMMB73_736922 [Zea mays]
Length=418

 Score =   163 bits (412),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   GSP+DL+
Sbjct  60    HATYVSLPDEQHDLILSDVIQLGQFVHVDRLEAATPVPILRGVRPVPGRHACVGSPEDLV  119



>ref|XP_010650628.1| PREDICTED: uncharacterized protein LOC104879471 [Vitis vinifera]
 ref|XP_010650629.1| PREDICTED: uncharacterized protein LOC104879471 [Vitis vinifera]
 ref|XP_010650630.1| PREDICTED: uncharacterized protein LOC104879471 [Vitis vinifera]
 emb|CAN75715.1| hypothetical protein VITISV_034017 [Vitis vinifera]
 emb|CBI36728.3| unnamed protein product [Vitis vinifera]
Length=739

 Score =   167 bits (423),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  +KI GEYRS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MATLVPGVLLKLLQHMNT-DIKIAGEYRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLEAASPVPILHGVRPVPGRHPCVGSPEDIV  119


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 56/113 (50%), Gaps = 16/113 (14%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL    +L E L  E+  WFL F++  LD    ++  +           +   I
Sbjct  615  EWIRGNGLDEAIDLAEMLRMESQDWFLGFVERFLDADVDISALS-----------DNGQI  663

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMH---GFVEKLKQKVYGCLLVHVDS  222
               L+ LK  N+WLD++    S + G   H     +++L++K+Y  LL HV+S
Sbjct  664  AGMLTQLKSVNDWLDEIG--SSKDEGDTPHISAETIDRLRKKIYEYLLTHVES  714



>gb|KDP32323.1| hypothetical protein JCGZ_13248 [Jatropha curcas]
Length=705

 Score =   167 bits (422),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ++NS T ++ G++R  LLQVI IVPA++GS+LWP+HGF++++SDS 
Sbjct  1     MASLTPGILLKLLQSMNSNT-RVTGDHRHALLQVIGIVPALAGSDLWPNHGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS+ D DLIL+N+LQLGQ  Y++R E  +PVP L GVRPI GRHPF G+P+ L+
Sbjct  60    NSTYVSLSERDTDLILSNRLQLGQFVYIERFEFDSPVPRLCGVRPIAGRHPFVGTPEPLI  119

Query  1388  QMMEAA  1371
               + A+
Sbjct  120   ARISAS  125


 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 63/109 (58%), Gaps = 9/109 (8%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEAN--H  375
            W RG+G+K T EL   L +E  +WF+KF++ SLD GF+      +     G+Q   N   
Sbjct  591  WTRGNGMKGTVELAMKLQSEMQVWFVKFVEESLDAGFRA---LGRCTSDGGKQLPLNSGS  647

Query  374  IGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV  228
            +   LS LK+ N+WLD+++  G   L  +    +EKLK+K+YG ++ HV
Sbjct  648  VAAILSQLKRVNDWLDRVVSNGDGPLAEK----IEKLKRKIYGFVIQHV  692



>gb|ACR35155.1| unknown [Zea mays]
 tpg|DAA48321.1| TPA: hypothetical protein ZEAMMB73_736922 [Zea mays]
Length=422

 Score =   163 bits (412),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   GSP+DL+
Sbjct  60    HATYVSLPDEQHDLILSDVIQLGQFVHVDRLEAATPVPILRGVRPVPGRHACVGSPEDLV  119



>ref|NP_001130305.1| hypothetical protein [Zea mays]
 gb|ACF78482.1| unknown [Zea mays]
 tpg|DAA62322.1| TPA: hypothetical protein ZEAMMB73_590071 [Zea mays]
Length=488

 Score =   164 bits (415),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNKGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++K+QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPEEQHDLILSDKIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGTPEDLV  119



>ref|XP_004306589.1| PREDICTED: uncharacterized protein LOC101312186 [Fragaria vesca 
subsp. vesca]
Length=732

 Score =   166 bits (421),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR++  TPVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRLQAATPVPILHGVRPVPGRHPCVGSPEDIV  119


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 54/111 (49%), Gaps = 12/111 (11%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW +G+GL  T +L E L   +  WFLKF++  LD     +  +           +   I
Sbjct  609  EWIKGNGLYETVDLAEMLRLHSQDWFLKFVERFLDADVDTSALS-----------DNGQI  657

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEM-HGFVEKLKQKVYGCLLVHVDS  222
               L+ LK  N+WLD +      E  + +    +++L++K+Y  LL HV+S
Sbjct  658  SGMLTQLKSVNDWLDSIGSNTDAEEATAVSEETIDRLRKKIYEYLLTHVES  708



>ref|XP_010930257.1| PREDICTED: uncharacterized protein LOC105051480 isoform X2 [Elaeis 
guineensis]
Length=607

 Score =   165 bits (418),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PG L+KLLQ +N+  VK+ GE+RSVLLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MAALVPGALLKLLQHMNTG-VKVGGEHRSVLLQVVSIVPALAGGELYPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GV+P+PGRHP  GSP+DL+
Sbjct  60    HATYVSLPDEQDDLILSDKIQLGQFIHVERLEAASPVPILRGVKPVPGRHPCVGSPEDLV  119


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 57/123 (46%), Gaps = 19/123 (15%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL+   EL  +L   +  WFL F++  LD                    + + +
Sbjct  485  EWTRGEGLEEGAELARALRESSRAWFLGFVERFLDADVAACMPW-----------DRDLV  533

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGF--------VEKLKQKVYGCLLVHVDSAA  216
               LS LK+ N+WLD +  RG  E                +E+L++K+Y  LL HV+SAA
Sbjct  534  AGMLSQLKKVNDWLDSIGQRGGEEGEDGGGRDDHGVPPETIERLRKKIYEYLLTHVESAA  593

Query  215  SAL  207
             AL
Sbjct  594  VAL  596


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -1

Query  944  VLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENP  765
            V W+SLP +L K GK +L+ +  A   A EA  EA +A+ L++CLSM+A+L SSA   NP
Sbjct  275  VSWASLPSSLAKLGKEVLKYRDAAQQAAIEAMQEAASAETLIRCLSMYAELTSSAEENNP  334

Query  764  HLSITKFFALHALIEQ  717
              S+ +F AL+A + +
Sbjct  335  QPSVEQFLALYATLSR  350



>ref|XP_010527195.1| PREDICTED: uncharacterized protein LOC104804579 [Tarenaya hassleriana]
Length=701

 Score =   166 bits (420),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 104/130 (80%), Gaps = 1/130 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ++NS T ++ G++RS LLQV  IVPA++GS+LWP+HGFF+++SDS 
Sbjct  1     MASLTPGILLKLLQSMNSGT-RVTGDHRSPLLQVTGIVPALAGSDLWPNHGFFVQISDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS  D DLIL N+LQLGQ  Y++R++  TPVP  +G+RP+ GRHPF GSP+ L+
Sbjct  60    NSTYVSLSDRDTDLILTNRLQLGQFIYLERLDFSTPVPRAVGIRPVAGRHPFVGSPEPLI  119

Query  1388  QMMEAAGEME  1359
               + +  + +
Sbjct  120   ARVSSGSKRD  129


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 58/110 (53%), Gaps = 10/110 (9%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            +W  GDG+K T +L   L  E   WFL F+++SLD           +N +     + + I
Sbjct  592  KWTDGDGMKETVKLAAKLQTEMQKWFLGFVESSLD----------NKNTAAALSLDCSSI  641

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDS  222
               LS LK+ NEWLD+++     E    +   +E+LK+K+YG ++ HV S
Sbjct  642  AAVLSQLKRVNEWLDRVVSSREEEEDPSLTDKIERLKRKIYGFVIHHVGS  691



>ref|XP_007033883.1| Uncharacterized protein TCM_019984 [Theobroma cacao]
 gb|EOY04809.1| Uncharacterized protein TCM_019984 [Theobroma cacao]
Length=744

 Score =   166 bits (421),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP++ GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRLESSSPVPIIRGVRPVPGRHPCVGSPEDIV  119


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 58/116 (50%), Gaps = 12/116 (10%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL    +L E L  E+  WFL F++  LD     +  +           +   I
Sbjct  621  EWTRGNGLDEAADLAEMLRMESQDWFLGFVEKFLDADVDTSALS-----------DNGQI  669

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMH-GFVEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD++      E    +    +++L++K+Y  LL HV+SAA+AL
Sbjct  670  AGMLTQLKSVNDWLDEISSSKDEEETPNVSLETIDRLRKKIYEYLLTHVESAAAAL  725



>gb|ACR35047.1| unknown [Zea mays]
Length=418

 Score =   162 bits (410),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPDEQHDLILSDVIQLGQFVHVDRLEAATPVPILRGVRPVPGRHACVGNPEDLV  119



>gb|KHF99667.1| hypothetical protein F383_05395 [Gossypium arboreum]
Length=750

 Score =   166 bits (421),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRLESASPVPILRGVRPVPGRHPCVGSPEDIV  119


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 27/123 (22%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W RG+GL    ++ + L  E+  WFL F++  LD     +              +   I 
Sbjct  627  WTRGNGLDEVVDMADMLQMESQDWFLGFVEKFLDADVDTSVL-----------SDNGQIA  675

Query  368  LTLSLLKQANEWLDKMMMRG---------SLELGSEMHGFVEKLKQKVYGCLLVHVDSAA  216
              L+ LK  N+WLD++             SLE        V++L++K+Y  LL HV+SAA
Sbjct  676  GMLTQLKSVNDWLDEISSSKDEGETPPHVSLET-------VDRLRKKIYDYLLTHVESAA  728

Query  215  SAL  207
            +AL
Sbjct  729  AAL  731



>ref|XP_006372831.1| hypothetical protein POPTR_0017s05480g [Populus trichocarpa]
 gb|ERP50628.1| hypothetical protein POPTR_0017s05480g [Populus trichocarpa]
Length=727

 Score =   166 bits (420),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R++  +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLQSASPVPILRGVRPVPGRHPCVGSPEDIV  119


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 12/116 (10%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW +G+GL    +L E L  E+  WFL F++  LD     +  +           +   I
Sbjct  604  EWIKGNGLDEAVDLAEMLRMESQDWFLGFVERFLDADVDTSALS-----------DNGQI  652

Query  371  GLTLSLLKQANEWLDKM-MMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD++ + +   E        V++L++K+Y  LL HV+SAA+AL
Sbjct  653  AGMLTQLKSVNDWLDEIGLNKDEAEAPHVSSETVDRLRKKIYEYLLTHVESAAAAL  708



>ref|XP_011037136.1| PREDICTED: uncharacterized protein LOC105134426 isoform X1 [Populus 
euphratica]
Length=727

 Score =   166 bits (419),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFSNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R++P +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLQPASPVPILRGVRPVPGRHPCVGSPEDIV  119


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 58/116 (50%), Gaps = 12/116 (10%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW +G+GL    +L E L  E+  WFL F++  LD        +           +   I
Sbjct  604  EWIKGNGLDEAVDLAEMLRMESQDWFLGFVERFLDADVDTLALS-----------DNGQI  652

Query  371  GLTLSLLKQANEWLDKM-MMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD++ + +   E        V++L++K+Y  LL HV+SAA+AL
Sbjct  653  AGMLTQLKSVNDWLDEIGLNKDEAEAPHVSSETVDRLRKKIYEYLLTHVESAAAAL  708



>ref|XP_010528796.1| PREDICTED: uncharacterized protein LOC104805816 [Tarenaya hassleriana]
Length=755

 Score =   166 bits (419),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRLESASPVPILHGVRPVPGRHPCVGSPEDIV  119


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 58/118 (49%), Gaps = 13/118 (11%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW +G+GL    +L E L   +  WFL F++  LD     + + +          +   I
Sbjct  629  EWVKGNGLDEAIDLVERLQMVSQDWFLGFVERFLDTDVDTSPSLS----------DNGQI  678

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSE---MHGFVEKLKQKVYGCLLVHVDSAASAL  207
               LS LK  N+WLD++      E G         +++L++K+Y  LL HV+SAA+AL
Sbjct  679  AGMLSQLKSVNDWLDEIGSSPGKEDGESPEVSEETIDRLRKKIYEYLLTHVESAAAAL  736



>ref|XP_008369178.1| PREDICTED: uncharacterized protein LOC103432754 [Malus domestica]
Length=737

 Score =   166 bits (419),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVP+++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPSLAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR++  TPVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRLQAATPVPILHGVRPVPGRHPCVGSPEDIV  119


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 60/124 (48%), Gaps = 28/124 (23%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW +G+GL    +L E L  ++  WFL F++  LD    ++  +           +   I
Sbjct  614  EWNKGNGLDEVVDLAEMLRLQSQAWFLGFVERFLDADVDISALS-----------DNGQI  662

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGF---------VEKLKQKVYGCLLVHVDSA  219
               L+ LK  N+WLD         +GS   GF         +++L++K+Y  LL HV+SA
Sbjct  663  AGMLTQLKSVNDWLD--------NIGSSQEGFETTDVSAETIDRLRKKIYEYLLTHVESA  714

Query  218  ASAL  207
            A+AL
Sbjct  715  AAAL  718



>ref|XP_010930255.1| PREDICTED: uncharacterized protein LOC105051480 isoform X1 [Elaeis 
guineensis]
 ref|XP_010930256.1| PREDICTED: uncharacterized protein LOC105051480 isoform X1 [Elaeis 
guineensis]
Length=725

 Score =   165 bits (418),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PG L+KLLQ +N+  VK+ GE+RSVLLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MAALVPGALLKLLQHMNTG-VKVGGEHRSVLLQVVSIVPALAGGELYPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GV+P+PGRHP  GSP+DL+
Sbjct  60    HATYVSLPDEQDDLILSDKIQLGQFIHVERLEAASPVPILRGVKPVPGRHPCVGSPEDLV  119


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 57/123 (46%), Gaps = 19/123 (15%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL+   EL  +L   +  WFL F++  LD                    + + +
Sbjct  603  EWTRGEGLEEGAELARALRESSRAWFLGFVERFLDADVAACMPW-----------DRDLV  651

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGF--------VEKLKQKVYGCLLVHVDSAA  216
               LS LK+ N+WLD +  RG  E                +E+L++K+Y  LL HV+SAA
Sbjct  652  AGMLSQLKKVNDWLDSIGQRGGEEGEDGGGRDDHGVPPETIERLRKKIYEYLLTHVESAA  711

Query  215  SAL  207
             AL
Sbjct  712  VAL  714



>gb|EPS71203.1| hypothetical protein M569_03555, partial [Genlisea aurea]
Length=740

 Score =   165 bits (418),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 103/127 (81%), Gaps = 1/127 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  V+I GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MAALVPGVLLKLLQHMNT-DVRIAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++KLQLGQ  +V+R++  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKLQLGQFIHVERLDSASPVPILRGVRPVPGRHPCVGTPEDIV  119

Query  1388  QMMEAAG  1368
                 A G
Sbjct  120   AATHALG  126


 Score = 65.9 bits (159),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 67/125 (54%), Gaps = 15/125 (12%)
 Frame = -1

Query  557  KLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEAN  378
            ++EWA+GDG++   EL E L  ++  WFL F++  LD    V    NK+N +    +   
Sbjct  614  QIEWAKGDGVEEAVELSEKLRLQSQDWFLGFMERFLDADVVVVGCANKKNNNSA-ADSGQ  672

Query  377  HIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGF--------VEKLKQKVYGCLLVHVDS  222
             I   LS LK  N+WLD+++         + H          +E++++K+Y  LL HV+S
Sbjct  673  QIAGMLSQLKSVNQWLDEIIS------NKDHHQLPRTCCVETIERIRKKIYEYLLTHVES  726

Query  221  AASAL  207
            AA+AL
Sbjct  727  AAAAL  731


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -1

Query  959  LSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSA  780
            L+   V WSSLPP L K GK + + +  A   A EA  EA  +  LLQCLS+F++LCSSA
Sbjct  410  LTEAKVSWSSLPPTLAKLGKEVFKHRDSAQTAAIEALLEASISDTLLQCLSLFSELCSSA  469

Query  779  SPENPHLSITKFFALHALIEQ  717
              ++P  ++ +F +LH+ + +
Sbjct  470  KEDDPKPAVEQFLSLHSTLNK  490



>gb|KDO45103.1| hypothetical protein CISIN_1g0048902mg, partial [Citrus sinensis]
Length=649

 Score =   164 bits (416),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLESASPVPILRGVRPVPGRHPCVGSPEDIV  119



>ref|XP_009617563.1| PREDICTED: uncharacterized protein LOC104109887 [Nicotiana tomentosiformis]
Length=744

 Score =   165 bits (418),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MATLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GVRPIPGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLEAASPVPILRGVRPIPGRHPCVGTPEDIV  119


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 62/118 (53%), Gaps = 17/118 (14%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            +W RGDGL+ T +L E L   +  WFL F++  LD     +  +           +   I
Sbjct  625  DWVRGDGLEETVDLAEILRMASQDWFLGFVERFLDADVDASALS-----------DNGQI  673

Query  371  GLTLSLLKQANEWLDKMMMRG---SLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               LS LK  N+WLD++       S E+ SE    ++++++K+Y  LL HV+SAA+AL
Sbjct  674  AGMLSQLKSVNDWLDEIGSNKDDESPEIDSET---IDRIRKKIYEYLLTHVESAAAAL  728



>gb|KHG08949.1| digeranylgeranylglycerophospholipid reductase [Gossypium arboreum]
Length=698

 Score =   165 bits (417),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PG+L+KLLQ++NS T ++ G++RS LLQVI IVPA++GS+LWP+HGF++++SDS 
Sbjct  1     MASLNPGILLKLLQSMNSPT-RVTGDHRSALLQVIGIVPALAGSDLWPNHGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS+ D DLIL+N+LQLGQ  YVDR    +PVP + G+RPI GRHPF GSP  L+
Sbjct  60    NSTYVSLSERDTDLILSNRLQLGQFVYVDRFHFDSPVPRVSGIRPIAGRHPFVGSPDPLI  119

Query  1388  QMMEAA  1371
               + ++
Sbjct  120   ARISSS  125


 Score = 76.6 bits (187),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 79/268 (29%), Positives = 126/268 (47%), Gaps = 38/268 (14%)
 Frame = -1

Query  944  VLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENP  765
            V W ++  +L K GK  ++ + LAS  AAEA  EA+A +++++ LSMF++L S +   NP
Sbjct  430  VAWDTISADLAKLGKEAMQRRILASKAAAEALEEAIATESVVRNLSMFSELSSKSKAGNP  489

Query  764  HLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKK---------------------TPD  648
              +I KF +++  + +     +    +  S TDN                       TP 
Sbjct  490  LPTIDKFLSIYNDVVKYTGIAETVATSNSSNTDNASKSSSLWVEVALATDLEILSLLTPQ  549

Query  647  SNHlgigigigkgklkpskppLELDLGGAEKLE-----WARGDGLKATKELRESLSNETH  483
            +N     +     K        +L      +LE     W  G G+K T +   +L +E  
Sbjct  550  NNESPSALQKSLSKT-------QLKTSSLPQLEPIATIWTSGQGMKETVQFALNLKSEME  602

Query  482  LWFLKFLDASLDVGFQ-VnnnnnkenksKGRQEEANHIGLTLSLLKQANEWLDKMMMRGS  306
            +WFL+F++ SLD GF+ +         SK    +   I   LS LK+ N+WLD+ + RG 
Sbjct  603  IWFLRFIEESLDAGFRMLGECAASSGGSKALPLDCGSIAGVLSQLKRVNDWLDQAVSRGD  662

Query  305  LELGSEMHGFVEKLKQKVYGCLLVHVDS  222
              L  +    VEKLK+K+YG ++ HV S
Sbjct  663  EPLIDK----VEKLKRKIYGFVIQHVGS  686



>ref|XP_009778777.1| PREDICTED: uncharacterized protein LOC104228069 [Nicotiana sylvestris]
Length=744

 Score =   165 bits (418),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MATLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GVRPIPGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLEAASPVPILRGVRPIPGRHPCVGTPEDIV  119


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 62/118 (53%), Gaps = 17/118 (14%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            +W RGDGL+ T +L E L   +  WFL F++  LD     +  +           +   I
Sbjct  625  DWVRGDGLEETVDLAEMLRMASQDWFLGFVERFLDADVDASALS-----------DNGQI  673

Query  371  GLTLSLLKQANEWLDKMMMRG---SLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               LS LK  N+WLD++       S E+ SE    ++++++K+Y  LL HV+SAA+AL
Sbjct  674  AGMLSQLKSVNDWLDEIGSNKDDESPEIDSET---IDRIRKKIYEYLLTHVESAAAAL  728



>ref|XP_010927900.1| PREDICTED: uncharacterized protein LOC105049832 isoform X2 [Elaeis 
guineensis]
Length=653

 Score =   164 bits (415),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFSNRGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  YVDR+E   PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIYVDRLEAALPVPILKGVRPVPGRHPCVGNPEDIV  119



>ref|XP_002889713.1| hypothetical protein ARALYDRAFT_470949 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65972.1| hypothetical protein ARALYDRAFT_470949 [Arabidopsis lyrata subsp. 
lyrata]
Length=751

 Score =   165 bits (418),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQV+SIVPA++G EL+P+ GF+++VSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKIAGEHRSSLLQVVSIVPALAGGELFPNQGFYLRVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRVESSSPVPILRGVRPVPGRHPCVGTPEDIV  119



>ref|XP_007013268.1| Serine/arginine repetitive matrix protein 1 [Theobroma cacao]
 gb|EOY30887.1| Serine/arginine repetitive matrix protein 1 [Theobroma cacao]
Length=708

 Score =   165 bits (417),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ++NS T ++ G++RS LLQVI IVPA++GS+LWP+HGF++++SDS 
Sbjct  1     MASLTPGILLKLLQSMNSPT-RVTGDHRSALLQVIGIVPALAGSDLWPNHGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS+ D +LIL+N+LQLGQ  YVDR    +PVP + G+RPI GRHPF GSP  L+
Sbjct  60    NSTYVSLSERDTELILSNRLQLGQFVYVDRFHFDSPVPRVSGIRPIAGRHPFVGSPDPLI  119

Query  1388  QMMEAA  1371
               + ++
Sbjct  120   ARISSS  125


 Score = 72.4 bits (176),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 6/107 (6%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W RG G+K T      L +E  +WFL+F++ SLD GF+V       +K+     +   I 
Sbjct  595  WTRGQGMKETVHFAMELKSEMQMWFLRFIEESLDAGFRVLGECGSGSKTLPL--DCGSIA  652

Query  368  LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV  228
              LS LK+ N+WLD+ +  G   L  +    VEKLK+K+YG ++ HV
Sbjct  653  AVLSQLKRVNDWLDRAVSNGDEPLVDK----VEKLKRKIYGFVIQHV  695



>ref|XP_008342567.1| PREDICTED: uncharacterized protein LOC103405362 isoform X3 [Malus 
domestica]
Length=619

 Score =   164 bits (415),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR++  TPVP+L GVRP+PGRH   GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRLQAATPVPILQGVRPVPGRHSCVGSPEDIV  119


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 18/119 (15%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW +G+GL    +L E L  ++  WFL F++  LD     +  +           +   I
Sbjct  496  EWNKGNGLDEVVDLAEKLRLQSQAWFLGFVERFLDADVDSSALS-----------DNGQI  544

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGF----VEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD +   GS++ G E        ++ L++K+Y  LL HV+SAA+AL
Sbjct  545  AGMLTQLKSVNDWLDNI---GSIQEGVETTDVSAETIDSLRKKIYEYLLTHVESAAAAL  600



>ref|NP_172353.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF99766.1|AC003981_16 F22O13.25 [Arabidopsis thaliana]
 gb|AAM20484.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ56784.1| At1g08760 [Arabidopsis thaliana]
 gb|AEE28344.1| uncharacterized protein AT1G08760 [Arabidopsis thaliana]
Length=748

 Score =   165 bits (417),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQVISIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKIAGEHRSSLLQVISIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQYIHVDRVESSSPVPILRGVRPVPGRHPCVGDPEDIV  119



>ref|XP_007150449.1| hypothetical protein PHAVU_005G154300g [Phaseolus vulgaris]
 gb|ESW22443.1| hypothetical protein PHAVU_005G154300g [Phaseolus vulgaris]
Length=743

 Score =   165 bits (417),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVGGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFVFVDRLEGASPVPILRGVRPVPGRHPCVGTPEDIV  119


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 61/119 (51%), Gaps = 19/119 (16%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+ L     L E L  ++  WFL F++  LD       + N            + I
Sbjct  621  EWVRGNSLNEVANLVEMLQLQSRDWFLGFVERFLDSDGDTTLSGN------------DQI  668

Query  371  GLTLSLLKQANEWLDKMMMRG----SLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD+++ R     S ++ +E    +++L++K+Y  LL HV+SAA+AL
Sbjct  669  AGMLTQLKSVNDWLDEIISRKDEGESCQISAET---IDRLRKKIYEYLLTHVESAAAAL  724



>ref|XP_010550202.1| PREDICTED: uncharacterized protein LOC104821115 [Tarenaya hassleriana]
Length=749

 Score =   165 bits (417),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 99/119 (83%), Gaps = 1/119 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ IN+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHINT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP++ GVRP+PGRHP  G PKD+
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRLESASPVPLVRGVRPVPGRHPCVGCPKDI  118


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 62/124 (50%), Gaps = 22/124 (18%)
 Frame = -1

Query  554  LEWARGDGLKATKELRESLSNETHLWFL----KFLDASLDVGFQVnnnnnkenksKGRQE  387
            LEWA+G+GL    +L E L   +  WFL    +FLDA +D    ++              
Sbjct  621  LEWAKGNGLDEAIDLVEKLQVVSQDWFLGFVERFLDADVDASSSLS--------------  666

Query  386  EANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGF----VEKLKQKVYGCLLVHVDSA  219
            +   I   LS LK  N+WLD++      E G +        +E+L++K+Y  LL HV+SA
Sbjct  667  DNGQIAGMLSQLKSVNDWLDEIGSSPGKEEGGDSSEVPEETIERLRKKIYEYLLSHVESA  726

Query  218  ASAL  207
            A+AL
Sbjct  727  AAAL  730



>ref|XP_010069275.1| PREDICTED: uncharacterized protein LOC104456229 [Eucalyptus grandis]
 ref|XP_010069276.1| PREDICTED: uncharacterized protein LOC104456229 [Eucalyptus grandis]
 ref|XP_010069277.1| PREDICTED: uncharacterized protein LOC104456229 [Eucalyptus grandis]
 ref|XP_010069278.1| PREDICTED: uncharacterized protein LOC104456229 [Eucalyptus grandis]
 gb|KCW57571.1| hypothetical protein EUGRSUZ_H00341 [Eucalyptus grandis]
Length=752

 Score =   165 bits (417),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVGGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+EP +PVP++ GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLEPASPVPIVKGVRPVPGRHPCVGNPEDIV  119


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 63/120 (53%), Gaps = 15/120 (13%)
 Frame = -1

Query  554  LEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANH  375
            LEW RG+GL  T +L E L  E+  WFL F++  LD     +  +           +   
Sbjct  621  LEWERGNGLDETVDLAEVLKVESRDWFLGFVERFLDADVDTSVLS-----------DNGQ  669

Query  374  IGLTLSLLKQANEWLDKMMMRGSLELGSEMHG----FVEKLKQKVYGCLLVHVDSAASAL  207
            I   LS LK  N+WLD++    + E  ++  G     V++L++K+Y  LL HV+SAA+AL
Sbjct  670  IAGMLSQLKSVNDWLDEIGSTKTDEGEAQTPGVSGEVVDRLRKKIYEYLLTHVESAAAAL  729



>ref|XP_011073840.1| PREDICTED: uncharacterized protein LOC105158698 [Sesamum indicum]
Length=745

 Score =   165 bits (417),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MATLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLESASPVPILRGVRPVPGRHPCVGTPEDIV  119


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 58/116 (50%), Gaps = 11/116 (9%)
 Frame = -1

Query  554  LEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANH  375
            +EWA+GD L    EL E L  E+  WFL F++  LD     +  +           +   
Sbjct  623  IEWAKGDSLDEAVELSERLRLESQDWFLGFVERFLDTDVDTSALS-----------DNGQ  671

Query  374  IGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
            I   LS LK  N+WLD++      E        ++++++K+Y  LL HV+SAA+AL
Sbjct  672  IAGMLSQLKSVNDWLDQIGSNKDEETPHISTETIDRIRKKIYEYLLTHVESAAAAL  727


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 71/119 (60%), Gaps = 8/119 (7%)
 Frame = -1

Query  1001  VDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknl  822
             V V+F   +NR+  L+   V W+SLP +L K GK +L+ +  A   A EA  EA  A+ L
Sbjct  400   VKVSF---SNRR--LTDASVSWASLPSSLAKLGKEVLKHRDAAQTAAIEAMQEASIAETL  454

Query  821   LQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYCFTKLSV--TDNKKTP  651
             L+CLS +++L SSA  +NP  ++ +F +LHA + +     D    T LSV  +DN++TP
Sbjct  455   LRCLSTYSELSSSAKEDNPQPAVEQFLSLHASLNKAHLIADSLSKT-LSVDSSDNEETP  512



>ref|XP_006442971.1| hypothetical protein CICLE_v10018994mg [Citrus clementina]
 ref|XP_006478747.1| PREDICTED: uncharacterized protein LOC102609198 isoform X1 [Citrus 
sinensis]
 ref|XP_006478748.1| PREDICTED: uncharacterized protein LOC102609198 isoform X2 [Citrus 
sinensis]
 gb|ESR56211.1| hypothetical protein CICLE_v10018994mg [Citrus clementina]
Length=748

 Score =   165 bits (417),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLESASPVPILRGVRPVPGRHPCVGSPEDIV  119


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 62/121 (51%), Gaps = 12/121 (10%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL    +L E L  E+  WFL F++  LD     ++ +           +   I
Sbjct  623  EWTRGNGLDEAVDLAEMLQMESQDWFLGFVERFLDADVDTSSLS-----------DNGQI  671

Query  371  GLTLSLLKQANEWLDKM-MMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRS  195
               LS LK  N+WLDK+   +  +E        V++L++K+Y  LL HV+SAA+AL + S
Sbjct  672  AGMLSQLKSVNDWLDKIGSSKDEVEAPRVSAETVDRLRKKIYEYLLTHVESAAAALGSGS  731

Query  194  H  192
             
Sbjct  732  Q  732



>ref|XP_008788220.1| PREDICTED: uncharacterized protein LOC103706043 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008788221.1| PREDICTED: uncharacterized protein LOC103706043 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008788223.1| PREDICTED: uncharacterized protein LOC103706043 isoform X1 [Phoenix 
dactylifera]
Length=736

 Score =   164 bits (416),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFSNRGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  YVDR+E  +PVP+L GVRP+PGRHP  G P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIYVDRLEAASPVPILRGVRPVPGRHPCVGHPEDIV  119


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 90/162 (56%), Gaps = 12/162 (7%)
 Frame = -1

Query  1136  QQEIKVQARPTTPSARSDALLTSDSTIINGVNTNTLPKRTNKQENVD-----VNFMSNNN  972
             +++ KVQ    TP+ +  A  +SD +  +    +++ K+T +  N       V F+SN+ 
Sbjct  331   KEDNKVQ----TPAKKGTANASSDDSDRSNKQRSSIIKKTQEASNNLNLANLVKFVSNSK  386

Query  971   RQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADL  792
             R    S   V W+S P +LVK GK +L+ +  A L A +A  EA AA++L++CLSM+ ++
Sbjct  387   RWTDGS---VSWASFPSSLVKLGKEVLKYRDAAQLAAIQALQEASAAESLIRCLSMYVEV  443

Query  791   CSSASPENPHLSITKFFALHALIEQPKKALDDYCFTKLSVTD  666
              S+A  +NP  ++ +F ALHA + +  +  D    T ++  D
Sbjct  444   TSTAKEDNPQPAVEEFLALHASLSRASQVTDSLANTAVTSPD  485


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 54/125 (43%), Gaps = 24/125 (19%)
 Frame = -1

Query  542  RGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIGLT  363
            RG GL+   EL  +L  E   WFL F++  LD        +           +   +   
Sbjct  604  RGGGLEEGSELARALREEARRWFLGFVERFLDADVAAPGPS-----------DGEQVAGM  652

Query  362  LSLLKQANEWLDKMMMRGSL-------------ELGSEMHGFVEKLKQKVYGCLLVHVDS  222
            LS LK+ N+WLD +  +                E G      +E+L++K+Y  LL HV+S
Sbjct  653  LSQLKRVNDWLDTIGRQREGEAAEAATAEDRVGEGGGVPEETIERLRKKIYEYLLAHVES  712

Query  221  AASAL  207
            AA AL
Sbjct  713  AAVAL  717



>ref|XP_008788224.1| PREDICTED: uncharacterized protein LOC103706043 isoform X2 [Phoenix 
dactylifera]
Length=705

 Score =   164 bits (415),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFSNRGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  YVDR+E  +PVP+L GVRP+PGRHP  G P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIYVDRLEAASPVPILRGVRPVPGRHPCVGHPEDIV  119


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 72/131 (55%), Gaps = 4/131 (3%)
 Frame = -1

Query  1046  VNTNTLPKRTNK----QENVDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKK  879
             +N  +L K  NK     +    N  S+++     +   V W+S P +LVK GK +L+ + 
Sbjct  324   LNGKSLSKEDNKVQTPAKKGTANASSDDSDSKRWTDGSVSWASFPSSLVKLGKEVLKYRD  383

Query  878   lasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALD  699
              A L A +A  EA AA++L++CLSM+ ++ S+A  +NP  ++ +F ALHA + +  +  D
Sbjct  384   AAQLAAIQALQEASAAESLIRCLSMYVEVTSTAKEDNPQPAVEEFLALHASLSRASQVTD  443

Query  698   DYCFTKLSVTD  666
                 T ++  D
Sbjct  444   SLANTAVTSPD  454


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 54/125 (43%), Gaps = 24/125 (19%)
 Frame = -1

Query  542  RGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIGLT  363
            RG GL+   EL  +L  E   WFL F++  LD        +           +   +   
Sbjct  573  RGGGLEEGSELARALREEARRWFLGFVERFLDADVAAPGPS-----------DGEQVAGM  621

Query  362  LSLLKQANEWLDKMMMRGSL-------------ELGSEMHGFVEKLKQKVYGCLLVHVDS  222
            LS LK+ N+WLD +  +                E G      +E+L++K+Y  LL HV+S
Sbjct  622  LSQLKRVNDWLDTIGRQREGEAAEAATAEDRVGEGGGVPEETIERLRKKIYEYLLAHVES  681

Query  221  AASAL  207
            AA AL
Sbjct  682  AAVAL  686



>ref|XP_003578444.1| PREDICTED: micronuclear linker histone polyprotein-like [Brachypodium 
distachyon]
Length=734

 Score =   164 bits (416),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA+SGS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALSGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++K+QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPEEQHDLILSDKIQLGQFIHVDRLEAATPVPILWGVRPVPGRHACVGNPEDLV  119



>ref|XP_004241426.1| PREDICTED: uncharacterized protein LOC101257082 [Solanum lycopersicum]
Length=747

 Score =   164 bits (416),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MATLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLEAASPVPILRGVRPVPGRHPCVGTPEDIV  119


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 11/109 (10%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            +W RGDGL+   +L E L   +  WFL F++  LD     +  +           +   I
Sbjct  624  DWVRGDGLEEAVDLAEMLRVASQDWFLGFVERFLDADVDASALS-----------DNGQI  672

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVD  225
               LS LK  N+WLD++      E        ++++++K+Y  LL HV+
Sbjct  673  AGMLSQLKSVNDWLDEISSSKDDESPQIASETIDRIRKKIYEYLLTHVE  721



>ref|XP_007204628.1| hypothetical protein PRUPE_ppa002148mg [Prunus persica]
 gb|EMJ05827.1| hypothetical protein PRUPE_ppa002148mg [Prunus persica]
Length=709

 Score =   164 bits (415),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ++NS T K+ G++RS LLQVI IVPA++GSELWP+ GF++++SDS 
Sbjct  1     MASLTPGILLKLLQSMNSAT-KVTGDHRSALLQVIGIVPALAGSELWPNQGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS  D DLIL N+LQLGQ  YVDR +  +PVP ++G+RPI GRH F G+P+ L+
Sbjct  60    NSTYVSLSDRDTDLILTNRLQLGQFAYVDRFDFDSPVPRVVGIRPIAGRHHFVGTPEPLV  119

Query  1388  QMMEAA  1371
               + A+
Sbjct  120   ARISAS  125


 Score = 72.8 bits (177),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 63/107 (59%), Gaps = 6/107 (6%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W +G G+K T EL  SL +E  +WFL+F++ +LD GF+V      +        ++  I 
Sbjct  597  WTKGRGMKDTVELAMSLQSEMQMWFLEFVEKALDAGFRVFGECAADGVKL--PLDSGSIA  654

Query  368  LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV  228
              LS LK+ NEWLD+++ +   ++  +    +++LK+K+YG ++ HV
Sbjct  655  AVLSQLKRVNEWLDRVVSKRDEQINEK----IDRLKRKIYGFVIQHV  697



>ref|XP_002462666.1| hypothetical protein SORBIDRAFT_02g029910 [Sorghum bicolor]
 gb|EER99187.1| hypothetical protein SORBIDRAFT_02g029910 [Sorghum bicolor]
Length=743

 Score =   164 bits (416),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++K+QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPEEQHDLILSDKIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGTPEDLV  119


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 81/158 (51%), Gaps = 22/158 (14%)
 Frame = -1

Query  1115  ARPTTPSARSDALLTSDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSHP---  945
             AR +T SA SD    +D  +   + T    KRT+         + N+N  N++   P   
Sbjct  338   ARKSTASAPSD---DADKAVKKHIPTV---KRTS-------GVLGNSNVTNLVKVPPNSK  384

Query  944   ------VLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSS  783
                     W+SLPP+L K GK +L+ ++ A + A EA  EA AA++LL+CLS +A++ S+
Sbjct  385   KLTDISTSWTSLPPSLAKLGKEILKYRESAQIAAVEAMQEASAAESLLRCLSSYAEVSST  444

Query  782   ASPENPHLSITKFFALHALIEQPKKALDDYCFTKLSVT  669
             A  +NP  ++ +F  LHA + +     D    +  S T
Sbjct  445   AEEQNPQAAVEQFLTLHAALSRATVITDTLAKSATSAT  482



>gb|KDP43890.1| hypothetical protein JCGZ_20900 [Jatropha curcas]
Length=741

 Score =   164 bits (416),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  V++ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVRVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLESASPVPILRGVRPVPGRHPCVGSPEDIV  119


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 58/117 (50%), Gaps = 13/117 (11%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW +GDGL    +L E L  ++  WFL F++  LD     +  +           +   I
Sbjct  617  EWIKGDGLDEAVDLAEMLRTQSQDWFLGFVERFLDADVDSSTLS-----------DNGQI  665

Query  371  GLTLSLLKQANEWLDKM--MMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD++    +   E        V++L++K+Y  LL HV+SAA+AL
Sbjct  666  AGMLTQLKSVNDWLDEIGGSNKDETETSHVSSETVDRLRKKIYEYLLTHVESAAAAL  722



>ref|XP_010235357.1| PREDICTED: PHD finger protein rhinoceros [Brachypodium distachyon]
Length=731

 Score =   164 bits (415),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   GSP+DL+
Sbjct  60    HATYVSLPEEQHDLILSDTIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGSPEDLV  119


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -1

Query  938  WSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHL  759
            W++LPP+L K GK +L+ +  A + A EA  EA AA++LL CLS +A++ S+A  +NP L
Sbjct  396  WTALPPSLAKLGKELLKYRDAAQMAAVEAMQEASAAESLLGCLSSYAEVSSTAEEQNPQL  455

Query  758  SITKFFALHALIEQPKKALD  699
            ++ +F ALHA + +     D
Sbjct  456  TVEQFLALHAAMSRATAVAD  475



>gb|EEE69083.1| hypothetical protein OsJ_28131 [Oryza sativa Japonica Group]
Length=708

 Score =   164 bits (415),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   GSP+DL+
Sbjct  60    HATYVSLPEEQHDLILSDTIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGSPEDLV  119



>ref|XP_006306848.1| hypothetical protein CARUB_v10008392mg [Capsella rubella]
 gb|EOA39746.1| hypothetical protein CARUB_v10008392mg [Capsella rubella]
Length=752

 Score =   164 bits (416),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKIAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRVESSSPVPILRGVRPVPGRHPCVGDPEDIV  119



>ref|XP_010927895.1| PREDICTED: uncharacterized protein LOC105049832 isoform X1 [Elaeis 
guineensis]
 ref|XP_010927896.1| PREDICTED: uncharacterized protein LOC105049832 isoform X1 [Elaeis 
guineensis]
 ref|XP_010927897.1| PREDICTED: uncharacterized protein LOC105049832 isoform X1 [Elaeis 
guineensis]
 ref|XP_010927898.1| PREDICTED: uncharacterized protein LOC105049832 isoform X1 [Elaeis 
guineensis]
 ref|XP_010927899.1| PREDICTED: uncharacterized protein LOC105049832 isoform X1 [Elaeis 
guineensis]
Length=741

 Score =   164 bits (415),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFSNRGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  YVDR+E   PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIYVDRLEAALPVPILKGVRPVPGRHPCVGNPEDIV  119


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 67/115 (58%), Gaps = 5/115 (4%)
 Frame = -1

Query  995  VNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQ  816
            V F+ N+ R    S   V W+SLP +L K GK +L+ +  A L A EA  EA AA++L++
Sbjct  376  VKFVPNSKRWTDGS---VSWASLPSSLTKLGKEVLKYRDAAQLAAVEAMQEASAAESLIR  432

Query  815  CLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKKTP  651
            CLSM+A+L S+A  +NP  ++ +F A  A + +     D     K++VT   ++P
Sbjct  433  CLSMYAELASTAKEDNPQPAVEQFLAFQASLSRASLVAD--SLVKIAVTSPDRSP  485



>ref|XP_008650784.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008650785.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008650786.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008650787.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008650789.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008650790.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008650791.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA62323.1| TPA: hypothetical protein ZEAMMB73_590071 [Zea mays]
 tpg|DAA62324.1| TPA: hypothetical protein ZEAMMB73_590071 [Zea mays]
 tpg|DAA62325.1| TPA: hypothetical protein ZEAMMB73_590071 [Zea mays]
 tpg|DAA62326.1| TPA: hypothetical protein ZEAMMB73_590071 [Zea mays]
Length=744

 Score =   164 bits (415),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNKGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++K+QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPEEQHDLILSDKIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGTPEDLV  119


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -1

Query  938  WSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHL  759
            W+SLPP+L K GK +L+ ++ A + AAEA  EA AA++LL+CLS +A++ S+A   NP  
Sbjct  393  WTSLPPSLAKLGKELLKYRESAQIAAAEAMQEASAAESLLRCLSSYAEVSSTAEEHNPQP  452

Query  758  SITKFFALHALIEQ  717
            ++ KFF LHA + +
Sbjct  453  AVEKFFTLHAALSR  466



>ref|XP_010258510.1| PREDICTED: uncharacterized protein LOC104598255 [Nelumbo nucifera]
 ref|XP_010258511.1| PREDICTED: uncharacterized protein LOC104598255 [Nelumbo nucifera]
 ref|XP_010258513.1| PREDICTED: uncharacterized protein LOC104598255 [Nelumbo nucifera]
Length=749

 Score =   164 bits (415),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MATLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++KLQLGQ  +V+R+E  +PVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPDEHDDLILSDKLQLGQFIHVERLEAASPVPILRGVRPVPGRHACIGNPEDLV  119


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 60/120 (50%), Gaps = 19/120 (16%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW +G+GL    +L ++L  E+  WFL F++  LD     +              + + I
Sbjct  625  EWIQGNGLDEAVDLAQTLKTESQDWFLGFIERFLDADMDNSAL-----------RDNSQI  673

Query  371  GLTLSLLKQANEWLDKMMMRGSLE-----LGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               LS LK  N+WL+++      E     + SE    +++L++K+Y  LL HV+SAA AL
Sbjct  674  ASMLSQLKSVNDWLEEIGSTKDEEEDGPCIPSET---IDRLRKKIYDYLLTHVESAAVAL  730


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 64/101 (63%), Gaps = 2/101 (2%)
 Frame = -1

Query  986  MSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLS  807
            +S NNR+  L+   V W+SLP +L K GK +L+ +  A + A EA  EA AA++L++CLS
Sbjct  402  VSLNNRR--LTDGSVSWASLPSSLAKLGKEVLKYRDAAQMAAIEAMQEASAAESLIRCLS  459

Query  806  MFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYCFT  684
            ++A+L +SA  +NP  ++ +F +LHA + + +   D    T
Sbjct  460  IYAELSTSAKEDNPQPTVEQFLSLHASLNRARLVADSLSKT  500



>gb|KHG07510.1| CTP synthase [Gossypium arboreum]
Length=745

 Score =   164 bits (415),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDS 
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSC  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRLESASPVPILHGVRPVPGRHPCVGSPEDIV  119


 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 56/115 (49%), Gaps = 16/115 (14%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL    +L E L  E+  WFL F++  LDV    +  +           + + I
Sbjct  617  EWTRGNGLDEAVDLAEMLRMESQDWFLGFVEKFLDVDVDTSALS-----------DNDQI  665

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGFV-----EKLKQKVYGCLLVHVDS  222
               L+ LK  N+WLD++        G EM   V     ++L++K+Y  LL HV+S
Sbjct  666  AGMLTQLKSVNDWLDEISSNKDEGEGEEMTPHVSSETIDRLRKKIYEYLLTHVES  720



>ref|XP_004957360.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X1 [Setaria italica]
 ref|XP_004957361.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X2 [Setaria italica]
Length=745

 Score =   164 bits (415),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++K+QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPEEQHDLILSDKIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGTPEDLV  119


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 80/146 (55%), Gaps = 22/146 (15%)
 Frame = -1

Query  1127  IKVQARPTTPSARSDALLTSDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNRQNILSSH  948
             I+  AR +T SA SD     D+      +T T+ KRT+         + N+N  N++   
Sbjct  336   IQKAARKSTASAPSD-----DADKAVKKHTPTV-KRTS-------GVLGNSNATNLVKIP  382

Query  947   P---------VLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFAD  795
             P           W+SLPP+L K GK +L+ ++ A + A EA  EA AA++LL+CLS +A+
Sbjct  383   PNSKKLTDTSTSWTSLPPSLAKLGKELLKYRESAQMAAVEAMQEASAAESLLRCLSSYAE  442

Query  794   LCSSASPENPHLSITKFFALHALIEQ  717
             + S+A  +NP  ++ +F  LHA + +
Sbjct  443   VSSTAEEQNPQPAVEQFLTLHAALSR  468



>ref|XP_008342565.1| PREDICTED: uncharacterized protein LOC103405362 isoform X1 [Malus 
domestica]
Length=721

 Score =   164 bits (414),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR++  TPVP+L GVRP+PGRH   GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRLQAATPVPILQGVRPVPGRHSCVGSPEDIV  119


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 18/119 (15%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW +G+GL    +L E L  ++  WFL F++  LD     +              +   I
Sbjct  598  EWNKGNGLDEVVDLAEKLRLQSQAWFLGFVERFLDADVDSSAL-----------SDNGQI  646

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGF----VEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD +   GS++ G E        ++ L++K+Y  LL HV+SAA+AL
Sbjct  647  AGMLTQLKSVNDWLDNI---GSIQEGVETTDVSAETIDSLRKKIYEYLLTHVESAAAAL  702



>ref|NP_001062388.1| Os08g0541500 [Oryza sativa Japonica Group]
 dbj|BAD03103.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF24302.1| Os08g0541500 [Oryza sativa Japonica Group]
Length=733

 Score =   164 bits (415),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   GSP+DL+
Sbjct  60    HATYVSLPEEQHDLILSDTIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGSPEDLV  119


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = -1

Query  995  VNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQ  816
            V   SN+ +   L+     W+SLPP+L K GK +L+ +  A + A EA  EA AA+NLL+
Sbjct  379  VKIASNSKK---LTDASASWTSLPPSLAKLGKELLKYRDAAQMAAVEAMQEASAAENLLR  435

Query  815  CLSMFADLCSSASPENPHLSITKFFALHALIEQ  717
            CLS +A++ S+A  +NP  ++ +F ALHA + +
Sbjct  436  CLSSYAEVSSTAEEQNPQPAVEQFLALHAAMSR  468



>ref|XP_009372734.1| PREDICTED: uncharacterized protein LOC103961841 isoform X1 [Pyrus 
x bretschneideri]
Length=738

 Score =   164 bits (414),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR++  TPVP+L GVRP+PGRH   GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRLQAATPVPILHGVRPVPGRHSCVGSPEDIV  119


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 62/119 (52%), Gaps = 18/119 (15%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW +G+GL    +L + L  ++  WFL F++  LD    ++  +           +   I
Sbjct  615  EWNKGNGLDEVVDLAKMLRLQSQAWFLGFVERFLDADVDISALS-----------DNGQI  663

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGF----VEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD +   GS++ G E        +++L++K+Y  LL HV+SAA+AL
Sbjct  664  AGMLTQLKSVNDWLDNI---GSIQEGVETTDISAETIDRLRKKIYEYLLTHVESAAAAL  719



>ref|XP_009372744.1| PREDICTED: uncharacterized protein LOC103961841 isoform X2 [Pyrus 
x bretschneideri]
Length=722

 Score =   164 bits (414),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR++  TPVP+L GVRP+PGRH   GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRLQAATPVPILHGVRPVPGRHSCVGSPEDIV  119


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 61/119 (51%), Gaps = 18/119 (15%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW +G+GL    +L + L  ++  WFL F++  LD    ++              +   I
Sbjct  599  EWNKGNGLDEVVDLAKMLRLQSQAWFLGFVERFLDADVDISAL-----------SDNGQI  647

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGF----VEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD +   GS++ G E        +++L++K+Y  LL HV+SAA+AL
Sbjct  648  AGMLTQLKSVNDWLDNI---GSIQEGVETTDISAETIDRLRKKIYEYLLTHVESAAAAL  703



>ref|XP_010908934.1| PREDICTED: uncharacterized protein LOC105035184 [Elaeis guineensis]
 ref|XP_010908942.1| PREDICTED: uncharacterized protein LOC105035184 [Elaeis guineensis]
Length=734

 Score =   164 bits (414),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KL Q +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLFQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFSNRGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  YVDR+E  +PVP+L GVRP+PGRHP  G P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIYVDRLEAASPVPILRGVRPVPGRHPCVGHPEDIV  119


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 58/125 (46%), Gaps = 21/125 (17%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EWARG GL+   EL   LS E   WFL F++  LD                G  +     
Sbjct  602  EWARGGGLEEGAELARVLSEEGRGWFLGFVERFLDADVAA----------PGPWDREQVA  651

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEM----------HGFVEKLKQKVYGCLLVHVDS  222
            G+ LS LK+ N+WLD++  R   +                  +E+L++K+Y  LL HV+S
Sbjct  652  GM-LSQLKKVNDWLDRIGRRREGQAAEAEDGGGEGGGVPEETIERLRKKIYEYLLAHVES  710

Query  221  AASAL  207
            AA AL
Sbjct  711  AAVAL  715


 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 84/159 (53%), Gaps = 10/159 (6%)
 Frame = -1

Query  1103  TPSARSDALLTSDSTIINGVNTNTLPKRTNKQEN-----VDVNFMSNNNRQNILSSHPVL  939
             TP  +  A   SD +  +     ++ K+T +  N       V F+SN+ R    S   V 
Sbjct  338   TPVKKGTANAASDDSDRSNKQRASIIKKTQEATNNLNLASLVKFVSNSKRWTDGS---VS  394

Query  938   WSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHL  759
             W+SLP +L K GK +L+ +  A + A +A  EA AA++L++CLSM+A++ S+A  +NP  
Sbjct  395   WASLPSSLAKLGKEVLKYRDAAQVAAIQALQEASAAESLIRCLSMYAEVTSTAKEDNPQP  454

Query  758   SITKFFALHALIEQPKKALDDYCFTKLSVTDNKKTPDSN  642
             ++ +F ALHA + +     D     K +VT   + P  N
Sbjct  455   AVEQFLALHASLSRASLVTD--SLAKTAVTSPDQAPAGN  491



>ref|XP_008242581.1| PREDICTED: uncharacterized protein LOC103340896 [Prunus mume]
Length=762

 Score =   164 bits (415),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 103/127 (81%), Gaps = 1/127 (1%)
 Frame = -1

Query  1751  TMASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDS  1572
             TMASLTPG+L+KLLQ++NS T K+ G++RS LLQVI IVPA++GS+LWP+ GF++++SDS
Sbjct  51    TMASLTPGILLKLLQSMNSAT-KVTGDHRSALLQVIGIVPALAGSDLWPNQGFYVQLSDS  109

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
              +STYV+LS  D DLIL N+LQLGQ  YVDR +  +PVP ++G+RPI GRH F G+P+ L
Sbjct  110   LNSTYVSLSDRDTDLILTNRLQLGQFAYVDRFDFDSPVPRVVGIRPIAGRHHFVGTPEPL  169

Query  1391  MQMMEAA  1371
             +  + A+
Sbjct  170   VARISAS  176


 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W +G G+K T EL  SL +E  +WFL+F++ +LD GF+V      +        +   I 
Sbjct  650  WTKGRGMKDTAELAMSLQSEMQMWFLEFVEKALDAGFRVFGECAADGVKL--PLDCGSIA  707

Query  368  LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV  228
              LS LK+ NEWLD+++ +       +M+  V++LK+K+YG ++ HV
Sbjct  708  AVLSQLKRVNEWLDRVVSK----RDEQMNEKVDRLKRKIYGFVIQHV  750



>ref|XP_006347312.1| PREDICTED: muscle M-line assembly protein unc-89-like [Solanum 
tuberosum]
Length=747

 Score =   164 bits (414),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MATLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFVHVERLEAASPVPILRGVRPVPGRHPCVGTPEDIV  119


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 11/109 (10%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            +W RGDGL+   +L E L   +  WFL F++  LD     +  +           +   I
Sbjct  624  DWVRGDGLEEAVDLAEMLRVASQDWFLGFVERFLDADVDASALS-----------DNGQI  672

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVD  225
               LS LK  N+WLD++      E        ++++++K+Y  LL HV+
Sbjct  673  AGMLSQLKSVNDWLDEISSSKDDESPKIASETIDRIRKKIYEYLLTHVE  721



>ref|XP_010458138.1| PREDICTED: uncharacterized protein LOC104739470 isoform X1 [Camelina 
sativa]
 ref|XP_010458139.1| PREDICTED: uncharacterized protein LOC104739470 isoform X2 [Camelina 
sativa]
Length=753

 Score =   164 bits (414),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQV+SIVPA++G EL+P+ GF+++VSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKIAGEHRSSLLQVVSIVPALAGGELFPNQGFYLRVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRVESSSPVPILRGVRPVPGRHPCVGDPEDIV  119



>gb|EEC84887.1| hypothetical protein OsI_32047 [Oryza sativa Indica Group]
Length=759

 Score =   164 bits (414),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++K+QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPEDQHDLILSDKIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGNPEDLV  119



>ref|XP_009393517.1| PREDICTED: uncharacterized protein LOC103979183 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score =   162 bits (411),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVLIKLLQ +N+  VKI GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLIKLLQHMNT-DVKIAGEHRSSLLQVVSIVPALAGSDLFTNRGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    NDLIL++++QLGQ  +VD +E G+PVP+L G RP+PGRHP  G+P+DL+
Sbjct  60    HATYVSLPDEHNDLILSDQIQLGQFIHVDCLEAGSPVPILKGARPLPGRHPCVGNPEDLV  119


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 59/132 (45%), Gaps = 28/132 (21%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG G++   EL   L  E H WFL F++  LD        +           +   +
Sbjct  504  EWERGVGMEDGAELARQLREEAHSWFLGFVERFLDADAAAPGPS-----------DREQV  552

Query  371  GLTLSLLKQANEWLDKMMMR---GSLELGSEMH--------------GFVEKLKQKVYGC  243
               LS LK+ N+WL+ +  R   G  E  +E+                 +++L++K+Y  
Sbjct  553  AAMLSQLKKVNDWLEAIGHRRREGEAEADAEVDEAEHGEGPGGGVPVETIDRLRKKIYEY  612

Query  242  LLVHVDSAASAL  207
            LL HV+SAA AL
Sbjct  613  LLTHVESAAVAL  624



>ref|XP_011011525.1| PREDICTED: uncharacterized protein LOC105116060 [Populus euphratica]
 ref|XP_011011526.1| PREDICTED: uncharacterized protein LOC105116060 [Populus euphratica]
 ref|XP_011011527.1| PREDICTED: uncharacterized protein LOC105116060 [Populus euphratica]
Length=727

 Score =   163 bits (413),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 100/119 (84%), Gaps = 1/119 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+ + GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFSNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             H+TYV+L    +DLIL++K+QLGQ  +V+R++P +PVP+L GVRP+PGRHP  GSP+D+
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLQPASPVPILRGVRPVPGRHPCVGSPEDI  118


 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 57/120 (48%), Gaps = 20/120 (17%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFL----KFLDASLDVGFQVnnnnnkenksKGRQEE  384
            EW RG+GL    +L   L  E+  WFL    +FLDA +D                    +
Sbjct  604  EWIRGNGLDEAVDLAGMLQMESQDWFLGYVERFLDADVDTSA---------------LSD  648

Query  383  ANHIGLTLSLLKQANEWLDKM-MMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               I   L+ LK  N+WLD++   +   E        +++L++K+Y  LL HV+SAA+AL
Sbjct  649  NGQIAGMLTQLKSVNDWLDEIGSSKDEAETPHVSSETIDRLRKKIYEYLLTHVESAAAAL  708



>ref|XP_010489346.1| PREDICTED: uncharacterized protein LOC104767025 [Camelina sativa]
Length=751

 Score =   164 bits (414),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQV+SIVPA++G EL+P+ GF+++VSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKIAGEHRSSLLQVVSIVPALAGGELFPNQGFYLRVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRVESSSPVPILRGVRPVPGRHPCVGDPEDIV  119



>gb|EYU36722.1| hypothetical protein MIMGU_mgv1a002034mg [Erythranthe guttata]
Length=724

 Score =   163 bits (413),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+LTPGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MATLTPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+++E  +PVP L GVRPIPGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVEKLEAASPVPYLRGVRPIPGRHPCMGTPEDIV  119


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 62/119 (52%), Gaps = 14/119 (12%)
 Frame = -1

Query  554  LEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANH  375
            +EWA+GDGL+   EL E L  E+  WFL F++  LD      + +           +   
Sbjct  601  IEWAKGDGLEEAVELSEMLRMESQDWFLGFVERFLDADVDTTSLS-----------DNGQ  649

Query  374  IGLTLSLLKQANEWLDKMMMRGSLELGSEMH---GFVEKLKQKVYGCLLVHVDSAASAL  207
            I   LS LK  N+WLD++      E  +  H     ++++++K+Y  LL HV+SAA+AL
Sbjct  650  IAGMLSQLKSVNDWLDEIGSSCKDEEETTQHISTETIDRIRKKIYEYLLTHVESAAAAL  708


 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 66/118 (56%), Gaps = 6/118 (5%)
 Frame = -1

Query  1001  VDVNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknl  822
             V V+F   NNR+  LS   V W SLP +L K GK +L+ +  A   A EA  EA  A+ L
Sbjct  397   VKVSF---NNRR--LSDASVSWGSLPSSLAKLGKEVLKHRDAAQTAAVEAMQEASTAETL  451

Query  821   LQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYC-FTKLSVTDNKKTP  651
             L+CLS +++L SSA  +NPH ++ +F +LHA + +     D          +DN++ P
Sbjct  452   LRCLSTYSELSSSAREDNPHPTVEQFLSLHASLNKAHLVADSLSKILSTDSSDNEENP  509



>ref|XP_010475688.1| PREDICTED: uncharacterized protein LOC104755062 [Camelina sativa]
Length=748

 Score =   164 bits (414),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQV+SIVPA++G EL+P+ GF+++VSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKIAGEHRSSLLQVVSIVPALAGGELFPNQGFYLRVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVDRVESSSPVPILRGVRPVPGRHPCVGDPEDIV  119


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (52%), Gaps = 15/120 (13%)
 Frame = -1

Query  554  LEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANH  375
            L W +G+GL    +L E L   +  WFL F++  LD    V  ++N      G       
Sbjct  620  LNWVKGNGLNEATDLAEKLQMVSQDWFLGFVERFLDA--DVITSSNLNLSDNG------Q  671

Query  374  IGLTLSLLKQANEWLDKMMMR----GSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
            I   LS LK  N+WLD++  +    G  E+  E    +++L++K+Y  LL HV+SAA+AL
Sbjct  672  IAGMLSQLKSVNDWLDEIGSKEDEEGLQEVSKET---IDRLRKKIYEYLLTHVESAAAAL  728



>dbj|BAJ87804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=705

 Score =   163 bits (412),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL 
Sbjct  60    HATYVSLPEDQHDLILSDTIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGTPEDLF  119


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 82/150 (55%), Gaps = 22/150 (15%)
 Frame = -1

Query  1136  QQEIKVQARPTTPSARSDALLTSDSTIINGVNTNTLP-KRTNKQENVDVNFMSNNNRQNI  960
             + + K+Q    TP  +S A   SD +    VN +  P +RT+         +SN N  N+
Sbjct  302   KDDTKIQ----TPPRKSTASAPSDDSD-RPVNKHLSPIRRTS-------GVLSNTNITNL  349

Query  959   ---------LSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLS  807
                      L+     W++LPP+L K GK +L+ +  A + A EA  EA AA++LL+CLS
Sbjct  350   VKIAANSKKLTDASTSWTALPPSLAKLGKELLKYRDAAQMAAVEAMQEASAAESLLRCLS  409

Query  806   MFADLCSSASPENPHLSITKFFALHALIEQ  717
              +A++ S+A  +NP L++ +F ALH+ + +
Sbjct  410   SYAEVSSTAEEQNPQLAVEQFLALHSAMSR  439



>ref|XP_006590928.1| PREDICTED: uncharacterized protein LOC100775984 isoform X1 [Glycine 
max]
 ref|XP_006590929.1| PREDICTED: uncharacterized protein LOC100775984 isoform X2 [Glycine 
max]
 gb|KHN06191.1| hypothetical protein glysoja_031633 [Glycine soja]
Length=742

 Score =   163 bits (413),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KL+Q +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDS 
Sbjct  1     MANLVPGVLLKLMQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFVFVDRLEAASPVPILHGVRPVPGRHPCVGTPEDIV  119

Query  1388  QMMEAAG  1368
                 + G
Sbjct  120   ATTHSLG  126


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 19/119 (16%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL    +L + L   +  WFL F++  LD     + +NN              I
Sbjct  620  EWVRGNGLDEVVDLADLLQLRSRDWFLVFVERFLDTDGDTSLSNN------------GEI  667

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGF----VEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD++   GS +   E        +++L++K+Y  LL HV+SAA+AL
Sbjct  668  AGMLTQLKNVNDWLDEI---GSSKNEGEPCQIPAETIDRLRKKIYEYLLTHVESAAAAL  723



>ref|XP_006590930.1| PREDICTED: uncharacterized protein LOC100775984 isoform X3 [Glycine 
max]
Length=738

 Score =   163 bits (413),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KL+Q +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDS 
Sbjct  1     MANLVPGVLLKLMQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFVFVDRLEAASPVPILHGVRPVPGRHPCVGTPEDIV  119

Query  1388  QMMEAAG  1368
                 + G
Sbjct  120   ATTHSLG  126


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 19/119 (16%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL    +L + L   +  WFL F++  LD     + +NN              I
Sbjct  616  EWVRGNGLDEVVDLADLLQLRSRDWFLVFVERFLDTDGDTSLSNN------------GEI  663

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGF----VEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD++   GS +   E        +++L++K+Y  LL HV+SAA+AL
Sbjct  664  AGMLTQLKNVNDWLDEI---GSSKNEGEPCQIPAETIDRLRKKIYEYLLTHVESAAAAL  719



>gb|EEE70053.1| hypothetical protein OsJ_30017 [Oryza sativa Japonica Group]
Length=759

 Score =   163 bits (413),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++K+QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPEDQHDLILSDKIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGNPEDLV  119



>ref|XP_010242740.1| PREDICTED: uncharacterized protein LOC104587013 [Nelumbo nucifera]
Length=734

 Score =   163 bits (412),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MATLVPGVLLKLLQNMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNKGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TY +L    +DLIL++KLQLGQ  +V+R+E  +PVP+L GVRP+PGRH   GSP+DL+
Sbjct  60    HATYASLPDEHDDLILSDKLQLGQFIHVERLEAASPVPILRGVRPVPGRHACIGSPEDLV  119


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 18/119 (15%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL    +L ++L  E+  WFL F++  LD         N      GR      I
Sbjct  611  EWIRGNGLDEAVDLAQTLKTESQDWFLGFVERFLDADVD-----NSALTDNGR------I  659

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGF----VEKLKQKVYGCLLVHVDSAASAL  207
               LS LK  N+WLD++   GS + G E        +++L++K+Y  LL HV+SAA AL
Sbjct  660  ANMLSQLKNVNDWLDEI---GSAKDGEEEPCIPAETIDRLRKKIYEYLLTHVESAAVAL  715



>ref|XP_009402685.1| PREDICTED: uncharacterized protein LOC103986400 [Musa acuminata 
subsp. malaccensis]
Length=737

 Score =   163 bits (412),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVLIKLLQ +N+  VK+ GE+RS LLQV SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLIKLLQHMNT-DVKVAGEHRSSLLQVASIVPALAGSDLFTNKGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV LS   NDLIL++K+QLGQ  +VDR+E G+PVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVYLSDEHNDLILSDKIQLGQFIHVDRLEAGSPVPILKGVRPLPGRHQCVGNPEDLV  119


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 58/136 (43%), Gaps = 34/136 (25%)
 Frame = -1

Query  554  LEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANH  375
            LEW RG GL+   EL  +L  +   WFL+F++  LD        +           +   
Sbjct  594  LEWDRGAGLEEGAELARALREDARAWFLEFVERFLDADAAAPVPS-----------DREQ  642

Query  374  IGLTLSLLKQANEWLDKMMMRGSLELGSEMHGF--------------------VEKLKQK  255
            +   LS LK+ N+WL+ +   GS     E                        +++L++K
Sbjct  643  VAAMLSQLKKVNDWLEAI---GSQRREGETEPEAEAGETEGGEGPSSGVPVETIQRLRKK  699

Query  254  VYGCLLVHVDSAASAL  207
            +Y  LL HV+SAA AL
Sbjct  700  IYEYLLTHVESAAVAL  715



>ref|XP_004486892.1| PREDICTED: uncharacterized protein LOC101502274 isoform X1 [Cicer 
arietinum]
 ref|XP_004486893.1| PREDICTED: uncharacterized protein LOC101502274 isoform X2 [Cicer 
arietinum]
 ref|XP_004486894.1| PREDICTED: uncharacterized protein LOC101502274 isoform X3 [Cicer 
arietinum]
Length=768

 Score =   163 bits (413),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVGGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFVFVDRFESSSPVPILHGVRPVPGRHPCVGTPEDIV  119


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 60/121 (50%), Gaps = 21/121 (17%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL    +L E L  ++  WFL F++  LD                 +  +   I
Sbjct  640  EWVRGNGLNEVVDLAEMLRLQSRDWFLGFVERFLDSDGDT------------KLSDNGQI  687

Query  371  GLTLSLLKQANEWLDKMMMRG------SLELGSEMHGFVEKLKQKVYGCLLVHVDSAASA  210
               L+ LK  N+WLD++ +        S ++  E    +++L++K+Y  LL HV+SAA+A
Sbjct  688  AGMLTQLKSVNDWLDEIGLNKDEGESYSSQISVET---IDRLRKKIYEYLLTHVESAAAA  744

Query  209  L  207
            L
Sbjct  745  L  745



>ref|XP_004486895.1| PREDICTED: uncharacterized protein LOC101502274 isoform X4 [Cicer 
arietinum]
Length=770

 Score =   163 bits (413),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVGGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFVFVDRFESSSPVPILHGVRPVPGRHPCVGTPEDIV  119


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 60/121 (50%), Gaps = 21/121 (17%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL    +L E L  ++  WFL F++  LD                 +  +   I
Sbjct  642  EWVRGNGLNEVVDLAEMLRLQSRDWFLGFVERFLDSDGDT------------KLSDNGQI  689

Query  371  GLTLSLLKQANEWLDKMMMRG------SLELGSEMHGFVEKLKQKVYGCLLVHVDSAASA  210
               L+ LK  N+WLD++ +        S ++  E    +++L++K+Y  LL HV+SAA+A
Sbjct  690  AGMLTQLKSVNDWLDEIGLNKDEGESYSSQISVET---IDRLRKKIYEYLLTHVESAAAA  746

Query  209  L  207
            L
Sbjct  747  L  747



>dbj|BAK06401.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=737

 Score =   163 bits (412),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL 
Sbjct  60    HATYVSLPEDQHDLILSDTIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGTPEDLF  119


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 82/150 (55%), Gaps = 22/150 (15%)
 Frame = -1

Query  1136  QQEIKVQARPTTPSARSDALLTSDSTIINGVNTNTLP-KRTNKQENVDVNFMSNNNRQNI  960
             + + K+Q    TP  +S A   SD +    VN +  P +RT+         +SN N  N+
Sbjct  334   KDDTKIQ----TPPRKSTASAPSDDSD-RPVNKHLSPIRRTS-------GVLSNTNITNL  381

Query  959   ---------LSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLS  807
                      L+     W++LPP+L K GK +L+ +  A + A EA  EA AA++LL+CLS
Sbjct  382   VKIAANSKKLTDASTSWTALPPSLAKLGKELLKYRDAAQMAAVEAMQEASAAESLLRCLS  441

Query  806   MFADLCSSASPENPHLSITKFFALHALIEQ  717
              +A++ S+A  +NP L++ +F ALH+ + +
Sbjct  442   SYAEVSSTAEEQNPQLAVEQFLALHSAMSR  471



>ref|XP_004974075.1| PREDICTED: chitinase-like protein PB1E7.04c-like [Setaria italica]
Length=744

 Score =   163 bits (412),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PG+L+KLLQ +NS  VK+ GE+RS LLQVISIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGILLKLLQHMNS-DVKVAGEHRSSLLQVISIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYVTL    +DLIL++ +QLGQ  +VDR E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVTLPDEQHDLILSDTIQLGQFIHVDRFEAATPVPILRGVRPVPGRHACVGNPEDLV  119



>ref|XP_007131932.1| hypothetical protein PHAVU_011G052900g [Phaseolus vulgaris]
 gb|ESW03926.1| hypothetical protein PHAVU_011G052900g [Phaseolus vulgaris]
Length=752

 Score =   163 bits (412),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 107/139 (77%), Gaps = 2/139 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KL+Q +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDS 
Sbjct  1     MASLVPGVLLKLMQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRPIPGRH   G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFVFVDRLEGASPVPILHGVRPIPGRHACVGTPEDIV  119

Query  1388  QMMEAAGEM-ECEVKKESA  1335
                 + G +   + KK SA
Sbjct  120   ATTHSLGFLGNAKAKKNSA  138



>ref|XP_007131933.1| hypothetical protein PHAVU_011G052900g [Phaseolus vulgaris]
 gb|ESW03927.1| hypothetical protein PHAVU_011G052900g [Phaseolus vulgaris]
Length=756

 Score =   163 bits (412),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 107/139 (77%), Gaps = 2/139 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KL+Q +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDS 
Sbjct  1     MASLVPGVLLKLMQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRPIPGRH   G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFVFVDRLEGASPVPILHGVRPIPGRHACVGTPEDIV  119

Query  1388  QMMEAAGEM-ECEVKKESA  1335
                 + G +   + KK SA
Sbjct  120   ATTHSLGFLGNAKAKKNSA  138



>ref|XP_009393516.1| PREDICTED: uncharacterized protein LOC103979183 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=733

 Score =   163 bits (412),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVLIKLLQ +N+  VKI GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLIKLLQHMNT-DVKIAGEHRSSLLQVVSIVPALAGSDLFTNRGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    NDLIL++++QLGQ  +VD +E G+PVP+L G RP+PGRHP  G+P+DL+
Sbjct  60    HATYVSLPDEHNDLILSDQIQLGQFIHVDCLEAGSPVPILKGARPLPGRHPCVGNPEDLV  119


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 59/132 (45%), Gaps = 28/132 (21%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG G++   EL   L  E H WFL F++  LD        +           +   +
Sbjct  595  EWERGVGMEDGAELARQLREEAHSWFLGFVERFLDADAAAPGPS-----------DREQV  643

Query  371  GLTLSLLKQANEWLDKMMMR---GSLELGSEMH--------------GFVEKLKQKVYGC  243
               LS LK+ N+WL+ +  R   G  E  +E+                 +++L++K+Y  
Sbjct  644  AAMLSQLKKVNDWLEAIGHRRREGEAEADAEVDEAEHGEGPGGGVPVETIDRLRKKIYEY  703

Query  242  LLVHVDSAASAL  207
            LL HV+SAA AL
Sbjct  704  LLTHVESAAVAL  715



>ref|XP_006592135.1| PREDICTED: uncharacterized protein LOC100805079 isoform X2 [Glycine 
max]
Length=738

 Score =   163 bits (412),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KL+Q +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDS 
Sbjct  1     MANLVPGVLLKLMQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFVFVDRLEAASPVPILHGVRPVPGRHPCVGTPEDIV  119

Query  1388  QMMEAAG  1368
                 + G
Sbjct  120   ATTHSLG  126



>ref|XP_008790586.1| PREDICTED: uncharacterized protein LOC103707751 isoform X2 [Phoenix 
dactylifera]
Length=702

 Score =   162 bits (411),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFSNRGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+ YV+L    +DLIL++K+QLGQ  YV R+E  +PVP+L GVRP+PGRHP  G PKD++
Sbjct  60    HAAYVSLPDEHDDLILSDKIQLGQFIYVVRLEAASPVPILKGVRPVPGRHPCVGKPKDIV  119



>ref|XP_006592134.1| PREDICTED: uncharacterized protein LOC100805079 isoform X1 [Glycine 
max]
Length=742

 Score =   163 bits (412),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KL+Q +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDS 
Sbjct  1     MANLVPGVLLKLMQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFVFVDRLEAASPVPILHGVRPVPGRHPCVGTPEDIV  119

Query  1388  QMMEAAG  1368
                 + G
Sbjct  120   ATTHSLG  126



>ref|XP_010278910.1| PREDICTED: uncharacterized protein LOC104612944 [Nelumbo nucifera]
Length=734

 Score =   162 bits (411),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 101/121 (83%), Gaps = 2/121 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KL+Q++NS T K+ GE+RSVLLQVI IVPA++GS+LWP+HGF++++SDS+
Sbjct  2     MASLTPGILLKLMQSMNSDT-KVVGEHRSVLLQVIGIVPALAGSDLWPNHGFYVQLSDSA  60

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRME-PGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             +STYV+LS  D DLIL N LQLGQ  YVDR++    PVP + G+RPI GRHPF G+P+ L
Sbjct  61    NSTYVSLSDRDTDLILTNLLQLGQFAYVDRLDFDSPPVPRVSGIRPIAGRHPFVGTPEPL  120

Query  1391  M  1389
             +
Sbjct  121   I  121


 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 5/110 (5%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W+R  G+K T EL ++L +E  LWFL+F++ SLD GF+V    + + K     E    + 
Sbjct  620  WSRASGVKETVELTKNLQSEMQLWFLQFVEESLDAGFRVFRVCSNDGKGVFHPENG-PLA  678

Query  368  LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSA  219
              LS LK+ N+WLD++  +   EL  E    +E+LK+K+YG ++ H+ +A
Sbjct  679  AVLSQLKRVNDWLDRVGEKRE-ELIMEK---IERLKRKIYGFVIQHIGTA  724



>ref|XP_010086722.1| hypothetical protein L484_016153 [Morus notabilis]
 gb|EXB23138.1| hypothetical protein L484_016153 [Morus notabilis]
Length=877

 Score =   164 bits (414),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L  GVL+KLLQ +N+  VK+ GE+RS LLQVISIVPA++GSEL+P+ GF++KVSDSS
Sbjct  1     MANLVTGVLLKLLQHMNT-DVKVAGEHRSSLLQVISIVPALAGSELFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R+E  +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLESASPVPILRGVRPVPGRHPCVGSPEDIV  119


 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 58/121 (48%), Gaps = 12/121 (10%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+G     +L   L  ++  WFL F++  LD     +  +           +   I
Sbjct  592  EWDRGNGFDEAVDLAGKLRLQSQDWFLGFVERFLDADVDSSALS-----------DNGQI  640

Query  371  GLTLSLLKQANEWLDKMMM-RGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRS  195
               L+ LK  N+WLD +   +  +E        +++L++K+Y  LL HV+SAA+AL   S
Sbjct  641  AGMLTQLKSVNDWLDNISSSKDEVENPHVSAETIDRLRKKIYEYLLTHVESAAAALGGGS  700

Query  194  H  192
            H
Sbjct  701  H  701



>tpg|DAA48322.1| TPA: hypothetical protein ZEAMMB73_736922 [Zea mays]
Length=746

 Score =   162 bits (411),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   GSP+DL+
Sbjct  60    HATYVSLPDEQHDLILSDVIQLGQFVHVDRLEAATPVPILRGVRPVPGRHACVGSPEDLV  119


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 79/134 (59%), Gaps = 7/134 (5%)
 Frame = -1

Query  1103  TPSARSDALLTSDST--IINGVNTNTLPKRTNKQENVDVNFM---SNNNRQNILSSHPVL  939
             TP  +S A   +D +  ++N   ++ + + +    N +V  +   + +NR+  L+     
Sbjct  344   TPPRKSSASAPADDSDKVVNNKLSSPIRRTSGVLNNPNVTNLVKVAASNRK--LTDASAS  401

Query  938   WSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHL  759
             W++LPP+LVK GK +L+ +  A + A EA  EA AA+++++CLS +A++ SSA  +NP  
Sbjct  402   WTTLPPSLVKLGKELLKYRDAAQMAAVEAMQEASAAESIVRCLSSYAEVSSSAEEQNPQQ  461

Query  758   SITKFFALHALIEQ  717
             ++ +F ALH  I +
Sbjct  462   AVEQFLALHGAISR  475



>ref|XP_002309785.2| hypothetical protein POPTR_0007s01680g [Populus trichocarpa]
 gb|EEE90235.2| hypothetical protein POPTR_0007s01680g [Populus trichocarpa]
Length=727

 Score =   162 bits (411),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +++  VK+ GE+RS LLQV+SIVPA++G EL+ + GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMDT-DVKVAGEHRSSLLQVVSIVPALAGGELFSNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +V+R++P +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLQPASPVPILRGVRPVPGRHPCVGSPEDIV  119


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 57/120 (48%), Gaps = 20/120 (17%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFL----KFLDASLDVGFQVnnnnnkenksKGRQEE  384
            EW RG+GL    +L   L  E+  WFL    +FLDA +D                    +
Sbjct  604  EWIRGNGLNEAVDLAGMLRMESQDWFLGYVERFLDADVDTSA---------------LSD  648

Query  383  ANHIGLTLSLLKQANEWLDKM-MMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               I   L+ LK  N+WLD++   +   E        V++L++K+Y  LL HV+SAA+AL
Sbjct  649  NGQIAGMLTQLKSVNDWLDEIGSSKDEAETPHVSSETVDRLRKKIYEYLLTHVESAAAAL  708



>gb|KHN25310.1| hypothetical protein glysoja_010227 [Glycine soja]
Length=742

 Score =   162 bits (411),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KL+Q +N+  VK+ GE+RS LLQV+SIVPA++G EL+P+ GF++KVSDS 
Sbjct  1     MANLVPGVLLKLMQHMNT-DVKVAGEHRSSLLQVVSIVPALAGGELFPNQGFYLKVSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFVFVDRLEAASPVPILHGVRPVPGRHPCVGTPEDIV  119

Query  1388  QMMEAAG  1368
                 + G
Sbjct  120   ATTHSLG  126



>ref|XP_006659647.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like [Oryza 
brachyantha]
Length=731

 Score =   162 bits (411),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPEEQHDLILSDTIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGNPEDLV  119


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = -1

Query  995  VNFMSNNNRQNILSSHPVLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQ  816
            V   S+N R   L+     W++LPP+L K GK +L+ +  A + A EA  EA AA+NLL+
Sbjct  379  VKIASSNKR---LTDSSTSWTALPPSLAKLGKELLKYRDAAQMAAVEAIQEASAAENLLR  435

Query  815  CLSMFADLCSSASPENPHLSITKFFALHALIEQ  717
            CLS +A++ S+A  +NP  ++ +F ALHA + +
Sbjct  436  CLSSYAEVSSTAEEQNPQPAVEQFLALHAAMSR  468



>ref|XP_008790585.1| PREDICTED: uncharacterized protein LOC103707751 isoform X1 [Phoenix 
dactylifera]
Length=734

 Score =   162 bits (410),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFSNRGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+ YV+L    +DLIL++K+QLGQ  YV R+E  +PVP+L GVRP+PGRHP  G PKD++
Sbjct  60    HAAYVSLPDEHDDLILSDKIQLGQFIYVVRLEAASPVPILKGVRPVPGRHPCVGKPKDIV  119



>ref|XP_006595069.1| PREDICTED: uncharacterized protein LOC100817734 [Glycine max]
Length=754

 Score =   162 bits (411),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 101/121 (83%), Gaps = 2/121 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAIS-GSELWPDHGFFIKVSDS  1572
             MA+L PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++ G EL+P+ GF++KVSDS
Sbjct  1     MANLVPGVLLKLLQHMNS-DVKVGGEHRSSLLQVVSIVPALAAGGELFPNQGFYLKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SH+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G+P+D+
Sbjct  60    SHATYVSLPDEHDDLILSDKIQLGQFVFVDRLEGASPVPILRGVRPVPGRHPCVGTPEDI  119

Query  1391  M  1389
             +
Sbjct  120   V  120


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 19/119 (16%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL     L E L  E+  WFL F++  LD       +            + + I
Sbjct  632  EWVRGNGLNEVVNLAEMLQLESRDWFLGFVERFLDSDGDTTLS------------DNDQI  679

Query  371  GLTLSLLKQANEWLDKMMMRG----SLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD++        S ++ +E    +++L++K+Y  LL HV+SAA+AL
Sbjct  680  AGMLTQLKSVNDWLDEIGSSKDEGESCQISTET---IDRLRKKIYEYLLTHVESAAAAL  735



>gb|KHN30090.1| hypothetical protein glysoja_010468 [Glycine soja]
Length=754

 Score =   162 bits (411),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 101/121 (83%), Gaps = 2/121 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAIS-GSELWPDHGFFIKVSDS  1572
             MA+L PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++ G EL+P+ GF++KVSDS
Sbjct  1     MANLVPGVLLKLLQHMNS-DVKVGGEHRSSLLQVVSIVPALAAGGELFPNQGFYLKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SH+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G+P+D+
Sbjct  60    SHATYVSLPDEHDDLILSDKIQLGQFVFVDRLEGASPVPILRGVRPVPGRHPCVGTPEDI  119

Query  1391  M  1389
             +
Sbjct  120   V  120


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 19/119 (16%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL     L E L  E+  WFL F++  LD       +            + + I
Sbjct  632  EWVRGNGLNEVVNLAEMLQLESRDWFLGFVERFLDSDGDTTLS------------DNDQI  679

Query  371  GLTLSLLKQANEWLDKMMMRG----SLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD++        S ++ +E    +++L++K+Y  LL HV+SAA+AL
Sbjct  680  AGMLTQLKSVNDWLDEIGSSKDEGESCQISTET---IDRLRKKIYEYLLTHVESAAAAL  735



>ref|XP_009118351.1| PREDICTED: uncharacterized protein LOC103843380 [Brassica rapa]
 ref|XP_009118352.1| PREDICTED: uncharacterized protein LOC103843380 [Brassica rapa]
Length=692

 Score =   161 bits (408),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQVISIVPA++G EL+ + GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKITGEHRSSLLQVISIVPALAGGELFSNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++KLQLGQ  +VDR+E  +PVP+L GVR +PGRHP  G+P+D++
Sbjct  60    HATYVSLPDKQDDLILSDKLQLGQFIHVDRVESSSPVPILCGVRVVPGRHPCLGTPEDIV  119


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 16/119 (13%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            +W +G+GL    +L E L   +  WFL F++  LD             ++     +   I
Sbjct  567  KWVKGNGLNEATDLAEKLQTVSQDWFLGFVERFLDADV---------VETSSNLSDNGQI  617

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMHGF----VEKLKQKVYGCLLVHVDSAASAL  207
               LS LK  N+WLD++   GS E G  +       ++ L++K+Y  LL HV+SAA+AL
Sbjct  618  AGMLSQLKSVNDWLDEI---GSKENGEGLQEVSKETIDGLRKKIYEYLLTHVESAAAAL  673



>emb|CDY06329.1| BnaA09g48740D [Brassica napus]
Length=625

 Score =   160 bits (406),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQVISIVPA++G EL+ + GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKIAGEHRSSLLQVISIVPALAGGELFSNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++KLQLGQ  +VDR+E  +PVP+L GVR +PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEQDDLILSDKLQLGQFIHVDRVESSSPVPILCGVRVVPGRHPCLGTPEDIV  119


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 90/331 (27%), Positives = 151/331 (46%), Gaps = 35/331 (11%)
 Frame = -1

Query  1148  LRGKQQEIKVQARPTTPSARSDALLTSDSTIINGVNTNTLPKRTNKQENVDVNFMSNNNR  969
             L  KQ+   V A+ +  ++++ +    +ST++   +  + PK T+    VD    + N  
Sbjct  294   LPSKQERANVFAKSSKENSKTQSTKKVESTVVETKDKTSKPKSTS--TTVDKRSTAENGL  351

Query  968   QNILSSHPV----------LWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlL  819
                L   PV           WSSLP +L + G+ +LR +  A ++A EA  EA A+++LL
Sbjct  352   PGSLVKVPVNSKRLTSASTQWSSLPSSLSRLGQEVLRHRDAAQVVAIEALQEASASESLL  411

Query  818   QCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKKTPDSNH  639
             QCL M+ DL S+A  ++P   + +F  LH+ ++  +   D    T    T   +    N 
Sbjct  412   QCLIMYNDLMSTAKMDDPLPVVEQFLKLHSSLKNVQIVTDQGNNT----TSKPRGNVQNR  467

Query  638   lgigigigkgklkpskppLELDLGGAEKL---EWARGDGLKATKELRESLSNETHLWFLK  468
                G  +    +          + G  +    +W +G+GL    +L E L   +  WFL 
Sbjct  468   PTFGSKLVAQGMIRKSSQKATTVAGGSESPPPKWVKGNGLNEATDLAEKLQTVSQDWFLG  527

Query  467   FLDASLDVGFQVnnnnnkenksKGRQEEANHIGLTLSLLKQANEWLDKMMMRGSLELGSE  288
             F++  LD             ++     +   I   LS LK  N+WLD++   GS E G  
Sbjct  528   FVERFLDADV---------VETSSNLSDNGQIAGMLSQLKSVNDWLDEI---GSKENGEG  575

Query  287   MHGF----VEKLKQKVYGCLLVHVDSAASAL  207
             +       ++ L++K+Y  LL HV+SAA+AL
Sbjct  576   LQEVSKETIDGLRKKIYEYLLTHVESAAAAL  606



>ref|XP_011007404.1| PREDICTED: uncharacterized protein LOC105113084 [Populus euphratica]
 ref|XP_011007405.1| PREDICTED: uncharacterized protein LOC105113084 [Populus euphratica]
 ref|XP_011007406.1| PREDICTED: uncharacterized protein LOC105113084 [Populus euphratica]
Length=727

 Score =   162 bits (409),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 100/119 (84%), Gaps = 1/119 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +++  VK+ GE+RS LLQV+SIVPA++G EL+ + GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMDT-DVKVAGEHRSSLLQVVSIVPALAGGELFSNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             H+TYV+L    +DLIL++K+QLGQ  +V+R++P +PVP+L GVRP+PGRHP  GSP+D+
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFIHVERLQPASPVPILRGVRPVPGRHPCVGSPEDI  118


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 57/120 (48%), Gaps = 20/120 (17%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFL----KFLDASLDVGFQVnnnnnkenksKGRQEE  384
            EW RG+GL    +L   L  E+  WFL    +FLDA +D                    +
Sbjct  604  EWIRGNGLDEAVDLAGMLQMESQDWFLGYVERFLDADVDTSA---------------LSD  648

Query  383  ANHIGLTLSLLKQANEWLDKM-MMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               I   L+ LK  N+WLD++   +   E        +++L++K+Y  LL HV+SAA+AL
Sbjct  649  NGQIAGMLTQLKSVNDWLDEIGSSKDEAETPHVSSETIDRLRKKIYEYLLTHVESAAAAL  708



>ref|XP_002444655.1| hypothetical protein SORBIDRAFT_07g025480 [Sorghum bicolor]
 gb|EES14150.1| hypothetical protein SORBIDRAFT_07g025480 [Sorghum bicolor]
Length=743

 Score =   161 bits (408),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVGGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPDEQHDLILSDTIQLGQFIHVDRLEAATPVPILRGVRPVPGRHACVGNPEDLV  119



>ref|NP_001142977.1| uncharacterized protein LOC100275431 [Zea mays]
 gb|ACG28041.1| hypothetical protein [Zea mays]
Length=745

 Score =   161 bits (408),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +NS  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLLKLLQHMNS-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++ +QLGQ  +VDR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPDEQHDLILSDVIQLGQFVHVDRLEAATPVPILRGVRPVPGRHACVGNPEDLV  119


 Score = 53.1 bits (126),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 74/132 (56%), Gaps = 3/132 (2%)
 Frame = -1

Query  1103  TPSARSDALLTSDST--IINGVNTNTLPKRTNKQENVDV-NFMSNNNRQNILSSHPVLWS  933
             TP  +S A   +D +  ++N   ++ + + +    N +V N +        L+     W+
Sbjct  344   TPPRKSSASAPADDSDKVVNNKLSSPIRRTSGVLNNPNVTNLVKVAASSRKLTDASASWT  403

Query  932   SLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSI  753
             +LPP+L K GK +L+ +  A + A EA  EA AA+++++CLS +A++ SSA  +NP  ++
Sbjct  404   TLPPSLAKLGKELLKYRDAAQMAAVEAMQEASAAESIVRCLSSYAEVSSSAEEQNPQQAV  463

Query  752   TKFFALHALIEQ  717
              +F ALH  I +
Sbjct  464   EQFLALHGAISR  475



>tpg|DAA40543.1| TPA: hypothetical protein ZEAMMB73_654064 [Zea mays]
Length=761

 Score =   162 bits (409),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNTG-VKVGGEHRSSLLQVVSIVPALAGSDLFTNRGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L +  +DLIL++++QLGQ  + DR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPEEQHDLILSDRIQLGQFVHADRLEAATPVPILRGVRPVPGRHACVGTPEDLV  119



>ref|XP_004507351.1| PREDICTED: serine-rich adhesin for platelets-like [Cicer arietinum]
Length=720

 Score =   161 bits (407),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KL+Q +N+  +K+ GE+RS LLQV+SIVPA++G +L+P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLMQHMNT-DIKVGGEHRSSLLQVVSIVPALAGGDLFPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+L    +DLIL++K+QLGQ  +VDR E  +PVP+L GVRP+PGRH   G+P+D++
Sbjct  60    HSTYVSLPDEHDDLILSDKIQLGQFVFVDRFEAASPVPILHGVRPVPGRHACVGTPEDIV  119


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 25/126 (20%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFL----KFLDASLDVGFQVnnnnnkenksKGRQEE  384
            EW +G+GL+    L E+L   +  WFL    KFL++  D+G                   
Sbjct  604  EWIKGNGLEEAVNLAETLQVRSRDWFLLFVEKFLESDGDIGLS----------------N  647

Query  383  ANHIGLTLSLLKQANEWLDKMMMRGS--LELGSEMHGFVEKLKQKVYGCLLVHVDSAASA  210
               I   LS LK  N+WLD++        ++ +E    +E+L++K+Y  LL HV+SAA+A
Sbjct  648  NGEIAGMLSQLKSVNDWLDEIGWNEGEWCQIPAET---IERLRKKIYEYLLTHVESAAAA  704

Query  209  LDTRSH  192
            L   S 
Sbjct  705  LTAGSQ  710


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  944  VLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENP  765
            V W+SLP ++ K G+ +++ +  A + A EA  EA A+++LLQCLS++A+L +SA   NP
Sbjct  387  VQWTSLPSSIAKLGREVMKHRDAAQMAATEAIQEAAASESLLQCLSVYAELSNSAKEHNP  446

Query  764  HLSITKFFALHALIEQPKKALDDYCFT  684
              +I +F ALH  +   +   D  C T
Sbjct  447  QPAIEQFLALHTSLNSARTIADSLCKT  473



>ref|XP_008460033.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Cucumis 
melo]
Length=742

 Score =   161 bits (408),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G +L P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSTLLQVVSIVPALAGGDLSPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L     DLIL++K+QLGQ  +V+R+E  +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHGDLILSDKIQLGQFIHVERLEAASPVPILHGVRPVPGRHPCVGSPEDIV  119


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 16/118 (14%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL    +L E L  ++  WFL F++  LD G                  +   +
Sbjct  618  EWIRGNGLNEAVDLAEMLRLQSQDWFLTFMERFLDAGVDTAAL-----------SDNGQL  666

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMH---GFVEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD   +  + + G   H     +++L++K+Y  LL+HV+SAA+AL
Sbjct  667  AGILTQLKSVNDWLDG--ISSNKDEGDITHISTETIDRLRKKIYEYLLMHVESAAAAL  722



>ref|XP_006597218.1| PREDICTED: muscle M-line assembly protein unc-89-like [Glycine 
max]
 gb|KHN33294.1| hypothetical protein glysoja_005336 [Glycine soja]
Length=752

 Score =   161 bits (407),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 101/121 (83%), Gaps = 2/121 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAIS-GSELWPDHGFFIKVSDS  1572
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++ G EL+P+ GF++KVSDS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVGGEHRSSLLQVVSIVPALAAGGELFPNQGFYLKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SH+TYV+L    +DLIL++K+QLGQ  +VDR+E  +PVP+L GVRP+PGRHP  G+P+D+
Sbjct  60    SHATYVSLPDEHDDLILSDKIQLGQFVFVDRLEGASPVPILRGVRPVPGRHPCVGTPEDI  119

Query  1391  M  1389
             +
Sbjct  120   V  120


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 19/119 (16%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL     L E L  ++  WFL F++  LD       +            + + I
Sbjct  630  EWVRGNGLNEVVNLAEMLQLQSRDWFLGFVERFLDSDGDTTLS------------DNDQI  677

Query  371  GLTLSLLKQANEWLDKMMMRG----SLELGSEMHGFVEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD++        S E+ +E    +++L++K+Y  LL HV+SAA+AL
Sbjct  678  AGMLTQLKSVNDWLDEIGSSKDEGESCEISAET---IDRLRKKIYEYLLTHVESAAAAL  733



>ref|XP_004145034.1| PREDICTED: uncharacterized protein LOC101214568 [Cucumis sativus]
 ref|XP_004153440.1| PREDICTED: uncharacterized protein LOC101216044 [Cucumis sativus]
 ref|XP_004170610.1| PREDICTED: uncharacterized protein LOC101231934 [Cucumis sativus]
Length=742

 Score =   160 bits (406),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++G +L P+ GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVAGEHRSTLLQVVSIVPALAGGDLSPNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L     DLIL++K+QLGQ  +V+R+E  +PVP+L GVRP+PGRHP  GSP+D++
Sbjct  60    HATYVSLPDEHGDLILSDKIQLGQFIHVERLEAASPVPILHGVRPVPGRHPCVGSPEDIV  119


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 16/118 (14%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+GL    +L E L  ++  WFL F++  LD G                  +   +
Sbjct  618  EWIRGNGLNEAVDLAEMLRLQSQDWFLTFMERFLDAGVDTAAL-----------SDNGQL  666

Query  371  GLTLSLLKQANEWLDKMMMRGSLELGSEMH---GFVEKLKQKVYGCLLVHVDSAASAL  207
               L+ LK  N+WLD +    + + G   H     +++L++K+Y  LL+HV+SAA+AL
Sbjct  667  AGILTQLKSVNDWLDGIA--SNKDEGDTTHISTETIDRLRKKIYEYLLMHVESAAAAL  722



>ref|XP_009383805.1| PREDICTED: uncharacterized protein LOC103971502 [Musa acuminata 
subsp. malaccensis]
Length=734

 Score =   160 bits (406),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 107/137 (78%), Gaps = 1/137 (1%)
 Frame = -1

Query  1745  ASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSSH  1566
             ASL PGVLIKLLQ +N+  VK+  ++RS LLQV+SIVPA+SGS+L+ + GF++KVSDSSH
Sbjct  10    ASLVPGVLIKLLQHLNT-NVKVGSKHRSSLLQVVSIVPALSGSDLFTNQGFYLKVSDSSH  68

Query  1565  STYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLMQ  1386
             +TYV+L    NDLI ++K+QLGQ  +VD +E G+PVP+L GVRP+PGRHP  G+P+D++ 
Sbjct  69    ATYVSLPDEHNDLISSDKIQLGQFIHVDGIEAGSPVPILKGVRPLPGRHPCVGNPEDIVA  128

Query  1385  MMEAAGEMECEVKKESA  1335
                + G ++ E  ++S+
Sbjct  129   ANSSHGFLDAEKPQQSS  145



>ref|XP_009802967.1| PREDICTED: uncharacterized protein LOC104248419 isoform X2 [Nicotiana 
sylvestris]
Length=601

 Score =   159 bits (402),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 99/136 (73%), Gaps = 2/136 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  + S  VK   E+RS LLQV  IVPA +    LWP HGFFIKVSDS
Sbjct  1     MAALAPGILLKLLNGMKSG-VKPTSEHRSSLLQVTDIVPADLDEKNLWPKHGFFIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +DL+L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPYEQDDLVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLVGTPEPL  119

Query  1391  MQMMEAAGEMECEVKK  1344
             M + E   ++E + K+
Sbjct  120   MGLREKGEKVEQKFKQ  135



>ref|XP_009802966.1| PREDICTED: uncharacterized protein LOC104248419 isoform X1 [Nicotiana 
sylvestris]
Length=603

 Score =   159 bits (402),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 99/136 (73%), Gaps = 2/136 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  + S  VK   E+RS LLQV  IVPA +    LWP HGFFIKVSDS
Sbjct  1     MAALAPGILLKLLNGMKSG-VKPTSEHRSSLLQVTDIVPADLDEKNLWPKHGFFIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +DL+L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPYEQDDLVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLVGTPEPL  119

Query  1391  MQMMEAAGEMECEVKK  1344
             M + E   ++E + K+
Sbjct  120   MGLREKGEKVEQKFKQ  135



>gb|EPS68799.1| hypothetical protein M569_05973, partial [Genlisea aurea]
Length=118

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 95/118 (81%), Gaps = 1/118 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQV+ IVPA+SG EL+ + GF++KVSDSS
Sbjct  2     MAALVPGVLLKLLQHMNT-DVKIAGEHRSSLLQVVGIVPALSGGELFTNQGFYLKVSDSS  60

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKD  1395
             H+TYV+L    + LIL++ +QLGQ  +V+R++  +PVP+L GVRPIPGRHP  G+P+D
Sbjct  61    HATYVSLPHHHHHLILSDNIQLGQFIHVERLDSASPVPILRGVRPIPGRHPCVGTPQD  118



>ref|XP_004149859.1| PREDICTED: uncharacterized protein LOC101211203 [Cucumis sativus]
 gb|KGN65379.1| hypothetical protein Csa_1G395600 [Cucumis sativus]
Length=695

 Score =   160 bits (404),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ +NS T ++ G++RS LLQVI IVPA++GSELWP+ GF+I++SDS 
Sbjct  1     MASLTPGILLKLLQAMNSNT-RVTGDHRSALLQVIGIVPALAGSELWPNRGFYIQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS+ + DLIL+N+L LGQ  YVDR E  TP+P + G+RPIPGR    GSP+ L+
Sbjct  60    NSTYVSLSERETDLILSNRLHLGQFIYVDRFEFDTPIPRVCGIRPIPGRQASVGSPELLI  119

Query  1388  QMMEAA  1371
               + A+
Sbjct  120   ARISAS  125


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 61/111 (55%), Gaps = 5/111 (5%)
 Frame = -1

Query  554  LEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQ-EEAN  378
            ++W RG  +K T EL   L +E  LWFLKF++ SLD G +V    + +            
Sbjct  588  VQWRRGHEMKETVELAMELQSEMKLWFLKFVEDSLDAGSKVFIERSVDAVKTSPPIPNRG  647

Query  377  HIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVD  225
             +   LS LK+ N+WLD+++ +    L  +    VE+LK+K+YG ++ +VD
Sbjct  648  SMASVLSQLKRVNDWLDRVVSKRDDPLKEK----VERLKRKIYGFVIQNVD  694



>ref|XP_004168200.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226555 
[Cucumis sativus]
Length=695

 Score =   159 bits (403),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ +NS T ++ G++RS LLQVI IVPA++GSELWP+ GF+I++SDS 
Sbjct  1     MASLTPGILLKLLQAMNSNT-RVTGDHRSALLQVIGIVPALAGSELWPNRGFYIQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS+ + DLIL+N+L LGQ  YVDR E  TP+P + G+RPIPGR    GSP+ L+
Sbjct  60    NSTYVSLSERETDLILSNRLHLGQFIYVDRFEFDTPIPRVCGIRPIPGRQASVGSPELLI  119

Query  1388  QMMEAA  1371
               + A+
Sbjct  120   ARISAS  125


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 61/111 (55%), Gaps = 5/111 (5%)
 Frame = -1

Query  554  LEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQ-EEAN  378
            ++W RG  +K T EL   L +E  LWFLKF++ SLD G +V    + +            
Sbjct  588  VQWRRGHEMKETVELAMELQSEMKLWFLKFVEDSLDAGSKVFIERSVDAVKTSPPIPNRG  647

Query  377  HIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVD  225
             +   LS LK+ N+WLD+++ +    L  +    VE+LK+K+YG ++ +VD
Sbjct  648  SMASVLSQLKRVNDWLDRVVSKRDDPLKEK----VERLKRKIYGFVIQNVD  694



>ref|XP_008463359.1| PREDICTED: uncharacterized protein LOC103501535 [Cucumis melo]
Length=698

 Score =   159 bits (403),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ +NS T ++ G++RS LLQVI IVPA++GSELWP+ GF+I++SDS 
Sbjct  1     MASLTPGILLKLLQAMNSNT-RVTGDHRSALLQVIGIVPALAGSELWPNRGFYIQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS+ + DLIL+N+L LGQ  YVDR E  TP+P + G+RPIPGR    GSP+ L+
Sbjct  60    NSTYVSLSERETDLILSNRLHLGQFVYVDRFEFDTPIPRVCGIRPIPGRQASVGSPELLI  119

Query  1388  QMMEAA  1371
               + A+
Sbjct  120   ARISAS  125


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 63/111 (57%), Gaps = 5/111 (5%)
 Frame = -1

Query  554  LEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQ-EEAN  378
            ++W RG  +K T EL   L +E  LWFLKF++ SLD G +V + ++ +            
Sbjct  591  VQWTRGHEMKETVELAMELQSEMKLWFLKFVEDSLDAGSKVFSESSGDAVKTSPPIPNRG  650

Query  377  HIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVD  225
             I   LS LK+ N+WLD+++ +    L  +    VE+LK+K+YG ++ +VD
Sbjct  651  SIASVLSQLKRVNDWLDRVVSKRDDPLKEK----VERLKRKIYGFVIQNVD  697



>ref|XP_010100472.1| hypothetical protein L484_027784 [Morus notabilis]
 gb|EXB82606.1| hypothetical protein L484_027784 [Morus notabilis]
Length=600

 Score =   158 bits (400),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 96/131 (73%), Gaps = 2/131 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  +N+ T K   E+RS LLQV  IVPA +    LWP HGFFIKVSDS
Sbjct  1     MAALAPGILLKLLNGMNTGT-KATSEHRSSLLQVTDIVPADLDEKNLWPKHGFFIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +D +L+NK+QLGQ  YVDR+EPG+P+PV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPSEQDDFVLSNKMQLGQFIYVDRLEPGSPLPVVKGAKPLPGRHPLVGTPEPL  119

Query  1391  MQMMEAAGEME  1359
             M + E   ++E
Sbjct  120   MGLRERGEKIE  130



>ref|XP_011034171.1| PREDICTED: uncharacterized protein LOC105132389 isoform X2 [Populus 
euphratica]
 ref|XP_011034172.1| PREDICTED: uncharacterized protein LOC105132389 isoform X2 [Populus 
euphratica]
Length=593

 Score =   158 bits (399),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 97/135 (72%), Gaps = 3/135 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  +++ T K  GE+RS LLQV  IVPA +    LWP HGFFIKVSDS
Sbjct  1     MATLAPGILLKLLNGMDTGT-KPTGEHRSSLLQVTDIVPAELDEKNLWPKHGFFIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +D +L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPSDQDDFVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLLGTPEPL  119

Query  1391  MQMMEAAGEMECEVK  1347
             M  +   GE   E K
Sbjct  120   MG-LRGKGERRSEQK  133



>ref|XP_006365225.1| PREDICTED: uncharacterized protein LOC102601016 [Solanum tuberosum]
Length=596

 Score =   158 bits (399),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 2/131 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  + S  VK   E+RS LLQV  IVPA +    LWP HGFFIKVSDS
Sbjct  1     MAALAPGILLKLLNGMKSG-VKPTSEHRSSLLQVTDIVPADLDEKNLWPKHGFFIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +DL+L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPDEQDDLVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLVGTPEPL  119

Query  1391  MQMMEAAGEME  1359
             M + E   ++E
Sbjct  120   MGLREKGEKVE  130



>ref|XP_011034170.1| PREDICTED: uncharacterized protein LOC105132389 isoform X1 [Populus 
euphratica]
Length=600

 Score =   158 bits (399),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 97/135 (72%), Gaps = 3/135 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  +++ T K  GE+RS LLQV  IVPA +    LWP HGFFIKVSDS
Sbjct  1     MATLAPGILLKLLNGMDTGT-KPTGEHRSSLLQVTDIVPAELDEKNLWPKHGFFIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +D +L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPSDQDDFVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLLGTPEPL  119

Query  1391  MQMMEAAGEMECEVK  1347
             M  +   GE   E K
Sbjct  120   MG-LRGKGERRSEQK  133



>ref|XP_002515571.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47020.1| conserved hypothetical protein [Ricinus communis]
Length=684

 Score =   159 bits (401),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ++NS T ++ G++RS LLQV  IVPA++GS+L+ + GF++++SDS 
Sbjct  1     MASLTPGILLKLLQSMNSTT-RVTGDHRSPLLQVTGIVPALAGSDLYSNQGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STY++LS  DNDLIL+N+LQLGQ  Y+DR E  +PVP + G+RPI GRHPF G+P+ L+
Sbjct  60    NSTYISLSDRDNDLILSNRLQLGQFVYIDRFEFDSPVPRVCGIRPIAGRHPFVGTPEPLI  119

Query  1388  QMMEAA  1371
               + A+
Sbjct  120   ARISAS  125


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 60/110 (55%), Gaps = 5/110 (5%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W RG G+K T EL   L  E  LWF++F++ SLD  F+        +  K     ++ I 
Sbjct  570  WTRGKGMKETVELAMKLQAEMQLWFVRFVEESLDASFRA-LGERSTDGIKAMPLSSSSIA  628

Query  368  LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSA  219
              L  LK+ N+WLD+++ +    L  +    +EKLK+K+YG ++ HV +A
Sbjct  629  AILPQLKRVNDWLDRIVSKNDELLVQK----IEKLKRKIYGFVIQHVGTA  674



>ref|XP_006661436.1| PREDICTED: uncharacterized protein LOC102700269 [Oryza brachyantha]
Length=877

 Score =   160 bits (404),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA++GS+L+ + GF++KVSDSS
Sbjct  1     MASLVPGVLVKLLQHMNT-DVKVAGEHRSSLLQVVSIVPALAGSDLFTNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  + DR+E  TPVP+L GVRP+PGRH   G+P+DL+
Sbjct  60    HATYVSLPDDQHDLILSDKIQLGQFIHADRLEAATPVPILRGVRPVPGRHACVGNPEDLV  119



>ref|XP_006372148.1| hypothetical protein POPTR_0018s12520g, partial [Populus trichocarpa]
 gb|ERP49945.1| hypothetical protein POPTR_0018s12520g, partial [Populus trichocarpa]
Length=635

 Score =   158 bits (399),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PG+L+KLLQ++NS   ++ G++RS LLQVI IVPA++GS+LWP+ GF++++SDS 
Sbjct  1     MASLAPGILLKLLQSMNSA-ARVTGDHRSPLLQVIGIVPALAGSDLWPNQGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS+ D DLIL N+LQLGQ  Y+DR +  +PVP + G+RPI GRH F G+P+ L+
Sbjct  60    NSTYVSLSERDTDLILTNRLQLGQFVYIDRFDFDSPVPRVSGIRPIAGRHSFVGTPEPLI  119

Query  1388  QMMEAA  1371
               + A+
Sbjct  120   ARISAS  125



>ref|XP_002525387.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37025.1| conserved hypothetical protein [Ricinus communis]
Length=603

 Score =   157 bits (398),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 93/123 (76%), Gaps = 2/123 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  +N+ T K   E+RS LLQV  IVPA +    LWP HGF+IKVSDS
Sbjct  1     MAALAPGILLKLLNGMNTGT-KATSEHRSSLLQVTDIVPADLDEKNLWPKHGFYIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +D +L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHPF G+P+ L
Sbjct  60    SHSIYVSLPSEQDDFVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPFVGTPEPL  119

Query  1391  MQM  1383
             M +
Sbjct  120   MGL  122



>ref|XP_010088873.1| hypothetical protein L484_020861 [Morus notabilis]
 gb|EXB37070.1| hypothetical protein L484_020861 [Morus notabilis]
Length=719

 Score =   159 bits (401),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 99/122 (81%), Gaps = 3/122 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISG--SELWPDHGFFIKVSD  1575
             MASLTPG+L+KLLQ++NS T K+ G++RS LLQVI IVPA+S   S+LWP+HGFF+ +SD
Sbjct  1     MASLTPGILLKLLQSMNSPT-KVTGDHRSALLQVIGIVPALSSGSSDLWPNHGFFVHLSD  59

Query  1574  SSHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKD  1395
             S +STYV+LS  D DLILNN+L LGQ  YVDR+   +P+P++ G+RP+PGRHP  GSP+ 
Sbjct  60    SLNSTYVSLSDRDVDLILNNRLHLGQFVYVDRLVFHSPLPLVSGLRPLPGRHPLLGSPQT  119

Query  1394  LM  1389
             L+
Sbjct  120   LI  121


 Score = 73.9 bits (180),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 63/237 (27%), Positives = 106/237 (45%), Gaps = 47/237 (20%)
 Frame = -1

Query  818  QCLSMFADLCSSASPENPHLSITKFFALHALI----------------EQPKK-------  708
            + LSMF++L S++   NP  +I +FFA++  I                E P+        
Sbjct  478  RSLSMFSELSSTSKVGNPLPTIDRFFAIYDDIVKHTTIAESVAHSHTSETPRDKLNIANE  537

Query  707  -------------ALDDYCFTKLSVTDNKKTPDS---NHlgigigigkgklkpskppLEL  576
                         A D    + L+   N K P +   +       +       SK   ++
Sbjct  538  QTNSVSLWVEAALATDLQIVSLLTTQVNNKAPSNLQKSMSKRQSFVSSSSSSSSKNQSKI  597

Query  575  DLGGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKG  396
             L  +   +W +G G+K T EL   L +E  +WFL+F++ ++D GF+V     +     G
Sbjct  598  SLPQSNTAQWKKGHGMKETVELANKLQSEMKMWFLRFVEEAIDAGFRV---FGECRSDGG  654

Query  395  RQE-EANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV  228
            R   +   I   LS LK+ NEWL++++ +   E  SE    V++LK+K+YG ++ HV
Sbjct  655  RLSLDCGSIAAVLSQLKRVNEWLERVVSKKD-ERNSEK---VDRLKRKIYGFVIQHV  707



>gb|KEH39487.1| DUF936 family protein [Medicago truncatula]
Length=742

 Score =   159 bits (401),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 100/121 (83%), Gaps = 2/121 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAI-SGSELWPDHGFFIKVSDS  1572
             MA+L PGVL+KLLQ +N+  VK+ GE+RS LLQV+SIVPA+ SG EL+P+ GF++KVSDS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKVGGEHRSSLLQVVSIVPALASGGELFPNQGFYLKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SH+TYV+L    +DLIL++K+QLGQ  +VDR E  +PVPV+ GV+P+PGRHP  G+P+D+
Sbjct  60    SHATYVSLPDEHDDLILSDKIQLGQFVFVDRFEASSPVPVIRGVKPVPGRHPCVGTPEDI  119

Query  1391  M  1389
             +
Sbjct  120   V  120



>emb|CDY22665.1| BnaC08g42990D [Brassica napus]
Length=628

 Score =   157 bits (398),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KLLQ +N+  VKI GE+RS LLQVISIVPA++G EL+ + GF++KVSDSS
Sbjct  1     MANLVPGVLLKLLQHMNT-DVKIAGEHRSSLLQVISIVPALAGGELFSNQGFYLKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    + LIL++KLQLGQ  +VDR+E  +PVP+L GVR +PGRHP  G+P+D++
Sbjct  60    HATYVSLPDEQDYLILSDKLQLGQFIHVDRVESSSPVPILCGVRVVPGRHPCLGTPEDIV  119

Query  1388  QMMEAAG  1368
                  +G
Sbjct  120   ATQFPSG  126


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 85/325 (26%), Positives = 148/325 (46%), Gaps = 33/325 (10%)
 Frame = -1

Query  1148  LRGKQQEIKVQARPTTPSARSDALLTSDST-IINGVNTNTLPKRTNKQENVDVNFMSNNN  972
             L  KQ+   V A+ +   +++ +    +ST ++   +  + PK T+    VD    + N 
Sbjct  291   LPSKQERANVFAKSSKEQSKTQSTKKVESTGVVETKDKTSKPKSTST--TVDKRSTAENG  348

Query  971   RQNILSSHPV----------LWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknl  822
                 L   PV           WSSLP +L + G+ +LR +  A ++A EA  EA A+++L
Sbjct  349   LPGSLVKVPVNSKRLAYASTQWSSLPSSLSRLGQEVLRHRDAAQVVAIEAMQEASASESL  408

Query  821   LQCLSMFADLCSSASPENPHLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKKTPDSN  642
             LQCL M+ +L S+A  ++P   + +F  LH+ ++  +   +    ++L  + +    + N
Sbjct  409   LQCLIMYNELMSTAKEDDPLPVVEQFLKLHSSLKNVQIVTE--SLSRLVSSKSSPEHEEN  466

Query  641   HlgigigigkgklkpskppLELDLGGAEKL--EWARGDGLKATKELRESLSNETHLWFLK  468
                  +     K K +         G+E    +W +G+GL    EL E L   +  WFL 
Sbjct  467   RSEEAVKAALEKQKLAASWATTVAAGSESPPPKWVKGNGLNEANELAEKLQTVSQDWFLG  526

Query  467   FLDASLDVGFQVnnnnnkenksKGRQEEANHIGLTLSLLKQANEWLDKMMMRGSLELGSE  288
             F++  LD             ++     +   I   LS LK  N+WLD++   GS E G  
Sbjct  527   FVERFLDADV---------VETSSNLSDNGQIAGMLSQLKSVNDWLDEI---GSKEDGEG  574

Query  287   MHGF----VEKLKQKVYGCLLVHVD  225
             +       ++ L++K+Y  LL HV+
Sbjct  575   LQEVAKETIDGLRKKIYEYLLTHVE  599



>ref|XP_010936747.1| PREDICTED: uncharacterized protein LOC105056300 [Elaeis guineensis]
Length=576

 Score =   157 bits (396),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PGVL+KLL  +N+ T K  GE+R+ LLQV  IVPA +   +LWP HGF+IKVSDS
Sbjct  1     MATLAPGVLLKLLDGMNTGTPKPIGEHRNALLQVTDIVPADLDEKDLWPKHGFYIKVSDS  60

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    ++L+L+NK+QLGQ  YVDR+EP +PVPV++G +P+PGRHP  G+P+ +
Sbjct  61    SHSIYVSLPFDQDELVLSNKMQLGQFIYVDRLEPSSPVPVIMGAKPLPGRHPLLGTPEPI  120

Query  1391  MQM  1383
             +++
Sbjct  121   VRV  123



>ref|XP_006844956.1| hypothetical protein AMTR_s00058p00171710 [Amborella trichopoda]
 gb|ERN06631.1| hypothetical protein AMTR_s00058p00171710 [Amborella trichopoda]
Length=590

 Score =   157 bits (396),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL+ +NS T K   E+RS LLQV  IVPA +  +ELWP HGF++KVSDS
Sbjct  1     MATLAPGILLKLLENMNSGT-KPTSEHRSSLLQVTDIVPADLEDNELWPKHGFYVKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +DL+L+NKLQLGQ  YVDR++PG+PVP+L GV+ IPGRHP  G+P+ +
Sbjct  60    SHSIYVSLPDHQDDLVLSNKLQLGQFIYVDRLDPGSPVPLLRGVKTIPGRHPLVGTPEQI  119

Query  1391  MQMME  1377
               + E
Sbjct  120   TGLRE  124



>ref|XP_009352495.1| PREDICTED: uncharacterized protein LOC103943858 [Pyrus x bretschneideri]
Length=709

 Score =   157 bits (398),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPG+L+KLLQ++NS T K+ G++RS LLQVI IVPA++GS+L  + GF++++SDS 
Sbjct  1     MASLTPGILLKLLQSMNSAT-KVTGDHRSALLQVIGIVPALAGSDLSSNQGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS  D DLIL N+LQLGQ  YVDR    +P+P++LG+RPI GRHPF G+P+ L+
Sbjct  60    NSTYVSLSDRDTDLILTNRLQLGQFAYVDRFNFDSPIPLVLGIRPIAGRHPFLGTPEPLV  119


 Score = 73.6 bits (179),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 7/107 (7%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W RG G+K T EL  SL +E  +WFL+F++ +LD GF+V               +   I 
Sbjct  595  WTRGHGMKETVELAVSLQSEMQMWFLQFVEKALDAGFRVFGECAANGGKL--PIDCGSIA  652

Query  368  LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV  228
              LS LK+ NEWLD     G +   +E++  V+ LK+K+YG ++ HV
Sbjct  653  AVLSQLKRVNEWLD-----GVVSKRNELNEKVDGLKRKIYGFVIQHV  694



>ref|XP_008368252.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103431859 
[Malus domestica]
Length=598

 Score =   156 bits (395),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KL+  +N+  VK  GE+RS LLQV  IVPA +    LWP  GF+IKVSDS
Sbjct  1     MAALAPGILLKLMDGMNT-GVKPTGEHRSALLQVTDIVPADLDEKSLWPTQGFYIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    ND +L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPAEHNDYVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLMGTPEPL  119

Query  1391  MQMMEAAGEME  1359
             M + E    +E
Sbjct  120   MGLREKGERIE  130



>ref|XP_009604059.1| PREDICTED: uncharacterized protein LOC104098912 [Nicotiana tomentosiformis]
Length=594

 Score =   156 bits (395),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 93/125 (74%), Gaps = 2/125 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  + S  VK   E+RS LLQV  IVPA +    LWP HGFFIKVSDS
Sbjct  1     MAALAPGILLKLLNGMKSG-VKPTSEHRSSLLQVTDIVPADLDEKNLWPKHGFFIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +DL+L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPYEQDDLVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLVGTPEPL  119

Query  1391  MQMME  1377
             M + E
Sbjct  120   MGLRE  124



>ref|XP_006369113.1| hypothetical protein POPTR_0001s16570g, partial [Populus trichocarpa]
 gb|ERP65682.1| hypothetical protein POPTR_0001s16570g, partial [Populus trichocarpa]
Length=323

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 105/168 (63%), Gaps = 28/168 (17%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASLTPGVL+KLLQ+INS               V SIVPA+SGSE+WP  GFFIKVSDSS
Sbjct  1     MASLTPGVLLKLLQSINS--------------NVNSIVPALSGSEVWPYKGFFIKVSDSS  46

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             HSTYV+LS  DN+LILNNKL+LGQ FYVDR+E GT             ++PF G+PKDLM
Sbjct  47    HSTYVSLSTEDNELILNNKLKLGQFFYVDRVEAGT-------------QNPFIGNPKDLM  93

Query  1388  QMMEAAGEMECEVKKESAknsnsnsnsnsnskkkkKIVIKEEKVGVAS  1245
             QM+    E    V  E   +     +       ++KI+IKEE  GVAS
Sbjct  94    QML-VPSEGPVAVDNEVTGSKLRELSEVKGENARQKIIIKEENAGVAS  140


 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 99/154 (64%), Gaps = 1/154 (1%)
 Frame = -1

Query  902  KGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENPHLSITKFFALHALI  723
            +GMLR + LA+L+AAEAQ +A  A  L++CL+MFA+LC+SASPENPHL++TKF  +  LI
Sbjct  171  QGMLRRRYLATLVAAEAQKQASTAAALIKCLNMFAELCASASPENPHLTLTKFLTIQQLI  230

Query  722  EQPKKALDDYCFTKLSVTDNKKTPDSNHlgigigigkgklkpskppLELDLGGAEKLEWA  543
            +QP      +    L +  +   PD+       G+   K K   P   ++L  +EK EWA
Sbjct  231  DQP-NVTTPFEDKSLRLFTDFSAPDTEKTSKKTGLSYAKAKLKSPKPSMELSASEKQEWA  289

Query  542  RGDGLKATKELRESLSNETHLWFLKFLDASLDVG  441
            +G+G K  KE++++L NET  WFL+FL+ +L+ G
Sbjct  290  KGEGTKEIKEVQQTLLNETRAWFLRFLEGALNAG  323



>gb|KDO82437.1| hypothetical protein CISIN_1g008847mg [Citrus sinensis]
Length=551

 Score =   156 bits (394),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  +N+  VK  GE+RS LLQV  IVPA +    LWP  GFFIKVSDS
Sbjct  1     MATLAPGILLKLLNGMNT-GVKPTGEHRSSLLQVTDIVPADLDEKNLWPTQGFFIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +D +L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPTEQDDFVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLVGTPEPL  119

Query  1391  MQMMEAAGEME  1359
             M + E   + E
Sbjct  120   MGLREKGEKSE  130



>ref|XP_002324965.2| hypothetical protein POPTR_0018s06270g [Populus trichocarpa]
 gb|EEF03530.2| hypothetical protein POPTR_0018s06270g [Populus trichocarpa]
Length=698

 Score =   157 bits (398),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PG+L+KLLQ++NS   ++ G++RS LLQVI IVPA++GS+LWP+ GF++++SDS 
Sbjct  1     MASLAPGILLKLLQSMNSA-ARVTGDHRSPLLQVIGIVPALAGSDLWPNQGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS+ D DLIL N+LQLGQ  Y+DR +  +PVP + G+RPI GRH F G+P+ L+
Sbjct  60    NSTYVSLSERDTDLILTNRLQLGQFVYIDRFDFDSPVPRVSGIRPIAGRHSFVGTPEPLI  119

Query  1388  QMMEAA  1371
               + A+
Sbjct  120   ARISAS  125


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 66/110 (60%), Gaps = 11/110 (10%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQE---EAN  378
            W RG G+K T EL   L  E  +WF+KF++ SLD GF+V      E  + G +     ++
Sbjct  586  WTRGHGMKETVELSMKLQVEMQMWFVKFIEESLDAGFRV----LGECANNGSKSLPLNSS  641

Query  377  HIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV  228
             I   LS LK+ NEWLD++ ++G  EL   + G +EKLK+K+YG ++ HV
Sbjct  642  SIAAVLSQLKRVNEWLDRVALKGD-EL---LTGKIEKLKKKIYGFVIQHV  687



>ref|XP_011009205.1| PREDICTED: uncharacterized protein LOC105114378 [Populus euphratica]
Length=698

 Score =   157 bits (397),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PG+L+KLLQ++NS   ++ G++RS LLQVI IVPA++GS+LWP+ GF++++SDS 
Sbjct  1     MASLAPGILLKLLQSMNSA-ARVTGDHRSPLLQVIGIVPALAGSDLWPNQGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS+ D DLIL N+LQLGQ  Y+DR +  +PVP + G+RPI GRH F G+P+ L+
Sbjct  60    NSTYVSLSERDTDLILTNRLQLGQFVYIDRFDFDSPVPRVSGIRPIAGRHSFVGTPEPLI  119

Query  1388  QMMEAA  1371
               + A+
Sbjct  120   ARISAS  125


 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 66/110 (60%), Gaps = 11/110 (10%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQE---EAN  378
            W RG G+K T EL   L  E  +WF+KF++ SLD GF+V      E  + G +     ++
Sbjct  586  WTRGHGMKETVELSMKLQVEMQMWFVKFIEDSLDAGFRV----LGECANNGSKSLPLNSS  641

Query  377  HIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV  228
             I   LS LK+ NEWLD++ ++G  EL   + G +EKLK+K+YG ++ HV
Sbjct  642  SIAAVLSQLKRVNEWLDRVALKGD-EL---LTGKIEKLKKKIYGFVIQHV  687



>gb|KDO80434.1| hypothetical protein CISIN_1g005209mg [Citrus sinensis]
Length=709

 Score =   157 bits (398),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MAS T G+L+KLLQ++NS T ++ G++RS LLQVI IVP ++GS+LWP+HGF++++SDS 
Sbjct  1     MASPTQGILLKLLQSMNSTT-RVTGDHRSALLQVIGIVPGLAGSDLWPNHGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS+ D +LIL N+LQLGQ  YVDR E  +PVP + G+RPI GRH F G+P+ L+
Sbjct  60    NSTYVSLSERDTELILTNRLQLGQFVYVDRFEFDSPVPRVCGIRPIAGRHAFCGTPEPLI  119

Query  1388  QMMEAA  1371
               + A+
Sbjct  120   ARISAS  125


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 65/118 (55%), Gaps = 11/118 (9%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W RG G+K T +L  +L +E  +WF+KF++  LD GF+     +  N S     +   I 
Sbjct  595  WTRGHGMKETVQLAVNLQSEMQMWFVKFVEELLDAGFRA-FGESSGNGSFNLPLDCGSIS  653

Query  368  LTLSLLKQANEWLD-KMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV----DSAASA  210
              LS LK+ N+WLD ++  R    +       +E+LK+K+YG ++ HV    D+AASA
Sbjct  654  AVLSQLKRVNDWLDHEVSSRDEPRVAK-----IEQLKRKIYGFVIQHVGTTYDNAASA  706



>ref|XP_006451057.1| hypothetical protein CICLE_v10007618mg [Citrus clementina]
 ref|XP_006475747.1| PREDICTED: uncharacterized protein LOC102627449 [Citrus sinensis]
 gb|ESR64297.1| hypothetical protein CICLE_v10007618mg [Citrus clementina]
Length=709

 Score =   157 bits (398),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MAS T G+L+KLLQ++NS T ++ G++RS LLQVI IVP ++GS+LWP+HGF++++SDS 
Sbjct  1     MASPTQGILLKLLQSMNSTT-RVTGDHRSALLQVIGIVPGLAGSDLWPNHGFYVQLSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS+ D +LIL N+LQLGQ  YVDR E  +PVP + G+RPI GRH F G+P+ L+
Sbjct  60    NSTYVSLSERDTELILTNRLQLGQFVYVDRFEFDSPVPRVCGIRPIAGRHAFCGTPEPLI  119

Query  1388  QMMEAA  1371
               + A+
Sbjct  120   ARISAS  125


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 65/118 (55%), Gaps = 11/118 (9%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W RG G+K T +L  +L +E  +WF+KF++  LD GF+     +  N S     +   I 
Sbjct  595  WTRGHGMKETVQLAVNLQSEMQMWFVKFVEELLDAGFRA-FGESSGNGSFNLPLDCGSIS  653

Query  368  LTLSLLKQANEWLD-KMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV----DSAASA  210
              LS LK+ N+WLD ++  R    +       +E+LK+K+YG ++ HV    D+AASA
Sbjct  654  AVLSQLKRVNDWLDHEVSSRDEPRVAK-----IEQLKRKIYGFVIQHVGTTYDNAASA  706



>ref|XP_003606816.1| hypothetical protein MTR_4g068050 [Medicago truncatula]
 gb|AES89013.1| DUF936 family protein [Medicago truncatula]
Length=727

 Score =   157 bits (398),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MA+L PGVL+KL+Q +N+  +K+ GE+RS LLQV+SIVPA++G +L+ + GF++KVSDSS
Sbjct  1     MANLVPGVLLKLMQHMNT-DIKVGGEHRSSLLQVVSIVPALAGGDLFTNQGFYVKVSDSS  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L    +DLIL++K+QLGQ  +VDR E  +PVP+L GVRP+PGRH   G+P+D++
Sbjct  60    HATYVSLPDEHDDLILSDKIQLGQFVFVDRFEAASPVPILRGVRPVPGRHACVGTPEDIV  119


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 13/121 (11%)
 Frame = -1

Query  551  EWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHI  372
            EW RG+ L A   L + L   +  WFL F++  LD    +  +NN              I
Sbjct  609  EWIRGNDLDAAVNLADMLQLRSRDWFLLFVEKFLDSDGDIGLSNN------------GQI  656

Query  371  GLTLSLLKQANEWLDKM-MMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRS  195
               L+ LK  N+WLD++   +   EL       +++L++K+Y  LL HV+SAA+AL   S
Sbjct  657  AGILTQLKSVNDWLDEIGSSKNEGELCQIPTETIDRLRKKIYEYLLTHVESAAAALTCDS  716

Query  194  H  192
             
Sbjct  717  Q  717



>ref|XP_004238670.1| PREDICTED: uncharacterized protein LOC101252685 [Solanum lycopersicum]
Length=596

 Score =   155 bits (393),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  + S  VK   E+RS LLQV  IVPA +    LWP HGFFIKVSDS
Sbjct  1     MAALAPGILLKLLNGMKSG-VKPTSEHRSSLLQVTDIVPADLDEKNLWPKHGFFIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +DL+L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPDEQDDLVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLVGTPEPL  119

Query  1391  MQMMEAAGEME  1359
             M +     ++E
Sbjct  120   MGLRGKGEKVE  130



>ref|XP_006438396.1| hypothetical protein CICLE_v10031068mg [Citrus clementina]
 gb|ESR51636.1| hypothetical protein CICLE_v10031068mg [Citrus clementina]
Length=579

 Score =   155 bits (392),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  +N+  VK  GE+RS LLQV  IVPA +    LWP  GFFIKVSDS
Sbjct  1     MATLAPGILLKLLNGMNT-GVKPTGEHRSSLLQVTDIVPADLDEKNLWPTQGFFIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +D +L+NK+QLGQ  YVD++EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPTEQDDFVLSNKMQLGQFIYVDKLEPGSPVPVVKGAKPLPGRHPLVGTPEPL  119

Query  1391  MQMMEAAGEMECEV  1350
             M + E   + E +V
Sbjct  120   MGLREKGEKSEQKV  133



>ref|XP_002264073.1| PREDICTED: uncharacterized protein LOC100260333 [Vitis vinifera]
Length=592

 Score =   155 bits (391),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MASL PG+L+KLL  +NS  +K   E+RS LLQV  IVPA +    LWP HGF+IKVSDS
Sbjct  1     MASLAPGILLKLLNGMNS-GLKPTSEHRSSLLQVTDIVPADLDEKNLWPKHGFYIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +DL+L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ +
Sbjct  60    SHSIYVSLPFEQDDLVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLVGTPEPI  119

Query  1391  MQMME  1377
             M + E
Sbjct  120   MGLRE  124



>ref|XP_006483844.1| PREDICTED: uncharacterized protein LOC102612188 [Citrus sinensis]
Length=601

 Score =   155 bits (392),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = -1

Query  1751  TMASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSD  1575
              MA+L PG+++KLL  +N+  VK  GE+RS LLQV  IVPA +    LWP  GFFIKVSD
Sbjct  22    AMATLAPGIVLKLLNGMNT-GVKPTGEHRSSLLQVTDIVPADLDEKNLWPTQGFFIKVSD  80

Query  1574  SSHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKD  1395
             SSHS YV+L    +D +L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ 
Sbjct  81    SSHSIYVSLPTEQDDFVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLVGTPEP  140

Query  1394  LMQMMEAAGEMECEV  1350
             LM + E   + E +V
Sbjct  141   LMGLREKGEKSEQKV  155



>emb|CBI32148.3| unnamed protein product [Vitis vinifera]
Length=547

 Score =   154 bits (390),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MASL PG+L+KLL  +NS  +K   E+RS LLQV  IVPA +    LWP HGF+IKVSDS
Sbjct  1     MASLAPGILLKLLNGMNS-GLKPTSEHRSSLLQVTDIVPADLDEKNLWPKHGFYIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +DL+L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ +
Sbjct  60    SHSIYVSLPFEQDDLVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLVGTPEPI  119

Query  1391  MQMME  1377
             M + E
Sbjct  120   MGLRE  124



>gb|KHG08389.1| dicer-like protein 2 [Gossypium arboreum]
Length=554

 Score =   154 bits (390),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 100/138 (72%), Gaps = 4/138 (3%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  +N+  VK   E+RS LLQV  IVPA +    LWP HGF+IKVSDS
Sbjct  1     MAALAPGILLKLLNGMNT-GVKPTSEHRSSLLQVTDIVPADLDEKNLWPKHGFYIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +D +L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPSDQDDFVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLVGTPEPL  119

Query  1391  MQMMEAAGEMECEVKKES  1338
             M +    GE + E K+ES
Sbjct  120   MGLRR-KGE-KSEQKQES  135



>ref|XP_004143072.1| PREDICTED: uncharacterized protein LOC101212478 [Cucumis sativus]
 ref|XP_004170062.1| PREDICTED: uncharacterized LOC101212478 [Cucumis sativus]
 gb|KGN62284.1| hypothetical protein Csa_2G348220 [Cucumis sativus]
Length=566

 Score =   154 bits (390),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 102/139 (73%), Gaps = 4/139 (3%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MASL PGVL+KLL  +NS  VK   ++RS LLQV  IVPA +    LWP HGF+IKVSDS
Sbjct  1     MASLAPGVLVKLLDGMNS-GVKPTSDHRSSLLQVTDIVPADLDEKNLWPKHGFYIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +D +L+NK+QLGQ  YVD++EPG+PVP++ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPSDQDDFVLSNKMQLGQFIYVDKLEPGSPVPLMKGTKPLPGRHPLVGTPEPL  119

Query  1391  MQMMEAAGEMECEVKKESA  1335
             M + +  GE +C+ K ++A
Sbjct  120   MGLRK-KGE-KCDDKSKAA  136



>ref|XP_006838229.1| hypothetical protein AMTR_s00217p00029330 [Amborella trichopoda]
 gb|ERN00798.1| hypothetical protein AMTR_s00217p00029330 [Amborella trichopoda]
Length=706

 Score =   156 bits (394),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL+PGVL+KLLQ + S  +K+ GE+R+VLLQVI IVP++SG +LW   GFF+KVSDS 
Sbjct  1     MASLSPGVLLKLLQHMKS-GIKVAGEHRTVLLQVIGIVPSLSGDDLWQSRGFFLKVSDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             H+TYV+L   +NDLI N+K+QLGQ  +V ++E G+PVP+L GV+ +P RHP  G+P+DL+
Sbjct  60    HATYVSLGDENNDLIFNDKIQLGQFIHVTKLESGSPVPILRGVKLVPRRHPCIGNPEDLV  119


 Score = 75.5 bits (184),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 19/125 (15%)
 Frame = -1

Query  569  GGAEKLEWARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQ  390
            G  E  EW RG GL+    L + +  E+  WFL++LD  LD GF                
Sbjct  600  GEQEACEWRRGKGLEENARLGKGMVEESRRWFLEYLDGVLDGGF----------------  643

Query  389  EEANHIGLTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASA  210
             E   + + L  +K+ +EWL+       L  G ++ G VE++++KVYG LL HV+ AA A
Sbjct  644  -EGEGVAMMLGQMKRVSEWLEGAGR--DLRDGKDVDGVVERVRKKVYGFLLQHVECAAMA  700

Query  209  LDTRS  195
            +  +S
Sbjct  701  MGNQS  705


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 55/98 (56%), Gaps = 0/98 (0%)
 Frame = -1

Query  944  VLWSSLPPNLVKPGKGMLRMKKlasliaaeaqaeamaaknlLQCLSMFADLCSSASPENP  765
            V W +LP NL  P K  LR +  A   + +A  EA AA ++++CLSM+A+ CS++  E P
Sbjct  390  VSWDALPSNLSVPAKDALRSRDTAFSASVDALLEASAADSVMRCLSMYAETCSTSKQEPP  449

Query  764  HLSITKFFALHALIEQPKKALDDYCFTKLSVTDNKKTP  651
             + + +F  L+ ++E+     D    TK SVT    TP
Sbjct  450  EVVVERFLNLNPIMERAALVADSLVQTKKSVTTGISTP  487



>ref|XP_008782438.1| PREDICTED: uncharacterized protein LOC103701975 [Phoenix dactylifera]
Length=566

 Score =   154 bits (389),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PGVL+KLL  +N+   K  GE+R+ LLQV  IVPA +   +LWP HGF+IKVSDS
Sbjct  1     MATLAPGVLLKLLDGMNTGASKPVGEHRNALLQVTDIVPADLDEKDLWPKHGFYIKVSDS  60

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +DL+L+NK+QLGQ  +VDR+EP +P+PV++G +P+PGRHP  G+P+ +
Sbjct  61    SHSIYVSLPFDQDDLVLSNKMQLGQFIHVDRLEPSSPIPVIMGAKPLPGRHPLMGTPEPI  120

Query  1391  MQMMEAAGE  1365
             ++     G+
Sbjct  121   VRAKGNGGK  129



>ref|XP_004301548.1| PREDICTED: uncharacterized protein LOC101301592 [Fragaria vesca 
subsp. vesca]
Length=701

 Score =   155 bits (393),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 99/127 (78%), Gaps = 2/127 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSE-LWPDHGFFIKVSDS  1572
             MAS TPG+L++LLQ++NS T K+ G++RS LLQVI IVPA++ S+ LWP+HGFF+++SDS
Sbjct  1     MASPTPGILLRLLQSMNSAT-KVTGDHRSALLQVIGIVPALTASDDLWPNHGFFVQLSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
              +STYV+LS+ D DLIL N+LQLGQ  YVDR +   PVP + G+RPI GRH F G P+ L
Sbjct  60    LNSTYVSLSEKDTDLILANRLQLGQFVYVDRFDFDAPVPRVAGIRPIAGRHAFVGVPEPL  119

Query  1391  MQMMEAA  1371
             +  + A+
Sbjct  120   VARISAS  126


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 63/107 (59%), Gaps = 6/107 (6%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W +G+G++ T EL ++L +E  +WFL+F++ ++D GF+V      +        +   I 
Sbjct  588  WKKGNGMRETVELAKNLQSEMQMWFLQFVEKAMDAGFRVFGECAADGGKL--PLDCGSIA  645

Query  368  LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHV  228
              LS LK+ NEWLD+++ +    L  +    V++LK+K+YG ++ HV
Sbjct  646  AVLSQLKRVNEWLDRVVSKRDDLLNEK----VDRLKRKIYGFVIQHV  688



>gb|KHG13326.1| RNA polymerase-associated rapA [Gossypium arboreum]
Length=684

 Score =   155 bits (392),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 101/127 (80%), Gaps = 2/127 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGS-ELWPDHGFFIKVSDS  1572
             MASLTPG+L+KLLQ++NS + ++ G++RS LLQVI I+PA++GS ELWP+HGF++++SDS
Sbjct  1     MASLTPGILLKLLQSMNS-SARVAGDHRSALLQVIGILPALAGSDELWPNHGFYVQLSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
               STYV+LS  D++LIL+N+LQLGQ  YVDR    +PVP + G+RPI GRH F GSP  L
Sbjct  60    LSSTYVSLSDRDSELILSNRLQLGQFVYVDRFHFESPVPRVSGIRPIAGRHAFVGSPDPL  119

Query  1391  MQMMEAA  1371
             +  + ++
Sbjct  120   IARISSS  126


 Score = 62.8 bits (151),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 58/119 (49%), Gaps = 23/119 (19%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W RG+G+K T     +L  E  +WF+ F++ SL                     +   I 
Sbjct  585  WTRGEGMKETMHFAMNLKVEMQMWFIGFMEESLKALVL----------------DCGSIA  628

Query  368  LTLSLLKQANEWLDKMMMRGSLELGSEMHGFVEKLKQKVYGCLLVHVDSAASALDTRSH  192
              LS LK+ N+WLD+ +++G   L   +H  VEKLK+K+YG ++ HV    +  D  SH
Sbjct  629  AVLSQLKRVNDWLDRAVLKGDEVL---VH-MVEKLKRKIYGFVIQHV---GTTFDNSSH  680



>ref|XP_003613238.1| hypothetical protein MTR_5g034370 [Medicago truncatula]
 gb|AES96196.1| DUF936 family protein [Medicago truncatula]
Length=571

 Score =   154 bits (389),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 2/127 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  +N+  VK   E+R+ LLQV  IVPA +    L+P  GF+IKVSDS
Sbjct  1     MATLAPGILVKLLNGLNT-GVKPTSEHRNSLLQVTDIVPADLDEKSLFPKQGFYIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YVTL    +D +L+NK+QLGQ  YVDR+EPG+PVPVL G +P+PGRHPF G+P+ L
Sbjct  60    SHSIYVTLPSDQHDFVLSNKMQLGQFIYVDRLEPGSPVPVLKGAKPLPGRHPFIGTPEPL  119

Query  1391  MQMMEAA  1371
             M + E A
Sbjct  120   MGLREKA  126



>ref|XP_010450218.1| PREDICTED: uncharacterized protein LOC104732383 [Camelina sativa]
Length=684

 Score =   155 bits (391),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PG+L+KLLQ +NS T +  G++RS  LQV  IVPA++GS+LWP+ GFF+++SDS 
Sbjct  1     MASLAPGILLKLLQCMNSNT-RPTGDHRSATLQVTGIVPALAGSDLWPNQGFFVQISDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV+LS+ D DLIL N+LQLGQ  Y++R+E  TPVP   G+RP+ GRH F GSP+ L+
Sbjct  60    NSTYVSLSERDTDLILTNRLQLGQFIYLERLEFATPVPRAAGIRPVAGRHAFVGSPEPLI  119


 Score = 66.2 bits (160),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 60/110 (55%), Gaps = 12/110 (11%)
 Frame = -1

Query  548  WARGDGLKATKELRESLSNETHLWFLKFLDASLDVGFQVnnnnnkenksKGRQEEANHIG  369
            W   DGLK T +   +L +E  +WF++F++ SLD              +  R  +++ I 
Sbjct  579  WTDIDGLKETAKFAVNLQSEMQMWFIRFVEESLD-----------NKNTAKRSLDSSSIA  627

Query  368  LTLSLLKQANEWLDKMMMRGSLELGS-EMHGFVEKLKQKVYGCLLVHVDS  222
              LS LKQ NEWLD+++     ++ +  +   +E+LK+K+YG ++ HV S
Sbjct  628  AVLSQLKQVNEWLDRVVSNQENQITTMALTAKIERLKRKIYGFVIHHVGS  677



>ref|XP_008444316.1| PREDICTED: uncharacterized protein LOC103487685 [Cucumis melo]
Length=566

 Score =   153 bits (387),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 101/139 (73%), Gaps = 4/139 (3%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MASL PGVL+KLL  +NS  VK   ++RS LLQV  IVPA +    LWP HGF+IKVSDS
Sbjct  1     MASLAPGVLVKLLDGMNS-GVKPTSDHRSSLLQVTDIVPADLDEKNLWPKHGFYIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +D +L+N++QLGQ  YVD++EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPSDQDDFVLSNRMQLGQFIYVDKLEPGSPVPVMKGTKPLPGRHPLVGTPEPL  119

Query  1391  MQMMEAAGEMECEVKKESA  1335
             M + +  GE +C+ K  +A
Sbjct  120   MGLRK-KGE-KCDDKSMAA  136



>emb|CDP00168.1| unnamed protein product [Coffea canephora]
Length=589

 Score =   154 bits (388),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  +NS  VK   E+RS LLQV  IVPA +    LWP HGFFIKVSDS
Sbjct  1     MATLAPGILLKLLNGMNS-GVKPTNEHRSSLLQVTDIVPADLDEKNLWPKHGFFIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +DL+L+NK+QLGQ  YVD++EPG+PVP++ G + +PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPFDQDDLVLSNKMQLGQFIYVDKLEPGSPVPIVKGAKLVPGRHPLVGTPEPL  119

Query  1391  MQMMEAAGEMECEV  1350
             M + E   ++E ++
Sbjct  120   MGLREKGEKIEQKI  133



>emb|CDY69222.1| BnaAnng29710D [Brassica napus]
Length=424

 Score =   151 bits (382),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPAISGSELWPDHGFFIKVSDSS  1569
             MASL PG+L+KLLQ +NS T +  G++RS +LQV  IVPA++GS+LWP+ GF++++SDS 
Sbjct  1     MASLAPGILLKLLQCMNSNT-RPTGDHRSAILQVTGIVPALAGSDLWPNQGFYVQISDSL  59

Query  1568  HSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDLM  1389
             +STYV LS+ D DLIL N+LQLGQ  Y++R+E  TPVP   G+RP+ GRH F G+P+ L+
Sbjct  60    NSTYVCLSERDTDLILTNRLQLGQFIYLERLEFSTPVPRAAGIRPVAGRHAFVGTPEPLI  119



>ref|XP_009413194.1| PREDICTED: uncharacterized protein LOC103994558 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413195.1| PREDICTED: uncharacterized protein LOC103994558 [Musa acuminata 
subsp. malaccensis]
Length=567

 Score =   153 bits (386),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PGVL+KLL  +N+ + K  GE+R+ LLQV  IVPA +   +LWP HGF+IK+SDS
Sbjct  1     MAALAPGVLMKLLNGMNTGSQKPVGEHRTALLQVTDIVPADLDEKDLWPKHGFYIKLSDS  60

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             S+S Y +L    +DL+L+NKLQLGQ  +VDR+EPG+PVPVL+G +P+PGRHP  G+P+ +
Sbjct  61    SNSIYASLPFDQDDLVLSNKLQLGQFIHVDRLEPGSPVPVLVGAKPLPGRHPLMGTPEPI  120

Query  1391  MQ  1386
             ++
Sbjct  121   VR  122



>ref|XP_007044621.1| Leucine-rich repeat-containing protein 50 [Theobroma cacao]
 gb|EOY00453.1| Leucine-rich repeat-containing protein 50 [Theobroma cacao]
Length=598

 Score =   153 bits (387),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  +N+  VK   E+RS LLQV  IVPA +    LWP HGF+IKVSDS
Sbjct  1     MATLAPGILLKLLNGMNTG-VKPTSEHRSSLLQVTDIVPADLDEKNLWPKHGFYIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +D +L+NK+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPSDQDDFVLSNKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLVGTPEPL  119

Query  1391  MQMMEAAGEME  1359
             M +     + E
Sbjct  120   MGLRRKGEKSE  130



>ref|XP_006380021.1| hypothetical protein POPTR_0008s19660g [Populus trichocarpa]
 gb|ERP57818.1| hypothetical protein POPTR_0008s19660g [Populus trichocarpa]
Length=545

 Score =   152 bits (385),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 91/121 (75%), Gaps = 2/121 (2%)
 Frame = -1

Query  1748  MASLTPGVLIKLLQTINSCTVKIRGEYRSVLLQVISIVPA-ISGSELWPDHGFFIKVSDS  1572
             MA+L PG+L+KLL  +++ T K   E+RS LLQV  IVPA +    LWP HGFFIKVSDS
Sbjct  1     MATLAPGILLKLLNGMDTGT-KPTSEHRSSLLQVTDIVPAELDEKNLWPKHGFFIKVSDS  59

Query  1571  SHSTYVTLSKPDNDLILNNKLQLGQLFYVDRMEPGTPVPVLLGVRPIPGRHPFFGSPKDL  1392
             SHS YV+L    +D +L++K+QLGQ  YVDR+EPG+PVPV+ G +P+PGRHP  G+P+ L
Sbjct  60    SHSIYVSLPSDQDDFVLSDKMQLGQFIYVDRLEPGSPVPVVKGAKPLPGRHPLLGTPEPL  119

Query  1391  M  1389
             M
Sbjct  120   M  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5576455993584