BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21255_g2_i1 len=1744 path=[5989:0-323 185:324-367 229:368-718
580:719-1743]

Length=1744
                                                                      Score     E

ref|XP_004235807.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    244   3e-72   
ref|XP_009778792.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    244   4e-72   
ref|XP_010318659.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    242   5e-72   
ref|XP_009596753.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    243   1e-71   
ref|XP_009767504.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    243   2e-71   
ref|XP_009617424.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    243   2e-71   
ref|XP_006341498.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    241   4e-71   
ref|XP_006341499.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    239   7e-71   
ref|XP_009758749.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    235   3e-69   
ref|XP_006346639.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    232   8e-69   
ref|XP_004241659.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    234   1e-68   
ref|XP_009605502.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    234   1e-68   
ref|XP_006365415.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    233   4e-68   
ref|XP_010314229.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    229   2e-67   
ref|XP_009596747.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    232   2e-67   
ref|XP_009605507.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    218   2e-63   
emb|CDO98317.1|  unnamed protein product                                218   1e-62   
ref|XP_011073590.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    213   3e-61   
ref|XP_002282941.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    213   3e-61   Vitis vinifera
gb|EYU21840.1|  hypothetical protein MIMGU_mgv1a013711mg                213   4e-61   
emb|CBI15601.3|  unnamed protein product                                211   6e-61   
ref|XP_011083132.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    210   3e-60   
emb|CAN72000.1|  hypothetical protein VITISV_032712                     216   3e-59   Vitis vinifera
gb|EYU24510.1|  hypothetical protein MIMGU_mgv1a013935mg                206   8e-59   
ref|XP_011085849.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    200   6e-57   
gb|KHG02671.1|  Nudix hydrolase 18, mitochondrial -like protein         200   1e-56   
ref|XP_006574813.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    199   1e-56   
gb|KDO60742.1|  hypothetical protein CISIN_1g030372mg                   199   3e-56   
ref|XP_007153255.1|  hypothetical protein PHAVU_003G019800g             198   3e-56   
ref|XP_010091723.1|  Nudix hydrolase 18                                 201   3e-56   
ref|XP_007045255.1|  Nudix hydrolase                                    198   3e-56   
ref|XP_006469321.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    201   9e-56   
gb|KHG14906.1|  Nudix hydrolase 18, mitochondrial -like protein         196   1e-55   
ref|XP_010270959.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    197   1e-55   
ref|XP_003528327.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    196   2e-55   
ref|XP_003532546.1|  PREDICTED: nudix hydrolase 4-like                  197   3e-55   
ref|XP_004140308.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    195   5e-55   
ref|XP_009370557.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    195   6e-55   
gb|KHN17955.1|  Nudix hydrolase 17, mitochondrial                       196   8e-55   
ref|XP_009370056.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    194   2e-54   
ref|XP_010107626.1|  Nudix hydrolase 17                                 193   2e-54   
ref|XP_006448175.1|  hypothetical protein CICLE_v10016278mg             196   3e-54   
ref|XP_004150841.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    192   5e-54   
ref|XP_004168523.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    192   6e-54   
ref|XP_007217269.1|  hypothetical protein PRUPE_ppa011832mg             192   9e-54   
ref|XP_007227594.1|  hypothetical protein PRUPE_ppa016570mg             191   1e-53   
ref|XP_008221469.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    191   1e-53   
ref|XP_002263589.2|  PREDICTED: nudix hydrolase 18, mitochondrial       191   1e-53   Vitis vinifera
ref|XP_003630930.1|  Nudix hydrolase                                    191   1e-53   
ref|NP_001236875.1|  uncharacterized protein LOC100500105               192   1e-53   
ref|XP_007163378.1|  hypothetical protein PHAVU_001G229700g             192   1e-53   
ref|XP_002284976.1|  PREDICTED: nudix hydrolase 18, mitochondrial       191   2e-53   Vitis vinifera
ref|XP_008381741.1|  PREDICTED: nudix hydrolase 17, mitochondrial       191   2e-53   
gb|KDP38109.1|  hypothetical protein JCGZ_04752                         190   4e-53   
ref|XP_003553078.1|  PREDICTED: nudix hydrolase 17, mitochondrial       191   4e-53   
ref|XP_002525991.1|  diphosphoinositol polyphosphate phosphohydro...    190   4e-53   Ricinus communis
ref|XP_010498218.1|  PREDICTED: nudix hydrolase 4-like                  190   7e-53   
ref|XP_009351540.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    189   8e-53   
ref|XP_010477005.1|  PREDICTED: nudix hydrolase 4                       190   1e-52   
ref|XP_008240121.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    190   1e-52   
ref|XP_007160556.1|  hypothetical protein PHAVU_002G331500g             190   1e-52   
gb|ACJ86054.1|  unknown                                                 189   1e-52   Medicago truncatula
ref|XP_009149274.1|  PREDICTED: nudix hydrolase 4                       189   1e-52   
ref|XP_010459443.1|  PREDICTED: nudix hydrolase 4-like                  189   2e-52   
ref|XP_007209610.1|  hypothetical protein PRUPE_ppa011552mg             189   2e-52   
ref|XP_003600707.1|  Nudix hydrolase                                    189   2e-52   
ref|XP_008360027.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    188   2e-52   
ref|XP_011002187.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    188   2e-52   
ref|XP_010105645.1|  Nudix hydrolase 17                                 188   2e-52   
ref|XP_004299512.1|  PREDICTED: nudix hydrolase 4-like                  189   3e-52   
ref|XP_010537505.1|  PREDICTED: nudix hydrolase 4                       189   3e-52   
gb|KHN41062.1|  Nudix hydrolase 17, mitochondrial                       188   3e-52   
ref|XP_003619856.1|  Nudix hydrolase                                    189   4e-52   
ref|XP_011001557.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    188   4e-52   
ref|NP_001237840.1|  uncharacterized protein LOC100305863               187   5e-52   
ref|XP_003525233.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    187   5e-52   
ref|XP_008368721.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    187   6e-52   
ref|XP_002531008.1|  diphosphoinositol polyphosphate phosphohydro...    187   7e-52   Ricinus communis
ref|XP_004288619.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    187   7e-52   
ref|XP_010062274.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    187   7e-52   
gb|KDP25791.1|  hypothetical protein JCGZ_22513                         187   8e-52   
ref|XP_009360054.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    187   9e-52   
gb|KHN39470.1|  Nudix hydrolase 17, mitochondrial                       187   1e-51   
ref|XP_004503255.1|  PREDICTED: nudix hydrolase 4-like                  188   1e-51   
gb|KDP34747.1|  hypothetical protein JCGZ_11901                         187   1e-51   
ref|XP_010036981.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    187   1e-51   
ref|XP_003544981.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    186   1e-51   
ref|XP_002305883.1|  MutT-like family protein                           186   1e-51   Populus trichocarpa [western balsam poplar]
emb|CDY19204.1|  BnaC05g14050D                                          187   2e-51   
ref|XP_004297443.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    185   2e-51   
ref|NP_001236150.1|  uncharacterized protein LOC100527186               185   2e-51   
ref|XP_006304212.1|  hypothetical protein CARUB_v10010316mg             186   2e-51   
gb|ACJ83842.1|  unknown                                                 187   2e-51   Medicago truncatula
gb|AFK40406.1|  unknown                                                 186   3e-51   
ref|XP_004503362.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    185   3e-51   
emb|CDY26172.1|  BnaA06g12450D                                          186   4e-51   
ref|XP_003637683.1|  Nudix hydrolase                                    184   4e-51   
ref|XP_011070581.1|  PREDICTED: nudix hydrolase 17, mitochondrial       184   4e-51   
ref|XP_008227931.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    185   5e-51   
ref|XP_002890268.1|  hypothetical protein ARALYDRAFT_312784             185   6e-51   
gb|AFK34506.1|  unknown                                                 184   7e-51   
ref|XP_007152662.1|  hypothetical protein PHAVU_004G148500g             186   8e-51   
ref|XP_004503124.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    184   1e-50   
ref|XP_009356007.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    184   1e-50   
ref|XP_010519202.1|  PREDICTED: nudix hydrolase 4-like                  184   1e-50   
ref|XP_004498257.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    182   1e-50   
emb|CDP16317.1|  unnamed protein product                                183   1e-50   
ref|XP_002888932.1|  predicted protein                                  184   2e-50   
ref|XP_003534133.1|  PREDICTED: nudix hydrolase 4                       183   2e-50   
ref|XP_007160422.1|  hypothetical protein PHAVU_002G320500g             182   3e-50   
ref|XP_009110355.1|  PREDICTED: nudix hydrolase 4                       184   3e-50   
ref|XP_008374870.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    183   3e-50   
ref|XP_006482118.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    182   4e-50   
ref|XP_004512769.1|  PREDICTED: nudix hydrolase 4-like isoform X1       184   4e-50   
ref|XP_011021781.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    182   5e-50   
ref|XP_010271341.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    181   5e-50   
ref|XP_004490826.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    181   6e-50   
ref|XP_003528984.1|  PREDICTED: nudix hydrolase 4-like                  182   7e-50   
ref|NP_173266.1|  nudix hydrolase 4                                     182   7e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322124.2|  hypothetical protein POPTR_0015s04970g             184   9e-50   Populus trichocarpa [western balsam poplar]
emb|CDX83857.1|  BnaC08g17880D                                          182   1e-49   
gb|AFK38562.1|  unknown                                                 181   1e-49   
gb|AAG30977.1|AC012396_13  unknown protein                              181   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002312457.2|  MutT/nudix family protein                          180   1e-49   Populus trichocarpa [western balsam poplar]
ref|NP_177495.2|  nudix hydrolase 21                                    181   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002314788.2|  MutT/nudix family protein                          180   2e-49   Populus trichocarpa [western balsam poplar]
emb|CDY48805.1|  BnaC02g34090D                                          180   2e-49   
ref|XP_008393445.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    181   2e-49   
ref|XP_006302706.1|  hypothetical protein CARUB_v10020817mg             182   2e-49   
gb|KFK41790.1|  hypothetical protein AALP_AA2G172400                    180   2e-49   
ref|XP_006372557.1|  MutT-like family protein                           180   2e-49   
ref|XP_011024029.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    179   3e-49   
ref|XP_009129215.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    180   3e-49   
ref|XP_010428280.1|  PREDICTED: nudix hydrolase 21, chloroplastic...    180   3e-49   
ref|XP_006416621.1|  hypothetical protein EUTSA_v10008778mg             181   3e-49   
ref|XP_009617071.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    180   5e-49   
gb|KFK33390.1|  hypothetical protein AALP_AA5G006700                    179   5e-49   
ref|XP_010527807.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    179   5e-49   
ref|XP_010471414.1|  PREDICTED: nudix hydrolase 21, chloroplastic...    180   6e-49   
ref|XP_006430600.1|  hypothetical protein CICLE_v10012837mg             179   6e-49   
ref|XP_009386464.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    178   7e-49   
ref|XP_007141921.1|  hypothetical protein PHAVU_008G237200g             179   9e-49   
ref|XP_006390545.1|  hypothetical protein EUTSA_v10019174mg             178   1e-48   
ref|XP_006395863.1|  hypothetical protein EUTSA_v10004986mg             178   1e-48   
ref|XP_003616266.1|  Nudix hydrolase                                    178   1e-48   
gb|KFK33389.1|  hypothetical protein AALP_AA5G006600                    178   2e-48   
emb|CDY17653.1|  BnaA06g34720D                                          177   2e-48   
ref|NP_172939.1|  nudix hydrolase 18                                    177   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004250193.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    178   3e-48   
ref|XP_009101324.1|  PREDICTED: nudix hydrolase 17, mitochondrial       177   3e-48   
ref|XP_006416963.1|  hypothetical protein EUTSA_v10008895mg             177   3e-48   
gb|KHM99173.1|  Nudix hydrolase 17, mitochondrial                       177   5e-48   
ref|XP_010416166.1|  PREDICTED: nudix hydrolase 21, chloroplastic...    177   5e-48   
ref|NP_565273.1|  nudix hydrolase 17                                    176   5e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDP16318.1|  unnamed protein product                                177   6e-48   
ref|XP_002876770.1|  hypothetical protein ARALYDRAFT_904375             176   8e-48   
ref|XP_011035560.1|  PREDICTED: nudix hydrolase 4-like                  176   8e-48   
emb|CDY36247.1|  BnaC07g21010D                                          176   9e-48   
emb|CDY68944.1|  BnaC06g43940D                                          175   1e-47   
ref|XP_009785973.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    176   1e-47   
ref|XP_009117867.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    175   1e-47   
ref|XP_009615821.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    176   2e-47   
ref|XP_006367609.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    174   2e-47   
ref|XP_006290383.1|  hypothetical protein CARUB_v10018090mg             174   2e-47   
ref|XP_004228715.1|  PREDICTED: nudix hydrolase 18, mitochondrial       173   3e-47   
ref|XP_009797085.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    173   4e-47   
emb|CDX82065.1|  BnaC02g22250D                                          174   4e-47   
ref|XP_006352449.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    175   4e-47   
emb|CDY33734.1|  BnaA09g45400D                                          174   5e-47   
gb|AAM66124.1|  unknown                                                 174   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009794972.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    174   6e-47   
ref|XP_010502149.1|  PREDICTED: nudix hydrolase 17, mitochondrial       173   7e-47   
ref|XP_008803888.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    173   7e-47   
ref|XP_010513896.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    173   7e-47   
gb|KFK32951.1|  hypothetical protein AALP_AA6G310700                    173   7e-47   
ref|XP_009106010.1|  PREDICTED: nudix hydrolase 21, chloroplastic...    173   8e-47   
ref|XP_010554408.1|  PREDICTED: nudix hydrolase 18, mitochondrial       172   8e-47   
ref|XP_007032125.1|  Nudix hydrolase                                    173   8e-47   
ref|XP_010917501.1|  PREDICTED: nudix hydrolase 17, mitochondrial       172   1e-46   
ref|XP_008812471.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    172   2e-46   
ref|XP_010926116.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    171   2e-46   
ref|XP_010459002.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    172   2e-46   
ref|XP_006305701.1|  hypothetical protein CARUB_v10010439mg             171   3e-46   
ref|XP_009127996.1|  PREDICTED: nudix hydrolase 21, chloroplastic       172   3e-46   
ref|XP_002890077.1|  hypothetical protein ARALYDRAFT_471677             171   3e-46   
emb|CDY51772.1|  BnaC05g49550D                                          171   4e-46   
emb|CDY58316.1|  BnaA02g16460D                                          171   5e-46   
ref|XP_009619787.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    170   6e-46   
gb|ACJ86058.1|  unknown                                                 171   1e-45   Medicago truncatula
ref|XP_010476561.1|  PREDICTED: nudix hydrolase 18, mitochondrial       170   1e-45   
gb|EPS62936.1|  hypothetical protein M569_11854                         169   2e-45   
ref|XP_009414780.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    169   2e-45   
ref|XP_009148873.1|  PREDICTED: nudix hydrolase 18, mitochondrial       169   3e-45   
emb|CDX81678.1|  BnaC08g39230D                                          168   4e-45   
emb|CDY51777.1|  BnaC05g49600D                                          168   4e-45   
gb|EYU30119.1|  hypothetical protein MIMGU_mgv1a020378mg                167   4e-45   
gb|KHG12612.1|  Nudix hydrolase 4 -like protein                         169   5e-45   
ref|XP_006346759.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    169   5e-45   
gb|KCW48616.1|  hypothetical protein EUGRSUZ_K02281                     168   9e-45   
ref|XP_004236687.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    168   1e-44   
ref|XP_011003749.1|  PREDICTED: nudix hydrolase 4-like                  168   1e-44   
ref|XP_010932566.1|  PREDICTED: nudix hydrolase 17, mitochondrial       165   3e-44   
ref|XP_007036922.1|  Nudix hydrolase, putative                          166   4e-44   
ref|XP_010496591.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    165   6e-44   
gb|KEH34601.1|  nudix hydrolase-like protein                            164   8e-44   
ref|XP_003619857.1|  Nudix hydrolase                                    166   1e-43   
ref|XP_009408403.1|  PREDICTED: nudix hydrolase 17, mitochondrial       164   1e-43   
ref|XP_009386463.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    165   1e-43   
gb|AAP57672.1|  MutT-like protein                                       163   2e-43   Cucumis sativus [cucumbers]
ref|XP_010066576.1|  PREDICTED: nudix hydrolase 17, mitochondrial       163   2e-43   
ref|NP_001048038.1|  Os02g0734300                                       162   5e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010916198.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    162   5e-43   
gb|EAY87426.1|  hypothetical protein OsI_08834                          161   7e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_008460551.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    160   1e-42   
ref|XP_009117868.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    160   3e-42   
ref|XP_008775463.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    160   3e-42   
ref|XP_009419118.1|  PREDICTED: nudix hydrolase 21, chloroplastic...    160   4e-42   
ref|XP_006647851.1|  PREDICTED: nudix hydrolase 21, chloroplastic...    158   1e-41   
ref|XP_009409249.1|  PREDICTED: nudix hydrolase 21, chloroplastic...    157   2e-41   
ref|XP_006828427.1|  hypothetical protein AMTR_s00060p00096990          154   4e-40   
gb|EAZ00395.1|  hypothetical protein OsI_22410                          150   8e-39   Oryza sativa Indica Group [Indian rice]
gb|ACF88368.1|  unknown                                                 150   9e-39   Zea mays [maize]
ref|XP_009391417.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    149   1e-38   
ref|NP_001057309.1|  Os06g0255400                                       149   1e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006843514.1|  hypothetical protein AMTR_s00053p00229450          149   3e-38   
gb|KDO50814.1|  hypothetical protein CISIN_1g029277mg                   148   4e-38   
emb|CDP01643.1|  unnamed protein product                                149   4e-38   
gb|EMS50379.1|  Nudix hydrolase 17, mitochondrial                       150   6e-38   
ref|XP_006430601.1|  hypothetical protein CICLE_v10012837mg             147   6e-38   
ref|XP_002272200.1|  PREDICTED: nudix hydrolase 16, mitochondrial       148   7e-38   Vitis vinifera
ref|XP_009348278.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    148   7e-38   
gb|ABK23596.1|  unknown                                                 149   8e-38   Picea sitchensis
ref|XP_010556716.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    146   1e-37   
gb|EMT05697.1|  Nudix hydrolase 17, mitochondrial                       147   1e-37   
ref|NP_001148660.1|  nudix hydrolase 4                                  146   1e-37   Zea mays [maize]
ref|XP_002454329.1|  hypothetical protein SORBIDRAFT_04g028750          148   2e-37   Sorghum bicolor [broomcorn]
ref|XP_003563991.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    147   2e-37   
ref|XP_006655976.1|  PREDICTED: nudix hydrolase 21, chloroplastic...    146   3e-37   
ref|XP_010673019.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    146   3e-37   
gb|ABR18248.1|  unknown                                                 145   8e-37   Picea sitchensis
ref|XP_008445383.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    144   9e-37   
ref|XP_004953836.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    143   2e-36   
ref|XP_010056034.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    143   2e-36   
ref|XP_010907194.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    144   2e-36   
emb|CDY09425.1|  BnaA02g25850D                                          144   3e-36   
ref|XP_008790962.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    143   4e-36   
ref|XP_006477497.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    143   5e-36   
gb|ACF81097.1|  unknown                                                 141   8e-36   Zea mays [maize]
ref|XP_010931967.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    142   9e-36   
ref|NP_001132303.1|  uncharacterized protein LOC100193744               141   1e-35   Zea mays [maize]
ref|XP_008243118.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    141   3e-35   
dbj|BAJ89150.1|  predicted protein                                      140   3e-35   
ref|XP_009794973.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    140   4e-35   
ref|XP_009384352.1|  PREDICTED: nudix hydrolase 16, mitochondrial       140   6e-35   
ref|XP_010276679.1|  PREDICTED: nudix hydrolase 16, mitochondrial       140   7e-35   
ref|NP_001149038.1|  nudix hydrolase 4                                  139   7e-35   Zea mays [maize]
ref|XP_010458729.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    140   1e-34   
ref|XP_007202583.1|  hypothetical protein PRUPE_ppa011588mg             140   1e-34   
ref|XP_009592925.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    139   1e-34   
ref|XP_009598986.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    139   1e-34   
ref|XP_002513032.1|  diphosphoinositol polyphosphate phosphohydro...    138   2e-34   Ricinus communis
ref|XP_006349581.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    138   2e-34   
gb|KDP40551.1|  hypothetical protein JCGZ_24550                         138   2e-34   
ref|XP_002264026.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    138   2e-34   Vitis vinifera
gb|ADE76466.1|  unknown                                                 138   2e-34   
dbj|BAJ85399.1|  predicted protein                                      137   3e-34   
ref|XP_003570493.1|  PREDICTED: nudix hydrolase 21, chloroplastic...    137   4e-34   
ref|XP_009779345.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    137   4e-34   
gb|EYU45784.1|  hypothetical protein MIMGU_mgv1a015793mg                136   5e-34   
ref|XP_010476266.1|  PREDICTED: nudix hydrolase 12, mitochondrial       137   7e-34   
ref|XP_010067719.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    136   1e-33   
ref|XP_006351370.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    136   1e-33   
ref|XP_004307090.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    135   2e-33   
gb|ABG22503.1|  Nudix hydrolase 13, mitochondrial precursor, puta...    137   2e-33   
ref|XP_004249309.1|  PREDICTED: nudix hydrolase 16, mitochondrial       135   2e-33   
ref|XP_007218492.1|  hypothetical protein PRUPE_ppa012156mg             135   2e-33   
ref|XP_008244669.1|  PREDICTED: nudix hydrolase 16, mitochondrial       135   2e-33   
ref|XP_008797101.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    136   3e-33   
ref|XP_009361878.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    135   3e-33   
ref|XP_001766830.1|  predicted protein                                  135   4e-33   
ref|XP_011000599.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    134   4e-33   
ref|XP_011020420.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    134   5e-33   
ref|NP_001068011.1|  Os11g0531700                                       136   5e-33   
ref|XP_007148919.1|  hypothetical protein PHAVU_005G025200g             134   6e-33   
ref|NP_563919.1|  nudix hydrolase 12                                    135   6e-33   
ref|XP_001765919.1|  predicted protein                                  133   7e-33   
ref|XP_009399737.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    134   8e-33   
ref|XP_008375371.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    134   9e-33   
ref|XP_002303936.1|  hypothetical protein POPTR_0003s19430g             133   1e-32   
gb|EYU20802.1|  hypothetical protein MIMGU_mgv1a021747mg                133   1e-32   
ref|XP_009391416.1|  PREDICTED: nudix hydrolase 17, mitochondrial...    133   2e-32   
ref|XP_009779344.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    132   2e-32   
ref|XP_011079067.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    132   3e-32   
gb|AAF78493.1|AC012187_13  Contains similarity to AP2/EREBP-like ...    138   3e-32   
ref|XP_002436810.1|  hypothetical protein SORBIDRAFT_10g009220          132   4e-32   
ref|XP_002960643.1|  hypothetical protein SELMODRAFT_73964              131   7e-32   
ref|XP_004965160.1|  PREDICTED: nudix hydrolase 21, chloroplastic...    131   7e-32   
ref|XP_011091851.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    131   8e-32   
ref|XP_002889975.1|  hypothetical protein ARALYDRAFT_471441             132   8e-32   
ref|XP_006578426.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    130   9e-32   
ref|XP_010237683.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    132   9e-32   
ref|XP_006417180.1|  hypothetical protein EUTSA_v10008801mg             131   1e-31   
gb|AGW24449.1|  mitochondrion nudix hydrolase 18                        128   1e-31   
gb|KHF98991.1|  Nudix hydrolase 16, mitochondrial -like protein         130   1e-31   
ref|XP_003576011.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    132   2e-31   
ref|XP_008806214.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    130   2e-31   
emb|CDY42157.1|  BnaC05g40620D                                          130   2e-31   
emb|CDY72412.1|  BnaCnng77480D                                          128   2e-31   
ref|XP_008806212.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    130   3e-31   
gb|KDO50816.1|  hypothetical protein CISIN_1g029277mg                   127   3e-31   
ref|XP_009146607.1|  PREDICTED: nudix hydrolase 16, mitochondrial       129   3e-31   
ref|XP_004297574.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    130   4e-31   
ref|XP_003627895.1|  Nudix hydrolase                                    129   4e-31   
emb|CDX98031.1|  BnaA06g07820D                                          129   4e-31   
ref|XP_006298658.1|  hypothetical protein CARUB_v10014749mg             129   4e-31   
ref|XP_002452174.1|  hypothetical protein SORBIDRAFT_04g021190          130   4e-31   
ref|XP_002882782.1|  hypothetical protein ARALYDRAFT_478618             129   5e-31   
emb|CDX98030.1|  BnaA06g07810D                                          129   5e-31   
ref|XP_006662968.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    131   6e-31   
ref|XP_009598985.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    129   6e-31   
ref|XP_003538246.2|  PREDICTED: nudix hydrolase 16, mitochondrial...    128   6e-31   
ref|XP_010066395.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    130   6e-31   
ref|XP_004979394.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    129   1e-30   
ref|XP_010249333.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    129   1e-30   
ref|XP_010465035.1|  PREDICTED: nudix hydrolase 16, mitochondrial       127   1e-30   
ref|XP_010499230.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    127   1e-30   
ref|XP_009135240.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    127   2e-30   
ref|XP_006407316.1|  hypothetical protein EUTSA_v10021582mg             128   2e-30   
ref|XP_006376707.1|  hypothetical protein POPTR_0012s041401g            125   2e-30   
emb|CDY19414.1|  BnaC05g09230D                                          127   2e-30   
ref|XP_008676599.1|  PREDICTED: uncharacterized protein LOC100193...    128   2e-30   
ref|XP_008445385.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    126   2e-30   
ref|XP_008676597.1|  PREDICTED: uncharacterized protein LOC100193...    129   2e-30   
ref|NP_001151121.1|  nudix hydrolase 13                                 128   3e-30   
ref|XP_004979393.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    129   3e-30   
emb|CDY00786.1|  BnaC03g37700D                                          126   3e-30   
ref|NP_001132362.1|  uncharacterized protein LOC100193807               129   3e-30   
gb|AFK43491.1|  unknown                                                 125   3e-30   
emb|CDY50533.1|  BnaA01g30470D                                          126   3e-30   
gb|KFK43557.1|  hypothetical protein AALP_AA1G141900                    127   4e-30   
ref|XP_010907205.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    126   4e-30   
emb|CDY52663.1|  BnaC01g38530D                                          126   5e-30   
gb|ACG42382.1|  nudix hydrolase 13                                      127   5e-30   
ref|XP_003616267.1|  Nudix hydrolase                                    124   5e-30   
ref|XP_010486983.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    126   6e-30   
ref|XP_009120504.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    125   7e-30   
gb|AFW63829.1|  hypothetical protein ZEAMMB73_506654                    128   8e-30   
ref|XP_008445384.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    124   1e-29   
emb|CDX73813.1|  BnaA03g32340D                                          125   2e-29   
gb|EYU40732.1|  hypothetical protein MIMGU_mgv1a016646mg                122   2e-29   
ref|XP_010695949.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    126   2e-29   
ref|XP_010425380.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    125   2e-29   
emb|CBI21254.3|  unnamed protein product                                125   3e-29   
gb|KFK33591.1|  hypothetical protein AALP_AA5G033800                    125   3e-29   
ref|XP_004952594.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    125   3e-29   
gb|KEH23498.1|  nudix hydrolase-like protein                            125   3e-29   
ref|XP_004952595.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    125   4e-29   
ref|XP_002277367.2|  PREDICTED: LOW QUALITY PROTEIN: nudix hydrol...    125   4e-29   
ref|XP_009592926.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    123   5e-29   
ref|XP_008645729.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    124   5e-29   
ref|XP_008445386.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    122   5e-29   
ref|XP_004171454.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    122   6e-29   
ref|XP_007227505.1|  hypothetical protein PRUPE_ppa011441mg             124   6e-29   
ref|XP_002512810.1|  diphosphoinositol polyphosphate phosphohydro...    124   7e-29   
ref|XP_009353496.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    124   7e-29   
emb|CDX83639.1|  BnaC07g23790D                                          123   8e-29   
ref|XP_010250478.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    125   8e-29   
ref|XP_008645728.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    124   8e-29   
ref|XP_003542815.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    122   1e-28   
ref|XP_006468932.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    124   1e-28   
gb|AFK46948.1|  unknown                                                 122   1e-28   
ref|XP_002876987.1|  hypothetical protein ARALYDRAFT_904865             123   1e-28   
ref|XP_008775374.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    122   1e-28   
ref|XP_009339526.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    123   1e-28   
ref|XP_004146804.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    122   1e-28   
ref|XP_010942334.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    122   2e-28   
ref|XP_010514328.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    122   2e-28   
ref|XP_009135239.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    121   2e-28   
ref|XP_009359855.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    123   2e-28   
ref|NP_189303.1|  nudix hydrolase 13                                    122   2e-28   
ref|XP_006446888.1|  hypothetical protein CICLE_v10016552mg             123   3e-28   
ref|XP_007151706.1|  hypothetical protein PHAVU_004G069000g             122   3e-28   
ref|XP_008222273.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    122   3e-28   
ref|XP_009390374.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    122   3e-28   
ref|XP_010528112.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    122   3e-28   
ref|NP_001132204.1|  hypothetical protein                               122   3e-28   
ref|XP_006292498.1|  hypothetical protein CARUB_v10018728mg             122   4e-28   
ref|XP_008673619.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    121   4e-28   
ref|XP_003518149.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    122   4e-28   
ref|XP_010502601.1|  PREDICTED: nudix hydrolase 13, mitochondrial       121   4e-28   
ref|XP_004306324.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    123   5e-28   
gb|KDO63524.1|  hypothetical protein CISIN_1g027123mg                   122   5e-28   
ref|XP_006395533.1|  hypothetical protein EUTSA_v10004929mg             121   5e-28   
ref|XP_003546710.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    120   5e-28   
gb|KHN35308.1|  Nudix hydrolase 16, mitochondrial                       120   5e-28   
ref|XP_010693344.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    120   7e-28   
ref|XP_008369602.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    121   7e-28   
ref|XP_010929495.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    121   8e-28   
ref|XP_009421016.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    120   9e-28   
ref|XP_008231224.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    122   9e-28   
ref|XP_009404728.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    120   9e-28   
ref|XP_010090933.1|  Nudix hydrolase 12                                 122   1e-27   
ref|XP_008657880.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    120   1e-27   
ref|XP_009152032.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    120   1e-27   
ref|NP_001151118.1|  nudix hydrolase 13                                 120   1e-27   
gb|KHN13397.1|  Nudix hydrolase 12, mitochondrial                       121   1e-27   
ref|XP_009404724.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    120   1e-27   
ref|XP_007010920.1|  Nudix hydrolase                                    120   2e-27   
ref|XP_011020913.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    120   2e-27   
gb|AFW84162.1|  hypothetical protein ZEAMMB73_733237                    124   2e-27   
ref|XP_008662023.1|  PREDICTED: nudix hydrolase 13 isoform X2           120   2e-27   
gb|EAY86065.1|  hypothetical protein OsI_07433                          120   2e-27   
ref|XP_011036212.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    119   2e-27   
ref|XP_009421015.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    120   2e-27   
ref|XP_002304633.1|  MutT/nudix family protein                          120   2e-27   
ref|XP_009152031.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    120   2e-27   
ref|XP_002978342.1|  hypothetical protein SELMODRAFT_443838             119   2e-27   
ref|XP_009404186.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    119   3e-27   
ref|NP_001046973.1|  Os02g0520100                                       119   3e-27   
gb|AFK43614.1|  unknown                                                 115   4e-27   
ref|XP_004975471.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    119   4e-27   
ref|XP_009403801.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    119   4e-27   
ref|XP_002461681.1|  hypothetical protein SORBIDRAFT_02g006440          117   6e-27   
ref|XP_004955808.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    117   7e-27   
ref|XP_009403800.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    119   7e-27   
ref|XP_009345170.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    120   8e-27   
ref|XP_002297885.2|  MutT/nudix family protein                          117   1e-26   
gb|KDP41877.1|  hypothetical protein JCGZ_26895                         118   1e-26   
ref|XP_010659097.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    116   1e-26   
ref|XP_008341207.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    119   1e-26   
ref|XP_006647248.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    117   2e-26   
ref|XP_002273187.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    117   2e-26   
ref|XP_006578427.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    116   2e-26   
emb|CBI29280.3|  unnamed protein product                                117   2e-26   
ref|NP_001148611.1|  nudix hydrolase 13                                 116   2e-26   
ref|XP_010239816.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    117   2e-26   
ref|XP_004165780.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    117   3e-26   
ref|XP_011000429.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    115   4e-26   
ref|XP_008365467.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    116   6e-26   
ref|XP_008379037.1|  PREDICTED: nudix hydrolase 13, mitochondrial       117   7e-26   
ref|XP_009372773.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    114   7e-26   
ref|XP_010235475.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    115   7e-26   
ref|XP_004145730.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    117   9e-26   
emb|CDY28534.1|  BnaC02g36260D                                          116   1e-25   
ref|XP_008449983.1|  PREDICTED: nudix hydrolase 13, mitochondrial       115   1e-25   
ref|XP_008354890.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    114   1e-25   
ref|XP_006303345.1|  hypothetical protein CARUB_v10010219mg             115   1e-25   
gb|KHG02250.1|  Nudix hydrolase 16, mitochondrial -like protein         114   1e-25   
gb|KFK43558.1|  hypothetical protein AALP_AA1G141900                    114   1e-25   
ref|XP_010317935.1|  PREDICTED: uncharacterized protein LOC101256458    121   2e-25   
gb|AFK46943.1|  unknown                                                 114   2e-25   
gb|KDP29264.1|  hypothetical protein JCGZ_16653                         113   3e-25   
emb|CDY19413.1|  BnaC05g09220D                                          114   3e-25   
emb|CAN73175.1|  hypothetical protein VITISV_007719                     117   3e-25   
ref|XP_004493101.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    114   4e-25   
emb|CDY48642.1|  BnaCnng16610D                                          112   5e-25   
ref|XP_002446364.1|  hypothetical protein SORBIDRAFT_06g014790          113   5e-25   
ref|NP_566428.1|  nudix hydrolase-like protein 16                       112   6e-25   
ref|XP_004493100.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    114   6e-25   
ref|XP_010547362.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    112   7e-25   
ref|XP_010557873.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    111   1e-24   
ref|XP_003056342.1|  predicted protein                                  111   1e-24   
ref|XP_008351111.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    112   1e-24   
ref|NP_001241033.1|  uncharacterized protein LOC100794003               112   2e-24   
ref|XP_007043743.1|  Nudix hydrolase                                    112   2e-24   
gb|KEH23499.1|  nudix hydrolase-like protein                            112   2e-24   
emb|CDX98029.1|  BnaA06g07800D                                          111   2e-24   
gb|KHN46832.1|  Nudix hydrolase 12, mitochondrial                       112   3e-24   
emb|CDX69633.1|  BnaA10g19820D                                          110   3e-24   
ref|XP_008231223.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    112   4e-24   
dbj|BAJ99925.1|  predicted protein                                      110   4e-24   
ref|XP_008676572.1|  PREDICTED: hypothetical protein isoform X1         111   5e-24   
ref|XP_006487578.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    110   6e-24   
ref|XP_006420826.1|  hypothetical protein CICLE_v10005826mg             110   6e-24   
gb|KGN47761.1|  hypothetical protein Csa_6G401320                       107   7e-24   
ref|XP_009617072.1|  PREDICTED: nudix hydrolase 18, mitochondrial...    108   7e-24   
ref|XP_002512684.1|  diphosphoinositol polyphosphate phosphohydro...    110   8e-24   
gb|KFK38608.1|  hypothetical protein AALP_AA3G136300                    108   9e-24   
emb|CDY48979.1|  BnaA02g28170D                                          109   1e-23   
ref|XP_010534198.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    108   1e-23   
ref|XP_009121756.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    108   1e-23   
gb|KHG16443.1|  Nudix hydrolase 13, mitochondrial -like protein         109   1e-23   
ref|XP_008222274.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    109   2e-23   
ref|XP_009404729.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    108   2e-23   
ref|NP_001147363.1|  LOC100280971                                       108   2e-23   
ref|XP_006844658.1|  hypothetical protein AMTR_s00016p00238370          109   3e-23   
ref|XP_009404727.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    108   3e-23   
ref|XP_009404725.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    108   3e-23   
ref|XP_004981324.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    107   3e-23   
gb|KFK25585.1|  hypothetical protein AALP_AA8G133800                    107   4e-23   
gb|EMS48460.1|  Nudix hydrolase 18, mitochondrial                       107   4e-23   
ref|XP_004511042.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    106   5e-23   
ref|XP_007133744.1|  hypothetical protein PHAVU_011G205700g             106   5e-23   
gb|KHN13422.1|  Nudix hydrolase 16, mitochondrial                       105   6e-23   
ref|XP_007161806.1|  hypothetical protein PHAVU_001G0998001g            107   6e-23   
ref|XP_009404723.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    107   7e-23   
ref|XP_002317859.2|  hypothetical protein POPTR_0012s041401g            103   7e-23   
ref|XP_003548920.1|  PREDICTED: nudix hydrolase 12, mitochondrial...    107   8e-23   
ref|XP_003557388.1|  PREDICTED: nudix hydrolase 16, mitochondrial...    106   8e-23   
ref|XP_009404722.1|  PREDICTED: nudix hydrolase 13, mitochondrial...    108   8e-23   



>ref|XP_004235807.1| PREDICTED: nudix hydrolase 18, mitochondrial-like isoform X1 
[Solanum lycopersicum]
Length=283

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 140/180 (78%), Gaps = 6/180 (3%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M +TK  SM SRTGRDLQRYN  GCRQVVGCIPYRYR+  QS  S + G   +DDLEFLL
Sbjct  1    MAMTKTLSMISRTGRDLQRYN-DGCRQVVGCIPYRYRKTNQS--STVQGTQ-IDDLEFLL  56

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVG--SCLGKWFFKSKSLGVLH  642
            +SSQKSP+ MFPKGGWE DE+LE+AALRETFEE+GV G+VG    LG W FKSKS G  H
Sbjct  57   ISSQKSPKWMFPKGGWETDEALEDAALRETFEESGVVGDVGVQEYLGTWSFKSKSQGTFH  116

Query  643  EGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE  822
            EG M PL+V EEL+DWPEK VR+R W+ + EA EVC+H WMKEALDV  S+LT + ++DE
Sbjct  117  EGHMFPLLVTEELEDWPEKTVRKRLWLKFSEAREVCWHSWMKEALDVFASKLTKRNKDDE  176



>ref|XP_009778792.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Nicotiana 
sylvestris]
Length=269

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 171/272 (63%), Gaps = 19/272 (7%)
 Frame = +1

Query  295   LTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVS  474
             + K  SM SR GRDLQRYN +GCRQVVGCIPYRYRE  QS+    +    +DDLEFLL+S
Sbjct  1     MFKTFSMSSRMGRDLQRYN-EGCRQVVGCIPYRYREANQSSS---NNGTRIDDLEFLLIS  56

Query  475   SQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEV--GSCLGKWFFKSKSLGVLHEG  648
             SQKSPR+MFPKGGWE DESL++AALRETFEEAGV GEV     LG W F+SKS G  HEG
Sbjct  57    SQKSPRVMFPKGGWEIDESLKDAALRETFEEAGVLGEVEVQDYLGTWSFRSKSQGTFHEG  116

Query  649   FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE--  822
              MLPL+V EELDDWPEK  R+R W+ + EA EVC+HPWMKEALDV  S+L  + +E+   
Sbjct  117   HMLPLLVTEELDDWPEKTARRRFWMKFNEAREVCWHPWMKEALDVFASKLAYRNKEEPQT  176

Query  823   ----NEARNGMMRNIELEPSIEILAQGNRKE-ETRMSSGVGESVKRKVEERH-----HHQ  972
                 NE  +  M NI+   + ++  +  R E E    +  G S+    E+          
Sbjct  177   SCPFNELSDKTMTNIDTTVANQMYDEEPRIEAEANPLTCDGPSINPIFEDEQIISTVADS  236

Query  973   LLIEILVSDEPLSIVAQSLHQRNEDPRTSCCS  1068
             + IE L S+E L I   +    NE  R S  +
Sbjct  237   MFIETLFSEE-LGISHVAAPMFNESKRISIIA  267



>ref|XP_010318659.1| PREDICTED: nudix hydrolase 18, mitochondrial-like isoform X2 
[Solanum lycopersicum]
Length=235

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 140/180 (78%), Gaps = 6/180 (3%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M +TK  SM SRTGRDLQRYN  GCRQVVGCIPYRYR+  QS  S + G   +DDLEFLL
Sbjct  1    MAMTKTLSMISRTGRDLQRYN-DGCRQVVGCIPYRYRKTNQS--STVQGTQ-IDDLEFLL  56

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVG--SCLGKWFFKSKSLGVLH  642
            +SSQKSP+ MFPKGGWE DE+LE+AALRETFEE+GV G+VG    LG W FKSKS G  H
Sbjct  57   ISSQKSPKWMFPKGGWETDEALEDAALRETFEESGVVGDVGVQEYLGTWSFKSKSQGTFH  116

Query  643  EGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE  822
            EG M PL+V EEL+DWPEK VR+R W+ + EA EVC+H WMKEALDV  S+LT + ++DE
Sbjct  117  EGHMFPLLVTEELEDWPEKTVRKRLWLKFSEAREVCWHSWMKEALDVFASKLTKRNKDDE  176



>ref|XP_009596753.1| PREDICTED: nudix hydrolase 17, mitochondrial-like isoform X2 
[Nicotiana tomentosiformis]
Length=269

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 154/220 (70%), Gaps = 17/220 (8%)
 Frame = +1

Query  295  LTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVS  474
            + K  SM SR GRDLQRYN +GCRQVVGCIPYRYRE  +S  S  +GA  +DDLEFLL+S
Sbjct  1    MFKTFSMSSRMGRDLQRYN-EGCRQVVGCIPYRYRETNES--SFNNGA-RIDDLEFLLIS  56

Query  475  SQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEV--GSCLGKWFFKSKSLGVLHEG  648
            SQKSPR+MFPKGGWE DESL++AALRETFEEAGV GEV     LG W FKSKS G  HEG
Sbjct  57   SQKSPRVMFPKGGWEIDESLKDAALRETFEEAGVLGEVEVQDYLGTWSFKSKSQGTFHEG  116

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDEN-  825
             MLPL+V EELDDWPEK  R+R W+ + EA EVC+HPWMKEALDV  S+L  + +E+   
Sbjct  117  HMLPLLVTEELDDWPEKTARRRFWMKFNEAREVCWHPWMKEALDVFASKLANRNKEEPQT  176

Query  826  -----EARNGMMRNIELEPSIEILAQGNRKEETRMSSGVG  930
                 E  +  M NI+ E     +A     +ETRM + V 
Sbjct  177  SCPFEELPDKTMTNIDTE-----VANQMYNDETRMEAEVN  211



>ref|XP_009767504.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Nicotiana 
sylvestris]
Length=288

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 139/180 (77%), Gaps = 6/180 (3%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M +TK  SM SRTGRDLQRYN  GCRQVVGCIPYRYR+  QS  S + G   +DDLEFLL
Sbjct  1    MAMTKTLSMISRTGRDLQRYN-DGCRQVVGCIPYRYRKTNQS--STVQGTQ-IDDLEFLL  56

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEV--GSCLGKWFFKSKSLGVLH  642
            +SSQKSPR MFPKGGWE DE+LE+AALRETFEE+GV GEV     LG W FKSKS G  H
Sbjct  57   ISSQKSPRWMFPKGGWETDEALEDAALRETFEESGVIGEVEVQEFLGTWSFKSKSQGTFH  116

Query  643  EGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE  822
            EG M PL+V +ELDDWPEK VR+R W+ + EA EVC+H WMKEALDV  S+LT + +E+E
Sbjct  117  EGHMFPLLVTDELDDWPEKTVRKRLWLKFSEAREVCWHSWMKEALDVFASKLTKRNKEEE  176



>ref|XP_009617424.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=288

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 139/180 (77%), Gaps = 6/180 (3%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M +TK  SM SRTGRDLQRYN  GCRQVVGCIPYRYR+  QS  S + G   +DDLEFLL
Sbjct  1    MAMTKTLSMISRTGRDLQRYN-DGCRQVVGCIPYRYRKTNQS--STVQGTQ-IDDLEFLL  56

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEV--GSCLGKWFFKSKSLGVLH  642
            +SSQKSPR MFPKGGWE DE+LE+AALRETFEE+GV GEV     LG W FKSKS G  H
Sbjct  57   ISSQKSPRWMFPKGGWETDEALEDAALRETFEESGVIGEVEVHEFLGTWNFKSKSQGTFH  116

Query  643  EGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE  822
            EG M PL+V +ELDDWPEK VR+R W+ + EA EVC+H WMKEALDV  S+LT + +E+E
Sbjct  117  EGHMFPLLVTDELDDWPEKTVRKRLWLKFSEAREVCWHSWMKEALDVFASKLTKRNKEEE  176



>ref|XP_006341498.1| PREDICTED: nudix hydrolase 17, mitochondrial-like isoform X1 
[Solanum tuberosum]
Length=283

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 139/180 (77%), Gaps = 6/180 (3%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M +TK  SM SRTGRDLQRYN  GCRQVVGCIPYRYR+  QS  S + G   +DDLEFLL
Sbjct  1    MAMTKTLSMISRTGRDLQRYN-DGCRQVVGCIPYRYRKTNQS--STVQGTQ-IDDLEFLL  56

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYG--EVGSCLGKWFFKSKSLGVLH  642
            +SSQKSP+ MFPKGGWE DE+LE+AALRETFEE+GV G  EV   LG W FKSKS G  H
Sbjct  57   ISSQKSPKWMFPKGGWETDEALEDAALRETFEESGVIGDVEVQEYLGTWSFKSKSQGTFH  116

Query  643  EGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE  822
            +G M PL+V EEL+DWPEK VR+R W+ + EA EVC+H WMKEALDV  S+LT + ++DE
Sbjct  117  QGHMFPLLVTEELEDWPEKTVRKRLWLKFSEAREVCWHSWMKEALDVFASKLTKRNKDDE  176



>ref|XP_006341499.1| PREDICTED: nudix hydrolase 17, mitochondrial-like isoform X2 
[Solanum tuberosum]
Length=235

 Score =   239 bits (610),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 139/180 (77%), Gaps = 6/180 (3%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M +TK  SM SRTGRDLQRYN  GCRQVVGCIPYRYR+  QS  S + G   +DDLEFLL
Sbjct  1    MAMTKTLSMISRTGRDLQRYN-DGCRQVVGCIPYRYRKTNQS--STVQGTQ-IDDLEFLL  56

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYG--EVGSCLGKWFFKSKSLGVLH  642
            +SSQKSP+ MFPKGGWE DE+LE+AALRETFEE+GV G  EV   LG W FKSKS G  H
Sbjct  57   ISSQKSPKWMFPKGGWETDEALEDAALRETFEESGVIGDVEVQEYLGTWSFKSKSQGTFH  116

Query  643  EGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE  822
            +G M PL+V EEL+DWPEK VR+R W+ + EA EVC+H WMKEALDV  S+LT + ++DE
Sbjct  117  QGHMFPLLVTEELEDWPEKTVRKRLWLKFSEAREVCWHSWMKEALDVFASKLTKRNKDDE  176



>ref|XP_009758749.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Nicotiana 
sylvestris]
Length=244

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 138/178 (78%), Gaps = 6/178 (3%)
 Frame = +1

Query  286  EMKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFL  465
            +M++ K  SM SRTGRDLQRYN  GCRQVVGCIPYR ++  Q   S + G P VDDLEFL
Sbjct  53   DMQIKKSFSMSSRTGRDLQRYN-HGCRQVVGCIPYRCKKTDQP--SCVQGTP-VDDLEFL  108

Query  466  LVSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEV--GSCLGKWFFKSKSLGVL  639
            L+SSQK+PRMMFPKGGWE DESLEEAA RETFEEAGV GEV     LG W FKSKS G  
Sbjct  109  LISSQKNPRMMFPKGGWEIDESLEEAASRETFEEAGVVGEVEVQEYLGTWSFKSKSQGTF  168

Query  640  HEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQE  813
            HEG M PL V EELDDWPEK VR+R WV++ EA EVC+HPWMKEALDV  S+L+ ++E
Sbjct  169  HEGHMFPLRVTEELDDWPEKTVRRRLWVNFSEAREVCWHPWMKEALDVFASKLSKRKE  226



>ref|XP_006346639.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Solanum tuberosum]
Length=191

 Score =   232 bits (592),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 138/177 (78%), Gaps = 4/177 (2%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M++ K  SM SRTGRDLQRYN +GCRQVVGCIPYR ++ +  +  +  G+  +DDLEFLL
Sbjct  1    MQIKKSFSMNSRTGRDLQRYN-RGCRQVVGCIPYRSKK-RDPSSCVQQGSTPIDDLEFLL  58

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEV--GSCLGKWFFKSKSLGVLH  642
            +SSQK+PRMMFPKGGWE DESLEEAA RETFEEAGV GEV     LG W FKSKS G+ H
Sbjct  59   ISSQKNPRMMFPKGGWEIDESLEEAASRETFEEAGVVGEVEVQEYLGTWSFKSKSQGIFH  118

Query  643  EGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQE  813
            EG M PL V EELDDWPEK VR+R WV + EA E+C+HPWMKEALDV  S+++ ++E
Sbjct  119  EGHMFPLRVTEELDDWPEKSVRRRLWVKFSEARELCWHPWMKEALDVFASKVSKRKE  175



>ref|XP_004241659.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Solanum lycopersicum]
Length=262

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 138/279 (49%), Positives = 173/279 (62%), Gaps = 23/279 (8%)
 Frame = +1

Query  295   LTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVS  474
             + K  SM SR GRDLQRYN +GCRQVVGCIPYRY    QS  +I       DDLEFLL+S
Sbjct  1     MFKTFSMSSRMGRDLQRYN-EGCRQVVGCIPYRYINSYQSGYNI-------DDLEFLLIS  52

Query  475   SQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVG--SCLGKWFFKSKSLGVLHEG  648
             SQKSPR+MFPKGGWE DESL++AALRETFEEAGV G+V     LG W FKSKS G  HEG
Sbjct  53    SQKSPRLMFPKGGWEIDESLKDAALRETFEEAGVLGDVDVQDYLGTWSFKSKSQGTFHEG  112

Query  649   FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENE  828
              MLPL+V +ELD+WPEK  R+R W+ + EA E+C+HPWMKEALDV  S+L  + +E+   
Sbjct  113   HMLPLLVTQELDEWPEKSARRRLWMKFNEAREICWHPWMKEALDVFASKLAKRNKEEPQT  172

Query  829   ARNGMMRNIELEPSIEILAQGNRK---EETRMSSGVGESVKRKVEERHHHQLLIEILVSD  999
                    + E  P+ +  A  N+    EE RM + V ++     EE     ++  I V D
Sbjct  173   LYPFKELSNEAMPNTDTTAVANQMYNIEEPRMDN-VDQANSLTCEE----PIINPIFVDD  227

Query  1000  EPLSIVAQSLHQRNEDPRTSCCSFEFLRTEEPRMGISLH  1116
                S+  ++L   NED   S  +   L  E+ R+ I  H
Sbjct  228   ---SMFNETLF--NEDLGISHIATTSLFNEDTRISIVAH  261



>ref|XP_009605502.1| PREDICTED: nudix hydrolase 18, mitochondrial-like isoform X1 
[Nicotiana tomentosiformis]
Length=242

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 137/177 (77%), Gaps = 6/177 (3%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M++ K  SM SRTGRDLQRYN  GCRQVVGCIPYR ++  QS  S +   P +DDLEFLL
Sbjct  52   MQIKKSFSMSSRTGRDLQRYN-HGCRQVVGCIPYRCKKTDQS--SCVQRTP-IDDLEFLL  107

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEV--GSCLGKWFFKSKSLGVLH  642
            +SSQK+PRMMFPKGGWE DESLEEAA RETFEEAGV GEV     LG W FKSKS G  H
Sbjct  108  ISSQKNPRMMFPKGGWEIDESLEEAASRETFEEAGVVGEVEVQEYLGTWSFKSKSQGTFH  167

Query  643  EGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQE  813
            EG M PL V EELDDWPEK VR+R WV++ EA EVC+HPWMKEALDV  S+L+ ++E
Sbjct  168  EGHMFPLRVTEELDDWPEKTVRRRLWVNFSEAREVCWHPWMKEALDVFASKLSKRKE  224



>ref|XP_006365415.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Solanum tuberosum]
Length=256

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 172/276 (62%), Gaps = 29/276 (11%)
 Frame = +1

Query  313   MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
             M SR GRDLQRYN +GCRQVVGCIPYRY    QS  +I       DDLEFLL+SSQKSPR
Sbjct  1     MSSRMGRDLQRYN-EGCRQVVGCIPYRYINSYQSGYNI-------DDLEFLLISSQKSPR  52

Query  493   MMFPKGGWEQDESLEEAALRETFEEAGVYGEVG--SCLGKWFFKSKSLGVLHEGFMLPLI  666
             +MFPKGGWE DESL++AALRETFEEAGV G+V     LG W FKSKS G  HEG MLPL+
Sbjct  53    LMFPKGGWEIDESLKDAALRETFEEAGVLGDVDVQDYLGTWSFKSKSQGTFHEGHMLPLL  112

Query  667   VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE------NE  828
             V +ELD+WPEK  R+R W+ + EA E+C+HPWMKEALDV  S+L  + +E+        E
Sbjct  113   VTQELDEWPEKSARRRLWMKFNEAREICWHPWMKEALDVFASKLAKRNKEEPQTLYPFKE  172

Query  829   ARNGMMRNIELEPSIEILAQGNRKEETRMSSGVGESVKRKVEERHHHQLLIEILVSDEPL  1008
               N +M NI+   +  +  Q    EE RM + V ++     EE     ++  I V D   
Sbjct  173   LSNVVMPNID---TTAVANQMYNIEEPRMDN-VDQANPLTCEE----PIINPIFVDD---  221

Query  1009  SIVAQSLHQRNEDPRTSCCSFEFLRTEEPRMGISLH  1116
             S+  ++L   NED   S  +   L  E+ R+ I  H
Sbjct  222   SMFNETLF--NEDLGISHIATTSLFNEDTRISIVAH  255



>ref|XP_010314229.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Solanum lycopersicum]
Length=192

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 134/177 (76%), Gaps = 3/177 (2%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M++ K  SM SRTGRDLQRYN +GCRQVVGCIPYR  +   S+      +  +DDLEFLL
Sbjct  1    MQIKKSFSMNSRTGRDLQRYN-RGCRQVVGCIPYRSIKRDPSSCVQQGSSTPIDDLEFLL  59

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVG--SCLGKWFFKSKSLGVLH  642
            +SSQK+PRMMFPKGGWE DESLEEAA RETFEEAGV GEV     LG W FKSKS G  H
Sbjct  60   ISSQKNPRMMFPKGGWEIDESLEEAASRETFEEAGVVGEVQVQEYLGTWSFKSKSQGTFH  119

Query  643  EGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQE  813
            EG M PL V EELDDWPEK VR+R WV + EA EVC+HPWMKEALDV  S+++ ++E
Sbjct  120  EGHMFPLRVTEELDDWPEKSVRRRLWVKFSEAREVCWHPWMKEALDVFASKMSKRKE  176



>ref|XP_009596747.1| PREDICTED: nudix hydrolase 17, mitochondrial-like isoform X1 
[Nicotiana tomentosiformis]
Length=285

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 152/236 (64%), Gaps = 33/236 (14%)
 Frame = +1

Query  295  LTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVS  474
            + K  SM SR GRDLQRYN +GCRQVVGCIPYRYRE  +S+    +    +DDLEFLL+S
Sbjct  1    MFKTFSMSSRMGRDLQRYN-EGCRQVVGCIPYRYRETNESS---FNNGARIDDLEFLLIS  56

Query  475  SQKSPRMMFPK----------------GGWEQDESLEEAALRETFEEAGVYGEV--GSCL  600
            SQKSPR+MFPK                GGWE DESL++AALRETFEEAGV GEV     L
Sbjct  57   SQKSPRVMFPKEVTGSSHENSLLQKCRGGWEIDESLKDAALRETFEEAGVLGEVEVQDYL  116

Query  601  GKWFFKSKSLGVLHEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALD  780
            G W FKSKS G  HEG MLPL+V EELDDWPEK  R+R W+ + EA EVC+HPWMKEALD
Sbjct  117  GTWSFKSKSQGTFHEGHMLPLLVTEELDDWPEKTARRRFWMKFNEAREVCWHPWMKEALD  176

Query  781  VLVSQLTLQQEEDEN------EARNGMMRNIELEPSIEILAQGNRKEETRMSSGVG  930
            V  S+L  + +E+        E  +  M NI+ E     +A     +ETRM + V 
Sbjct  177  VFASKLANRNKEEPQTSCPFEELPDKTMTNIDTE-----VANQMYNDETRMEAEVN  227



>ref|XP_009605507.1| PREDICTED: nudix hydrolase 18, mitochondrial-like isoform X2 
[Nicotiana tomentosiformis]
Length=205

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 127/163 (78%), Gaps = 6/163 (4%)
 Frame = +1

Query  331  RDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMMFPKG  510
            RDLQRYN  GCRQVVGCIPYR ++  QS  S +   P +DDLEFLL+SSQK+PRMMFPKG
Sbjct  29   RDLQRYN-HGCRQVVGCIPYRCKKTDQS--SCVQRTP-IDDLEFLLISSQKNPRMMFPKG  84

Query  511  GWEQDESLEEAALRETFEEAGVYGEV--GSCLGKWFFKSKSLGVLHEGFMLPLIVLEELD  684
            GWE DESLEEAA RETFEEAGV GEV     LG W FKSKS G  HEG M PL V EELD
Sbjct  85   GWEIDESLEEAASRETFEEAGVVGEVEVQEYLGTWSFKSKSQGTFHEGHMFPLRVTEELD  144

Query  685  DWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQE  813
            DWPEK VR+R WV++ EA EVC+HPWMKEALDV  S+L+ ++E
Sbjct  145  DWPEKTVRRRLWVNFSEAREVCWHPWMKEALDVFASKLSKRKE  187



>emb|CDO98317.1| unnamed protein product [Coffea canephora]
Length=257

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 145/212 (68%), Gaps = 6/212 (3%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M++ K+ SM SRTGRDLQRYN +GCRQVVGCIPYR+R+  ++A   +HG  L  +LEFLL
Sbjct  1    MQIKKLVSMPSRTGRDLQRYNFEGCRQVVGCIPYRFRKTHRAAP--VHGK-LSSELEFLL  57

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQKSPRMMFPKGGWE DE++E+AA+RET EEAGV G V   LG W FKSKS    HEG
Sbjct  58   ISSQKSPRMMFPKGGWELDETIEQAAMRETMEEAGVLGHVEDNLGVWTFKSKSQDASHEG  117

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENE  828
             ML   V EELD WPEKDVRQR W+S  EA  +C H WMKEALD  +S+    +EE    
Sbjct  118  HMLAFRVTEELDCWPEKDVRQRIWLSANEARILCAHEWMKEALDCFLSKQENAREE-RTP  176

Query  829  ARNGMMRNIELEPSIEILAQGNRKEETRMSSG  924
            + + ++RN   EP     A   + E+   S G
Sbjct  177  SLSDLLRN--EEPKFGRPALSGQNEDINCSFG  206



>ref|XP_011073590.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Sesamum indicum]
Length=210

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 138/199 (69%), Gaps = 6/199 (3%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M++ K+ S  SR+GR +QRYN QG RQVVGC+PYR R+  +S    IHG  LV+DLE LL
Sbjct  3    MQIKKLASSPSRSGRHMQRYN-QGFRQVVGCVPYRIRKTNESPE--IHGT-LVEDLEVLL  58

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQKS RMMFPKGGWE DE +E AA RET EEAGV G +G  LG+W FKSKS    HE 
Sbjct  59   ISSQKSQRMMFPKGGWELDEDIELAASRETLEEAGVVGLLGDKLGEWIFKSKSQEKFHEA  118

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQ--EEDE  822
            FM  L+V EELD WPEKD+RQR W++  EA EVC H WMKEAL+  VSQ T QQ  E+D 
Sbjct  119  FMFSLLVTEELDVWPEKDLRQRVWMTVNEAREVCAHSWMKEALEAFVSQFTPQQRVEDDP  178

Query  823  NEARNGMMRNIELEPSIEI  879
               R  + R  EL  SI +
Sbjct  179  LSCRLELCRTEELRLSIGV  197



>ref|XP_002282941.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Vitis vinifera]
Length=213

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 135/185 (73%), Gaps = 10/185 (5%)
 Frame = +1

Query  286  EMKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFL  465
            ++K  K+ S+ SRTGR  QRYN QGCRQVVGCIPYRY+  K+S      GAP +++LE L
Sbjct  35   KLKNQKMVSIVSRTGRQFQRYN-QGCRQVVGCIPYRYKTDKES-----DGAP-IEELEVL  87

Query  466  LVSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHE  645
            +VSSQK   M+FPKGGWE DES+EEAA RET EEAGV G VG  LGKW FKSKS G   E
Sbjct  88   VVSSQKGKGMLFPKGGWEIDESIEEAATRETLEEAGVLGNVGCKLGKWSFKSKSRGTFDE  147

Query  646  GFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQE---E  816
            G+M PL+V E+LD WPEK+VRQR W++  EA EVC H WMKEALD+L+ +L   QE   E
Sbjct  148  GYMFPLLVKEQLDFWPEKNVRQRRWMAASEAREVCQHWWMKEALDILIQRLMNGQEKGVE  207

Query  817  DENEA  831
            DE  +
Sbjct  208  DETPS  212



>gb|EYU21840.1| hypothetical protein MIMGU_mgv1a013711mg [Erythranthe guttata]
Length=212

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 142/222 (64%), Gaps = 17/222 (8%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M++ K+ S  SR GR LQRYN QG R VVGCIPYR R+   S    IHG  L++DLE LL
Sbjct  3    MQIKKLASSPSRAGRHLQRYN-QGFRLVVGCIPYRIRKNNNSP--TIHGT-LIEDLEVLL  58

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQKSPRMMFPKGGWE DE +E AA RET EEAGV G++G  LG+W FKSKS    HEG
Sbjct  59   ISSQKSPRMMFPKGGWELDEDIELAASRETLEEAGVIGDIGDKLGEWVFKSKSQEKYHEG  118

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENE  828
             M  L+V EELD WPEKDVRQR W+S  EA EVC H WMKEALD  V Q   +Q      
Sbjct  119  SMFSLLVTEELDVWPEKDVRQRVWMSVEEAREVCAHSWMKEALDAFVCQFNPRQ------  172

Query  829  ARNGMMRNIELEPSIEILAQGNRKEETRMSSGVGESVKRKVE  954
                  R +E EP      +  R +E R+S G G+S    V+
Sbjct  173  ------RVVEEEPLASCRLELCRTDELRLSIG-GQSADEDVD  207



>emb|CBI15601.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 129/175 (74%), Gaps = 10/175 (6%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            S+ SRTGR  QRYN QGCRQVVGCIPYRY+  K+S      GAP +++LE L+VSSQK  
Sbjct  3    SIVSRTGRQFQRYN-QGCRQVVGCIPYRYKTDKES-----DGAP-IEELEVLVVSSQKGK  55

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             M+FPKGGWE DES+EEAA RET EEAGV G VG  LGKW FKSKS G   EG+M PL+V
Sbjct  56   GMLFPKGGWEIDESIEEAATRETLEEAGVLGNVGCKLGKWSFKSKSRGTFDEGYMFPLLV  115

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQE---EDEN  825
             E+LD WPEK+VRQR W++  EA EVC H WMKEALD+L+ +L   QE   EDE 
Sbjct  116  KEQLDFWPEKNVRQRRWMAASEAREVCQHWWMKEALDILIQRLMNGQEKGVEDET  170



>ref|XP_011083132.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Sesamum indicum]
Length=208

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 137/199 (69%), Gaps = 10/199 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M++ K+ S+ SRTGR LQRYN QG RQVVGCIPYR RE  +S+  I     L++DLE LL
Sbjct  1    MQIKKLVSLPSRTGRHLQRYN-QGFRQVVGCIPYRIRETNKSSYGI-----LIEDLEVLL  54

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            ++SQKSPRMMFPKGGWE DE++E AA RET EEAGV G +G  LG+W FKSKS    HEG
Sbjct  55   ITSQKSPRMMFPKGGWELDENIELAASRETLEEAGVVGLLGEKLGEWIFKSKSQEKFHEG  114

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT----LQQEE  816
             M PL+V EELD WPEK+VRQR W++  EA E C   WMKEAL+  V Q T    L++E+
Sbjct  115  SMFPLLVTEELDVWPEKNVRQRIWMTINEAREACSQLWMKEALEAFVGQFTPRPRLEEEQ  174

Query  817  DENEARNGMMRNIELEPSI  873
                 R  + R  E+  SI
Sbjct  175  LATSCRLALCRAEEIRLSI  193



>emb|CAN72000.1| hypothetical protein VITISV_032712 [Vitis vinifera]
Length=472

 Score =   216 bits (549),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 142/211 (67%), Gaps = 16/211 (8%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            S+ SRTGR  QRYN QGCRQVVGCIPYRY+  K+S      GAP +++LE L+VSSQK  
Sbjct  3    SIVSRTGRQFQRYN-QGCRQVVGCIPYRYKTDKES-----DGAP-IEELEVLVVSSQKGK  55

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             M+FPKGGWE DES+EEAA RET EEAGV G VG  LGKW FKSKS G   EG+M PL+V
Sbjct  56   GMLFPKGGWEIDESIEEAATRETLEEAGVLGNVGCKLGKWSFKSKSRGTFDEGYMFPLLV  115

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEARNGMMR  849
             E+LD WPEK+VRQR W++  EA EVC H WMKEALD+L+ +L   QE+       G+M 
Sbjct  116  KEQLDFWPEKNVRQRRWMAASEAREVCQHWWMKEALDILIQRLMNGQEK-------GVME  168

Query  850  NIELEPSIEILAQGNR--KEETRMSSGVGES  936
             + LE     L +  R  K  T+ S   G S
Sbjct  169  RVTLENPNRPLERFKRTKKNPTKTSDDSGGS  199



>gb|EYU24510.1| hypothetical protein MIMGU_mgv1a013935mg [Erythranthe guttata]
Length=206

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 133/195 (68%), Gaps = 4/195 (2%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M++ K+  + SRTGR LQRYN QG RQVVGCIPYR R+  +S   ++HG  L++DLE LL
Sbjct  1    MQIKKLVVLPSRTGRHLQRYN-QGFRQVVGCIPYRIRKSNKS--HLLHGT-LLEDLEVLL  56

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            ++SQKSPRMMFPKGGWE DE++E AA RET EEAGV G +G  LG+W FKSKS    HEG
Sbjct  57   ITSQKSPRMMFPKGGWELDENIELAASRETLEEAGVVGMLGDKLGEWIFKSKSQEKFHEG  116

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENE  828
             M PL+V EELD WPEK VR+R W++  EA E C   WMKEALD  V Q    +EE    
Sbjct  117  SMFPLLVTEELDVWPEKSVRRRIWMTVSEAKEACAAAWMKEALDAFVCQFKRVEEEQLTS  176

Query  829  ARNGMMRNIELEPSI  873
             R    R+ +L   I
Sbjct  177  CRLASCRSEDLRLCI  191



>ref|XP_011085849.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Sesamum indicum]
Length=180

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 135/186 (73%), Gaps = 10/186 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDD--LEF  462
            M+L  + ++ SRTGR LQRYN  G RQVVGCIPYRY+       S +  +P+VD+  +E 
Sbjct  1    MELKNMVTLVSRTGRHLQRYNFHGHRQVVGCIPYRYK-------SNLGTSPMVDEEEIEV  53

Query  463  LLVSSQKSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVL  639
            L+++SQ+  + M+FPKGGWE+DES+E+AALRET EEAGV G+V   LGKW FKSK+    
Sbjct  54   LVITSQRKGKGMLFPKGGWEKDESIEDAALRETVEEAGVVGDVEHKLGKWNFKSKNNDTC  113

Query  640  HEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEED  819
            +EG M PL+V E+L+ WPEKDVRQR WVS REA ++C + WMKEAL++LVS+LT Q   D
Sbjct  114  YEGHMFPLLVKEQLEFWPEKDVRQRLWVSVREARKMCQYWWMKEALELLVSRLTAQANVD  173

Query  820  ENEARN  837
            +    N
Sbjct  174  QGRKSN  179



>gb|KHG02671.1| Nudix hydrolase 18, mitochondrial -like protein [Gossypium arboreum]
Length=182

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 129/172 (75%), Gaps = 9/172 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            M SRTGR LQRY+  G RQVVGCIPYRY+    S G+      + DDLE L++SSQK  +
Sbjct  4    MVSRTGRHLQRYDNLGRRQVVGCIPYRYKSS--SDGT------MTDDLEVLVISSQKCQK  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            MMFPKGGWE DES EEAALRE+ EEAGV G V   LGKW F SKS G  +EG+M PL+V 
Sbjct  56   MMFPKGGWELDESREEAALRESLEEAGVRGNVECELGKWDFMSKSHGTFYEGYMFPLLVK  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQL-TLQQEEDEN  825
            EELD WPE+++RQR+W++ +EA +VC H WMKEALD+LV +L +L+Q+ ++N
Sbjct  116  EELDFWPEQNLRQRTWMNVKEARDVCQHWWMKEALDILVERLNSLKQQNEQN  167



>ref|XP_006574813.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Glycine max]
 gb|KHN15447.1| Nudix hydrolase 17, mitochondrial [Glycine soja]
Length=165

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 124/169 (73%), Gaps = 8/169 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            M SRTGR++QRYN  G RQVVGCIPYRY+E   S G++       ++LE L+VSSQKS  
Sbjct  4    MVSRTGREMQRYNSSGGRQVVGCIPYRYKE--DSDGNV------SNELEVLMVSSQKSQA  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G V   LG+W F SK  G  +EG M PL+V 
Sbjct  56   LMFPKGGWELDESVEEAACRESLEEAGVTGFVQHELGQWSFISKRHGTYYEGHMFPLLVE  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEED  819
            E+LD WPEKD+R+R W+S  EA EVC H WMKEALD+LV +LTLQQ  +
Sbjct  116  EQLDSWPEKDLRRRIWMSVNEAREVCQHWWMKEALDILVERLTLQQNRN  164



>gb|KDO60742.1| hypothetical protein CISIN_1g030372mg [Citrus sinensis]
Length=178

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 129/172 (75%), Gaps = 10/172 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK-SP  489
            + SRTGR LQRY+  G RQVVGC+PYRY+ G   AG++      VDD+E L+++SQK S 
Sbjct  6    LVSRTGRQLQRYDNMGRRQVVGCVPYRYKTG-DGAGNV------VDDIEVLVITSQKGSQ  58

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DE+++EAALRE+FEEAGV G V   LGKW F SKS G  +EG+M PL+V
Sbjct  59   GMMFPKGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLV  118

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT--LQQEED  819
             E+L+ WPEKDVRQR W+S  EA E C H WMKEALD+LV +L+  +QQ+E+
Sbjct  119  TEQLELWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVERLSSRVQQKEE  170



>ref|XP_007153255.1| hypothetical protein PHAVU_003G019800g [Phaseolus vulgaris]
 gb|ESW25249.1| hypothetical protein PHAVU_003G019800g [Phaseolus vulgaris]
Length=165

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 126/169 (75%), Gaps = 8/169 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR++QRYN  G RQVVGCIPYRY+E  +S G++       ++LE LLVSSQK   
Sbjct  4    LVSRTGREMQRYNSSGGRQVVGCIPYRYKE--ESDGNV------SNELEVLLVSSQKGQA  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G V   LG+W F SK  G  +EG M PL+V 
Sbjct  56   LMFPKGGWELDESIEEAAYRESLEEAGVTGIVEHELGEWSFMSKRHGTYYEGHMFPLLVK  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEED  819
            EELD WPEKD+R+R+W+S  EA EVC H WMKEALD+LV +LTLQ+ ++
Sbjct  116  EELDLWPEKDLRRRTWMSVDEAGEVCQHWWMKEALDILVERLTLQKNKN  164



>ref|XP_010091723.1| Nudix hydrolase 18 [Morus notabilis]
 gb|EXB45086.1| Nudix hydrolase 18 [Morus notabilis]
Length=235

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 136/187 (73%), Gaps = 12/187 (6%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            SM SR+GR LQRY+ +GCRQVVGCIPYRY +  + +         V++LE L++SSQK  
Sbjct  3    SMVSRSGRHLQRYD-EGCRQVVGCIPYRYTKTDEFSS--------VEELEVLVISSQKGQ  53

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DES+E+AALRET EEAGV G V   LGKW +KSK  G+LHEG+M P+ V
Sbjct  54   GMMFPKGGWEVDESMEDAALRETLEEAGVRGIVERRLGKWRYKSKRGGILHEGYMFPMRV  113

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLV---SQLTLQQEEDENEARNG  840
             E+LD WPEKD+R+R W+S  +A EVC H WMKEALD LV   +QL  ++E+DE    +G
Sbjct  114  QEQLDLWPEKDLRKRRWMSVAQAREVCQHLWMKEALDELVRRQTQLKQKEEKDETTTCSG  173

Query  841  MMRNIEL  861
            ++R+ ++
Sbjct  174  LVRSPKI  180



>ref|XP_007045255.1| Nudix hydrolase [Theobroma cacao]
 gb|EOY01087.1| Nudix hydrolase [Theobroma cacao]
Length=175

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 130/173 (75%), Gaps = 10/173 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR LQRY+  G RQVVGCIPYR++    S G+I       DDLE L++SSQK  +
Sbjct  4    LVSRTGRHLQRYDDLGRRQVVGCIPYRFK--CSSDGTI------SDDLEVLVISSQKGQK  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            MMFPKGGWE DES EEAALRE+ EEAGV G V   LG+W F SKS G  +EG+M PL+V 
Sbjct  56   MMFPKGGWEVDESREEAALRESVEEAGVLGSVECELGRWNFISKSHGTFYEGYMFPLLVK  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT--LQQEEDEN  825
            EELD WPE++VRQR+W++ +EA +VC H WMKEALD+LV +LT  LQQ++++N
Sbjct  116  EELDLWPEQNVRQRAWLNVKEARDVCQHWWMKEALDILVERLTSSLQQQKEQN  168



>ref|XP_006469321.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Citrus sinensis]
Length=272

 Score =   201 bits (510),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 129/172 (75%), Gaps = 10/172 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK-SP  489
            + SRTGR LQRY+  G RQVVGC+PYRY+ G   AG++      VDD+E L+++SQK S 
Sbjct  100  LVSRTGRQLQRYDNMGRRQVVGCVPYRYKTG-DGAGNV------VDDIEVLVITSQKGSQ  152

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DE+++EAALRE+FEEAGV G V   LGKW F SKS G  +EG+M PL+V
Sbjct  153  GMMFPKGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLV  212

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT--LQQEED  819
             E+L+ WPEKDVRQR W+S  EA E C H WMKEALD+LV +L+  +QQ+E+
Sbjct  213  TEQLELWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVERLSSRVQQKEE  264



>gb|KHG14906.1| Nudix hydrolase 18, mitochondrial -like protein [Gossypium arboreum]
Length=172

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 126/172 (73%), Gaps = 9/172 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR LQRY+  G RQVVGCIPYRY+  + S G+      L  DLE L++SSQK  +
Sbjct  4    LVSRTGRHLQRYDALGRRQVVGCIPYRYK--RNSDGT------LSTDLEVLVISSQKCQK  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            MMFPKGGWE DES E+AALRE+ EEAGV G V   LGKW F SK  G  +EG+M PL+V 
Sbjct  56   MMFPKGGWELDESKEQAALRESVEEAGVRGNVECELGKWDFMSKRYGTFYEGYMFPLLVK  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT-LQQEEDEN  825
            EEL  WPE++VRQR+W+S +EA +VC H WMKEALD+LV +LT LQQ + +N
Sbjct  116  EELALWPEQNVRQRTWMSVKEARDVCQHWWMKEALDILVERLTSLQQHKGQN  167



>ref|XP_010270959.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Nelumbo nucifera]
Length=195

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 121/163 (74%), Gaps = 3/163 (2%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            ++ SRTGR+ QRY+ +G RQVVGCIPYRY+ GK  +   +  +    DLE LL+SSQKS 
Sbjct  3    ALVSRTGREFQRYDDEGRRQVVGCIPYRYKTGKSPSHEAMDDS---QDLEVLLISSQKSH  59

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             M+FPKGGWE DES++EAA RET EEAGV G V S LGKWFFKSKS   ++EG+M PL+V
Sbjct  60   AMLFPKGGWEMDESMKEAAKRETMEEAGVEGNVESQLGKWFFKSKSHDAIYEGYMFPLLV  119

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQL  798
             ++LD WPEK VRQR W++  EA EVC   WMKEALD LV +L
Sbjct  120  EKQLDIWPEKHVRQRKWMTVDEAREVCQPLWMKEALDRLVRRL  162



>ref|XP_003528327.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Glycine max]
Length=165

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 121/169 (72%), Gaps = 8/169 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR++QRYN  G RQVVGCIPYRY+E      S        ++LE L+VSSQK   
Sbjct  4    LMSRTGREMQRYNSSGGRQVVGCIPYRYKEDNDGNVS--------NELEVLVVSSQKGQA  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G V   LG+W F SK LG  +EG M PL+V 
Sbjct  56   LMFPKGGWELDESVEEAASRESLEEAGVTGIVQHELGQWSFISKRLGTYYEGHMFPLLVK  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEED  819
            E+LD WPEKD+R+R W+S  EA EVC H WMKEALD+LV +LTLQ+  +
Sbjct  116  EQLDLWPEKDLRRRIWMSINEAREVCQHWWMKEALDILVERLTLQKNRN  164



>ref|XP_003532546.1| PREDICTED: nudix hydrolase 4-like [Glycine max]
 gb|KHN00135.1| Nudix hydrolase 4 [Glycine soja]
Length=229

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 125/169 (74%), Gaps = 13/169 (8%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRY-REGKQSAGSIIHGAPLVDDLEFLL  468
            +L  +  + +RTGR LQRY+  GCRQVVGCIPYRY R+G Q+            +LE L+
Sbjct  28   QLDNMMCLVARTGRHLQRYD-DGCRQVVGCIPYRYKRKGSQN-----------KELEVLV  75

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +S+QK   M FPKGGWE DES+E+AALRET EEAGV G V S LGKWF+KSK    +HEG
Sbjct  76   ISAQKGNGMQFPKGGWESDESMEQAALRETIEEAGVVGNVESKLGKWFYKSKRQDTMHEG  135

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            +M PL+V ++L++WPEK++R+R+W++  EA + C HPWMKEALDVLVS+
Sbjct  136  YMFPLLVKKQLENWPEKNIRKRTWMTIDEAKQACPHPWMKEALDVLVSR  184



>ref|XP_004140308.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Cucumis sativus]
 ref|XP_004171757.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Cucumis sativus]
 gb|KGN51037.1| MutT-like protein [Cucumis sativus]
Length=185

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 124/174 (71%), Gaps = 6/174 (3%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            S+ SRTGR LQRY+++G RQVVGCIPYRY+  K+S    I      ++LE L++SSQK  
Sbjct  12   SLVSRTGRHLQRYDIRGRRQVVGCIPYRYKTTKKSTLDNI------EELEVLVISSQKGK  65

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             M+FPKGGWE DES+ EAA RET EEAGV G V   LG W FKSK+    +EG+M PL+V
Sbjct  66   GMLFPKGGWETDESITEAASRETLEEAGVRGIVQGELGSWSFKSKTYDTFYEGYMFPLLV  125

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
             E+L+ WPEK+ RQR W+S  EA EVC H WMKEALD+LV +L+ Q+++   E 
Sbjct  126  KEQLEFWPEKNFRQRVWMSAHEAREVCQHWWMKEALDILVGRLSSQKKQQMEEV  179



>ref|XP_009370557.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Pyrus x bretschneideri]
Length=192

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 128/187 (68%), Gaps = 12/187 (6%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDD---LEFLLVS  474
            V ++ SRTGR +QRY  +G RQVVGCIPYRY+  KQ+        PL +D   LE L++S
Sbjct  11   VAALVSRTGRHMQRYR-KGHRQVVGCIPYRYKASKQT--------PLKNDAQELEVLVIS  61

Query  475  SQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFM  654
            SQK   M+FPKGGWE DES E AA RET EEAGV G V   LGKW FKSKS    +EG+M
Sbjct  62   SQKGKGMLFPKGGWELDESKEGAAERETLEEAGVRGLVERELGKWIFKSKSHDSQYEGYM  121

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEAR  834
             PL+V E+LD WPEK++RQR W+S  EA EVC H WMKEALD LVS+LT QQ++D+    
Sbjct  122  FPLLVQEQLDFWPEKNLRQRVWMSVEEASEVCQHWWMKEALDRLVSRLTTQQQKDQGPVL  181

Query  835  NGMMRNI  855
                 N+
Sbjct  182  KSRKENL  188



>gb|KHN17955.1| Nudix hydrolase 17, mitochondrial [Glycine soja]
Length=211

 Score =   196 bits (497),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 129/170 (76%), Gaps = 6/170 (4%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR+LQRY  +G RQVVGCIPYR++ G++++  ++      D+LE L++SSQK
Sbjct  10   VAALVSRTGRELQRYR-KGRRQVVGCIPYRFKIGEKTSLDVVS-----DELEVLVISSQK  63

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES +EAALRET EEAGV G VG  LGKW FKSK+    +EG+M PL
Sbjct  64   GKGMLFPKGGWELDESKKEAALRETMEEAGVRGIVGGKLGKWSFKSKTHDTFYEGYMFPL  123

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQE  813
            +V E+L+ WPE++VRQR W+S  EA EVC H WMKEALD LV++L+ Q++
Sbjct  124  LVQEQLEFWPEQNVRQRIWMSVTEAREVCQHWWMKEALDRLVNRLSGQKQ  173



>ref|XP_009370056.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Pyrus x bretschneideri]
Length=191

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 125/173 (72%), Gaps = 12/173 (7%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDD---LEFLLVS  474
            V ++ +RTGR LQRY+ +G RQVVGCIPYRY+  KQ+        PL DD   LE L++S
Sbjct  11   VTALVARTGRHLQRYS-KGRRQVVGCIPYRYKASKQT--------PLKDDAQELEVLVIS  61

Query  475  SQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFM  654
            SQK   M+FPKGGWEQDES E AA RET EEAGV G +G  LGKW FKSKS    +EG+M
Sbjct  62   SQKGKGMLFPKGGWEQDESKEGAASRETLEEAGVRGLIGCELGKWSFKSKSHDSDYEGYM  121

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQE  813
             PL+V E+LD WPEK++RQR W++  EA EVC H WMKEALD LV +LT QQ+
Sbjct  122  FPLLVQEQLDFWPEKNLRQRIWMNVEEAREVCQHWWMKEALDRLVYRLTQQQK  174



>ref|XP_010107626.1| Nudix hydrolase 17 [Morus notabilis]
 gb|EXC16428.1| Nudix hydrolase 17 [Morus notabilis]
Length=175

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 122/171 (71%), Gaps = 11/171 (6%)
 Frame = +1

Query  319  SRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMM  498
            SRTGR+LQRYN  G RQVVGCIPYRY+ G   A        + ++LE L++SSQK   +M
Sbjct  6    SRTGRELQRYNHMGRRQVVGCIPYRYKNGNDGA--------MCNELEVLVISSQKGQGLM  57

Query  499  FPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEE  678
            FPKGGWE DES+EEAA RE+ EEAGV G V   LG W F SKS G  +EG+M PL+V E+
Sbjct  58   FPKGGWELDESVEEAASRESLEEAGVLGNVECQLGNWSFISKSRGTYYEGYMFPLLVKEQ  117

Query  679  LDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT---LQQEEDE  822
            LD WPEK+VR+R W++  EA EVC H WMKEALD+LV +L+    Q +EDE
Sbjct  118  LDLWPEKNVRRRIWMTAAEAREVCQHWWMKEALDILVERLSSPKKQHKEDE  168



>ref|XP_006448175.1| hypothetical protein CICLE_v10016278mg [Citrus clementina]
 gb|ESR61415.1| hypothetical protein CICLE_v10016278mg [Citrus clementina]
Length=266

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 129/172 (75%), Gaps = 10/172 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK-SP  489
            + SRTGR LQRY+  G RQVVGC+PYRY+ G   AG++      VDD+E L+++SQK S 
Sbjct  94   LVSRTGRQLQRYDNMGRRQVVGCVPYRYKTG-DGAGNV------VDDIEVLVITSQKGSQ  146

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DE+++EAALRE+FEEAGV G V   LGKW F SKS G  +EG+M PL+V
Sbjct  147  GMMFPKGGWELDETVKEAALRESFEEAGVMGNVEHELGKWNFLSKSRGTFYEGYMFPLLV  206

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT--LQQEED  819
             E+L+ WPEKDVRQR W+S  EA E C H WMKEALD+LV +L+  +QQ+E+
Sbjct  207  TEQLELWPEKDVRQRIWMSVAEAREACRHGWMKEALDILVERLSSRVQQKEE  258



>ref|XP_004150841.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Cucumis sativus]
 gb|KGN51444.1| hypothetical protein Csa_5G547610 [Cucumis sativus]
Length=174

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 122/171 (71%), Gaps = 7/171 (4%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR+LQRYN  G RQVVGCIPYR++  +        G  + ++ E L++SSQK   
Sbjct  4    LVSRTGRELQRYNHMGFRQVVGCIPYRFKYNED-------GMKISNEYEVLVISSQKGQG  56

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DESLE+AA RE+ EEAGV G+V S LGKW F SKS G  +EG+M PL V 
Sbjct  57   LMFPKGGWELDESLEQAASRESLEEAGVLGKVESQLGKWRFISKSQGTYYEGYMFPLFVE  116

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDEN  825
            E+LD WPEK VR+R W+   EA EVC H WMKEALD+LV +LT+ ++ D +
Sbjct  117  EQLDLWPEKHVRERIWMPVAEAREVCRHWWMKEALDILVKRLTIGEQNDND  167



>ref|XP_004168523.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Cucumis sativus]
 ref|XP_008467102.1| PREDICTED: nudix hydrolase 18, mitochondrial [Cucumis melo]
Length=174

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 122/171 (71%), Gaps = 7/171 (4%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR+LQRYN  G RQVVGCIPYR++  +        G  + ++ E L++SSQK   
Sbjct  4    LVSRTGRELQRYNHMGFRQVVGCIPYRFKYNED-------GMKICNEYEVLVISSQKGQG  56

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DESLE+AA RE+ EEAGV G+V S LGKW F SKS G  +EG+M PL V 
Sbjct  57   LMFPKGGWELDESLEQAASRESLEEAGVLGKVESQLGKWRFISKSQGTYYEGYMFPLFVE  116

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDEN  825
            E+LD WPEK VR+R W+   EA EVC H WMKEALD+LV +LT+ ++ D +
Sbjct  117  EQLDLWPEKHVRERIWMPVAEAREVCRHWWMKEALDILVKRLTIGEQNDND  167



>ref|XP_007217269.1| hypothetical protein PRUPE_ppa011832mg [Prunus persica]
 gb|EMJ18468.1| hypothetical protein PRUPE_ppa011832mg [Prunus persica]
Length=194

 Score =   192 bits (488),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 126/173 (73%), Gaps = 6/173 (3%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            ++ SRTGR LQRY+ +G RQVVGCIPYRY+  KQ+     H AP   +LE L+++SQK  
Sbjct  12   ALVSRTGRHLQRYS-KGRRQVVGCIPYRYKTSKQTPSK--HDAP---ELEVLVITSQKGK  65

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             M+FPKGGWE DES E AA RET EEAGV G +   LGKW FKSKS    ++G+M PL+V
Sbjct  66   GMLFPKGGWEIDESKEGAASRETLEEAGVRGLIEGELGKWIFKSKSHDAYYDGYMFPLLV  125

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENE  828
             E+LD WPEK++R+R W+S +EA EVC H WMKEALD LV++LT QQ+  + E
Sbjct  126  QEQLDFWPEKNLRRRIWMSAQEAREVCQHWWMKEALDRLVNRLTSQQQNQDQE  178



>ref|XP_007227594.1| hypothetical protein PRUPE_ppa016570mg [Prunus persica]
 gb|EMJ28793.1| hypothetical protein PRUPE_ppa016570mg [Prunus persica]
Length=173

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 123/173 (71%), Gaps = 9/173 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +RTGR+LQRYN+ G RQVVGCIPYRY+ G+  A        + D+LE L+++SQK   
Sbjct  4    LVARTGRELQRYNM-GRRQVVGCIPYRYKNGRDGA--------ISDELEVLVITSQKGNA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
             MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS    +EG+M PL V 
Sbjct  55   FMFPKGGWELDESVEEAASRESLEEAGVVGNVECELGKWSFMSKSQETYYEGYMFPLFVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            E+LD WPEK+VR+R W+S  +A E C H WMKEALD+LV +LT  Q+++E  A
Sbjct  115  EQLDLWPEKNVRRRIWMSAAKAREACQHWWMKEALDILVERLTSAQKQEEENA  167



>ref|XP_008221469.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Prunus mume]
Length=173

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 123/173 (71%), Gaps = 9/173 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +RTGR+LQRYN+ G RQVVGCIPYRY+ G   A        + D+LE L+++SQK   
Sbjct  4    LVARTGRELQRYNM-GRRQVVGCIPYRYKNGSDGA--------ISDELEVLVITSQKGNA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
             MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS    +EG M PL V+
Sbjct  55   FMFPKGGWELDESVEEAASRESLEEAGVVGNVECELGKWSFMSKSQETYYEGHMFPLFVM  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            E+LD WPEK+VRQR W+S  +A + C H WMKEALD+LV +LT  Q+++E +A
Sbjct  115  EQLDLWPEKNVRQRIWMSAAKARDACQHWWMKEALDILVERLTSAQKQEEEDA  167



>ref|XP_002263589.2| PREDICTED: nudix hydrolase 18, mitochondrial [Vitis vinifera]
 emb|CBI33465.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 121/171 (71%), Gaps = 8/171 (5%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            ++ SRTGR LQRYN +G RQVVGCIPYRYR   Q  GS+  G    + LE LL+SSQK  
Sbjct  3    ALVSRTGRHLQRYN-KGRRQVVGCIPYRYRITNQ--GSLEDG----EALEVLLISSQKGK  55

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             M+FPKGGWE DES  EAALRET EEAGV G V   LGKW FKSK      E FM PL+V
Sbjct  56   SMLFPKGGWETDESKTEAALRETVEEAGVTGIVERELGKWSFKSKRNDTYCEAFMFPLLV  115

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT-LQQEED  819
             EEL+ WPEK+VR+R WVS  EA EVC H WMKEALD  V +LT LQQEED
Sbjct  116  KEELELWPEKNVRERKWVSVAEAREVCQHWWMKEALDRFVRRLTFLQQEED  166



>ref|XP_003630930.1| Nudix hydrolase [Medicago truncatula]
 gb|AET05406.1| nudix hydrolase-like protein [Medicago truncatula]
 gb|AFK37228.1| unknown [Medicago truncatula]
Length=164

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 119/166 (72%), Gaps = 8/166 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SR+GR+LQRYN  G RQVVGCIPYRY+E      S        ++LE L+VSSQKS R
Sbjct  4    LVSRSGRELQRYNNMGGRQVVGCIPYRYKEDIDGNRS--------NELEVLVVSSQKSQR  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G V   LG+W F SK  G+ +EG+M PL V 
Sbjct  56   LMFPKGGWELDESVEEAACRESLEEAGVTGLVECELGQWNFISKRYGIYYEGYMFPLFVK  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQ  810
            E+LD WPEK+VR+R W++  +A EVC H WMKEALD+LV +L   Q
Sbjct  116  EQLDQWPEKNVRRRIWMTVAQAREVCQHWWMKEALDILVQRLVSSQ  161



>ref|NP_001236875.1| uncharacterized protein LOC100500105 [Glycine max]
 gb|ACU14941.1| unknown [Glycine max]
Length=211

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 128/170 (75%), Gaps = 6/170 (4%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR+LQRY  +G RQVVGCIPYR++ G++++  ++      D+LE L++SSQK
Sbjct  10   VAALVSRTGRELQRYR-KGRRQVVGCIPYRFKIGEKTSLDVVS-----DELEVLVISSQK  63

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES +EAALRET EEAGV G VG  LGKW FKSK+    +EG+M PL
Sbjct  64   GKGMLFPKGGWELDESKKEAALRETMEEAGVRGIVGGKLGKWSFKSKTHDTFYEGYMFPL  123

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQE  813
            +V E+L+ WPE++VRQR W+S  EA EVC H WMKEALD LV++ + Q++
Sbjct  124  LVQEQLEFWPEQNVRQRIWMSVTEAREVCQHWWMKEALDRLVNRPSGQKQ  173



>ref|XP_007163378.1| hypothetical protein PHAVU_001G229700g [Phaseolus vulgaris]
 gb|ESW35372.1| hypothetical protein PHAVU_001G229700g [Phaseolus vulgaris]
Length=193

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 131/181 (72%), Gaps = 7/181 (4%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR+LQRY  +G RQVVGCIPYR++ G++++  +       D+LE L++SSQK
Sbjct  10   VVALVSRTGRELQRYR-KGRRQVVGCIPYRFKIGEKTSLDV------SDELEVLVISSQK  62

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES +EAALRET EEAGV G VG  LGKW FKSK+    +EG+M PL
Sbjct  63   GKGMLFPKGGWELDESKKEAALRETIEEAGVRGIVGGKLGKWSFKSKTHDTFYEGYMFPL  122

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEARNGM  843
            +V E+L+ WPE++VRQR W+S  EA +VC H WMKEALD LV++L  Q+   +N+   G 
Sbjct  123  LVQEQLEFWPEQNVRQRVWMSVTEARDVCQHWWMKEALDRLVNRLAGQKVGRDNKQVLGS  182

Query  844  M  846
            M
Sbjct  183  M  183



>ref|XP_002284976.1| PREDICTED: nudix hydrolase 18, mitochondrial [Vitis vinifera]
 emb|CBI26838.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 120/163 (74%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR+LQRY+ QG R VVGCIPYRY+ G  S GSI       D+LE L++SS+K   
Sbjct  4    VVSRTGRELQRYD-QGRRLVVGCIPYRYKSG--SDGSI------KDELEVLVISSKKGQG  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            MMFPKGGWE DES+EEAA RE+ EEAGV G+VG  LG+W F SK  G  +EG+M PL+V 
Sbjct  55   MMFPKGGWETDESVEEAASRESLEEAGVLGKVGCELGQWSFMSKRYGTFYEGYMFPLLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            E+LD WPEKD RQR W+   EA EVC H WMKEALDVLV +LT
Sbjct  115  EQLDLWPEKDERQRIWMDVAEAREVCQHWWMKEALDVLVRRLT  157



>ref|XP_008381741.1| PREDICTED: nudix hydrolase 17, mitochondrial [Malus domestica]
Length=173

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 123/170 (72%), Gaps = 9/170 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +RTGR+LQRYN+ G RQVVGCIPYRY++G   A S        ++LE L+++SQK   
Sbjct  4    LVARTGRELQRYNM-GRRQVVGCIPYRYKDGSDGAIS--------NELEVLVITSQKGNA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
             MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS    +EG+M PL V 
Sbjct  55   FMFPKGGWELDESVEEAASRESLEEAGVLGNVECQLGKWSFMSKSQETYYEGYMFPLFVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE  822
            E+LD WPEK+VRQR W++  +A E C H WMKEALD+LV +LT +Q+++E
Sbjct  115  EQLDLWPEKNVRQRIWMTTTKAREACQHWWMKEALDILVERLTSEQKQEE  164



>gb|KDP38109.1| hypothetical protein JCGZ_04752 [Jatropha curcas]
Length=178

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 123/175 (70%), Gaps = 8/175 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SR+GR+LQRY+ QG RQVVGCIPYRY   K  +  +I      D++E L+++SQK   
Sbjct  5    LVSRSGRELQRYDNQGRRQVVGCIPYRY---KNCSDGLIG-----DEVEVLVITSQKGQG  56

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            MMFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SK  G  +EG+M PL+V 
Sbjct  57   MMFPKGGWELDESVEEAASRESLEEAGVLGHVEDELGKWNFLSKRHGTFYEGYMFPLLVT  116

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEARN  837
            E+LD WPEKD+RQR W++  EA +VC H WMKEALD+LV +LT  Q +   E  N
Sbjct  117  EQLDFWPEKDLRQRIWMTVEEARDVCRHWWMKEALDILVERLTSIQMQQPKEEDN  171



>ref|XP_003553078.1| PREDICTED: nudix hydrolase 17, mitochondrial [Glycine max]
 gb|KHN07540.1| Nudix hydrolase 17, mitochondrial [Glycine soja]
Length=199

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 129/178 (72%), Gaps = 7/178 (4%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR+LQRY  +G RQVVGCIPYR++ G+++         + D+LE L++SSQK
Sbjct  10   VVALVSRTGRELQRYR-KGRRQVVGCIPYRFKIGEKTC------LDVSDELEVLVISSQK  62

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES +EAALRET EEAGV G VG  LGKW FKSK+    +EG+M PL
Sbjct  63   GKGMLFPKGGWELDESKKEAALRETMEEAGVRGIVGGKLGKWSFKSKTHDTFYEGYMFPL  122

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEARN  837
            +V E+L+ WPE++VRQR W+S  EA EVC H WMKEALD LV++L+ Q++   +   N
Sbjct  123  LVQEQLEFWPEQNVRQRIWMSVTEAREVCQHWWMKEALDRLVNRLSGQKQLGHHRDNN  180



>ref|XP_002525991.1| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus 
communis]
 gb|EEF36415.1| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus 
communis]
Length=175

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 123/173 (71%), Gaps = 10/173 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SR+GR+LQRY+ QG RQVVGCIPYRY+     + S        D+LE L+++SQK  +
Sbjct  4    LVSRSGRELQRYDNQGRRQVVGCIPYRYKNSSDGSFS--------DELEVLVITSQKGGQ  55

Query  493  -MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SK  G  +EG+M PL+V
Sbjct  56   GMMFPKGGWELDESVEEAASRESLEEAGVLGHVEDELGKWNFLSKRHGTFYEGYMFPLLV  115

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT-LQQEEDEN  825
             E+LD WPEKDVRQR W+   EA + C H WMKEALD+LV +LT LQ+  +EN
Sbjct  116  TEQLDFWPEKDVRQRIWMPVAEARDACRHWWMKEALDILVGRLTSLQRRTEEN  168



>ref|XP_010498218.1| PREDICTED: nudix hydrolase 4-like [Camelina sativa]
Length=208

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 123/178 (69%), Gaps = 7/178 (4%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++ KV S+ SRTGRDLQRY+  G RQVVGC+PYRY+  KQ    I        ++E LL+
Sbjct  36   QIEKVVSLVSRTGRDLQRYDTSGYRQVVGCVPYRYK--KQEVNGIES-----TEIEVLLI  88

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QK   M+FPKGGWE DES+EEAALRET EEAGV GE+   +GKW +KSK   ++H+G+
Sbjct  89   SAQKGKGMLFPKGGWEMDESMEEAALRETIEEAGVTGELQGKIGKWQYKSKRHNIIHDGY  148

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDEN  825
            M  L+V +E + WPE ++RQR WVS  EA EVC + WM+EAL   V+  +L  +E  N
Sbjct  149  MFALLVSQEFELWPEAEIRQRRWVSLDEAREVCHNWWMREALKAFVNLKSLTNDESWN  206



>ref|XP_009351540.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Pyrus x bretschneideri]
Length=173

 Score =   189 bits (480),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 122/170 (72%), Gaps = 9/170 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +RTGR+LQRYN+ G RQVVGCIPYRY++G   A S        ++LE L+++SQK   
Sbjct  4    LVARTGRELQRYNM-GRRQVVGCIPYRYKDGSDGAIS--------NELEVLVITSQKGNA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
             MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS    +EG+M PL V 
Sbjct  55   FMFPKGGWELDESVEEAASRESLEEAGVLGNVECQLGKWSFMSKSQETYYEGYMFPLFVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE  822
            E+LD WPEK+VRQR W++  +A E C H WMKEALD+LV +LT +Q+ +E
Sbjct  115  EQLDLWPEKNVRQRIWMTTTKAREACQHWWMKEALDILVERLTSEQKPEE  164



>ref|XP_010477005.1| PREDICTED: nudix hydrolase 4 [Camelina sativa]
Length=208

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 123/178 (69%), Gaps = 7/178 (4%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++ KV S+ SRTGRDLQRY+  G RQVVGC+PYRY+  KQ    I        ++E LL+
Sbjct  36   QIEKVVSLVSRTGRDLQRYDTSGYRQVVGCVPYRYK--KQEVNGI-----ETTEIEVLLI  88

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QK   M+FPKGGWE DES+EEAALRET EEAGV GE+   +GKW +KSK   ++H+G+
Sbjct  89   SAQKGKGMLFPKGGWEMDESMEEAALRETIEEAGVTGELQGKIGKWQYKSKRHNIIHDGY  148

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDEN  825
            M  L+V +E + WPE ++RQR WVS  EA EVC + WM+EAL+  V+   L  +E  N
Sbjct  149  MFALLVSQEFELWPEAEIRQRRWVSLDEAREVCHNWWMREALEAFVNLKCLTNDESWN  206



>ref|XP_008240121.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Prunus mume]
Length=202

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 131/181 (72%), Gaps = 10/181 (6%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M++  V S+ SRTGR +QRY+ +GCRQVVGCIPYR+R+ +QS+         +++LE L+
Sbjct  29   MQIEDVVSLVSRTGRHMQRYD-KGCRQVVGCIPYRFRKTEQSSS--------LEELEVLV  79

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   M+FPKGGWE DES+E+AA RET EEAGV G +GS LG W +KSKS G +HEG
Sbjct  80   ISSQKGQGMLFPKGGWEIDESIEDAAKRETLEEAGVIGHLGSKLGVWRYKSKSHGTVHEG  139

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVS-QLTLQQEEDEN  825
            +M PL+V ++LD WPE+  R+R W+S  EA E C + WM+EAL+ LV  Q+  QQ  +E 
Sbjct  140  YMFPLLVQQQLDLWPEQSARKRQWMSVAEAREACQNVWMREALENLVCRQMHPQQAGEET  199

Query  826  E  828
            +
Sbjct  200  K  200



>ref|XP_007160556.1| hypothetical protein PHAVU_002G331500g [Phaseolus vulgaris]
 gb|ESW32550.1| hypothetical protein PHAVU_002G331500g [Phaseolus vulgaris]
Length=217

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 123/162 (76%), Gaps = 13/162 (8%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRY-REGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            + SRTGR+LQRY++ G RQVVGCIPYRY R+G Q            ++LE L++S+QK  
Sbjct  39   LVSRTGRELQRYHL-GRRQVVGCIPYRYTRKGSQD-----------NELEVLVISAQKGN  86

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             M FPKGGWE DES+E+AA+RE+ EEAGV G V + LGKWF+KSKS   L EG+M PL+V
Sbjct  87   GMQFPKGGWENDESMEQAAVRESIEEAGVVGNVENKLGKWFYKSKSEDTLREGYMFPLLV  146

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
             ++L++WPEK+ R+R+W++  EA +VC HPWMKEALDVLVS+
Sbjct  147  QKQLENWPEKNFRKRTWMTVAEAKQVCPHPWMKEALDVLVSR  188



>gb|ACJ86054.1| unknown [Medicago truncatula]
Length=195

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 128/176 (73%), Gaps = 7/176 (4%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR+LQRY  +G RQVVGCIPYRY+ G++++  +       D+LE L++SSQK
Sbjct  10   VVTLVSRTGRELQRYR-KGRRQVVGCIPYRYKIGEKNSLDV------SDELEVLVISSQK  62

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES +EAALRET EEAGV G V   LGKW FKSK+   L++G+M PL
Sbjct  63   GKGMLFPKGGWELDESQKEAALRETMEEAGVRGIVEGKLGKWSFKSKTYDTLYDGYMFPL  122

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            +V EEL+ WPE+++RQR W+S  EA +VC H WMKEALD LV++L  Q+   E + 
Sbjct  123  LVQEELEFWPEQNLRQRRWMSISEARDVCQHWWMKEALDRLVNRLLRQKLGSEKQV  178



>ref|XP_009149274.1| PREDICTED: nudix hydrolase 4 [Brassica rapa]
Length=209

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 8/182 (4%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++ KV S+ SRTGRDLQRY+ +G RQVVGC+PYRY++ +Q  G+         ++E LL+
Sbjct  35   QIEKVVSLVSRTGRDLQRYDNEGYRQVVGCVPYRYKK-RQGNGT------ETKEIELLLI  87

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QK   M+FPKGGWE DES+EEAALRET EEAGV GE+   LGKW +KSK   V+HEG+
Sbjct  88   SAQKGKGMLFPKGGWEIDESMEEAALRETIEEAGVTGELEEKLGKWQYKSKRQSVIHEGY  147

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            M  L+V +E + WPE + RQR WV   EA EVC + WM+EAL+V V+ L  + EE E EA
Sbjct  148  MFALLVDQEYERWPEAETRQRRWVGLDEAREVCQNWWMREALEVFVN-LKCKAEEVEIEA  206

Query  832  RN  837
             +
Sbjct  207  ND  208



>ref|XP_010459443.1| PREDICTED: nudix hydrolase 4-like [Camelina sativa]
Length=208

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 123/178 (69%), Gaps = 7/178 (4%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++ KV S+ SRTGRDLQRY+  G RQVVGC+PYRY+  KQ    I        ++E LL+
Sbjct  36   QIEKVVSLVSRTGRDLQRYDTSGYRQVVGCVPYRYK--KQEVNGIES-----TEIEVLLI  88

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QK   M+FPKGGWE DES+EEAALRET EEAGV GE+   +GKW +KSK   ++H+G+
Sbjct  89   SAQKGKGMLFPKGGWEMDESMEEAALRETIEEAGVTGELQGKIGKWQYKSKRHNIIHDGY  148

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDEN  825
            M  L+V +E + WPE ++RQR WVS  EA EVC + WM+EAL+  V+   L  +E  N
Sbjct  149  MFALLVSQEFELWPEAEIRQRRWVSLDEAREVCHNWWMREALEAFVNLKCLTNDESWN  206



>ref|XP_007209610.1| hypothetical protein PRUPE_ppa011552mg [Prunus persica]
 gb|EMJ10809.1| hypothetical protein PRUPE_ppa011552mg [Prunus persica]
Length=206

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 137/198 (69%), Gaps = 15/198 (8%)
 Frame = +1

Query  238  VLRKQGGSGLICVKK*EMKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSA  417
            +  K+ G   I      M++  V S+ SRTGR +QRY+ +G RQVVGCIPYR+R+ +QS+
Sbjct  18   LFSKKNGGNFI-----PMQIEDVVSLVSRTGRHMQRYD-EGYRQVVGCIPYRFRKTEQSS  71

Query  418  GSIIHGAPLVDDLEFLLVSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSC  597
                     +++LE L++SSQK   M+FPKGGWE DES+EEAA RET EEAGV G +GS 
Sbjct  72   S--------LEELEVLVISSQKGQGMLFPKGGWEIDESIEEAAKRETLEEAGVVGHLGSR  123

Query  598  LGKWFFKSKSLGVLHEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEAL  777
            LG W +KSKS G++HEG+M PL+V ++LD WPE+  R+R W+S  EA E C + WM+EAL
Sbjct  124  LGMWRYKSKSHGLIHEGYMFPLLVQQQLDFWPEQSARKRQWMSVAEAREACQNWWMREAL  183

Query  778  DVLV-SQLTLQQEEDENE  828
            + LV  Q+  QQ+E+  E
Sbjct  184  EKLVCRQMHPQQKEEAEE  201



>ref|XP_003600707.1| Nudix hydrolase [Medicago truncatula]
 gb|AES70958.1| nudix hydrolase-like protein [Medicago truncatula]
 gb|AFK42056.1| unknown [Medicago truncatula]
Length=195

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 128/176 (73%), Gaps = 7/176 (4%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR+LQRY  +G RQVVGCIPYRY+ G++++  +       D+LE L++SSQK
Sbjct  10   VVTLVSRTGRELQRYR-KGRRQVVGCIPYRYKIGEKNSLDV------SDELEVLVISSQK  62

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES +EAALRET EEAGV G V   LGKW FKSK+   L++G+M PL
Sbjct  63   GKGMLFPKGGWELDESQKEAALRETMEEAGVRGIVEGKLGKWSFKSKTYDTLYDGYMFPL  122

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            +V EEL+ WPE+++RQR W+S  EA +VC H WMKEALD LV++L  Q+   E + 
Sbjct  123  LVQEELEFWPEQNLRQRRWMSISEARDVCQHWWMKEALDRLVNRLLGQKLGSEKQV  178



>ref|XP_008360027.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Malus domestica]
Length=174

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 121/170 (71%), Gaps = 9/170 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR+LQRYN+ G RQVVGCIPYRY++G     S        ++LE L+++SQK   
Sbjct  5    LVSRTGRELQRYNM-GRRQVVGCIPYRYKDGSDGVVS--------NELEVLVITSQKGNA  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
             MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS    +EG+M PL V 
Sbjct  56   FMFPKGGWELDESVEEAASRESLEEAGVLGNVECQLGKWCFMSKSQETYYEGYMFPLFVK  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE  822
            E+LD WPEK+VRQR W++  +A E C H WMKEALD+LV +LT +Q++ E
Sbjct  116  EQLDLWPEKNVRQRIWMTAAKAREACQHWWMKEALDILVERLTSEQKQGE  165



>ref|XP_011002187.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Populus euphratica]
Length=188

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 122/175 (70%), Gaps = 12/175 (7%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V S+ SRTGR LQRYN +G RQVVGCIPYRY +GK             D L+ L++SSQK
Sbjct  12   VASLVSRTGRHLQRYN-KGRRQVVGCIPYRYTKGKGE-----------DGLQVLVISSQK  59

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DE++++ ALRET+EEAGV G +   LG+W F+S++ G  +EG+M PL
Sbjct  60   GKGMLFPKGGWESDETIKQGALRETYEEAGVKGVLEPQLGEWTFQSRTHGTDYEGYMFPL  119

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENE  828
             V EELD WPEK  R R W+S  EA E C H WMKEALDVLV +L  QQ+ DE+E
Sbjct  120  RVKEELDFWPEKTNRLRKWMSVTEARECCQHWWMKEALDVLVDRLAGQQQLDEDE  174



>ref|XP_010105645.1| Nudix hydrolase 17 [Morus notabilis]
 gb|EXC05433.1| Nudix hydrolase 17 [Morus notabilis]
Length=181

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 124/173 (72%), Gaps = 11/173 (6%)
 Frame = +1

Query  319  SRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMM  498
            +RTGR LQRYN +G RQVVGCIPYRY+  +Q++         + +L+ L++SSQK   M+
Sbjct  14   ARTGRHLQRYN-KGRRQVVGCIPYRYKTCRQNS---------LRELQVLVISSQKGKGML  63

Query  499  FPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEE  678
            FPKGGWE+DES  EAALRET EEAGV G V   LGKW FKSK+    ++G+M PL+V EE
Sbjct  64   FPKGGWEKDESKTEAALRETLEEAGVRGVVERELGKWSFKSKTYDTFYDGYMFPLLVQEE  123

Query  679  LDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQL-TLQQEEDENEAR  834
            LD WPE D RQR W+S  EA EVC H WM EALD LVS+L + QQ +DE+E +
Sbjct  124  LDLWPEMDFRQRKWMSVTEAREVCQHWWMIEALDRLVSRLASKQQHDDEDEVQ  176



>ref|XP_004299512.1| PREDICTED: nudix hydrolase 4-like [Fragaria vesca subsp. vesca]
Length=206

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 130/184 (71%), Gaps = 12/184 (7%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M+L  + S+ SRTGR LQRY+ +GCRQVVGCIPYRYR+ +Q + S       V+D+E L+
Sbjct  29   MQLENMVSLVSRTGRHLQRYD-KGCRQVVGCIPYRYRQTEQESSS-------VEDIEVLV  80

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVG-SCLGKWFFKSKSLGVLHE  645
            +SSQK   ++FPKGGWE DES+EEAA RET EEAGV G +    LGKW +KSKS G  HE
Sbjct  81   ISSQKGQGILFPKGGWELDESIEEAACRETLEEAGVTGHLELPILGKWPYKSKSQGTFHE  140

Query  646  GFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDEN  825
            G+M PL+V ++L+ WPEK VR+R W++  +A E C + WM+EALD    + T  QE+   
Sbjct  141  GYMFPLLVNKQLESWPEKTVRKREWMTIADAKEACQNWWMREALDEFFRRQTQTQEK---  197

Query  826  EARN  837
            EA+N
Sbjct  198  EAQN  201



>ref|XP_010537505.1| PREDICTED: nudix hydrolase 4 [Tarenaya hassleriana]
Length=212

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 123/170 (72%), Gaps = 7/170 (4%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++ KV S+ SRTGRDLQRY+ +G RQVVGCIPYRY++        I G   V+++E L++
Sbjct  35   QIEKVVSLVSRTGRDLQRYDSKGFRQVVGCIPYRYKKNN------IDGND-VEEIEVLVI  87

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QK   M+FPKGGWE DES+EEAALRET EEAGV G++   LGKW +KSK   V+HEG+
Sbjct  88   SAQKGKGMLFPKGGWEIDESMEEAALRETIEEAGVTGQLEEKLGKWQYKSKRQNVIHEGY  147

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            M PL+V ++ + WPE ++RQR WV   EA EVC + WM+EAL+  + + T
Sbjct  148  MFPLLVSQQFESWPEAEIRQRRWVKLSEAREVCQNWWMREALEEFIKRKT  197



>gb|KHN41062.1| Nudix hydrolase 17, mitochondrial [Glycine soja]
Length=190

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 132/197 (67%), Gaps = 19/197 (10%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR+LQRY  +G RQVVGCIPYRY+ G Q++          ++LE L+++SQK
Sbjct  10   VVALVSRTGRELQRYR-KGRRQVVGCIPYRYKIGDQTS------LDAQEELEVLVITSQK  62

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES +EAALRET EEAGV G V   LGKW FKSK+    +EG+M PL
Sbjct  63   GKGMLFPKGGWELDESKKEAALRETIEEAGVRGTVEGKLGKWSFKSKTHDTFYEGYMFPL  122

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEARNGM  843
            +V E+L+ WPE++VRQR W+S  EA EVC H WMKEAL+ LV++            + G 
Sbjct  123  LVQEQLELWPEQNVRQRIWMSISEAREVCQHWWMKEALERLVNR------------KLGR  170

Query  844  MRNIELEPSIEILAQGN  894
            +R IE+  SI  +  GN
Sbjct  171  VRQIEIVGSIHCIGDGN  187



>ref|XP_003619856.1| Nudix hydrolase [Medicago truncatula]
 gb|AES76074.1| nudix hydrolase-like protein [Medicago truncatula]
 gb|AFK34504.1| unknown [Medicago truncatula]
Length=230

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 121/169 (72%), Gaps = 16/169 (9%)
 Frame = +1

Query  307  DSMC---SRTGRDLQRYNVQGCRQVVGCIPYRYRE-GKQSAGSIIHGAPLVDDLEFLLVS  474
            + MC    RTGR LQRY  QGCRQVVGCIPYRY++ G Q             ++E LL+S
Sbjct  71   NMMCLVSPRTGRHLQRYE-QGCRQVVGCIPYRYKKNGTQE-----------KEIEVLLIS  118

Query  475  SQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFM  654
            +QK   M FPKGGWE+DE++E+AALRET EEAGV G V S LGKW++KSK    +HEG+M
Sbjct  119  AQKGSGMQFPKGGWEKDETMEQAALRETIEEAGVIGSVESNLGKWYYKSKRQPTMHEGYM  178

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             PL+V +ELD+WPE ++R+R W++  EA E+C + WMKEALD LVS+ T
Sbjct  179  FPLLVSKELDNWPEMNIRRRKWLTVDEAKEICPYAWMKEALDELVSRQT  227



>ref|XP_011001557.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Populus euphratica]
Length=193

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 123/175 (70%), Gaps = 7/175 (4%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V S+ SRTGR LQRY+ +G RQVVGCIPYRY+ G  S   +       D+LE L++SSQK
Sbjct  12   VASLVSRTGRHLQRYD-KGRRQVVGCIPYRYKNGSSSTSEV------EDELEVLVISSQK  64

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DE++++AA RET+EEAGV G V   LG W F+S++ G  ++G++ PL
Sbjct  65   GKGMLFPKGGWELDETIKQAASRETYEEAGVKGNVEHQLGHWTFQSRTHGTDYDGYLFPL  124

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENE  828
             V E LD WPEK+ RQR W+S  EA E C H WMKEALDVLV +L  +Q+  E+E
Sbjct  125  HVKEVLDFWPEKNNRQRKWMSVEEARESCQHGWMKEALDVLVDRLAGRQQLGEDE  179



>ref|NP_001237840.1| uncharacterized protein LOC100305863 [Glycine max]
 gb|ACU13752.1| unknown [Glycine max]
Length=190

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 132/197 (67%), Gaps = 19/197 (10%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V  + SRTGR+LQRY  +G RQVVGCIPYRY+ G Q++        + ++LE L+++SQK
Sbjct  10   VVVLVSRTGRELQRYR-KGRRQVVGCIPYRYKIGDQTS------LDVQEELEVLVITSQK  62

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES +EAALRET EEAGV G V   LGKW FKSK+    +EG+M PL
Sbjct  63   GKGMLFPKGGWELDESKKEAALRETIEEAGVRGTVEGKLGKWSFKSKTHDTFYEGYMFPL  122

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEARNGM  843
            +V E+L+ WPE++VRQR W+S  EA EVC H WMKEAL+ LV++            + G 
Sbjct  123  LVQEQLELWPEQNVRQRIWMSISEAREVCQHWWMKEALERLVNR------------KLGR  170

Query  844  MRNIELEPSIEILAQGN  894
            +R IE+  SI  +  GN
Sbjct  171  VRQIEIVGSIHCIGDGN  187



>ref|XP_003525233.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Glycine max]
 gb|KHN21603.1| Nudix hydrolase 17, mitochondrial [Glycine soja]
Length=175

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 123/173 (71%), Gaps = 8/173 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SR+GR+LQRYN  G RQVVGCIPYRY+E        I G  + ++LE L+VSSQK   
Sbjct  4    LVSRSGRELQRYNNMGGRQVVGCIPYRYKED-------IDG-KMSNELEVLVVSSQKGRG  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G + S LG+W F SK  G+ +EG M P+ V 
Sbjct  56   LMFPKGGWELDESVEEAACRESLEEAGVLGIIESELGQWNFISKRYGIYYEGHMFPMFVK  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            E+LD WPEK++R+R W++  EA EVC H WMKEALD+LV ++   Q+  E+ A
Sbjct  116  EQLDTWPEKNLRRRIWMTVAEAREVCQHWWMKEALDILVQRIVSSQQRKEDIA  168



>ref|XP_008368721.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Malus domestica]
Length=192

 Score =   187 bits (475),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 124/176 (70%), Gaps = 12/176 (7%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDD---LEFLLVS  474
            V ++ SRTGR +QRY+ +G RQVVGCIPYRY+  KQ+        P  +D   LE L++S
Sbjct  11   VAALVSRTGRHMQRYS-KGHRQVVGCIPYRYKASKQT--------PFKNDAKELEVLVIS  61

Query  475  SQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFM  654
            SQK   M+FPKGGWE DES E AA RET EEAGV G +   LG+W F SKS     EG+M
Sbjct  62   SQKGKGMLFPKGGWELDESKEGAAARETLEEAGVRGLIERELGEWSFNSKSHDSYKEGYM  121

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE  822
             PL+V E+LD WPEK++RQR W+S  +A EVC H WMKEALD LV++LT QQ++D+
Sbjct  122  FPLLVQEQLDFWPEKNLRQRIWMSVEDAREVCQHWWMKEALDRLVNRLTTQQQKDQ  177



>ref|XP_002531008.1| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus 
communis]
 gb|EEF31368.1| diphosphoinositol polyphosphate phosphohydrolase, putative [Ricinus 
communis]
Length=193

 Score =   187 bits (475),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 125/174 (72%), Gaps = 6/174 (3%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            ++ SRTGR LQRY+  G RQVVGCIPYRY+ G+Q+   I  G      LE L++SSQK  
Sbjct  13   ALVSRTGRHLQRYSKGGRRQVVGCIPYRYKTGEQNYKEIGGG------LEVLVISSQKGK  66

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             ++FPKGGWE DE+++EAA RET EEAGV G V   LGKW FKSK+    +EG+M PL+V
Sbjct  67   GLLFPKGGWELDETIKEAASRETLEEAGVRGIVECELGKWSFKSKTHDTFYEGYMFPLLV  126

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
             E+L+ WPEK+VR+R W+S  +A E C H WMKEALD LV++L+ QQ+ ++ E 
Sbjct  127  QEQLEFWPEKNVRERKWMSVADARECCQHWWMKEALDRLVNRLSSQQQLEDVEV  180



>ref|XP_004288619.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Fragaria vesca 
subsp. vesca]
Length=192

 Score =   187 bits (475),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 121/165 (73%), Gaps = 5/165 (3%)
 Frame = +1

Query  307  DSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKS  486
            ++M SRTGR LQRYN +G RQVVGCIPYRY+  KQS  S   GA    +L+ L+++SQK 
Sbjct  9    ENMVSRTGRHLQRYN-KGRRQVVGCIPYRYKMAKQSL-SKDDGA---KELQVLVITSQKG  63

Query  487  PRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLI  666
              M+FPKGGWE DES E AA RET EEAGV G +   LGKW FKSKS    +EG+M PL 
Sbjct  64   KGMLFPKGGWELDESKEGAASRETLEEAGVRGTIECELGKWSFKSKSHDAHYEGYMFPLH  123

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            V E+LD WPEK++RQR W+S +EA EVC H WMKEALD LV++LT
Sbjct  124  VQEQLDFWPEKNLRQRIWMSAQEAREVCQHWWMKEALDRLVNRLT  168



>ref|XP_010062274.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Eucalyptus 
grandis]
 gb|KCW69389.1| hypothetical protein EUGRSUZ_F02870 [Eucalyptus grandis]
Length=203

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 133/192 (69%), Gaps = 12/192 (6%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRY--REGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            ++ SRTGR LQRY+ QG RQVVGCIPYRY  RE    AG            E L++SSQK
Sbjct  14   TLVSRTGRHLQRYSKQGSRQVVGCIPYRYKSREDDSLAGEEEDEV------EVLVISSQK  67

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               ++FPKGGWE+DES++ AALRET EEAGV G + S LGKW FKSKS   ++EG M PL
Sbjct  68   GKGLLFPKGGWEKDESMKAAALRETVEEAGVRGTIESKLGKWSFKSKSQDAVYEGHMFPL  127

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEARNG-  840
            +V E+LD WPEK+VRQR W++ REA EVC H WMK+ALD+LV++LT  ++ D   ++ G 
Sbjct  128  LVNEQLDVWPEKNVRQRYWMNVREAGEVCQHWWMKDALDLLVNRLT-SKDGDRPASKEGD  186

Query  841  --MMRNIELEPS  870
               +R+  + P+
Sbjct  187  CPSLRHCSIRPT  198



>gb|KDP25791.1| hypothetical protein JCGZ_22513 [Jatropha curcas]
Length=197

 Score =   187 bits (475),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 125/175 (71%), Gaps = 5/175 (3%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR LQRY+  G RQVVGCIPYRY+  K+ + +I       +  E L++SSQK   
Sbjct  14   LVSRTGRHLQRYSKGGRRQVVGCIPYRYKTEKKDSLNIEE-----EGFEVLVISSQKGKG  68

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            M+FPKGGWE DE++E+AA RET EEAGV G V   LGKW FKSK+    +EG+M PL+V 
Sbjct  69   MLFPKGGWELDETIEQAASRETVEEAGVRGIVECELGKWSFKSKTHDTYYEGYMFPLLVQ  128

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEARN  837
            E+LD WPEK+VR+R W+S  +A E C H WMKEALD+LV++L  Q++ +E E R+
Sbjct  129  EQLDFWPEKNVRERKWMSVADARECCQHWWMKEALDLLVNRLISQEQLEEGEVRS  183



>ref|XP_009360054.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Pyrus x bretschneideri]
Length=208

 Score =   187 bits (476),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 132/199 (66%), Gaps = 16/199 (8%)
 Frame = +1

Query  238  VLRKQGGSGLICVKK*EMKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSA  417
            V  K+ G   I      M++  + S+ SRTGR  QRY  +GCRQVVGCIPYRYRE + S+
Sbjct  22   VFSKKNGGDFI-----PMQIENMVSLVSRTGRQFQRYE-EGCRQVVGCIPYRYREKQTSS  75

Query  418  GSIIHGAPLVDDLEFLLVSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSC  597
                      ++LE L++SSQK   M+FPKGGWE DES+EEAA RET EEAGV G + + 
Sbjct  76   D---------EELEVLVISSQKGKGMLFPKGGWEMDESIEEAAKRETLEEAGVTGHLETR  126

Query  598  LGKWFFKSKSLGVLHEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEAL  777
            LG W +KSK+ G +HEG+M PL+V ++L+ WPEK  R+R WV+  EA E C + WMKEAL
Sbjct  127  LGSWRYKSKTQGTVHEGYMFPLLVQQQLEFWPEKSSRKREWVTVSEAREACQNWWMKEAL  186

Query  778  DVLVSQ-LTLQQEEDENEA  831
            + LV Q +  Q + +E EA
Sbjct  187  EKLVCQKMQPQPKGEEGEA  205



>gb|KHN39470.1| Nudix hydrolase 17, mitochondrial [Glycine soja]
Length=190

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 131/197 (66%), Gaps = 19/197 (10%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR+LQRY  +G RQVVGCIPYRY+ G Q++          ++LE L++SSQK
Sbjct  10   VVALVSRTGRELQRYR-KGRRQVVGCIPYRYKIGDQTS------LEAQEELEVLVISSQK  62

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES +EAALRET EEAGV G V   LGKW FKSK+    +EG+M PL
Sbjct  63   GKGMLFPKGGWELDESKKEAALRETMEEAGVRGTVEGKLGKWSFKSKTRDTFYEGYMFPL  122

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEARNGM  843
            +V E+L+ WPE++VRQR W+S  EA EVC H WMKEAL+ LV++            + G 
Sbjct  123  LVQEQLEFWPEQNVRQRIWMSVSEAREVCQHWWMKEALERLVNR------------KLGR  170

Query  844  MRNIELEPSIEILAQGN  894
            +  IE+  SI  +  GN
Sbjct  171  VTQIEIVGSIHCIGDGN  187



>ref|XP_004503255.1| PREDICTED: nudix hydrolase 4-like [Cicer arietinum]
Length=234

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 120/166 (72%), Gaps = 14/166 (8%)
 Frame = +1

Query  307  DSMC--SRTGRDLQRYNVQGCRQVVGCIPYRYR-EGKQSAGSIIHGAPLVDDLEFLLVSS  477
            + MC  +RTGR LQRY+  GCRQVVGCIPYRYR +G Q+            +LE L++S+
Sbjct  74   NMMCLVARTGRHLQRYDDHGCRQVVGCIPYRYRRKGTQN-----------KELEVLVIST  122

Query  478  QKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFML  657
            Q    M FPKGGWE DES+E+AALRET EEAGV G + + LGKW +KSK    +HEG+M 
Sbjct  123  QNGDGMQFPKGGWETDESMEQAALRETIEEAGVMGNIENKLGKWSYKSKRQDTVHEGYMF  182

Query  658  PLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
             L+V ++L++WPEK++R+R W+S  EA EVC H WMKEALDVLVS+
Sbjct  183  SLLVKKQLENWPEKNIRKRRWMSVTEAKEVCPHTWMKEALDVLVSR  228



>gb|KDP34747.1| hypothetical protein JCGZ_11901 [Jatropha curcas]
Length=214

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 121/163 (74%), Gaps = 5/163 (3%)
 Frame = +1

Query  301  KVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQ  480
            K+ S+ SRTGR LQRY+ +GCRQVVGCIPYRY++    +          +++E L++S+Q
Sbjct  37   KMVSLVSRTGRHLQRYD-RGCRQVVGCIPYRYKKSDDPSSM----DKTAENIEVLVISAQ  91

Query  481  KSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLP  660
            +   M+FPKGGWEQDES+EEAA+RET EEAGV G V   LGKW +KSK  G+LHEG+M P
Sbjct  92   RGKGMLFPKGGWEQDESMEEAAVRETLEEAGVIGNVECELGKWQYKSKRGGILHEGYMFP  151

Query  661  LIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLV  789
            ++V ++LD WPEKD+R+R WV+  EA EVC   WM+EAL+ LV
Sbjct  152  MLVQKQLDLWPEKDIRKRRWVTVTEAREVCQTWWMREALEELV  194



>ref|XP_010036981.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Eucalyptus 
grandis]
 gb|KCW48617.1| hypothetical protein EUGRSUZ_K02281 [Eucalyptus grandis]
Length=204

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 126/174 (72%), Gaps = 7/174 (4%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            +++  V S+ SRTGR LQRY  +  RQVVGCIPYRYR+  QS+G    G    ++LEFL+
Sbjct  28   VQIKDVVSLVSRTGRHLQRYE-KDRRQVVGCIPYRYRKTDQSSGG---GG---EELEFLV  80

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            VSS K  RMMFPKGGWE DE++E+AALRE+ EEAGV G +   LG+W +KSKS G  H+G
Sbjct  81   VSSPKGQRMMFPKGGWELDETIEQAALRESAEEAGVTGTLECKLGEWRYKSKSNGSFHDG  140

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQ  810
             M PL+V +ELD WPEK VRQR WV+  EA E+C   WMKEAL++L+ +L  Q+
Sbjct  141  HMFPLLVQKELDFWPEKHVRQRRWVTADEAKELCQQLWMKEALELLIQRLRQQK  194



>ref|XP_003544981.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Glycine max]
Length=190

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 131/197 (66%), Gaps = 19/197 (10%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR+LQRY  +G RQVVGCIPYRY+ G Q++          ++LE L++SSQK
Sbjct  10   VVALVSRTGRELQRYR-KGRRQVVGCIPYRYKIGDQTS------LEAQEELEVLVISSQK  62

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES +EAALRET EEAGV G V   LGKW FKSK+    +EG+M PL
Sbjct  63   GKGMLFPKGGWELDESKKEAALRETMEEAGVRGTVEGKLGKWSFKSKTHDTFYEGYMFPL  122

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEARNGM  843
            +V E+L+ WPE++VRQR W+S  EA EVC H WMKEAL+ LV++            + G 
Sbjct  123  LVQEQLEFWPEQNVRQRIWMSVSEAREVCQHWWMKEALERLVNR------------KLGR  170

Query  844  MRNIELEPSIEILAQGN  894
            +  IE+  SI  +  GN
Sbjct  171  VTQIEIVGSIHCIGDGN  187



>ref|XP_002305883.1| MutT-like family protein [Populus trichocarpa]
 gb|EEE86394.1| MutT-like family protein [Populus trichocarpa]
Length=188

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 121/175 (69%), Gaps = 12/175 (7%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V S+ SRTGR LQRYN +G RQVVGCIPYRY +GK             D  + L++SSQK
Sbjct  12   VASLVSRTGRHLQRYN-KGRRQVVGCIPYRYTKGKGE-----------DGFQVLVISSQK  59

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DE++++ A+RET+EEAGV G +   LG+W F+S++ G  +EG+M PL
Sbjct  60   GKGMLFPKGGWESDETIKQGAVRETYEEAGVKGVLEPQLGEWTFQSRTHGTDYEGYMFPL  119

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENE  828
             V EELD WPEK  R R W+S  EA E C H WMKEALDVLV +L  QQ+ DE+E
Sbjct  120  RVKEELDFWPEKTNRLRKWMSVTEARECCQHWWMKEALDVLVDRLAGQQQLDEDE  174



>emb|CDY19204.1| BnaC05g14050D [Brassica napus]
Length=209

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++ KV S+ SRTGRDLQRY+  G RQVVGC+PYRY++ +Q  G+         ++E LL+
Sbjct  35   QIEKVVSLVSRTGRDLQRYDNAGYRQVVGCVPYRYKK-RQGNGT------ESKEIELLLI  87

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QK   M+FPKGGWE DES+EEAALRET EEAGV GE+   LGKW +KSK   V+HEG+
Sbjct  88   SAQKGKGMLFPKGGWEIDESMEEAALRETIEEAGVTGELEEKLGKWQYKSKRHSVIHEGY  147

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            M  L+V +E + WPE + RQR WV   EA EVC + WMKEAL+  V+ L  + EE E EA
Sbjct  148  MFALLVDQEYERWPEAETRQRRWVGLDEAREVCQNWWMKEALEAFVN-LKCKAEEVEIEA  206



>ref|XP_004297443.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Fragaria vesca 
subsp. vesca]
Length=177

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 121/174 (70%), Gaps = 10/174 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +RTGR+LQRYN+ G RQVVGCIPYRY+ G     S         +LEFL+++SQK   
Sbjct  4    LVARTGRELQRYNM-GRRQVVGCIPYRYKNGVDGTES--------KELEFLVITSQKGNA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
             MFPKGGWE DES+EEAA RE+ EEAGV G V   LG+W F SK     +EG+M PL V 
Sbjct  55   FMFPKGGWELDESVEEAASRESLEEAGVLGNVECQLGQWSFMSKRHDTYYEGYMFPLFVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEE-DENEA  831
            E+LD WPEK+VRQR W++  +A E C H WMKEALD+LV +LT +Q + DE +A
Sbjct  115  EQLDLWPEKNVRQRVWMTAAKAREACQHWWMKEALDILVERLTSEQNQRDEEDA  168



>ref|NP_001236150.1| uncharacterized protein LOC100527186 [Glycine max]
 gb|ACU16237.1| unknown [Glycine max]
 gb|KHN16539.1| Nudix hydrolase 17, mitochondrial [Glycine soja]
Length=171

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 121/174 (70%), Gaps = 14/174 (8%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYR---EGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            + SR+GR+LQRYN  G RQVVGCIPYRY+   EGK S           ++LE L+VSSQK
Sbjct  4    LVSRSGRELQRYNNMGGRQVVGCIPYRYKQDIEGKMS-----------NELEVLVVSSQK  52

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               +MFPKGGWE DES+EEAA RE+ EEAGV G +   LG+W F SK  G+ +EG M P+
Sbjct  53   GQGLMFPKGGWELDESVEEAAYRESLEEAGVMGMIERELGQWNFISKRYGIYYEGHMFPM  112

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDEN  825
             V E+LD WPEK++R+R W++  EA EVC H WMKEALD+LV ++   Q+  E+
Sbjct  113  FVKEQLDIWPEKNLRRRIWMTVAEAREVCQHWWMKEALDILVQRIVSSQQRKED  166



>ref|XP_006304212.1| hypothetical protein CARUB_v10010316mg [Capsella rubella]
 gb|EOA37110.1| hypothetical protein CARUB_v10010316mg [Capsella rubella]
Length=204

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 121/167 (72%), Gaps = 7/167 (4%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++ KV S+ SRTGRDLQRY+  G RQVVGC+PYR++  KQ    I        ++E LLV
Sbjct  36   QIEKVVSLVSRTGRDLQRYDNSGYRQVVGCVPYRFK--KQEVNGIES-----QEIEVLLV  88

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QKS  M+FPKGGWE DES+EEAALRET EEAGV GE+G  LG+W +KSK   ++H+G+
Sbjct  89   SAQKSKGMLFPKGGWETDESMEEAALRETIEEAGVTGELGEKLGRWQYKSKRHSIIHDGY  148

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVS  792
            M  L+V +E + WPE ++R+R WVS  EA EVC + WM+EAL+  ++
Sbjct  149  MFALLVSQEFELWPEAEIRERRWVSLDEAREVCQNWWMREALEAFIN  195



>gb|ACJ83842.1| unknown [Medicago truncatula]
Length=230

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 120/169 (71%), Gaps = 16/169 (9%)
 Frame = +1

Query  307  DSMC---SRTGRDLQRYNVQGCRQVVGCIPYRYRE-GKQSAGSIIHGAPLVDDLEFLLVS  474
            + MC    RTGR LQRY  QGCRQVVGCIPYRY++ G Q             ++E LL+S
Sbjct  71   NMMCLVSPRTGRHLQRYE-QGCRQVVGCIPYRYKKNGTQE-----------KEIEVLLIS  118

Query  475  SQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFM  654
            +QK   M FPKG WE+DE++E+AALRET EEAGV G V S LGKW++KSK    +HEG+M
Sbjct  119  AQKGSGMQFPKGSWEKDETMEQAALRETIEEAGVIGSVESNLGKWYYKSKRQPTMHEGYM  178

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             PL+V +ELD+WPE ++R+R W++  EA E+C + WMKEALD LVS+ T
Sbjct  179  FPLLVSKELDNWPEMNIRRRKWLTVDEAKEICPYAWMKEALDELVSRQT  227



>gb|AFK40406.1| unknown [Lotus japonicus]
Length=207

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 126/169 (75%), Gaps = 11/169 (7%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVD--DLEFLLVSSQK  483
            ++ SRTGR+LQRY  +G RQVVGCIPYR++ G++        A L D  +LE L++SSQK
Sbjct  12   ALVSRTGRELQRYR-EGRRQVVGCIPYRFKVGEK--------ASLNDSGELEVLVISSQK  62

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               ++FPKGGWE DES +EAALRET EEAGV G VG  LGKW FKSK+   L+EG+M PL
Sbjct  63   GKGLLFPKGGWELDESQKEAALRETLEEAGVRGIVGGRLGKWSFKSKTHDALYEGYMFPL  122

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQ  810
            +V E+L+ WPE+++RQR W+S  EA EVC H WMKEALD LV++LT Q+
Sbjct  123  LVQEQLEFWPEQNLRQRIWMSVTEAREVCQHWWMKEALDRLVNRLTGQK  171



>ref|XP_004503362.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Cicer arietinum]
Length=170

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 120/162 (74%), Gaps = 8/162 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SR+GR+LQRYN  G RQVVGCIPYRY+E        I+G  + ++LE L+VSSQK   
Sbjct  4    LVSRSGRELQRYNNMGGRQVVGCIPYRYKED-------ING-NMGNELEVLVVSSQKGHA  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G+V   LG+W F SK  G+ +EG+M PL V 
Sbjct  56   LMFPKGGWELDESVEEAACRESLEEAGVIGKVECELGQWNFISKRHGIYYEGYMFPLFVK  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQL  798
            E+LD WPEK++R+R W++  +A EVC H WMKEALD+LV +L
Sbjct  116  EQLDHWPEKNLRRRIWMTVAQAREVCQHWWMKEALDILVQRL  157



>emb|CDY26172.1| BnaA06g12450D [Brassica napus]
Length=209

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 127/182 (70%), Gaps = 8/182 (4%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++ KV S+ SRTGRDLQRY+  G RQVVGC+PYRY++ +Q  G+         ++E LL+
Sbjct  35   QIEKVVSLVSRTGRDLQRYDNAGYRQVVGCVPYRYKK-RQGNGT------ESKEIELLLI  87

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QK   M+FPKGGWE DES+EEAALRET EEAGV GE+   LGKW +KSK   V+HEG+
Sbjct  88   SAQKGKGMLFPKGGWEIDESMEEAALRETIEEAGVTGELEERLGKWQYKSKRQSVIHEGY  147

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            M  L V +E + WPE + RQR WV   EA EVC + WM+EAL+V V+ L  + EE E EA
Sbjct  148  MFALRVDQEYERWPEAETRQRRWVGLDEAREVCQNWWMREALEVFVN-LKCKAEEVEIEA  206

Query  832  RN  837
             +
Sbjct  207  ND  208



>ref|XP_003637683.1| Nudix hydrolase [Medicago truncatula]
 gb|AFK47343.1| unknown [Medicago truncatula]
 gb|KEH40611.1| nudix hydrolase-like protein [Medicago truncatula]
Length=165

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 120/169 (71%), Gaps = 8/169 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SR+GR +QRYN  G RQVVGCIPYRY++        I G  + ++LE L+VSSQK   
Sbjct  4    LVSRSGRQMQRYNETGGRQVVGCIPYRYKQD-------IDGN-MGNELEVLVVSSQKGQS  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
             MFPKGGWE DESLEEAA RE+ EEAGV G V   LG+W F SK  G  +EG M PL+V 
Sbjct  56   FMFPKGGWELDESLEEAACRESLEEAGVIGTVEHELGEWSFISKRYGTYYEGHMFPLLVK  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEED  819
            E+L+ WPEK++R R W++  EA +VC H WMKEALD+LV +LTLQ+ ++
Sbjct  116  EQLEHWPEKNLRTRIWMNVVEARDVCQHWWMKEALDILVDRLTLQKNKN  164



>ref|XP_011070581.1| PREDICTED: nudix hydrolase 17, mitochondrial [Sesamum indicum]
Length=173

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 119/175 (68%), Gaps = 6/175 (3%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            M +RTGR LQRYN Q  R VVGCIPYRY+ GK+      H      +LE L++SS+KS  
Sbjct  4    MVARTGRHLQRYN-QDHRLVVGCIPYRYKNGKKGCSPEDH-----HELEVLVISSKKSDA  57

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            MMFPKGGWE DES+EEAA RE+ EEAGV G V   LG+W FKSKS  + H+GFM PL+V 
Sbjct  58   MMFPKGGWEVDESVEEAASRESLEEAGVLGNVECELGRWIFKSKSRELYHQGFMFPLLVT  117

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEARN  837
            ++LD WPEK  R+R W+S  EA E C   WMKEALD+LV +L     + EN  ++
Sbjct  118  QQLDLWPEKAARKREWMSVDEAREACGQWWMKEALDILVDRLRSSPLKQENHVQS  172



>ref|XP_008227931.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Prunus mume]
Length=194

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 119/162 (73%), Gaps = 6/162 (4%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            ++ SRTGR LQRY+ +G RQVVGCIPYRY+  KQ+     H AP   +LE L+++SQK  
Sbjct  12   ALVSRTGRHLQRYS-KGRRQVVGCIPYRYKTSKQTPSK--HDAP---ELEVLVITSQKGK  65

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             M+FPKGGWE DES E AA RET EEAGV G +   LGKW FKSKS    ++G+M PL+V
Sbjct  66   GMLFPKGGWEIDESKEGAASRETLEEAGVRGLIEGELGKWIFKSKSHDAYYDGYMFPLLV  125

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
             E+LD WPEK++RQR W+S +EA EVC H WMKEALD LV++
Sbjct  126  QEQLDFWPEKNLRQRIWMSAQEAREVCQHWWMKEALDRLVNR  167



>ref|XP_002890268.1| hypothetical protein ARALYDRAFT_312784 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66527.1| hypothetical protein ARALYDRAFT_312784 [Arabidopsis lyrata subsp. 
lyrata]
Length=207

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 126/182 (69%), Gaps = 10/182 (5%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++ KV S+ SRTGRDLQRY+  G RQVVGC+PYRY+  KQ    I        +++ LLV
Sbjct  36   QIEKVVSLVSRTGRDLQRYDNSGYRQVVGCVPYRYK--KQQVNGI-----ETQEIQVLLV  88

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QK   M+FPKGGWE DES+EEAALRET EEAGV GE+   LGKW +KSK   ++H+G+
Sbjct  89   SAQKGKGMLFPKGGWETDESMEEAALRETIEEAGVTGELEEKLGKWQYKSKRHSIIHDGY  148

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            M  L+V +E + WPE ++RQR WVS  EA EVC + WM+EAL+  ++   L    D++E+
Sbjct  149  MFALLVSQEFERWPEAEMRQRRWVSLDEAREVCQNWWMREALEAFINLKCLA---DDDES  205

Query  832  RN  837
             N
Sbjct  206  GN  207



>gb|AFK34506.1| unknown [Lotus japonicus]
Length=170

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 120/170 (71%), Gaps = 8/170 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SR+GR+LQRYN  G RQVVGCIPYRY+E        I G  + ++ E L+VSSQK   
Sbjct  4    LVSRSGRELQRYNNMGGRQVVGCIPYRYKED-------IDG-NMSNESEVLVVSSQKGQG  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA+RE+ EEAGV G V   LG+W F SK  G+ +EG M PL V 
Sbjct  56   LMFPKGGWEIDESVEEAAIRESLEEAGVIGTVEGELGQWNFISKRYGIYYEGHMFPLFVK  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE  822
            E+LD WPEK++R+R W++  +A E C H WMKEALD+LV +L   Q++ +
Sbjct  116  EQLDQWPEKNLRRRVWMTVAQAREACQHWWMKEALDILVQRLVSSQQQKK  165



>ref|XP_007152662.1| hypothetical protein PHAVU_004G148500g [Phaseolus vulgaris]
 gb|ESW24656.1| hypothetical protein PHAVU_004G148500g [Phaseolus vulgaris]
Length=258

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 120/172 (70%), Gaps = 12/172 (7%)
 Frame = +1

Query  322  RTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMMF  501
            RTGR LQRY+ QGCRQVVGCIPYRY+                 +LE L++S+QK   M F
Sbjct  97   RTGRHLQRYD-QGCRQVVGCIPYRYKNNGTKD----------KELEVLVISAQKGHGMQF  145

Query  502  PKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEEL  681
            PKGGWE DES+E+AALRET EEAGV G V S LGKW++KSK   ++HEG+M PL+V +EL
Sbjct  146  PKGGWEIDESMEQAALRETVEEAGVIGSVESNLGKWYYKSKRQPIMHEGYMFPLLVKKEL  205

Query  682  DDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLV-SQLTLQQEEDENEAR  834
            D+WPE + R+R W++  EA E+C + WMKEALDVLV  Q  L  ++D +  R
Sbjct  206  DNWPEMNTRKRRWMTVTEAKEICPYTWMKEALDVLVMRQNQLHSKKDVDMCR  257



>ref|XP_004503124.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Cicer arietinum]
Length=190

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 126/170 (74%), Gaps = 7/170 (4%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V  + SRTGR+LQRY  +G RQVVGCIPYR++ G+++   I       D+LE L++SSQK
Sbjct  10   VVVLVSRTGRELQRYK-KGRRQVVGCIPYRFKIGEKNTLDI------SDELEVLVISSQK  62

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES +EAALRET EEAGV G V   LGKW FKSK+   L++G+M PL
Sbjct  63   GKGMLFPKGGWEIDESQKEAALRETIEEAGVRGIVEGKLGKWSFKSKTHDTLYDGYMFPL  122

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQE  813
            +V E+L+ WPE+++RQR W++ +EA +VC H WMKEALD LV++L  Q++
Sbjct  123  LVQEQLEFWPEQNLRQRKWMNIKEARDVCQHWWMKEALDRLVNRLYGQKQ  172



>ref|XP_009356007.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Pyrus x bretschneideri]
Length=208

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 129/197 (65%), Gaps = 14/197 (7%)
 Frame = +1

Query  238  VLRKQGGSGLICVKK*EMKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSA  417
            V  K+ G   I      M++  + S+ SRTGR  QRY  +GCRQVVGCIPYRYR+ ++S+
Sbjct  21   VFSKKNGGEFI-----PMQIENMVSLVSRTGRQFQRYE-KGCRQVVGCIPYRYRKTEKSS  74

Query  418  GSIIHGAPLVDDLEFLLVSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSC  597
                      ++LE L++SSQK   +MFPKGGWE DES+EEAA RET EEAGV G + + 
Sbjct  75   CD--------EELEVLVISSQKGKGIMFPKGGWEMDESIEEAAKRETLEEAGVTGHLETR  126

Query  598  LGKWFFKSKSLGVLHEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEAL  777
            LG W +KSKS G  HEG+M PL+V ++LD WPEK  R+R W++  EA E C + WMKEAL
Sbjct  127  LGMWRYKSKSQGTFHEGYMFPLLVQQQLDLWPEKSSRKREWMTVAEAREACQNWWMKEAL  186

Query  778  DVLVSQLTLQQEEDENE  828
            + LV +    Q + E E
Sbjct  187  EKLVCRQMQPQPKGEEE  203



>ref|XP_010519202.1| PREDICTED: nudix hydrolase 4-like [Tarenaya hassleriana]
Length=215

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 121/168 (72%), Gaps = 7/168 (4%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++  V ++ SRTGRDLQRY+ +G RQVVGCIPYRY++       I       +++E LL+
Sbjct  35   QIDNVVTLVSRTGRDLQRYDSKGFRQVVGCIPYRYKKRNVDGNDI-------EEIEVLLI  87

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QK   M+FPKGGWE DES+EEAALRET EEAGV G++   LGKW +KSK   ++HEG+
Sbjct  88   SAQKGKGMLFPKGGWEMDESIEEAALRETIEEAGVTGQLEEKLGKWQYKSKRHSMVHEGY  147

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            M PL+V ++ + WPE ++RQR W++  EA EVC + WM+EAL+  +++
Sbjct  148  MFPLLVSQQFEHWPEAEIRQRKWMNLSEAREVCHNWWMREALEEFINR  195



>ref|XP_004498257.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Cicer arietinum]
Length=162

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 117/161 (73%), Gaps = 8/161 (5%)
 Frame = +1

Query  319  SRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMM  498
            SRTGR +QRYN  G RQVVGCIPYRY++        I G  + ++LE L+VSSQK   +M
Sbjct  6    SRTGRQMQRYNSAGGRQVVGCIPYRYKQE-------IDGN-MSNELEVLVVSSQKGQALM  57

Query  499  FPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEE  678
            FPKGGWE DESLEEAALRE+ EEAGV G V   LG+W F SK  G  +EG M PL+V E+
Sbjct  58   FPKGGWELDESLEEAALRESLEEAGVIGLVEHELGQWSFISKRHGTYYEGHMFPLLVKEQ  117

Query  679  LDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            L+ WPEK++R+R W++  EA EVC H WMKEALD+LV +LT
Sbjct  118  LELWPEKNLRRRIWMNVVEAREVCQHWWMKEALDILVDRLT  158



>emb|CDP16317.1| unnamed protein product [Coffea canephora]
Length=175

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 120/172 (70%), Gaps = 8/172 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR LQRYN +G R VVGCIPYR++  ++          + + +E L++SSQ    
Sbjct  4    LVSRTGRHLQRYNDKGRRLVVGCIPYRFKGQEKDK--------VNNQVEVLVISSQNGQG  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            MMFPKGGWE DESL EAA RE+ EEAGV G V   LG W FKSKS G  HEG+M PL+V 
Sbjct  56   MMFPKGGWELDESLIEAACRESLEEAGVLGNVEDELGIWRFKSKSQGTYHEGYMFPLLVT  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENE  828
            E+LD WPE++VR+R W++  EA EVC H WMKEALD  V++L L++ ED+ +
Sbjct  116  EQLDLWPEQNVRKRVWMTVAEAREVCKHWWMKEALDKFVNRLPLEELEDQQQ  167



>ref|XP_002888932.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65191.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=194

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 118/163 (72%), Gaps = 13/163 (8%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            S+ SRTGRDLQRYN  G RQVVGC+PYRY++         HG     ++E LL+S+QK  
Sbjct  39   SLVSRTGRDLQRYNTAGYRQVVGCVPYRYKK---------HGG---GEIEVLLISAQKKG  86

Query  490  R-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLI  666
            + M+ PKGGWE DES+EEAALRET EEAGV G++   LGKW +KSK   ++H+G+M PL+
Sbjct  87   KGMLLPKGGWEIDESIEEAALRETIEEAGVTGQLEESLGKWQYKSKRHSMIHDGYMFPLL  146

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            V ++ + WPE D+RQR WVS  EA+E+C + WM+EAL+  +++
Sbjct  147  VSQQFERWPEADIRQRKWVSLSEAIELCQNSWMREALEAFINR  189



>ref|XP_003534133.1| PREDICTED: nudix hydrolase 4 [Glycine max]
 gb|ACU16174.1| unknown [Glycine max]
 gb|KHN43646.1| Nudix hydrolase 4 [Glycine soja]
Length=203

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 122/173 (71%), Gaps = 14/173 (8%)
 Frame = +1

Query  322  RTGRDLQRYNVQGCRQVVGCIPYRYRE-GKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMM  498
            RTGR LQRY+ +GCRQVVGCIPYRY+  G Q             +LE L++S+QK   M 
Sbjct  42   RTGRHLQRYD-KGCRQVVGCIPYRYKNNGTQDK-----------ELEVLVISAQKGHGMQ  89

Query  499  FPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEE  678
            FPKGGWE DES+E+AALRET EEAGV G V   LGKW++KSK   ++HEG+M PL+V +E
Sbjct  90   FPKGGWETDESMEQAALRETIEEAGVVGSVEGKLGKWYYKSKRQPIMHEGYMFPLLVKKE  149

Query  679  LDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT-LQQEEDENEAR  834
            LD+WPE + R+R W++  EA E+C + WMKEALD LV + T L  ++D + +R
Sbjct  150  LDNWPEMNTRKRRWMTVDEAKEICPYAWMKEALDELVRRQTQLHSKKDGDMSR  202



>ref|XP_007160422.1| hypothetical protein PHAVU_002G320500g [Phaseolus vulgaris]
 gb|ESW32416.1| hypothetical protein PHAVU_002G320500g [Phaseolus vulgaris]
Length=168

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 118/170 (69%), Gaps = 8/170 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SR+GR+LQRYN  G RQVVGCIPYRY+E             + ++LE L+VSSQK   
Sbjct  4    LVSRSGRELQRYNNMGGRQVVGCIPYRYKEDVD--------GNMSEELEVLVVSSQKGQG  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G +   LG+W F SK  GV +EG M P+ V 
Sbjct  56   LMFPKGGWELDESVEEAACRESLEEAGVLGSIEHELGQWNFISKRYGVYYEGHMFPMFVK  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE  822
            E+LD WPE+++R+R W+S  EA EVC H WMKEALD+LV ++    +E +
Sbjct  116  EQLDTWPEQNLRRRIWMSVGEAREVCQHWWMKEALDILVQRMVSSAQEKD  165



>ref|XP_009110355.1| PREDICTED: nudix hydrolase 4 [Brassica rapa]
 emb|CDX96726.1| BnaA08g22690D [Brassica napus]
Length=214

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 125/182 (69%), Gaps = 8/182 (4%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++ KV S+ SRTGRDLQRY+  G RQVVGC+PYRY+  +      ++G     ++E LL+
Sbjct  35   QIEKVVSLVSRTGRDLQRYDNSGYRQVVGCVPYRYKTQQ------VNGTE-SKEIEVLLI  87

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QK   M+FPKGGWE DES+EEAALRET EEAGV GE+   LGKW +KSK   ++H G+
Sbjct  88   SAQKGKGMLFPKGGWEIDESMEEAALRETIEEAGVTGELEEKLGKWQYKSKRHNIIHHGY  147

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            M  L+V +E + WPE ++RQR WV   EA EVC + WM+EAL+  V+ +    EE E EA
Sbjct  148  MFALLVDQEFERWPEAEMRQRKWVGLDEAGEVCQNWWMREALEAFVN-VKCNTEEVEIEA  206

Query  832  RN  837
             N
Sbjct  207  SN  208



>ref|XP_008374870.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Malus domestica]
 ref|XP_008346808.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Malus domestica]
Length=208

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 129/197 (65%), Gaps = 14/197 (7%)
 Frame = +1

Query  238  VLRKQGGSGLICVKK*EMKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSA  417
            V  K+ G   I      M++  + S+ SRTGR  QRY  +GCRQVVGCIPYRYR+ ++++
Sbjct  21   VFSKKNGGEFI-----PMQIENMVSLVSRTGRQFQRYE-KGCRQVVGCIPYRYRKTEKTS  74

Query  418  GSIIHGAPLVDDLEFLLVSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSC  597
                      ++LE L++SSQK   M+FPKGGWE DES+EEAA RET EEAGV G + + 
Sbjct  75   SD--------EELEVLVISSQKGKGMLFPKGGWEMDESIEEAAKRETLEEAGVIGHLETR  126

Query  598  LGKWFFKSKSLGVLHEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEAL  777
            LG W +KSKS G  HEG+M PL+V ++L+ WPEK  R+R W++  EA E C + WMKEAL
Sbjct  127  LGMWRYKSKSQGAFHEGYMFPLLVQQQLELWPEKSSRKREWMTVAEAREACQNWWMKEAL  186

Query  778  DVLVSQLTLQQEEDENE  828
            + LV +    Q + E E
Sbjct  187  EKLVCRQMQPQPKGEEE  203



>ref|XP_006482118.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Citrus sinensis]
Length=196

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 127/177 (72%), Gaps = 8/177 (5%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR LQRY  +G RQVVGCIPYRY+  KQS    I+     +DLE L++SSQK
Sbjct  20   VGNLVSRTGRHLQRYQ-KGRRQVVGCIPYRYKCVKQSLD--INE----EDLEVLVISSQK  72

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEV-GSCLGKWFFKSKSLGVLHEGFMLP  660
               M+FPKGGWE DES++EAALRET EEAGV G V    LG+W FKS++    ++G+M P
Sbjct  73   GKGMLFPKGGWEIDESIQEAALRETIEEAGVTGIVECELLGEWNFKSRAHNTDYQGYMFP  132

Query  661  LIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            L+V E+L +WPEK+VR R W+S  EA +VC H WMKEALD LV +LT QQ  D+ ++
Sbjct  133  LLVQEQLAEWPEKNVRSRKWMSAAEARKVCQHWWMKEALDRLVMRLTSQQLHDKEDS  189



>ref|XP_004512769.1| PREDICTED: nudix hydrolase 4-like isoform X1 [Cicer arietinum]
 ref|XP_004512770.1| PREDICTED: nudix hydrolase 4-like isoform X2 [Cicer arietinum]
Length=242

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 115/161 (71%), Gaps = 13/161 (8%)
 Frame = +1

Query  322  RTGRDLQRYNVQGCRQVVGCIPYRYR-EGKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMM  498
            RTGR LQRY  +GCRQVVGCIPYRY+  G Q             ++E LL+S+QK   M 
Sbjct  91   RTGRHLQRYE-KGCRQVVGCIPYRYKSNGTQE-----------KEIEVLLISAQKGHGMQ  138

Query  499  FPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEE  678
            FPKGGWE DES+E+AALRET EEAGV G V   LGKW++KSK    +HEG+M PL+V +E
Sbjct  139  FPKGGWESDESMEQAALRETIEEAGVLGSVEGNLGKWYYKSKRQPTMHEGYMFPLLVSKE  198

Query  679  LDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            LD+WPE ++R+R W+S  EA E+C + WMKEALD L+S+ T
Sbjct  199  LDNWPEMNLRKRKWLSVAEAKEICPYAWMKEALDELLSRQT  239



>ref|XP_011021781.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Populus euphratica]
Length=176

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 125/174 (72%), Gaps = 11/174 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +R+GR+LQRY+  G RQVVGCIPYR++    S GS+       D+LE L+++SQK   
Sbjct  4    LVARSGRELQRYDNLGRRQVVGCIPYRFKNC--SDGSV------GDELEVLVITSQKGQA  55

Query  493  --MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLI  666
              MMFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SK  G  +EG+M PL+
Sbjct  56   RGMMFPKGGWELDESVEEAASRESLEEAGVLGNVEDGLGKWNFLSKRHGTFYEGYMFPLL  115

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ-LTLQQEEDEN  825
            V ++LD WPEK+VRQR W++  EA EVC H WMKEAL++LV +  +LQQ+ +EN
Sbjct  116  VTKQLDLWPEKNVRQRIWMTVDEAREVCRHWWMKEALNILVERHKSLQQQNEEN  169



>ref|XP_010271341.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Nelumbo nucifera]
Length=166

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 120/174 (69%), Gaps = 11/174 (6%)
 Frame = +1

Query  295  LTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVS  474
            +  VD + SRTGRDLQRY+  G RQVVGCIPYR       A         ++DLE L++S
Sbjct  1    MAVVDVLVSRTGRDLQRYDEVGRRQVVGCIPYRCNNPSNDAD--------INDLEVLMIS  52

Query  475  SQKSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            SQK    M+FPKGGWEQDES+ +AA RET+EEAGV G + + LG+W FKSK  G  +EG+
Sbjct  53   SQKKRHIMLFPKGGWEQDESIVQAAERETYEEAGVTGTIKTGLGRWLFKSKRFGSDYEGY  112

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQE  813
            M PL+V + LD+WPEK+VRQR W++  EA + C H WM EAL+ LV  L LQQ+
Sbjct  113  MYPLLVEKLLDNWPEKNVRQRKWMTVDEAKKSCPHDWMIEALEELV--LRLQQK  164



>ref|XP_004490826.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Cicer arietinum]
Length=175

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 123/167 (74%), Gaps = 8/167 (5%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR+LQRY  +G RQVVGCIPYRY    Q++  I       ++LE L+++S+K
Sbjct  10   VVALVSRTGRELQRYR-KGRRQVVGCIPYRYIICDQTSLEI------PEELEVLVITSKK  62

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGE-VGSCLGKWFFKSKSLGVLHEGFMLP  660
            S RM+FPKGGWE DES +EAALRET EEAGV G  VG  LGKW FK K+ G L+EG+M P
Sbjct  63   SKRMLFPKGGWESDESKKEAALRETVEEAGVRGIIVGGKLGKWRFKGKNNGSLYEGYMFP  122

Query  661  LIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            L+V E+LD WPE+ VRQR+W+   EA EVC   WM+EAL+ LV+++T
Sbjct  123  LLVQEQLDIWPEQSVRQRTWMKVSEAREVCQQWWMREALERLVNRVT  169



>ref|XP_003528984.1| PREDICTED: nudix hydrolase 4-like [Glycine max]
 gb|KHN45259.1| Nudix hydrolase 4 [Glycine soja]
Length=203

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 121/173 (70%), Gaps = 14/173 (8%)
 Frame = +1

Query  322  RTGRDLQRYNVQGCRQVVGCIPYRYRE-GKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMM  498
            RTGR LQRY+  GCRQVVGCIPYRY+  G Q             +LE L++S+QK   M 
Sbjct  42   RTGRHLQRYD-NGCRQVVGCIPYRYKNNGTQDK-----------ELEVLVISAQKGHGMQ  89

Query  499  FPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEE  678
            FPKGGWE DES+E+AALRET EEAGV G V S LGKW++KSK   ++HEG+M PL+V +E
Sbjct  90   FPKGGWETDESMEQAALRETIEEAGVVGSVESKLGKWYYKSKRQPIMHEGYMFPLLVKKE  149

Query  679  LDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT-LQQEEDENEAR  834
            LD+WPE + R+R W++  EA  +C + WMKEALD LV + T L  ++D + +R
Sbjct  150  LDNWPEMNTRKRRWMTVDEAKVICPYAWMKEALDELVRRQTQLHSKKDGDMSR  202



>ref|NP_173266.1| nudix hydrolase 4 [Arabidopsis thaliana]
 sp|Q9LE73.1|NUDT4_ARATH RecName: Full=Nudix hydrolase 4; Short=AtNUDT4; AltName: Full=ADP-ribose 
pyrophosphatase; AltName: Full=NADH pyrophosphatase 
[Arabidopsis thaliana]
 gb|AAF25994.1|AC013354_13 F15H18.18 [Arabidopsis thaliana]
 gb|AAF78378.1|AC069551_11 T10O22.27 [Arabidopsis thaliana]
 gb|AAO23625.1| At1g18300 [Arabidopsis thaliana]
 dbj|BAE99375.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29699.1| nudix hydrolase 4 [Arabidopsis thaliana]
Length=207

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 125/182 (69%), Gaps = 10/182 (5%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++ KV S+ SRTGRDLQRY+  G RQVVGC+PYRY+  KQ    +         ++ LLV
Sbjct  36   QIEKVVSLVSRTGRDLQRYDHAGYRQVVGCVPYRYK--KQEVNGV-----ETQVIQVLLV  88

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QK   M+FPKGGWE DES+EEAALRET EEAGV GE+   LGKW +KSK   ++H+G+
Sbjct  89   SAQKGKGMLFPKGGWETDESMEEAALRETIEEAGVTGELEEKLGKWQYKSKRHSIIHDGY  148

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            M  L+V +E + WPE ++RQR WVS  EA EVC + WM+EAL+  ++   L    D++E+
Sbjct  149  MFALLVSQEFERWPEAEMRQRRWVSLDEAREVCQNWWMREALEAFINLKCLA---DDDES  205

Query  832  RN  837
             N
Sbjct  206  GN  207



>ref|XP_002322124.2| hypothetical protein POPTR_0015s04970g [Populus trichocarpa]
 gb|EEF06251.2| hypothetical protein POPTR_0015s04970g [Populus trichocarpa]
Length=266

 Score =   184 bits (467),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 115/160 (72%), Gaps = 9/160 (6%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            S+ SRTGR+LQRY  +GCR VVGCIPYRY++ ++           V++LE L++S+Q   
Sbjct  105  SLVSRTGRNLQRYE-KGCRLVVGCIPYRYKKSQEPTS--------VEELEVLVISAQNGQ  155

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             M+FPKGGWE DES+EEAA+RET EEAGV G VG  LG W +KSK   ++HE +M PL+V
Sbjct  156  GMLFPKGGWENDESMEEAAMRETEEEAGVIGVVGGKLGPWQYKSKRSSIMHESYMFPLLV  215

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLV  789
             EELD WPE  +R+R WVS  EA EVC + WM++AL+ LV
Sbjct  216  QEELDSWPESKIRKRRWVSINEAREVCHNWWMRDALEELV  255



>emb|CDX83857.1| BnaC08g17880D [Brassica napus]
Length=213

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 124/180 (69%), Gaps = 8/180 (4%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++ KV S+ SRTGRDLQRY+  G RQVVGC+PYRY+  +      ++G     ++E LL+
Sbjct  35   QIEKVVSLVSRTGRDLQRYDNSGYRQVVGCVPYRYKTQQ------VNGTE-SKEIEVLLI  87

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QK   M+FPKGGWE DES+EEAALRET EEAGV GE+   LG+W +KSK   ++H G+
Sbjct  88   SAQKGKGMLFPKGGWEIDESMEEAALRETIEEAGVTGELEEKLGRWQYKSKRHNIIHHGY  147

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            M  L+V +E + WPE ++RQR WV   EA EVC + WM+EAL+  V+ L    EE E EA
Sbjct  148  MFALLVDQEFERWPEAEMRQRKWVGLDEAREVCQNWWMREALEAFVN-LKCNTEEVEIEA  206



>gb|AFK38562.1| unknown [Lotus japonicus]
Length=201

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 119/169 (70%), Gaps = 12/169 (7%)
 Frame = +1

Query  292  KLTKVDSMCS-RTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            +L  V S+ S RTGR LQRY+ +GCR VVGCIPYRY+  +              ++E L+
Sbjct  32   QLENVISLVSPRTGRHLQRYD-KGCRLVVGCIPYRYKRNETQD----------KEIEVLV  80

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +S+QK   M FPKGGWE DES+E+AALRET EEAGV G V S LGKW++KSK    +HEG
Sbjct  81   ISAQKGHGMQFPKGGWESDESMEQAALRETIEEAGVVGSVESKLGKWYYKSKRQPTVHEG  140

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            +M PL+V +ELD+WPE + R+R W++  EA E+C + WMKEALD LV++
Sbjct  141  YMFPLLVSKELDNWPEMNTRRRKWITVAEAKEICPYAWMKEALDELVNR  189



>gb|AAG30977.1|AC012396_13 unknown protein [Arabidopsis thaliana]
Length=177

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 118/166 (71%), Gaps = 13/166 (8%)
 Frame = +1

Query  301  KVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQ  480
            KV S+ SRTGRDLQRYN  G RQVVGC+PYRY++         HG     ++E LL+S+Q
Sbjct  19   KVVSLVSRTGRDLQRYNTAGYRQVVGCVPYRYKK---------HGG---GEIEVLLISAQ  66

Query  481  KSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFML  657
            K  + M+ PKGGWE DES+EEAALRET EEAGV G++   LGKW +KSK   ++H+G M 
Sbjct  67   KKGKGMLLPKGGWEIDESIEEAALRETIEEAGVTGQLEESLGKWQYKSKRHTMIHDGHMF  126

Query  658  PLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            PL+V ++ + WPE + RQR WVS  EA+E+C + WM+EAL+  +++
Sbjct  127  PLLVSQQFEIWPESEFRQRKWVSLSEAIELCQNSWMREALEAFINR  172



>ref|XP_002312457.2| MutT/nudix family protein [Populus trichocarpa]
 gb|EEE89824.2| MutT/nudix family protein [Populus trichocarpa]
Length=176

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 118/173 (68%), Gaps = 13/173 (8%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK--S  486
            M +R+GR+LQRY+  G RQVVGCIPYR++                D+LE L+++SQK  +
Sbjct  4    MVARSGRELQRYDDMGRRQVVGCIPYRFKNCSDGFNG--------DELEVLVITSQKGQT  55

Query  487  PRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLI  666
              MMFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SK  G  +EGFM PL 
Sbjct  56   QGMMFPKGGWELDESVEEAASRESLEEAGVLGNVEDELGKWNFLSKRHGTFYEGFMFPLF  115

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLV---SQLTLQQEE  816
            V ++LD WPEK VRQR W++  EA EVC H WMKEALD+LV   + L LQ+EE
Sbjct  116  VTKQLDLWPEKSVRQRIWMTVDEAREVCRHWWMKEALDILVERHTSLQLQKEE  168



>ref|NP_177495.2| nudix hydrolase 21 [Arabidopsis thaliana]
 sp|Q8VY81.1|NUD21_ARATH RecName: Full=Nudix hydrolase 21, chloroplastic; Short=AtNUDT21; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL62361.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72091.1| unknown protein [Arabidopsis thaliana]
 gb|AEE35473.1| nudix hydrolase 21 [Arabidopsis thaliana]
Length=198

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 118/166 (71%), Gaps = 13/166 (8%)
 Frame = +1

Query  301  KVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQ  480
            KV S+ SRTGRDLQRYN  G RQVVGC+PYRY++         HG     ++E LL+S+Q
Sbjct  40   KVVSLVSRTGRDLQRYNTAGYRQVVGCVPYRYKK---------HGG---GEIEVLLISAQ  87

Query  481  KSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFML  657
            K  + M+ PKGGWE DES+EEAALRET EEAGV G++   LGKW +KSK   ++H+G M 
Sbjct  88   KKGKGMLLPKGGWEIDESIEEAALRETIEEAGVTGQLEESLGKWQYKSKRHTMIHDGHMF  147

Query  658  PLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            PL+V ++ + WPE + RQR WVS  EA+E+C + WM+EAL+  +++
Sbjct  148  PLLVSQQFEIWPESEFRQRKWVSLSEAIELCQNSWMREALEAFINR  193



>ref|XP_002314788.2| MutT/nudix family protein [Populus trichocarpa]
 gb|EEF00959.2| MutT/nudix family protein [Populus trichocarpa]
Length=176

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 125/174 (72%), Gaps = 11/174 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +R+GR+LQRY+  G RQVVGCIPYR++    S GS+       D+LE L+++SQK   
Sbjct  4    LVARSGRELQRYDNLGRRQVVGCIPYRFKNC--SDGSV------GDELEVLVITSQKGQA  55

Query  493  --MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLI  666
              MMFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SK  G  +EG+M PL+
Sbjct  56   RGMMFPKGGWELDESVEEAASRESLEEAGVLGNVEDGLGKWNFLSKRHGTFYEGYMFPLL  115

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ-LTLQQEEDEN  825
            V ++LD WPEK+VRQR W++  EA EVC H WMKEALD+LV +  +LQQ+ +E+
Sbjct  116  VTKQLDLWPEKNVRQRIWMTVDEAREVCRHWWMKEALDMLVERHKSLQQQNEEH  169



>emb|CDY48805.1| BnaC02g34090D [Brassica napus]
Length=182

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 117/171 (68%), Gaps = 9/171 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGCIPYR++        +     + D++E L+
Sbjct  1    MGVEKMVCLVSRTGRQFQRYN-KGRRQVVGCIPYRFK--------LSSDGKISDEVEVLV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   MMFPKGGWE DES+EEAA RE+ EEAGV G +G  LGKW F SKS G  +EG
Sbjct  52   ISSQKGHAMMFPKGGWELDESVEEAAARESLEEAGVLGNIGHQLGKWDFLSKSRGTYYEG  111

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             M P++V E+LD WPE+  RQR W++  +A E C   WMKEALDVLV +L+
Sbjct  112  LMFPMLVTEQLDLWPEQHARQRIWMNVVDAREACRDWWMKEALDVLVERLS  162



>ref|XP_008393445.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Malus domestica]
Length=201

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 121/184 (66%), Gaps = 19/184 (10%)
 Frame = +1

Query  238  VLRKQGGSGLICVKK*EMKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSA  417
            V  K+ G   I      M++  + S+ SRTGR  QRY  +GCRQVVGCIPYRYR+     
Sbjct  21   VFSKKNGGDFI-----PMQIENMVSLVSRTGRQFQRYE-KGCRQVVGCIPYRYRKTD---  71

Query  418  GSIIHGAPLVDDLEFLLVSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSC  597
                      ++LE L++SSQK   M+FPKGGWE DES+EEAA RETFEEAGV G + + 
Sbjct  72   ----------EELEVLVISSQKGKGMLFPKGGWEMDESIEEAAKRETFEEAGVTGHLETR  121

Query  598  LGKWFFKSKSLGVLHEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEAL  777
            LG W + SK+ G +HEG+M PL+V ++L+ WPEK  R+R WV+  EA E C + WMKEAL
Sbjct  122  LGSWRYTSKTQGTVHEGYMFPLLVQQQLELWPEKSSRKREWVTVSEAREACQNWWMKEAL  181

Query  778  DVLV  789
            + LV
Sbjct  182  EKLV  185



>ref|XP_006302706.1| hypothetical protein CARUB_v10020817mg, partial [Capsella rubella]
 gb|EOA35604.1| hypothetical protein CARUB_v10020817mg, partial [Capsella rubella]
Length=261

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 116/166 (70%), Gaps = 11/166 (7%)
 Frame = +1

Query  295  LTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVS  474
            + KV S+ SRTGRDLQRYN  G RQVVGC+PYRY+      G I          E LL+S
Sbjct  99   IEKVVSLVSRTGRDLQRYNSSGHRQVVGCVPYRYKNHGCGGGEI----------EVLLIS  148

Query  475  SQKSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            +QK  + M+ PKGGWE DES+EEAALRET EEAGV G++   LGKW +KSK   ++H+G+
Sbjct  149  AQKKGKGMLLPKGGWEVDESIEEAALRETIEEAGVTGQLEESLGKWQYKSKRHSMVHDGY  208

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLV  789
            M PL+V ++ + WPE ++RQR WVS  EA+E+C + WM+EAL+  +
Sbjct  209  MFPLLVSQQFEQWPEAEIRQRRWVSLSEAVELCENSWMREALEAFI  254



>gb|KFK41790.1| hypothetical protein AALP_AA2G172400 [Arabis alpina]
Length=191

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 119/166 (72%), Gaps = 13/166 (8%)
 Frame = +1

Query  301  KVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQ  480
            KV S+ SRTGRDLQRY+  G RQVVGCIPYRY+  KQ +G I          E LL+S+Q
Sbjct  32   KVVSLVSRTGRDLQRYDTTGFRQVVGCIPYRYK--KQGSGEI----------EILLISAQ  79

Query  481  KSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFML  657
            K  + M+ PKGGWE DES+EEAALRET EEAGV GE+   LGKW +KSK   ++H+ +M 
Sbjct  80   KQGKGMLLPKGGWEIDESMEEAALRETIEEAGVTGELEETLGKWQYKSKRHNMIHDSYMF  139

Query  658  PLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            PL+V ++ + WPE ++RQR WVS  EA+E+C   WM+EAL+V +++
Sbjct  140  PLLVSQQFEQWPESEIRQRRWVSLDEAIELCQIWWMREALEVFINR  185



>ref|XP_006372557.1| MutT-like family protein [Populus trichocarpa]
 gb|ERP50354.1| MutT-like family protein [Populus trichocarpa]
Length=193

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 121/175 (69%), Gaps = 7/175 (4%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V S+ SRTGR LQRY+ +G RQVVGCIPYRY+ G  +         + D+LE L++SSQK
Sbjct  12   VASLVSRTGRHLQRYD-KGRRQVVGCIPYRYKNGSSNT------LEVEDELEVLVISSQK  64

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DE++++AA RET+EEAGV G V   LG W F+S++ G  ++G++ PL
Sbjct  65   GKGMLFPKGGWELDETIKQAASRETYEEAGVKGNVEHQLGHWTFQSRTHGTDYDGYLFPL  124

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENE  828
             V E LD WPEK+ RQR W+S  EA E C   WMKEALDVLV +L  +Q+  E E
Sbjct  125  HVKEVLDFWPEKNNRQRKWMSVEEARECCQRWWMKEALDVLVDRLAGRQQLGEEE  179



>ref|XP_011024029.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Populus euphratica]
Length=177

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 119/176 (68%), Gaps = 11/176 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK--S  486
            M +R+GR+LQRY+  G RQVVGCIPYR++                D+LE L+++SQK  +
Sbjct  4    MVARSGRELQRYDNMGRRQVVGCIPYRFKNCSDGLTG--------DELEVLVITSQKGQT  55

Query  487  PRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLI  666
              MMFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SK  G  +EGFM PL 
Sbjct  56   QGMMFPKGGWELDESVEEAASRESLEEAGVLGNVEDELGKWNFLSKRHGTFYEGFMFPLF  115

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT-LQQEEDENEA  831
            V ++LD WPEK VRQR W++  EA EVC H WMKEALD+LV + T LQQ + E  A
Sbjct  116  VTKQLDLWPEKSVRQRIWMTVDEAREVCRHWWMKEALDILVERHTSLQQLQKEELA  171



>ref|XP_009129215.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Brassica rapa]
Length=182

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 115/171 (67%), Gaps = 9/171 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGCIPYR++        +       D+ E L+
Sbjct  1    MGVEKMVCLVSRTGRQFQRYN-KGRRQVVGCIPYRFK--------LSSDGKFSDEFEILV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   MMFPKGGWE DES+EEAA RE+ EEAGV G +G  LGKW F SKS G  +EG
Sbjct  52   ISSQKGHAMMFPKGGWELDESVEEAAARESLEEAGVLGNIGHQLGKWDFLSKSRGTYYEG  111

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             M P++V E+LD WPE+  RQR W++  +A E C   WMKEALDVLV +L+
Sbjct  112  LMFPMLVTEQLDLWPEQHARQRIWMNVVDAREACRDWWMKEALDVLVERLS  162



>ref|XP_010428280.1| PREDICTED: nudix hydrolase 21, chloroplastic-like [Camelina sativa]
Length=204

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 119/168 (71%), Gaps = 10/168 (6%)
 Frame = +1

Query  295  LTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVS  474
            + KV S+ SRTGRDLQRY+  G RQVVGC+PYRY++         HG     ++E LL+S
Sbjct  40   IEKVVSLVSRTGRDLQRYSTSGHRQVVGCVPYRYKK---------HGGGGEREIEVLLIS  90

Query  475  SQKSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            +QK  + M+ PKGGWE DES+EEAALRET EEAGV G++   LGKW +KSK   ++H+G+
Sbjct  91   AQKKGKGMLLPKGGWEIDESIEEAALRETIEEAGVTGQLEESLGKWQYKSKRHTMVHDGY  150

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            M PL+V ++ + WPE + RQR WVS  EA+ +C + WM+EAL+  +++
Sbjct  151  MFPLLVSQQFEKWPEAEFRQRRWVSLSEAIVLCQNSWMREALEAFINR  198



>ref|XP_006416621.1| hypothetical protein EUTSA_v10008778mg [Eutrema salsugineum]
 gb|ESQ34974.1| hypothetical protein EUTSA_v10008778mg [Eutrema salsugineum]
Length=208

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 120/167 (72%), Gaps = 7/167 (4%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLV  471
            ++ KV S+ SRTGRDLQRY+  G RQVVGC+PYRY++ +      I+G     ++E LL+
Sbjct  35   QIEKVVSLVSRTGRDLQRYDNAGYRQVVGCVPYRYKKQE------INGNE-SKEIEVLLI  87

Query  472  SSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            S+QK   M+FPKGGWE DES+EEAALRET EEAGV GE+   LGKW +KSK   ++H+G+
Sbjct  88   SAQKGKGMLFPKGGWEIDESMEEAALRETIEEAGVTGELEEKLGKWQYKSKRHSMIHQGY  147

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVS  792
            M  L+V +E + WPE ++RQR WV   EA EVC + WM+EAL+  ++
Sbjct  148  MFVLLVNQEFERWPEAEIRQRKWVGLDEAREVCQNWWMREALEAFIN  194



>ref|XP_009617071.1| PREDICTED: nudix hydrolase 18, mitochondrial-like isoform X1 
[Nicotiana tomentosiformis]
Length=205

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 122/167 (73%), Gaps = 10/167 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDD-LEFLLVSSQKSP  489
            M SRTGR LQRYN +G RQVVGCIPYRY++       II  +   +D  E LL+S Q+  
Sbjct  4    MVSRTGRHLQRYN-KGRRQVVGCIPYRYKD-------IIDLSMADEDAFEVLLISPQRKG  55

Query  490  R-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLI  666
            + ++FPKGGWE+DE++E+AA RET EEAGV G+V   LG W+F++K+    +EG M PL 
Sbjct  56   KGLLFPKGGWEKDETIEDAARRETIEEAGVCGDVEGKLGIWYFENKNGDTAYEGHMFPLF  115

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQ  807
            V EELD WPEKD+R+R W+S REA ++C H WMKEAL++LVS+LT Q
Sbjct  116  VTEELDTWPEKDIRKRLWMSVREARKLCQHGWMKEALELLVSRLTSQ  162



>gb|KFK33390.1| hypothetical protein AALP_AA5G006700 [Arabis alpina]
Length=183

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 118/171 (69%), Gaps = 9/171 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGCIPYR++        + +   + D++E L+
Sbjct  1    MGVEKMVCLVSRTGRQFQRYN-KGRRQVVGCIPYRFK--------LANDGKISDEVEVLV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   +MFPKGGWE DES+EEAA RE  EEAGV G +G  LGKW F SKS G  +EG
Sbjct  52   ISSQKGHALMFPKGGWEIDESVEEAASRECIEEAGVLGNIGHQLGKWDFLSKSRGTYYEG  111

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             M P++V E+L+ WPE+ VRQR W++  EA E C   WMKEALDVLV +L+
Sbjct  112  LMFPMLVTEQLELWPEQHVRQRIWMNVVEAREACRDWWMKEALDVLVERLS  162



>ref|XP_010527807.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Tarenaya hassleriana]
Length=177

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 114/163 (70%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVGCIPYR++        I     + D+LE L+++SQK   
Sbjct  4    LVSRTGRQFQRYN-KGRRQVVGCIPYRFK--------ISSDGTISDELEVLVITSQKGHA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            MMFPKGGWE DES+EEAA RE+ EEAGV G + S LGKW F SKS G  +EG M P++V 
Sbjct  55   MMFPKGGWELDESVEEAASRESLEEAGVLGSIESQLGKWDFLSKSRGTFYEGLMFPMLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            E+LD WPE+ +RQR W++  EA E C   WMKEALD+LV +L+
Sbjct  115  EQLDLWPEQHLRQRIWMTVEEAREACRDWWMKEALDILVERLS  157



>ref|XP_010471414.1| PREDICTED: nudix hydrolase 21, chloroplastic-like [Camelina sativa]
Length=203

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 10/168 (6%)
 Frame = +1

Query  295  LTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVS  474
            + KV S+ SRTGRDLQRY+  G RQVVGC+PYRY++         HG     ++E LL+S
Sbjct  39   IEKVVSLVSRTGRDLQRYSTSGHRQVVGCVPYRYKK---------HGGGEGGEIEVLLIS  89

Query  475  SQKSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            +QK  + M+ PKGGWE DES+EEAALRET EEAGV G++   LGKW +KSK   ++H+G+
Sbjct  90   AQKKGKGMLLPKGGWEIDESIEEAALRETIEEAGVTGQLEESLGKWQYKSKRHTMVHDGY  149

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            M PL+V ++ + WPE D RQR WVS  EA+ +C + WM+EAL+  +++
Sbjct  150  MFPLLVSQQFEKWPEADFRQRRWVSLSEAIVLCQNSWMREALEAFINR  197



>ref|XP_006430600.1| hypothetical protein CICLE_v10012837mg [Citrus clementina]
 gb|ESR43840.1| hypothetical protein CICLE_v10012837mg [Citrus clementina]
 gb|KDO50813.1| hypothetical protein CISIN_1g029277mg [Citrus sinensis]
Length=196

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 123/170 (72%), Gaps = 8/170 (5%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR LQRY  +G RQVVGCIPYRY+  KQS    I+     +DLE L++SSQK
Sbjct  20   VGNLVSRTGRHLQRYQ-KGRRQVVGCIPYRYKCVKQSLD--INE----EDLEVLVISSQK  72

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEV-GSCLGKWFFKSKSLGVLHEGFMLP  660
               M+FPKGGWE DES++EAALRET EEAGV G V    LG+W FKS++    ++G+M P
Sbjct  73   GKGMLFPKGGWEIDESIQEAALRETIEEAGVTGIVECELLGEWNFKSRAHNTDYQGYMFP  132

Query  661  LIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQ  810
            L+V ++L +WPEK+VR R W+S  EA +VC H WMKEALD LV +LT QQ
Sbjct  133  LLVQDQLAEWPEKNVRSRKWMSVAEARKVCQHWWMKEALDRLVMRLTSQQ  182



>ref|XP_009386464.1| PREDICTED: nudix hydrolase 17, mitochondrial-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=175

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 107/162 (66%), Gaps = 6/162 (4%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            M SR GR LQRY+  G R VVGCIPY+Y  G         G  L   +E L++SS K   
Sbjct  4    MVSRQGRQLQRYSKSGSRLVVGCIPYKYNPGDGG------GEDLDRSMEVLVISSPKGNG  57

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            ++FPKGGWE DE+++EAALRE  EEAGV G V   LGKW +KS++ G +HEG M PL V 
Sbjct  58   LLFPKGGWETDETIKEAALREALEEAGVQGNVQRKLGKWKYKSRTYGAVHEGIMFPLNVT  117

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQL  798
            EEL DWPE   R+R WV+  +A E C HPWMKEALD LV +L
Sbjct  118  EELGDWPEMHTRERKWVTVADAKEGCQHPWMKEALDRLVKRL  159



>ref|XP_007141921.1| hypothetical protein PHAVU_008G237200g [Phaseolus vulgaris]
 gb|ESW13915.1| hypothetical protein PHAVU_008G237200g [Phaseolus vulgaris]
Length=193

 Score =   179 bits (453),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 120/163 (74%), Gaps = 7/163 (4%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            ++ SRTGR+LQRY  +G RQVVGCIPYRY+   Q++   + G    +DLE L+++SQK  
Sbjct  13   ALVSRTGRELQRYR-KGRRQVVGCIPYRYKIVDQTS---LEGP---EDLEVLVITSQKGK  65

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             M+FPKGGWE DES +EAALRET EEAGV G V   LGKW FKSK+    +EG+M PL+V
Sbjct  66   GMLFPKGGWELDESKKEAALRETIEEAGVRGTVEGKLGKWSFKSKTHDTFYEGYMFPLLV  125

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQL  798
             E+L+ WPE++ RQR W+S  +A EVC H WMKEAL+ LV++L
Sbjct  126  QEQLEFWPEQNFRQRIWMSVSDAREVCQHWWMKEALERLVNRL  168



>ref|XP_006390545.1| hypothetical protein EUTSA_v10019174mg [Eutrema salsugineum]
 gb|ESQ27831.1| hypothetical protein EUTSA_v10019174mg [Eutrema salsugineum]
Length=195

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 116/168 (69%), Gaps = 13/168 (8%)
 Frame = +1

Query  295  LTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVS  474
            + KV S+ SRTGRDLQRYN  G RQVVGCIPYRY+  K   G I          E LL+S
Sbjct  36   IEKVVSLVSRTGRDLQRYNTAGYRQVVGCIPYRYK--KDCGGEI----------EVLLIS  83

Query  475  SQKSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            +QK  + M+ PKGGWE DES+EEAALRET EEAGV G++   LGKW +KSK   ++H+G+
Sbjct  84   AQKKGKGMLLPKGGWEIDESMEEAALRETIEEAGVTGQLEETLGKWQYKSKRHSMIHDGY  143

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            M PL+V ++ + WPE D R R WV   EA+E+C + WM+EAL+  +S+
Sbjct  144  MFPLLVSQQFERWPESDFRHRKWVCLSEAIELCQNWWMREALEAFISR  191



>ref|XP_006395863.1| hypothetical protein EUTSA_v10004986mg [Eutrema salsugineum]
 gb|ESQ33149.1| hypothetical protein EUTSA_v10004986mg [Eutrema salsugineum]
Length=183

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 116/171 (68%), Gaps = 9/171 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGCIPYR++        +     + D+LE L+
Sbjct  1    MGVEKMVCLVSRTGRQFQRYN-KGRRQVVGCIPYRFK--------LSSDGKISDELEVLV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   MMFPKGGWE DES+EEAA RE+ EEAGV G +G  LG+W F SKS G  +EG
Sbjct  52   ISSQKGHAMMFPKGGWELDESVEEAASRESLEEAGVLGNIGHQLGQWDFLSKSRGTYYEG  111

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             M P++V E+L+ WPE+  RQR W++   A E C   WMKEALDVL+ +L+
Sbjct  112  LMFPMLVTEQLELWPEQHARQRVWMNVENAREACRDWWMKEALDVLIERLS  162



>ref|XP_003616266.1| Nudix hydrolase [Medicago truncatula]
 gb|AES99224.1| nudix hydrolase-like protein [Medicago truncatula]
Length=191

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 123/175 (70%), Gaps = 9/175 (5%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V +  SRTGRDLQRY  +G RQVVGCIPYRY  G Q++     GA   ++LE L+++S+K
Sbjct  10   VVASVSRTGRDLQRYR-KGRRQVVGCIPYRYIIGDQTS----LGAN--EELEVLVITSKK  62

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
              RM+FPKGGWE DES +EAALRET EEAGV G V   LGKW FK K+ G  +EG+M PL
Sbjct  63   GKRMLFPKGGWEMDESKKEAALRETIEEAGVRGIVEGKLGKWRFKGKNYG--YEGYMFPL  120

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENE  828
            +V E+ + WPE+ VRQR+W++  EA EVC   WMKEAL+ LV +L   + +D  E
Sbjct  121  LVQEQFEIWPEQSVRQRTWMNVSEAREVCQQRWMKEALERLVDRLKGHKLDDVKE  175



>gb|KFK33389.1| hypothetical protein AALP_AA5G006600 [Arabis alpina]
Length=198

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 9/171 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGCIPYR++        + +   + D++E L+
Sbjct  1    MGVEKMVGLVSRTGRQFQRYN-KGRRQVVGCIPYRFK--------LANDGKISDEVEVLV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   +MFPKGGWE DES+EEAA RE  EEAGV G +G  LGKW F SKS G  +EG
Sbjct  52   ISSQKGHALMFPKGGWEIDESVEEAASRECIEEAGVRGNIGHQLGKWDFLSKSKGTYYEG  111

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             M P++V E+L+ WPE+ VRQR W++  EA + C   WMKEALDVLV +L+
Sbjct  112  LMFPMLVTEQLELWPEQHVRQRIWMNVVEARKACRDWWMKEALDVLVERLS  162



>emb|CDY17653.1| BnaA06g34720D [Brassica napus]
Length=182

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 117/171 (68%), Gaps = 9/171 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGCIPYR++        +     + D++E L+
Sbjct  1    MGVEKMACLVSRTGRQFQRYN-KGRRQVVGCIPYRFK--------LSSDGKISDEVEVLV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   MMFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS G  +EG
Sbjct  52   ISSQKGHAMMFPKGGWELDESVEEAASRESLEEAGVLGNVEHQLGKWDFLSKSRGTYYEG  111

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             M P++V E+L+ WPE+  RQR W++  EA E C   WMKEALDVLV++L+
Sbjct  112  LMFPMLVTEQLELWPEQHARQRIWMNVVEAREACRDWWMKEALDVLVARLS  162



>ref|NP_172939.1| nudix hydrolase 18 [Arabidopsis thaliana]
 sp|Q9LQU5.1|NUD18_ARATH RecName: Full=Nudix hydrolase 18, mitochondrial; Short=AtNUDT18; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF79225.1|AC006917_10 F10B6.26 [Arabidopsis thaliana]
 dbj|BAC42118.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63852.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29236.1| nudix hydrolase 18 [Arabidopsis thaliana]
Length=176

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 117/175 (67%), Gaps = 13/175 (7%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVGCIPYR +        I     + D+ E L++SSQK   
Sbjct  4    LVSRTGRQSQRYN-KGRRQVVGCIPYRLK--------ISSDGTISDEFEVLVISSQKGHA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS G  +EGFM P++V 
Sbjct  55   LMFPKGGWELDESVEEAASRESLEEAGVVGNVERQLGKWDFLSKSKGTFYEGFMFPMLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTL----QQEEDEN  825
            EEL+ WPE+ +RQR W+   EA + C   WMKEALDVLV +L+L      EEDEN
Sbjct  115  EELELWPEQHLRQRIWMKVDEARDACRDWWMKEALDVLVQRLSLLSLKPMEEDEN  169



>ref|XP_004250193.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Solanum lycopersicum]
Length=202

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 127/174 (73%), Gaps = 8/174 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M+L  +  + SR+GR LQRYN +G RQVVGCIPYRY++  +   S+I      D  E LL
Sbjct  1    MELKDMVVLVSRSGRHLQRYN-KGRRQVVGCIPYRYKDFTEL--SLIDE----DAFEVLL  53

Query  469  VSSQKSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHE  645
            +S Q+  + ++FPKGGWE+DE++E+AA RET EEAGV GEV   LG W+F++K+    +E
Sbjct  54   ISPQRKGKGLLFPKGGWEEDETIEDAAQRETIEEAGVRGEVECKLGTWYFENKTGDTAYE  113

Query  646  GFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQ  807
            G M PL V EELD WPEK++R+R+W++ REA ++C + WMKEAL+VLVS+LT Q
Sbjct  114  GHMFPLFVTEELDYWPEKEIRERTWMNVREARKLCQNGWMKEALEVLVSRLTSQ  167



>ref|XP_009101324.1| PREDICTED: nudix hydrolase 17, mitochondrial [Brassica rapa]
Length=182

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 117/171 (68%), Gaps = 9/171 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGCIPYR++        +     + D++E L+
Sbjct  1    MGVEKMVCLVSRTGRQFQRYN-KGRRQVVGCIPYRFK--------LSSDGKISDEVEVLV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   MMFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS G  +EG
Sbjct  52   ISSQKGHAMMFPKGGWELDESVEEAASRESLEEAGVLGNVEHQLGKWDFLSKSRGTYYEG  111

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             M P++V E+L+ WPE+  RQR W++  EA E C   WMKEALDVLV++L+
Sbjct  112  LMFPMLVTEQLELWPEQHARQRIWMNVVEAREACRDWWMKEALDVLVARLS  162



>ref|XP_006416963.1| hypothetical protein EUTSA_v10008895mg [Eutrema salsugineum]
 gb|ESQ35316.1| hypothetical protein EUTSA_v10008895mg [Eutrema salsugineum]
Length=177

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 110/163 (67%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVGCIPYR +        I     + DD E L++SSQK   
Sbjct  4    VVSRTGRQFQRYN-KGRRQVVGCIPYRLK--------ISSDGTISDDFEVLVISSQKGHA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS G  +EG M P++V 
Sbjct  55   LMFPKGGWELDESVEEAASRESLEEAGVMGNVERQLGKWDFLSKSRGTFYEGLMFPMLVT  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EELD WPE+ +RQR W+   EA E C   WMKEALDVLV +L+
Sbjct  115  EELDLWPEQHLRQRMWMKVDEAREACRDWWMKEALDVLVHRLS  157



>gb|KHM99173.1| Nudix hydrolase 17, mitochondrial [Glycine soja]
Length=200

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 121/204 (59%), Gaps = 43/204 (21%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVG-----------------------------------CIP  387
            + SRTGR++QRYN  G RQVVG                                   CIP
Sbjct  4    LMSRTGREMQRYNSSGGRQVVGDSGTRAFSMAALSDKLAFCLVSACLVTVAPKLFQWCIP  63

Query  388  YRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMMFPKGGWEQDESLEEAALRETFEE  567
            YRY+E      S        ++LE L+VSSQK   +MFPKGGWE DES+EEAA RE+ EE
Sbjct  64   YRYKEDNDGNVS--------NELEVLVVSSQKGQALMFPKGGWELDESVEEAASRESLEE  115

Query  568  AGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEV  747
            AGV G V   LG+W F SK LG  +EG M PL+V E+LD WPEKD+R+R W+S  EA EV
Sbjct  116  AGVTGIVQHELGQWSFISKRLGTYYEGHMFPLLVKEQLDLWPEKDLRRRIWMSINEAREV  175

Query  748  CFHPWMKEALDVLVSQLTLQQEED  819
            C H WMKEALD+LV +LTLQ+  +
Sbjct  176  CQHWWMKEALDILVERLTLQKNRN  199



>ref|XP_010416166.1| PREDICTED: nudix hydrolase 21, chloroplastic-like [Camelina sativa]
Length=202

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 119/168 (71%), Gaps = 11/168 (7%)
 Frame = +1

Query  295  LTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVS  474
            + KV S+ SRTGRDLQRY+  G RQVVGC+PYR+++         HG     ++E LL+S
Sbjct  39   IEKVVSLVSRTGRDLQRYSTSGHRQVVGCVPYRFKK---------HGGG-EREIEVLLIS  88

Query  475  SQKSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            +QK  + M+ PKGGWE DES+EEAALRET EEAGV G++   LGKW +KSK   ++H+G+
Sbjct  89   AQKKGKGMLLPKGGWEIDESIEEAALRETIEEAGVTGQLEESLGKWQYKSKRHTMVHDGY  148

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            M PL+V ++ + WPE D RQR WVS  EA+ +C + WM+EAL+  +++
Sbjct  149  MFPLLVSQQFEKWPEADFRQRRWVSLSEAIVLCQNSWMREALEAFINR  196



>ref|NP_565273.1| nudix hydrolase 17 [Arabidopsis thaliana]
 sp|Q9ZU95.1|NUD17_ARATH RecName: Full=Nudix hydrolase 17, mitochondrial; Short=AtNUDT17; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK17130.1|AF325062_1 unknown protein [Arabidopsis thaliana]
 gb|AAK25841.1|AF360131_1 unknown protein [Arabidopsis thaliana]
 gb|AAL06556.1|AF412103_1 At2g01670/T8O11.16 [Arabidopsis thaliana]
 gb|AAD12704.1| expressed protein [Arabidopsis thaliana]
 gb|AAK93707.1| unknown protein [Arabidopsis thaliana]
 gb|AEC05483.1| nudix hydrolase 17 [Arabidopsis thaliana]
Length=182

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 117/171 (68%), Gaps = 9/171 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGC+PYR++        + +   + D++E L+
Sbjct  1    MGVEKMVCLASRTGRQFQRYN-KGRRQVVGCVPYRFK--------LSNDGKISDEVEVLV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   +MFPKGGWE DES+EEAA RE  EEAGV G V   LGKW F SKS G  +EG
Sbjct  52   ISSQKGHALMFPKGGWELDESVEEAASRECLEEAGVLGNVEHQLGKWDFLSKSRGTYYEG  111

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             M P++V E+L+ WPE+ VRQR W++  EA E C   WMKEALDVLV +L+
Sbjct  112  LMFPMLVTEQLELWPEQHVRQRIWMNVTEAREACRDWWMKEALDVLVERLS  162



>emb|CDP16318.1| unnamed protein product [Coffea canephora]
Length=204

 Score =   177 bits (448),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 112/158 (71%), Gaps = 10/158 (6%)
 Frame = +1

Query  328  GRDLQRYNVQGCRQVVGCIPYRYR-EGKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMMFP  504
            GR LQRYN QGCR VVGCIPYR++ EG +            +++E LLVSS KS  +MFP
Sbjct  9    GRHLQRYNDQGCRLVVGCIPYRFKSEGSERTN---------NEVEVLLVSSPKSQEVMFP  59

Query  505  KGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEELD  684
            KGGWE  ES++EAA RET EEAGV G V   LG W FKSKS  + HEG+M PL+V EELD
Sbjct  60   KGGWEFGESIKEAARRETLEEAGVLGNVEDELGIWRFKSKSQEIYHEGYMFPLLVTEELD  119

Query  685  DWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQL  798
             WPEK+VR+R+W++  EA + C   WMKEALD L+++L
Sbjct  120  PWPEKNVRKRAWMTVVEARDACKQWWMKEALDRLINRL  157



>ref|XP_002876770.1| hypothetical protein ARALYDRAFT_904375 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53029.1| hypothetical protein ARALYDRAFT_904375 [Arabidopsis lyrata subsp. 
lyrata]
Length=182

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 117/171 (68%), Gaps = 9/171 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGC+PYR++        + +   + D++E L+
Sbjct  1    MGVEKMVCLASRTGRQFQRYN-KGRRQVVGCVPYRFK--------LSNDGKISDEVEVLV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   +MFPKGGWE DES+EEAA RE  EEAGV G V   LGKW F SKS G  +EG
Sbjct  52   ISSQKGHALMFPKGGWELDESVEEAASRECLEEAGVLGNVEHQLGKWDFLSKSRGTYYEG  111

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             M P++V E+L+ WPE+ VRQR W++  EA E C   WMKEALDVLV +L+
Sbjct  112  LMFPMLVTEQLELWPEQHVRQRIWMNVTEAREACRDWWMKEALDVLVVRLS  162



>ref|XP_011035560.1| PREDICTED: nudix hydrolase 4-like [Populus euphratica]
Length=200

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 118/167 (71%), Gaps = 9/167 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            +++  + S+ SRTGR+LQRY  +G R VVGCIPYRY++ ++           V++LE L+
Sbjct  32   VQIETMVSLVSRTGRNLQRYE-KGFRLVVGCIPYRYKKSQEPTS--------VEELEVLV  82

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +S+Q    M+FPKGGWE DES+EEAA+RET EEAGV G V   LG W++KSK   ++HE 
Sbjct  83   ISAQNGQGMLFPKGGWENDESMEEAAMRETEEEAGVIGVVEGKLGPWYYKSKRSCIMHES  142

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLV  789
            +M PL+V EELD WPE  +R+R WVS  EA EVC + WM++AL+ LV
Sbjct  143  YMFPLLVQEELDSWPESKIRERRWVSINEAREVCHNWWMRDALEELV  189



>emb|CDY36247.1| BnaC07g21010D [Brassica napus]
Length=182

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 9/171 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGCIPYR++        +     + D++E L+
Sbjct  1    MGVEKMVCLVSRTGRQFQRYN-KGRRQVVGCIPYRFK--------LSSDGKISDEVEVLV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   MMFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS G  +EG
Sbjct  52   ISSQKGHAMMFPKGGWELDESVEEAAARESLEEAGVLGNVEHQLGKWDFLSKSRGTYYEG  111

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             M P++V E+L+ WPE+  RQR W++  +A E C   WMKEALD+LV++L+
Sbjct  112  LMFPMLVTEQLELWPEQHARQRIWMNVVDAREACRDWWMKEALDILVARLS  162



>emb|CDY68944.1| BnaC06g43940D [Brassica napus]
Length=174

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 114/171 (67%), Gaps = 15/171 (9%)
 Frame = +1

Query  295  LTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVS  474
            + KV S+ SRTGRDLQRY+  G RQVVGCIPYRY+                 ++E LL+S
Sbjct  18   IQKVVSLVSRTGRDLQRYDTTGYRQVVGCIPYRYKND--------------GEIEVLLIS  63

Query  475  SQKSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            +QK  + M+ PKGGWE DES+EEAALRET EEAGV G +   LGKW +KSK   ++H+GF
Sbjct  64   AQKKGKGMLLPKGGWEIDESIEEAALRETMEEAGVTGHLEETLGKWQYKSKRHNMVHDGF  123

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTL  804
            M PL+V E+ + WPE   RQR WV   EA+++C + WM+EALD  + +  L
Sbjct  124  MFPLLVSEQFEQWPESGFRQRKWVCLSEAIDLCQNWWMREALDAFIDRKCL  174



>ref|XP_009785973.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Nicotiana 
sylvestris]
Length=210

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 133/191 (70%), Gaps = 12/191 (6%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDD--LEF  462
            M+L ++  + SR+GR LQRYN +G RQVVGCIPYRY++  + +        +VD+   E 
Sbjct  1    MELKEMVVLVSRSGRHLQRYN-KGRRQVVGCIPYRYKDFTELS--------MVDEDAFEV  51

Query  463  LLVSSQKSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVL  639
            LL+S Q+  + ++FPKGGWE+DE++E+AA RET EEAGV GEV   LG W+F++KS    
Sbjct  52   LLISPQRKGKGLLFPKGGWEKDETIEDAAQRETVEEAGVRGEVECKLGTWYFENKSGDTA  111

Query  640  HEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEED  819
            +EG M PL V E+LD WPEK++R+R+W++  EA  +C + WMKEAL++LVS+LT Q +  
Sbjct  112  YEGHMFPLFVTEQLDSWPEKEIRERTWMNVCEARRLCQNGWMKEALELLVSRLTSQSKRT  171

Query  820  ENEARNGMMRN  852
            + E   G+ R 
Sbjct  172  KGELYPGIERT  182



>ref|XP_009117867.1| PREDICTED: nudix hydrolase 18, mitochondrial-like isoform X1 
[Brassica rapa]
Length=179

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 114/163 (70%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVGCIPYR    K S+  I+      D+ E L++SSQK   
Sbjct  4    VVSRTGRQFQRYN-KGRRQVVGCIPYRL---KTSSDGIVS-----DEFEVLVISSQKGHA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAALRE+ EEAGV G+V   LGKW F SKS G  +EG M P++V 
Sbjct  55   LMFPKGGWELDESIEEAALRESLEEAGVIGDVERQLGKWDFLSKSRGTFYEGLMFPMLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EEL+ WPE+ +RQR W+   EA E C   WMKEALDVLV +L+
Sbjct  115  EELELWPEQHLRQRMWMKVDEAREACRDWWMKEALDVLVHRLS  157



>ref|XP_009615821.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=210

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 131/191 (69%), Gaps = 12/191 (6%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDD--LEF  462
            M+L ++  + SR+GR LQRYN +G RQVVGCIPYRY++  + +        +VD+   E 
Sbjct  1    MELKEMVVLVSRSGRHLQRYN-KGRRQVVGCIPYRYKDFTELS--------MVDEDAFEV  51

Query  463  LLVSSQKSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVL  639
            LL+S Q+  + ++FPKGGWE+DE++E+AA RET EEAGV GEV   LG W+F++KS    
Sbjct  52   LLISPQRKGKGLLFPKGGWEKDETIEDAAQRETVEEAGVRGEVECKLGTWYFENKSGDTA  111

Query  640  HEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEED  819
            +EG M PL V E+LD WPEK++R+R+W+S  EA  +C + WMKEAL++LVS+ T Q    
Sbjct  112  YEGHMFPLFVTEQLDSWPEKEIRERTWMSVCEARRLCQNGWMKEALELLVSRFTSQSNRT  171

Query  820  ENEARNGMMRN  852
            + E   G+ R 
Sbjct  172  KGELYPGIERT  182



>ref|XP_006367609.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Solanum tuberosum]
Length=160

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 113/164 (69%), Gaps = 17/164 (10%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRY-REGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            M SRTGR +QRYN +G R VVGCIPYR+ R G               + E L+VSSQK  
Sbjct  4    MVSRTGRQMQRYN-KGHRLVVGCIPYRFTRNG---------------EFEVLVVSSQKGH  47

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW FKSKS G+ HEG+M PL+V
Sbjct  48   AMMFPKGGWETDESVEEAASRESLEEAGVLGIVQCELGKWRFKSKSQGIYHEGYMFPLLV  107

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             E+L  WPE+++R+R+W++  EA E C   WMKEAL+ LV++L 
Sbjct  108  TEQLSLWPEQNLRKRAWMTVEEASEACQQWWMKEALEKLVNRLN  151



>ref|XP_006290383.1| hypothetical protein CARUB_v10018090mg [Capsella rubella]
 gb|EOA23281.1| hypothetical protein CARUB_v10018090mg [Capsella rubella]
Length=183

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 9/171 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGC+PYR++        + +   + D++E L+
Sbjct  1    MGVEKMVCLASRTGRQFQRYN-KGRRQVVGCVPYRFK--------LSNDGKISDEVEVLV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   +MFPKGGWE DES+EEAA RE  EEAGV G +   LGKW F SKS G  +EG
Sbjct  52   ISSQKGHALMFPKGGWELDESVEEAASRECREEAGVLGNIEHQLGKWDFLSKSRGTYYEG  111

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             M P++V E+L+ WPE+ VRQR W++  EA E C   WMKEALDVLV +L+
Sbjct  112  LMFPMLVTEQLELWPEQHVRQRIWMNVTEAREACRDWWMKEALDVLVERLS  162



>ref|XP_004228715.1| PREDICTED: nudix hydrolase 18, mitochondrial [Solanum lycopersicum]
Length=160

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 113/164 (69%), Gaps = 17/164 (10%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRY-REGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            M SRTGR +QRYN +G R VVGCIPYR+ R G               + E L++SSQK  
Sbjct  4    MVSRTGRQMQRYN-KGHRLVVGCIPYRFTRNG---------------EFEVLVISSQKGH  47

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW FKSKS G+ HEG+M PL+V
Sbjct  48   AMMFPKGGWETDESVEEAASRESLEEAGVLGIVQCELGKWRFKSKSQGIYHEGYMFPLLV  107

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             E+L  WPE+++R+R+W++  EA E C   WMKEAL+ LV++L 
Sbjct  108  TEQLSLWPEQNLRKRAWMTVEEASEACQQWWMKEALEKLVNRLN  151



>ref|XP_009797085.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Nicotiana 
sylvestris]
Length=166

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 111/164 (68%), Gaps = 17/164 (10%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRY-REGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            M SRTGR LQRYN +G R VVGCIPYR+ R G               + E L+VSSQK  
Sbjct  4    MVSRTGRQLQRYN-KGRRLVVGCIPYRFTRNG---------------EFEVLVVSSQKGH  47

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DES+EEAA RE+ EEAGV G V   LG W FKSKS G+ HEG+M PL+V
Sbjct  48   AMMFPKGGWELDESVEEAASRESLEEAGVLGIVQCELGNWRFKSKSQGIYHEGYMFPLLV  107

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             E+L  WPE++VR+R+W+S  EA EVC   WMKEAL  LV +L 
Sbjct  108  TEQLSLWPEQNVRRRAWMSVEEASEVCQQWWMKEALARLVERLN  151



>emb|CDX82065.1| BnaC02g22250D [Brassica napus]
Length=191

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 117/167 (70%), Gaps = 13/167 (8%)
 Frame = +1

Query  301  KVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQ  480
            KV S+ SRTGRDLQRYN  G RQVVGCIPYRY++         HG     ++E LL+S+Q
Sbjct  32   KVISLVSRTGRDLQRYNTTGYRQVVGCIPYRYKK---------HGGG--GEIEVLLISAQ  80

Query  481  KSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVL-HEGFM  654
            +  + M+ PKGGWE DES+EEAALRET EEAGV G++   LG W +KSK   ++ H+G+M
Sbjct  81   RKEKGMLLPKGGWEIDESIEEAALRETIEEAGVTGQLEESLGMWQYKSKRENMMVHDGYM  140

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
             P++V E+ + WPE   RQR WV   EAME+C + WM+EAL+V +++
Sbjct  141  FPMLVSEQFEIWPESGFRQRKWVCLSEAMELCRNGWMREALEVFINR  187



>ref|XP_006352449.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Solanum tuberosum]
Length=211

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 127/176 (72%), Gaps = 12/176 (7%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDD--LEF  462
            M+L  +  + SR+GR LQRYN +G RQVVGC+PYRY++  + +        LVD+   E 
Sbjct  1    MELKDMVVLVSRSGRHLQRYN-KGRRQVVGCLPYRYKDFIELS--------LVDEDAFEV  51

Query  463  LLVSSQKSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVL  639
            LL+S Q+  + ++FPKGGWE+DE++E+AA RET EEAGV GEV   LG W+F++K+    
Sbjct  52   LLISPQRKGKGLLFPKGGWEEDETIEDAAQRETIEEAGVRGEVECKLGTWYFENKAGDTA  111

Query  640  HEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQ  807
            +EG M PL V EELD WPEK++R+R+W++ REA + C + WMKEAL+VLVS+LT Q
Sbjct  112  YEGHMFPLFVTEELDYWPEKEIRERTWMNVREARKQCQNGWMKEALEVLVSRLTSQ  167



>emb|CDY33734.1| BnaA09g45400D [Brassica napus]
Length=179

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 113/163 (69%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVGCIPYR    K S+  I+      D+ E LL+SSQK   
Sbjct  4    VVSRTGRQFQRYN-KGRRQVVGCIPYRL---KTSSDGIVS-----DEFEVLLISSQKGHA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G+V   LGKW F SKS G  +EG M P++V 
Sbjct  55   LMFPKGGWELDESIEEAASRESLEEAGVIGDVERQLGKWDFLSKSRGTFYEGLMFPMLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EEL+ WPE+ +RQR W+   EA E C   WMKEALDVLV +L+
Sbjct  115  EELELWPEQHLRQRMWMKVDEAREACRDWWMKEALDVLVHRLS  157



>gb|AAM66124.1| unknown [Arabidopsis thaliana]
Length=177

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 113/163 (69%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVGC+PYR++        + +   + D++E L++SSQK   
Sbjct  4    LASRTGRQFQRYN-KGRRQVVGCVPYRFK--------LSNDGKISDEVEVLVISSQKGHA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE  EEAGV G V   LGKW F SKS G  +EG M P++V 
Sbjct  55   LMFPKGGWELDESVEEAASRECLEEAGVLGNVEHQLGKWDFLSKSRGTYYEGLMFPMLVT  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            E+L+ WPE+ VRQR W++  EA E C   WMKEALDVLV +L+
Sbjct  115  EQLELWPEQHVRQRIWMNVTEAREACRDWWMKEALDVLVERLS  157



>ref|XP_009794972.1| PREDICTED: nudix hydrolase 18, mitochondrial-like isoform X1 
[Nicotiana sylvestris]
Length=205

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 119/166 (72%), Gaps = 8/166 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            M SRTGR LQRYN +G RQVVGCIPYRY++       I       D  E LL+S Q+  +
Sbjct  4    MVSRTGRHLQRYN-KGRRQVVGCIPYRYKD------IIDLSMGDEDAFEVLLISPQRKGK  56

Query  493  -MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             ++FPKGGWE+DE++E+AA RET EEAGV G+V   LG W+F++K+    +EG M PL V
Sbjct  57   GLLFPKGGWEKDETIEDAARRETIEEAGVCGDVEGKLGIWYFENKNGDTAYEGHMFPLFV  116

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQ  807
             EELD WPEKD+R+R W+S REA ++C + WMKEAL++LVS+LT Q
Sbjct  117  TEELDYWPEKDIRKRFWMSVREARKLCQNGWMKEALELLVSRLTSQ  162



>ref|XP_010502149.1| PREDICTED: nudix hydrolase 17, mitochondrial [Camelina sativa]
 ref|XP_010424941.1| PREDICTED: nudix hydrolase 17, mitochondrial [Camelina sativa]
Length=182

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 117/171 (68%), Gaps = 9/171 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGC+PYR++        + +   + D++E L+
Sbjct  1    MGVEKMVCLASRTGRQFQRYN-KGRRQVVGCVPYRFK--------LSNDGKISDEVEVLV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   +MFPKGGWE DES+EEAA RE  EEAGV G +   LGKW F SKS G  +EG
Sbjct  52   ISSQKGHALMFPKGGWELDESVEEAASRECREEAGVLGNIEHQLGKWDFLSKSRGTYYEG  111

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             M P++V E+L+ WPE+ +RQR W++  EA E C   WMKEALDVLV +L+
Sbjct  112  LMFPMLVTEQLELWPEQHLRQRIWMNVTEAREACRDWWMKEALDVLVERLS  162



>ref|XP_008803888.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Phoenix dactylifera]
Length=171

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 108/164 (66%), Gaps = 6/164 (4%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            S+ SR GR LQRY   G R VVGCIPY+++  K     I         +E L++SSQK  
Sbjct  3    SLVSRQGRHLQRYTSTGRRLVVGCIPYKFKVDKPWDNDIDRA------MEVLVISSQKGH  56

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DE+++EA  RE  EEAGV G V   LGKW +KS+S    +EG M PL V
Sbjct  57   GMMFPKGGWELDETIKEAVSREALEEAGVRGNVEGSLGKWRYKSRSHDAFYEGIMFPLDV  116

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             EEL DWPE DVR+R WV+  EA E C HPWMKEAL+ LV++++
Sbjct  117  TEELVDWPEMDVRKRRWVTVAEAREGCQHPWMKEALERLVTRIS  160



>ref|XP_010513896.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Camelina sativa]
Length=182

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 117/171 (68%), Gaps = 9/171 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGC+PYR++        + +   + D++E L+
Sbjct  1    MGVEKMVCLASRTGRQFQRYN-KGRRQVVGCVPYRFK--------LSNDGKISDEVEVLV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +SSQK   +MFPKGGWE DES+EEAA RE  EEAGV G +   LGKW F SKS G  +EG
Sbjct  52   ISSQKGHALMFPKGGWELDESVEEAASRECREEAGVLGNIEHQLGKWDFLSKSRGTYYEG  111

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             M P++V E+L+ WPE+ +RQR W++  EA E C   WMKEALDVLV +L+
Sbjct  112  LMFPMLVTEQLEFWPEQHLRQRIWMNVTEAREACRDWWMKEALDVLVERLS  162



>gb|KFK32951.1| hypothetical protein AALP_AA6G310700 [Arabis alpina]
Length=177

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 110/163 (67%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVGCIPYR +        I     + D+ E L++SSQK   
Sbjct  4    LVSRTGRQSQRYN-KGRRQVVGCIPYRLK--------ISSDGTISDEFEVLVISSQKGHA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS G  +EG M P++V 
Sbjct  55   LMFPKGGWELDESIEEAASRESLEEAGVIGNVERQLGKWDFLSKSRGTYYEGLMFPMLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EELD WPE+ +RQR W+   EA E C   WMKEALDVLV +L+
Sbjct  115  EELDLWPEQHLRQRMWLKVDEAREACRDWWMKEALDVLVHRLS  157



>ref|XP_009106010.1| PREDICTED: nudix hydrolase 21, chloroplastic-like [Brassica rapa]
 emb|CDX96481.1| BnaA07g30920D [Brassica napus]
Length=174

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 114/171 (67%), Gaps = 15/171 (9%)
 Frame = +1

Query  295  LTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVS  474
            + KV S+ SRTGRDLQRY+  G RQVVGCIPYRY+                 ++E LL+S
Sbjct  18   IQKVVSLVSRTGRDLQRYDTTGYRQVVGCIPYRYKND--------------GEIEVLLIS  63

Query  475  SQKSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
            +QK  + M+ PKGGWE DES+EEAALRET EEAGV G +   LGKW ++SK   ++H+GF
Sbjct  64   AQKKGKGMLLPKGGWEIDESIEEAALRETMEEAGVTGHLEETLGKWQYQSKRHSMVHDGF  123

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTL  804
            M P++V E+ + WPE   RQR WV   EA+++C + WM+EALD  + +  L
Sbjct  124  MFPMLVSEQFEQWPESGFRQRKWVCLSEAIDLCQNWWMREALDAFIDRKCL  174



>ref|XP_010554408.1| PREDICTED: nudix hydrolase 18, mitochondrial [Tarenaya hassleriana]
Length=160

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 112/163 (69%), Gaps = 8/163 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVGCIPYR++              + ++L+ L+++SQKS  
Sbjct  4    LVSRTGRQFQRYN-EGRRQVVGCIPYRFKISSDEG-------TMSEELQVLVITSQKSHA  55

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            MMFPKGGWE DES+EEAA RE+ EEAGV G +   LG+W F SKS G  +EG M P++V 
Sbjct  56   MMFPKGGWELDESVEEAASRESLEEAGVLGNIERQLGEWDFMSKSRGTFYEGLMFPMLVK  115

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            E+LD WPE+ +RQR W+   EA E C   WMKEALDVLV +L+
Sbjct  116  EQLDLWPEQHLRQRLWMRVDEAREACRDWWMKEALDVLVERLS  158



>ref|XP_007032125.1| Nudix hydrolase [Theobroma cacao]
 gb|EOY03051.1| Nudix hydrolase [Theobroma cacao]
Length=181

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 117/176 (66%), Gaps = 10/176 (6%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V  + SRTGR LQRY+ +G R VVGCIPYRY+                 +LE L++SSQK
Sbjct  10   VVPLVSRTGRHLQRYS-KGRRLVVGCIPYRYKTSSVEEK---------QELEVLVISSQK  59

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES +EAA RET EEAGV G V   LGKW FKSK+    +EG+M PL
Sbjct  60   GKGMLFPKGGWEIDESKKEAASRETLEEAGVRGIVEHELGKWNFKSKTHDTHYEGYMFPL  119

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            +V E+LD WPEK+VRQR W+S  +A + C + WMKEALD+L  +L  Q++ DE E 
Sbjct  120  LVQEQLDIWPEKNVRQREWMSVDKARKACQYSWMKEALDILEQRLMSQRQLDEEEV  175



>ref|XP_010917501.1| PREDICTED: nudix hydrolase 17, mitochondrial [Elaeis guineensis]
Length=175

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 107/164 (65%), Gaps = 6/164 (4%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            S+ SR GR LQRY   G R VVGCIPY+++  K     I         +E L++SSQK  
Sbjct  3    SLVSRQGRQLQRYTSAGGRLVVGCIPYKFKIDKPCKDGIDQA------MEVLVISSQKGH  56

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DE+++EA  RE  EEAGV G +   LGKW +KS+S    +EG M PL V
Sbjct  57   GMMFPKGGWELDETIKEAVSREALEEAGVQGNIEDFLGKWRYKSRSHDAFYEGIMFPLNV  116

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             EEL  WPE DVR+R WV+  EA E C HPWMKEALD LV++L+
Sbjct  117  TEELIHWPEMDVRKRRWVTIAEAREGCQHPWMKEALDRLVTRLS  160



>ref|XP_008812471.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Phoenix dactylifera]
Length=170

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 107/164 (65%), Gaps = 6/164 (4%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            S+ SR GR LQRY   G R VVGCIPY+++  +     +         +E L++SSQK  
Sbjct  3    SLVSRQGRQLQRYTSAGGRLVVGCIPYKFKIDEPCKDGVDQA------MEVLVISSQKGH  56

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DE+++EA  RE  EEAGV G +   LGKW +KS+S    +EG M PL V
Sbjct  57   GMMFPKGGWELDETIKEAVSREALEEAGVQGNIEGSLGKWMYKSRSHDAFYEGIMFPLNV  116

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             EEL  WPE DVR+R WV+  EA E C HPWMKEALD LV++L+
Sbjct  117  TEELVHWPEMDVRKRRWVTIAEAREGCQHPWMKEALDRLVTRLS  160



>ref|XP_010926116.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Elaeis guineensis]
Length=171

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 109/168 (65%), Gaps = 14/168 (8%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDL----EFLLVSS  477
            S+ SR GR LQRY+  GCR VVGCIPY++              P  DDL    E L++SS
Sbjct  3    SLVSRQGRQLQRYSSSGCRLVVGCIPYKFN----------MDMPCSDDLDKAVEVLVISS  52

Query  478  QKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFML  657
            QK   MMFPKGGWE DE++++AA RE  EEAGV G +   LG+W +KSK+    +EG M 
Sbjct  53   QKGYGMMFPKGGWETDETIKQAASREAMEEAGVQGNIERKLGRWKYKSKTYDAFYEGIMF  112

Query  658  PLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            PL V E L DWPE DVR R WV+  EA E C H WMKEAL++L+++L+
Sbjct  113  PLNVTEVLVDWPEMDVRARRWVTVAEAREGCEHLWMKEALEILITRLS  160



>ref|XP_010459002.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Camelina sativa]
Length=186

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 120/192 (63%), Gaps = 16/192 (8%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G R VVGCIPYR +    S  S         + E L++SSQK   
Sbjct  4    LVSRTGRQSQRYN-KGRRLVVGCIPYRVKTSNDSKTS--------GEFEVLVISSQKGQA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RET EEAGV G V   LGKW F SKS G  +EG M P++V 
Sbjct  55   LMFPKGGWELDESVEEAASRETLEEAGVVGNVERQLGKWDFLSKSRGTFYEGLMFPMLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEARNGMMRN  852
            EEL+ WPE+ +RQR+W+   EA E C   WMKEALDVLV +L+       + +RN M   
Sbjct  115  EELELWPEQHLRQRTWMKVDEAREACRDWWMKEALDVLVQRLS-------SPSRNPMEEK  167

Query  853  IELEPSIEILAQ  888
             +  P I + A+
Sbjct  168  DKTIPLISLSAE  179



>ref|XP_006305701.1| hypothetical protein CARUB_v10010439mg [Capsella rubella]
 gb|EOA38599.1| hypothetical protein CARUB_v10010439mg [Capsella rubella]
Length=176

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 110/163 (67%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G R VVGCIPYR +    S  S        D+ E L++SSQK   
Sbjct  4    LVSRTGRQSQRYN-KGRRIVVGCIPYRLKTSNDSTTS--------DEYEVLVISSQKGQA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DE++EEAA RE+ EEAGV G V   LGKW F SKS G ++EG M PL+V 
Sbjct  55   LMFPKGGWELDETVEEAASRESLEEAGVVGNVERQLGKWDFLSKSRGTIYEGLMFPLLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EEL+ WPE+ +RQR W+   EA E C   WMKEALDVLV +L+
Sbjct  115  EELEIWPEQHLRQRMWMKVDEAREACRDWWMKEALDVLVQRLS  157



>ref|XP_009127996.1| PREDICTED: nudix hydrolase 21, chloroplastic [Brassica rapa]
Length=188

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 117/167 (70%), Gaps = 13/167 (8%)
 Frame = +1

Query  301  KVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQ  480
            KV S+ SRTGRDLQRYN  G RQVVGCIPYRY++         HG     ++E LL+S+Q
Sbjct  29   KVISLVSRTGRDLQRYNTTGYRQVVGCIPYRYKK---------HGGG--GEIEVLLISAQ  77

Query  481  KSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVL-HEGFM  654
            K  + M+ PKGGWE DES+EEAALRET EEAGV G++   LG W +KSK   ++ H+G+M
Sbjct  78   KKGKGMLLPKGGWEIDESIEEAALRETIEEAGVTGQLEESLGMWQYKSKRDNMMVHDGYM  137

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
             P++V E+ + WPE   RQR WV   EA+E+C + WM+EAL+V +++
Sbjct  138  FPMLVSEQFEIWPECGFRQRKWVCLSEAIELCRNGWMREALEVFINR  184



>ref|XP_002890077.1| hypothetical protein ARALYDRAFT_471677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66336.1| hypothetical protein ARALYDRAFT_471677 [Arabidopsis lyrata subsp. 
lyrata]
Length=176

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 111/163 (68%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVGCIPYR +        I     + D+ E L++SSQK   
Sbjct  4    LVSRTGRQSQRYN-KGRRQVVGCIPYRLK--------ISSDGTITDEFEVLVISSQKGHA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DE++EEAA RE+ EEAGV G V   LGKW F SKS G ++EG M PL+V 
Sbjct  55   LMFPKGGWELDETIEEAASRESLEEAGVVGNVEKQLGKWDFLSKSRGTVYEGLMFPLLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EEL+ WPE+ +R+R W+   EA E C   WMKEALDVLV +L+
Sbjct  115  EELELWPEQHLRRRIWMKVDEARETCRDWWMKEALDVLVQRLS  157



>emb|CDY51772.1| BnaC05g49550D [Brassica napus]
Length=177

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 110/163 (67%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVGCIPYR +        I     + D+ E L++SSQK   
Sbjct  4    VVSRTGRQFQRYN-KGRRQVVGCIPYRLK--------ISTDGTISDEFEVLVISSQKGHA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS G  +EG M P++V 
Sbjct  55   LMFPKGGWELDESVEEAASRESLEEAGVIGNVERQLGKWDFLSKSRGTFYEGLMFPMLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EEL+ WPE+ +RQR W+   EA E C   WMKEALDVL+ +L+
Sbjct  115  EELELWPEQHLRQRMWMKVDEAREACRDWWMKEALDVLIHRLS  157



>emb|CDY58316.1| BnaA02g16460D [Brassica napus]
Length=188

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 117/167 (70%), Gaps = 13/167 (8%)
 Frame = +1

Query  301  KVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQ  480
            KV S+ SRTGRDLQRYN  G RQVVGC+PYRY++         HG     ++E LL+S+Q
Sbjct  29   KVISLVSRTGRDLQRYNTTGYRQVVGCVPYRYKK---------HGGG--GEIEVLLISAQ  77

Query  481  KSPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVL-HEGFM  654
            K  + M+ PKGGWE DES+EEAALRET EEAGV G++   LG W +KSK   ++ H+G+M
Sbjct  78   KKGKGMLLPKGGWEIDESIEEAALRETIEEAGVTGQLEESLGMWQYKSKRDNMMVHDGYM  137

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
             P++V E+ + WPE   RQR WV   EA+E+C + WM+EAL+V +++
Sbjct  138  FPMLVSEQFEIWPECGFRQRKWVCLSEAIELCRNGWMREALEVFINR  184



>ref|XP_009619787.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=166

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 111/164 (68%), Gaps = 17/164 (10%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRY-REGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            M SRTGR LQRYN +G R VVGCIPYR+ R G               + E L+VSSQK  
Sbjct  4    MVSRTGRQLQRYN-KGRRLVVGCIPYRFTRNG---------------EFEVLVVSSQKGH  47

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW FKSKS  + HEG+M P++V
Sbjct  48   SMMFPKGGWELDESVEEAASRESLEEAGVLGIVQCELGKWRFKSKSQAIYHEGYMFPMLV  107

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             E+L  WPE++VR+R+W++  EA E C   WMKEAL+ LV +L 
Sbjct  108  TEQLSLWPEQNVRRRAWMNVEEASESCQQWWMKEALERLVERLN  151



>gb|ACJ86058.1| unknown [Medicago truncatula]
Length=232

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 108/150 (72%), Gaps = 13/150 (9%)
 Frame = +1

Query  325  TGRDLQRYNVQGCRQVVGCIPYRYRE-GKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMMF  501
            TG  LQRY  QGCRQVVGCIPYRY++ G Q             ++E LL+S+QK   M F
Sbjct  80   TGSHLQRYE-QGCRQVVGCIPYRYKKNGTQE-----------KEIEVLLISAQKGSGMQF  127

Query  502  PKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEEL  681
            PKGGWE+DE++E+AALRET EEAGV G V S LGKW++KSK    +HEG+M PL+V +EL
Sbjct  128  PKGGWEKDETMEQAALRETIEEAGVIGSVESNLGKWYYKSKRQPTMHEGYMFPLLVSKEL  187

Query  682  DDWPEKDVRQRSWVSYREAMEVCFHPWMKE  771
            D+WPE ++R+R W++  EA E+C + WMK+
Sbjct  188  DNWPEMNIRRRKWLTVDEAKEICPYAWMKK  217



>ref|XP_010476561.1| PREDICTED: nudix hydrolase 18, mitochondrial [Camelina sativa]
Length=186

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 109/163 (67%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G R VVGCIPYR +    S  S         + E L++SSQK   
Sbjct  4    LVSRTGRQSQRYN-KGRRLVVGCIPYRIKTSNDSKTS--------GEFEVLVISSQKGHA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS G  +EG M P++V 
Sbjct  55   LMFPKGGWELDESIEEAASRESLEEAGVVGNVERQLGKWDFLSKSRGTFYEGLMFPMLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EEL+ WPE+ +RQR+W+   EA E C   WMKEALDVLV +L+
Sbjct  115  EELELWPEQHLRQRTWMKVDEAREACRDWWMKEALDVLVQRLS  157



>gb|EPS62936.1| hypothetical protein M569_11854, partial [Genlisea aurea]
Length=162

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 107/163 (66%), Gaps = 4/163 (2%)
 Frame = +1

Query  322  RTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPL---VDDLEFLLVSSQKSPR  492
            R+GR LQRYN +G R VVGC+PYR      ++ S    +     V+DLE LL+SSQKSP+
Sbjct  1    RSGRRLQRYN-EGIRLVVGCVPYRITNNASTSTSTSSSSSSSSSVEDLEVLLISSQKSPK  59

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DE +E AA RET EEAGV G +G  LG+W FKSKS    H G M  L+V 
Sbjct  60   LMFPKGGWELDEDIELAASRETLEEAGVVGSIGGKLGEWTFKSKSQEKFHRGSMFSLLVT  119

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EELD WPEK  R+R W+   EA E C   WMKEALD  V + T
Sbjct  120  EELDHWPEKIQRRRVWMGVNEAWEACSDEWMKEALDSFVKRFT  162



>ref|XP_009414780.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Musa acuminata 
subsp. malaccensis]
Length=168

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 103/158 (65%), Gaps = 9/158 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            M SR GR LQRY+  G R VVGCIPY++  G    G+          +E L+VSS K   
Sbjct  4    MVSRQGRQLQRYSKAGSRIVVGCIPYKFNRGYDDVGT---------SMEVLVVSSPKGNG  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            ++FPKGGWE DE++E+AALRE  EEAGV G V   LGKW +KS++    HEG M P+ V 
Sbjct  55   LLFPKGGWETDETIEQAALREALEEAGVQGNVEGKLGKWRYKSRTYDAYHEGIMFPMNVT  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVL  786
            +EL DWPE  +R+R WV+  EA E C HPWMKEAL+ L
Sbjct  115  QELGDWPEMHLRERKWVTVAEAKEGCQHPWMKEALERL  152



>ref|XP_009148873.1| PREDICTED: nudix hydrolase 18, mitochondrial [Brassica rapa]
 emb|CDY45295.1| BnaA06g09650D [Brassica napus]
Length=177

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 109/163 (67%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVGCIPYR +        I     + ++ E L++SSQK   
Sbjct  4    VVSRTGRQFQRYN-KGRRQVVGCIPYRLK--------ISTDGTISEEFEVLVISSQKGHA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS G  +EG M P++V 
Sbjct  55   LMFPKGGWELDESVEEAASRESLEEAGVIGNVERQLGKWDFLSKSRGTFYEGLMFPMLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EEL+ WPE+ +RQR W+   EA E C   WMKEALD LV +L+
Sbjct  115  EELELWPEQHLRQRMWMKVDEAREACRDWWMKEALDALVDRLS  157



>emb|CDX81678.1| BnaC08g39230D [Brassica napus]
Length=179

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 112/163 (69%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVGCIPYR    K S+  I+      ++ E L++SSQK   
Sbjct  4    VVSRTGRQFQRYN-KGRRQVVGCIPYRL---KTSSDGIVS-----NEFEVLVISSQKGHA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS G  +EG M P++V 
Sbjct  55   LMFPKGGWELDESIEEAASRESLEEAGVIGVVERQLGKWDFLSKSRGTFYEGLMFPMLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            E+L+ WPE+ +RQR W+   EA E C   WMKEALDVLV +L+
Sbjct  115  EQLELWPEQHLRQRMWMKVDEAREACRDWWMKEALDVLVHRLS  157



>emb|CDY51777.1| BnaC05g49600D [Brassica napus]
Length=177

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 109/163 (67%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVGCIPYR +        I     + ++ E L++SSQK   
Sbjct  4    VVSRTGRQFQRYN-KGRRQVVGCIPYRLK--------ISTEGTISEEFEVLVISSQKGHA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS G  +EG M P++V 
Sbjct  55   LMFPKGGWELDESVEEAASRESLEEAGVIGNVERQLGKWDFLSKSRGTFYEGLMFPMLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EEL+ WPE+ +RQR W+   EA E C   WMKEALD LV +L+
Sbjct  115  EELELWPEQHLRQRMWMKVDEAREACRDWWMKEALDALVDRLS  157



>gb|EYU30119.1| hypothetical protein MIMGU_mgv1a020378mg [Erythranthe guttata]
Length=160

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 116/166 (70%), Gaps = 11/166 (7%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            M +RTGR  QRYN +  R VVGCIPYRY++G++            D+LE L++SS+KS  
Sbjct  4    MAARTGRQFQRYN-KDHRLVVGCIPYRYKKGREEE----------DELEVLVISSKKSQA  52

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            MMFPKGGWE DES+EEAA RE+ EEAGV G +   LGKW FKSKS  + HEG M PL+V 
Sbjct  53   MMFPKGGWEVDESVEEAASRESLEEAGVLGNIQCELGKWVFKSKSGELYHEGHMFPLLVT  112

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQ  810
            ++LD WPE+  R+R W+S  EA   C   WMKEALD+LV++L L++
Sbjct  113  QQLDLWPEQTARRRQWMSVAEAKAACEQWWMKEALDILVNRLILKR  158



>gb|KHG12612.1| Nudix hydrolase 4 -like protein [Gossypium arboreum]
Length=206

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 117/173 (68%), Gaps = 9/173 (5%)
 Frame = +1

Query  289  MKLTKVDSMCS--RTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEF  462
            M + K+ S  S  RTGR LQRYN +G R VVGCIPYRYRE + +         + + +E 
Sbjct  31   MPIEKLVSRVSYPRTGRHLQRYNNRGFRLVVGCIPYRYRESEDAKS-------IEEAIEV  83

Query  463  LLVSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLH  642
            L++++Q    ++FPKGGWE+DES+EEAA+RET EEAGV G +   LGKW +KSK   + H
Sbjct  84   LVINAQNGKGILFPKGGWEKDESMEEAAIRETVEEAGVVGVIECKLGKWCYKSKRQSIYH  143

Query  643  EGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EG M  L+V +ELD WPEK++R+R WV+  +A E C H WM EAL+ LV + T
Sbjct  144  EGHMFGLLVKQELDGWPEKNIRKREWVTVSKAREECPHLWMIEALEELVWRQT  196



>ref|XP_006346759.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Solanum tuberosum]
Length=205

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 118/167 (71%), Gaps = 8/167 (5%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SR+GR LQRYN +G RQVVGCIPYRY++      +        D  E LL+S Q+  +
Sbjct  4    LVSRSGRHLQRYN-KGRRQVVGCIPYRYKD------NFDLSMADEDAFEVLLISPQRKGK  56

Query  493  -MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             ++FPKGGWE+DE++E AA RET EEAGV G++   LG W+F++K+    +EG M PL V
Sbjct  57   GLLFPKGGWEKDETIEVAARRETIEEAGVCGDIEGKLGTWYFENKNGDTAYEGHMFPLFV  116

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQ  810
             EELD WPEKD+R+R W+S +EA ++C   WMKEAL++LVS+LT Q+
Sbjct  117  KEELDLWPEKDIRERFWMSVQEARKLCQQGWMKEALEMLVSRLTSQR  163



>gb|KCW48616.1| hypothetical protein EUGRSUZ_K02281 [Eucalyptus grandis]
Length=199

 Score =   168 bits (425),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 121/174 (70%), Gaps = 12/174 (7%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            +++  V S+ SRTGR LQRY  +  RQVVG     YR+  QS+G    G    ++LEFL+
Sbjct  28   VQIKDVVSLVSRTGRHLQRYE-KDRRQVVG-----YRKTDQSSGG---GG---EELEFLV  75

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            VSS K  RMMFPKGGWE DE++E+AALRE+ EEAGV G +   LG+W +KSKS G  H+G
Sbjct  76   VSSPKGQRMMFPKGGWELDETIEQAALRESAEEAGVTGTLECKLGEWRYKSKSNGSFHDG  135

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQ  810
             M PL+V +ELD WPEK VRQR WV+  EA E+C   WMKEAL++L+ +L  Q+
Sbjct  136  HMFPLLVQKELDFWPEKHVRQRRWVTADEAKELCQQLWMKEALELLIQRLRQQK  189



>ref|XP_004236687.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Solanum lycopersicum]
Length=206

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 118/167 (71%), Gaps = 10/167 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREG-KQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            + SR+GR LQRYN +G RQVVGCIPYRY++    S G         D  E LL+S Q+  
Sbjct  4    LVSRSGRHLQRYN-KGRRQVVGCIPYRYKDNFDLSMGD-------EDAFEVLLISPQRKG  55

Query  490  R-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLI  666
            + ++FPKGGWE+DE++E AA RET EEAGV G++   LG W+F++K+    +EG M PL 
Sbjct  56   KGLLFPKGGWEKDETIEVAARRETIEEAGVCGDIEGKLGTWYFENKNGDTAYEGHMFPLF  115

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQ  807
            V EELD WPEKD+R+R W+S +EA ++C   WMKEAL++LVS+LT Q
Sbjct  116  VKEELDLWPEKDIRERFWMSVQEARKLCQQGWMKEALEMLVSRLTSQ  162



>ref|XP_011003749.1| PREDICTED: nudix hydrolase 4-like [Populus euphratica]
Length=200

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 115/169 (68%), Gaps = 9/169 (5%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            +++  + ++ SRTGR LQRY  +G R VVGCIPYRY++ ++           V++LE L+
Sbjct  32   VQIENMVTLVSRTGRHLQRYE-KGYRLVVGCIPYRYKKSQEPTS--------VEELEVLV  82

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEG  648
            +S+Q    M+ PKGGWE DE +EEAA RET EEAGV G V   LG W +KSK   ++HE 
Sbjct  83   ISAQNGQGMLLPKGGWENDECMEEAAKRETEEEAGVIGVVQDKLGPWHYKSKRSCIMHES  142

Query  649  FMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            +M PL+V +ELD WPEK++R+R WVS  EA EVC + WM+EAL+ L  Q
Sbjct  143  YMFPLLVQKELDCWPEKNIRKRRWVSINEAREVCHNWWMREALEELFRQ  191



>ref|XP_010932566.1| PREDICTED: nudix hydrolase 17, mitochondrial [Elaeis guineensis]
Length=164

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 105/164 (64%), Gaps = 6/164 (4%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            S+ SR GR LQRY   G R VVGCIPY+++  K     I         +E L++SSQK  
Sbjct  3    SLVSRQGRHLQRYTSTGGRLVVGCIPYKFKIDKPCDYDIDQA------MEVLVISSQKGH  56

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DE++ +A  RE  EEAGV G +   LG W +KSKS    +EG M PL V
Sbjct  57   GMMFPKGGWELDETITQAVSREALEEAGVRGNLEDKLGTWSYKSKSHDAFYEGIMFPLNV  116

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             EEL  WPE DVR+R WV+  EA E C HPWMKEAL+ LV++L+
Sbjct  117  TEELFHWPEMDVRRRRWVTVAEAREGCQHPWMKEALERLVTRLS  160



>ref|XP_007036922.1| Nudix hydrolase, putative [Theobroma cacao]
 gb|EOY21423.1| Nudix hydrolase, putative [Theobroma cacao]
Length=212

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 110/157 (70%), Gaps = 9/157 (6%)
 Frame = +1

Query  322  RTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDD-LEFLLVSSQKSPRMM  498
            RTGR LQRY+ +G R VVGCIPYRYR+ +++          +D+ +E L++++Q    M+
Sbjct  44   RTGRQLQRYDKRGFRLVVGCIPYRYRKTEEATS--------IDEVIEVLVINAQNGQGML  95

Query  499  FPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEE  678
            FPKGGWE+DE++E AA+RET EEAGV G +   LGKW +KSK     HEG M PL+V +E
Sbjct  96   FPKGGWEKDETMEAAAIRETREEAGVIGNIECKLGKWLYKSKRQSKFHEGHMFPLLVEQE  155

Query  679  LDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLV  789
            LD WPE+++R R WV+  EA E C H WM+EAL+ LV
Sbjct  156  LDRWPEENIRNRKWVTVSEAREQCPHLWMREALEELV  192



>ref|XP_010496591.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Camelina sativa]
Length=186

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 108/163 (66%), Gaps = 9/163 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G R VVGCIPYR +    +  S         + E L++SSQK   
Sbjct  4    LVSRTGRQSQRYN-KGRRLVVGCIPYRVKTSNDNKTS--------GEFEVLVISSQKGQA  54

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAA RE+ EEAGV G V   LGKW F SKS G  +EG M P++V 
Sbjct  55   LMFPKGGWELDESVEEAASRESLEEAGVVGNVERQLGKWDFLSKSRGTFYEGLMFPMLVK  114

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EEL+ WPE+ +RQR+W+   EA E     WMKEALDVLV +L+
Sbjct  115  EELELWPEQHLRQRTWMKVHEAREAYRDWWMKEALDVLVQRLS  157



>gb|KEH34601.1| nudix hydrolase-like protein [Medicago truncatula]
Length=176

 Score =   164 bits (416),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 109/148 (74%), Gaps = 7/148 (5%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR+LQRY  +G RQVVGCIPYRY+ G++++        + D+LE L++SSQK
Sbjct  32   VVTLVSRTGRELQRYR-KGRRQVVGCIPYRYKIGEKNS------LDVSDELEVLVISSQK  84

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES +EAALRET EEAGV G V   LGKW FKSK+   L++G+M PL
Sbjct  85   GKGMLFPKGGWELDESQKEAALRETMEEAGVRGIVEGKLGKWSFKSKTYDTLYDGYMFPL  144

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEV  747
            +V EEL+ WPE+++RQR WVS   ++ V
Sbjct  145  LVQEELEFWPEQNLRQRRWVSNMNSVNV  172



>ref|XP_003619857.1| Nudix hydrolase [Medicago truncatula]
 gb|AES76075.1| nudix hydrolase-like protein [Medicago truncatula]
Length=213

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 104/148 (70%), Gaps = 16/148 (11%)
 Frame = +1

Query  307  DSMC---SRTGRDLQRYNVQGCRQVVGCIPYRYRE-GKQSAGSIIHGAPLVDDLEFLLVS  474
            + MC    RTGR LQRY  QGCRQVVGCIPYRY++ G Q             ++E LL+S
Sbjct  71   NMMCLVSPRTGRHLQRYE-QGCRQVVGCIPYRYKKNGTQE-----------KEIEVLLIS  118

Query  475  SQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFM  654
            +QK   M FPKGGWE+DE++E+AALRET EEAGV G V S LGKW++KSK    +HEG+M
Sbjct  119  AQKGSGMQFPKGGWEKDETMEQAALRETIEEAGVIGSVESNLGKWYYKSKRQPTMHEGYM  178

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREA  738
             PL+V +ELD+WPE ++R+R WVS  E 
Sbjct  179  FPLLVSKELDNWPEMNIRRRKWVSVYET  206



>ref|XP_009408403.1| PREDICTED: nudix hydrolase 17, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 101/160 (63%), Gaps = 9/160 (6%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            S+ SR GR LQRY   G R VVGCIPY++            G  L   +E L++SS K  
Sbjct  3    SLVSRQGRQLQRYTKSGGRLVVGCIPYKFSP---------RGEGLDKSMEVLVISSPKGN  53

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             ++FPKGGWE DE+++EAA RE  EEAGV G V   LG+W +KS++    +EG M PL V
Sbjct  54   GLLFPKGGWETDETIKEAASREALEEAGVQGNVERKLGRWRYKSRTYDAYYEGIMFPLNV  113

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLV  789
             EEL DWPE   RQR WV+  EA E C HPWMKEAL+ LV
Sbjct  114  TEELGDWPEMHARQRKWVTVAEAKEGCQHPWMKEALERLV  153



>ref|XP_009386463.1| PREDICTED: nudix hydrolase 18, mitochondrial-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=204

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 109/191 (57%), Gaps = 35/191 (18%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            M SR GR LQRY+  G R VVGCIPY+Y  G         G  L   +E L++SS K   
Sbjct  4    MVSRQGRQLQRYSKSGSRLVVGCIPYKYNPGDGG------GEDLDRSMEVLVISSPKGNG  57

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVG----SC---------------------  597
            ++FPKGGWE DE+++EAALRE  EEAGV G V     SC                     
Sbjct  58   LLFPKGGWETDETIKEAALREALEEAGVQGNVQVSLRSCPLPLQITRLCRSVADHLAVPS  117

Query  598  ----LGKWFFKSKSLGVLHEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWM  765
                LGKW +KS++ G +HEG M PL V EEL DWPE   R+R WV+  +A E C HPWM
Sbjct  118  LQRKLGKWKYKSRTYGAVHEGIMFPLNVTEELGDWPEMHTRERKWVTVADAKEGCQHPWM  177

Query  766  KEALDVLVSQL  798
            KEALD LV +L
Sbjct  178  KEALDRLVKRL  188



>gb|AAP57672.1| MutT-like protein [Cucumis sativus]
Length=151

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 105/149 (70%), Gaps = 6/149 (4%)
 Frame = +1

Query  370  VVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMMFPKGGWEQDESLEEAAL  549
            VVGC+ YRY+  K+S    I      ++LE L++SSQK   M+FPKGGWE DES+ EAA 
Sbjct  3    VVGCVAYRYKTTKKSTLDNI------EELEVLVISSQKGKGMLFPKGGWETDESITEAAS  56

Query  550  RETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEELDDWPEKDVRQRSWVSY  729
            RET EEAGV G V   LG W FKSK+    +EG+M PL+V E+L+ WPEK+ RQR W+S 
Sbjct  57   RETLEEAGVRGIVQGELGSWSFKSKTYDTFYEGYMFPLLVKEQLEFWPEKNFRQRVWMSA  116

Query  730  REAMEVCFHPWMKEALDVLVSQLTLQQEE  816
             EA EVC H WMKEALD+LV +L+ Q+++
Sbjct  117  HEAREVCQHWWMKEALDILVGRLSSQKKQ  145



>ref|XP_010066576.1| PREDICTED: nudix hydrolase 17, mitochondrial [Eucalyptus grandis]
 gb|KCW64502.1| hypothetical protein EUGRSUZ_G02109 [Eucalyptus grandis]
Length=173

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 122/174 (70%), Gaps = 12/174 (7%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRY-REGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            M SR+GR+LQRY++ G RQVVGCIPYRY R+G    G         D+LEFL++SS K  
Sbjct  4    MVSRSGRELQRYHM-GRRQVVGCIPYRYKRDGDGVVG---------DELEFLVISSPKGQ  53

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             +MFPKGGWE DES EEAA RE+ EEAGV G++   LG+W F SK  G  +EG M PL V
Sbjct  54   GLMFPKGGWELDESEEEAASRESIEEAGVLGDIECKLGRWSFLSKRYGTYYEGHMFPLFV  113

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQL-TLQQEEDENE  828
             EELD WPEK++RQR W++  EA EVC H WMKEALD+LV +L ++ Q E + E
Sbjct  114  KEELDLWPEKNLRQRIWMTAAEAREVCRHWWMKEALDILVERLGSIPQNERKPE  167



>ref|NP_001048038.1| Os02g0734300 [Oryza sativa Japonica Group]
 dbj|BAD16159.1| MutT/nudix-like [Oryza sativa Japonica Group]
 dbj|BAF09952.1| Os02g0734300 [Oryza sativa Japonica Group]
 gb|EAZ24525.1| hypothetical protein OsJ_08286 [Oryza sativa Japonica Group]
 dbj|BAG96796.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87122.1| unnamed protein product [Oryza sativa Japonica Group]
Length=160

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 105/161 (65%), Gaps = 14/161 (9%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +R GR+LQRY   G R VVGCIPYR R G               ++E L+++SQK   
Sbjct  4    LVARQGRELQRYTSAGGRIVVGCIPYRVRSG--------------GEMEVLVITSQKGHG  49

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            MMFPKGGWE DES++EAA RE  EEAGV G+  + LG W++KS+     +EGFM PL V 
Sbjct  50   MMFPKGGWELDESMDEAARREALEEAGVRGDTETSLGCWYYKSRRYDTTYEGFMFPLRVT  109

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            +EL  WPE   R+R+W + ++AM+ C H WM+EAL+ LVS+
Sbjct  110  DELLQWPEMSSRKRTWATVQQAMDGCQHGWMREALERLVSR  150



>ref|XP_010916198.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Elaeis guineensis]
Length=171

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 109/176 (62%), Gaps = 13/176 (7%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            S  SR GR LQRY+  G R VVGCIPY++   K        G  L   +E L++SSQK  
Sbjct  3    SSVSRQGRQLQRYSRSGSRLVVGCIPYKFDIDKSC------GDDLDQVMEVLVISSQKGY  56

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DE++++AA RE  EEAGV G V   LG+W +KSK+     EG M PL V
Sbjct  57   GMMFPKGGWEIDETIKQAASREALEEAGVQGNVERRLGRWKYKSKTQDAFCEGVMFPLNV  116

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEARN  837
             E L DWPE DVR+R WV+  EA E C H WMKEAL+ LV++L+       N  RN
Sbjct  117  TEVLMDWPEMDVRERRWVTVAEAREGCEHLWMKEALERLVTRLS-------NSTRN  165



>gb|EAY87426.1| hypothetical protein OsI_08834 [Oryza sativa Indica Group]
Length=160

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 104/161 (65%), Gaps = 14/161 (9%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +R GR+LQRY   G R VVGCIPYR R G               ++E L+++SQK   
Sbjct  4    LVARQGRELQRYTSAGGRIVVGCIPYRVRSG--------------GEMEVLVITSQKGHG  49

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            MMFPKGGWE DES++EAA RE  EEAGV G   + LG W++KS+     +EGFM PL V 
Sbjct  50   MMFPKGGWELDESMDEAARREALEEAGVRGNTETSLGCWYYKSRRYDTTYEGFMFPLRVT  109

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            +EL  WPE   R+R+W + ++AM+ C H WM+EAL+ LVS+
Sbjct  110  DELLQWPEMSSRKRTWATVQQAMDGCQHGWMREALERLVSR  150



>ref|XP_008460551.1| PREDICTED: nudix hydrolase 18, mitochondrial-like, partial [Cucumis 
melo]
Length=160

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 103/146 (71%), Gaps = 6/146 (4%)
 Frame = +1

Query  379  CIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMMFPKGGWEQDESLEEAALRET  558
            CIPYRY+  K+S    I      ++LE L++SSQK   M+FPKGGWE DES+ EAA RET
Sbjct  10   CIPYRYKTTKKSTLDNI------EELEVLVISSQKGKGMLFPKGGWETDESITEAASRET  63

Query  559  FEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEELDDWPEKDVRQRSWVSYREA  738
             EEAGV G V   LG W FKSK+    +EG+M PL+V E+L+ WPEK+ RQR W+S  EA
Sbjct  64   LEEAGVRGIVQGELGSWSFKSKTYDTFYEGYMFPLLVKEQLEFWPEKNFRQRVWMSAHEA  123

Query  739  MEVCFHPWMKEALDVLVSQLTLQQEE  816
             EVC H WMKEALD+LV +L+ Q+++
Sbjct  124  REVCQHWWMKEALDILVGRLSSQKKQ  149



>ref|XP_009117868.1| PREDICTED: nudix hydrolase 18, mitochondrial-like isoform X2 
[Brassica rapa]
Length=174

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 109/163 (67%), Gaps = 14/163 (9%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + SRTGR  QRYN +G RQVVG         K S+  I+      D+ E L++SSQK   
Sbjct  4    VVSRTGRQFQRYN-KGRRQVVGL--------KTSSDGIVS-----DEFEVLVISSQKGHA  49

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            +MFPKGGWE DES+EEAALRE+ EEAGV G+V   LGKW F SKS G  +EG M P++V 
Sbjct  50   LMFPKGGWELDESIEEAALRESLEEAGVIGDVERQLGKWDFLSKSRGTFYEGLMFPMLVK  109

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            EEL+ WPE+ +RQR W+   EA E C   WMKEALDVLV +L+
Sbjct  110  EELELWPEQHLRQRMWMKVDEAREACRDWWMKEALDVLVHRLS  152



>ref|XP_008775463.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Phoenix dactylifera]
Length=171

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 106/168 (63%), Gaps = 14/168 (8%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDL----EFLLVSS  477
            S+ SR GR LQRY+  G R VVGCIPY++   K          P  DDL    E L++SS
Sbjct  3    SLVSRQGRQLQRYSRTGSRLVVGCIPYKFNIDK----------PCSDDLDQAMEVLVISS  52

Query  478  QKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFML  657
            QK   MMFPKGGWE DE++++AA RE  EEAGV G V   LG+W +KSK+    +EG M 
Sbjct  53   QKGYGMMFPKGGWEIDETIKQAASREALEEAGVQGNVERRLGRWRYKSKTHDAFYEGVMF  112

Query  658  PLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            PL V E L +WPE DVR+R WV+  EA E C   WMKEAL+ LV +L 
Sbjct  113  PLNVTEVLMNWPEMDVRRRRWVTVAEAREGCEQLWMKEALERLVRRLA  160



>ref|XP_009419118.1| PREDICTED: nudix hydrolase 21, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 108/171 (63%), Gaps = 6/171 (4%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKS-  486
            S+ SR GR LQRY   G R +VGCIPY+ ++  +     I+       +E L+V+SQK+ 
Sbjct  3    SLVSRQGRQLQRYTSCGKRLIVGCIPYKVKKIDRICEHNINQV-----VEVLVVTSQKTR  57

Query  487  PRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLI  666
              +MFPKGGWE DE++ +AA RE FEEAGV G V   LGKW +KSKS   +HE  M PL 
Sbjct  58   EEIMFPKGGWEVDETITQAARREAFEEAGVQGLVEDSLGKWRYKSKSHDKIHEAVMFPLN  117

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEED  819
            V EEL  WPEK VR R W++  EAM  C   WMKEALD LV +L+    E+
Sbjct  118  VTEELYYWPEKSVRTRKWINVAEAMAECNQSWMKEALDRLVKRLSTSSLEE  168



>ref|XP_006647851.1| PREDICTED: nudix hydrolase 21, chloroplastic-like [Oryza brachyantha]
Length=158

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 103/161 (64%), Gaps = 15/161 (9%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +R GR+LQRY   G R VVGCIPYR R G               ++E L+++SQK   
Sbjct  4    LVARQGRELQRYTSSGGRIVVGCIPYRVRGG---------------EMEVLVITSQKGHG  48

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVL  672
            MMFPKGGWE DES++EAA RE  EEAGV GE    LG W++KS+     +EGFM PL V 
Sbjct  49   MMFPKGGWELDESMDEAARREALEEAGVRGETEPSLGCWYYKSRRYDKTYEGFMFPLRVT  108

Query  673  EELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            +EL  WPE   R+R+W + ++ M+ C H WM+EAL+ LVS+
Sbjct  109  DELHQWPEMASRKRTWATVQQVMDGCQHGWMREALEQLVSR  149



>ref|XP_009409249.1| PREDICTED: nudix hydrolase 21, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=167

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 105/167 (63%), Gaps = 14/167 (8%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDD--LEFLLVSSQK  483
            ++ SR GR LQRY+  G R +VGCIPYR           +   P   D  +E L++SS K
Sbjct  4    ALVSRQGRQLQRYDSCGSRLIVGCIPYR-----------VKTMPCDPDQAVEVLVISSSK  52

Query  484  SPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLP  660
              + +MFPKGGWEQDES+ +AA RETFEEAGV G +   LG W +KSKS   +HE  M P
Sbjct  53   KRQEIMFPKGGWEQDESIIQAAYRETFEEAGVLGHLEDSLGIWRYKSKSHDKIHEAVMFP  112

Query  661  LIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            L V EEL  WPEK +R R W+S  EAM  C H WMKEAL  LV +L+
Sbjct  113  LNVTEELYCWPEKAIRTRKWISVAEAMAECKHSWMKEALARLVKRLS  159



>ref|XP_006828427.1| hypothetical protein AMTR_s00060p00096990 [Amborella trichopoda]
 gb|ERM95843.1| hypothetical protein AMTR_s00060p00096990 [Amborella trichopoda]
Length=180

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 106/164 (65%), Gaps = 13/164 (8%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            S+ SRTGR LQRY+  G R + GCIPYR+   K S      G      LE L++SSQK  
Sbjct  3    SLMSRTGRHLQRYD-NGRRLIAGCIPYRFTTEKLSDNG--EG----KTLEVLMISSQKGC  55

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             ++FPKGGWE+DESL++A  RE  EEAGV G++   L +W  KSK       G+M PL V
Sbjct  56   SLLFPKGGWEKDESLKDAVRREALEEAGVQGKIEKRLARWTSKSK------RGYMFPLRV  109

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
             E+LD WPEK +R+R WVS  EA E+C +PWM +ALD LVS+ T
Sbjct  110  TEQLDHWPEKHIRERMWVSVAEAREMCKYPWMMKALDQLVSRYT  153



>gb|EAZ00395.1| hypothetical protein OsI_22410 [Oryza sativa Indica Group]
Length=168

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 104/161 (65%), Gaps = 19/161 (12%)
 Frame = +1

Query  313  MCSRTGRDLQRY-NVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            M +R GR+LQRY +  G R VVGCIPYR R      G +          E L++SSQK  
Sbjct  5    MVARQGRELQRYSDNTGGRMVVGCIPYRVR---GDGGGV----------EVLVISSQKKG  51

Query  490  R-----MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFM  654
                  +MFPKGGWE DES++EAA RE  EEAGV GE+G+ LG+W ++S+     +EGF+
Sbjct  52   AAAGDVVMFPKGGWELDESVDEAARREALEEAGVLGEIGASLGRWCYRSRRYDATYEGFV  111

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEAL  777
             PL V +ELD WPE   R+RSWVS ++AM+ C H WM+EAL
Sbjct  112  FPLRVTDELDRWPEMAARRRSWVSPQQAMDRCPHWWMREAL  152



>gb|ACF88368.1| unknown [Zea mays]
 gb|AFW63828.1| nudix hydrolase 4 [Zea mays]
Length=161

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 107/168 (64%), Gaps = 16/168 (10%)
 Frame = +1

Query  313  MCSRTGRDLQRYN-VQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            + +R GR+LQRY+   G R VVGCIPYR R                 +LE L+++SQK  
Sbjct  5    LVARQGRELQRYSQSTGGRIVVGCIPYRVRRD--------------GELEVLVITSQKGH  50

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKS-LGVLHEGFMLPLI  666
             MMFPKGGWE DES++EAA RE  EEAGV G+ G  LG W +KS+  +   +EGFM PL 
Sbjct  51   GMMFPKGGWEVDESMDEAARREALEEAGVLGDTGPVLGLWHYKSRRYVDQTYEGFMFPLR  110

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQ  810
            V +EL  WPE   R+R+W + ++AM+ C H WM+EAL+ LV++  + Q
Sbjct  111  VADELHQWPEMASRKRTWATVQQAMDGCPHWWMREALERLVARQAVLQ  158



>ref|XP_009391417.1| PREDICTED: nudix hydrolase 17, mitochondrial-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=159

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 105/174 (60%), Gaps = 17/174 (10%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            ++ SR GR LQRY+  G R VVGCIPY+++E  + A            +E L+VSSQK P
Sbjct  3    ALVSRHGRRLQRYS-SGRRLVVGCIPYKFKEVDEPA------------IEVLVVSSQKGP  49

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             +MFPKGGWE DES+ EAA RE FEEAGV G +   LGKW   SK    +H  FM  L V
Sbjct  50   ELMFPKGGWELDESMPEAASREAFEEAGVRGNLEGTLGKW--TSKGDDKVH--FMYALRV  105

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
             E L  WPE D R+R WV+  EA EVC H WM+EA+D L   L     ++ N A
Sbjct  106  TEVLQQWPEMDARERKWVTVEEAREVCKHSWMREAVDKLADLLPSPSGQEMNSA  159



>ref|NP_001057309.1| Os06g0255400 [Oryza sativa Japonica Group]
 dbj|BAD45240.1| MutT/nudix-like [Oryza sativa Japonica Group]
 dbj|BAF19223.1| Os06g0255400 [Oryza sativa Japonica Group]
Length=168

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 104/161 (65%), Gaps = 19/161 (12%)
 Frame = +1

Query  313  MCSRTGRDLQRY-NVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            M +R GR+LQRY +  G R VVGCIPYR R      G +          E L++SSQK  
Sbjct  5    MVARQGRELQRYSDNTGGRMVVGCIPYRVR---GDGGGV----------EVLVISSQKKG  51

Query  490  R-----MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFM  654
                  +MFPKGGWE DES++EAA RE  EEAGV GE+G+ LG+W ++S+     +EGF+
Sbjct  52   AAAGDVVMFPKGGWELDESVDEAARREALEEAGVLGEIGASLGRWCYRSRRYDATYEGFV  111

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEAL  777
             PL V +ELD WPE   R+RSWVS ++AM+ C H WM+EAL
Sbjct  112  FPLRVTDELDRWPEMAARRRSWVSPQQAMDRCPHWWMREAL  152



>ref|XP_006843514.1| hypothetical protein AMTR_s00053p00229450 [Amborella trichopoda]
 gb|ERN05189.1| hypothetical protein AMTR_s00053p00229450 [Amborella trichopoda]
Length=189

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 114/190 (60%), Gaps = 15/190 (8%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +RTGR  QRY  +GCR V GCIPYRYR   +++G   +     D +E L+++SQ  P 
Sbjct  4    LVARTGRHQQRYE-EGCRLVAGCIPYRYRTSNETSGDKSN-----DSVEVLMINSQSGPG  57

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSK------SLGVLHEGFM  654
            ++FPKGGWE DE+ E+AALRE  EEAGV GE+   LG + FKSK      S   L    M
Sbjct  58   LLFPKGGWENDETKEQAALREALEEAGVQGEIMEFLGFYEFKSKTHQDELSPEGLCRAAM  117

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQL---TLQQEEDEN  825
              L+V EEL  WPE+ +RQR W++  EA E C H WMK+AL    S+     +Q +  EN
Sbjct  118  FALLVTEELVSWPEQSMRQRRWLTIPEAEEHCRHSWMKKALQEGFSKWHASKMQHDNAEN  177

Query  826  EARNGMMRNI  855
            ++ +   R+ 
Sbjct  178  QSPDSADRDT  187



>gb|KDO50814.1| hypothetical protein CISIN_1g029277mg [Citrus sinensis]
Length=168

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 106/169 (63%), Gaps = 34/169 (20%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR LQRY  +G RQVVGCIPYRY+  KQS    I+     +DLE L++SSQK
Sbjct  20   VGNLVSRTGRHLQRYQ-KGRRQVVGCIPYRYKCVKQSLD--INE----EDLEVLVISSQK  72

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPL  663
               M+FPKGGWE DES++EAALRET EEAGV G                           
Sbjct  73   GKGMLFPKGGWEIDESIQEAALRETIEEAGVTG---------------------------  105

Query  664  IVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQ  810
            IV ++L +WPEK+VR R W+S  EA +VC H WMKEALD LV +LT QQ
Sbjct  106  IVEDQLAEWPEKNVRSRKWMSVAEARKVCQHWWMKEALDRLVMRLTSQQ  154



>emb|CDP01643.1| unnamed protein product [Coffea canephora]
Length=174

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 111/167 (66%), Gaps = 16/167 (10%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDD--LEFLLVSSQK  483
            ++ SRTGR LQRY  +GCRQVVGCIPYR +        + + A LVD+  LE L++++Q+
Sbjct  3    ALVSRTGRHLQRYE-RGCRQVVGCIPYRIK--------LANKATLVDEDSLEVLVITAQR  53

Query  484  SPR-MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLP  660
              + ++FPKGGWE DE + EAA RET EEAGV G+V   LG W F++++     E FM  
Sbjct  54   KGKGVLFPKGGWETDEDIFEAAERETVEEAGVVGDVQKFLGHWNFENQN----KESFMFA  109

Query  661  LIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            + V E+L+ WPE+D RQR W+S  EA + C   WMK+AL+ LV  LT
Sbjct  110  MQVREQLEFWPEQDKRQRIWMSVAEARKECKQKWMKDALENLVKWLT  156



>gb|EMS50379.1| Nudix hydrolase 17, mitochondrial [Triticum urartu]
Length=224

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 102/159 (64%), Gaps = 9/159 (6%)
 Frame = +1

Query  322  RTGRDLQRYNVQ-GCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMM  498
            R GR+LQRY+   G R VVGCIPYR R G    G           LE L++SSQK   MM
Sbjct  66   REGRELQRYSASTGGRIVVGCIPYRVRAGGDGDGEGE--------LEVLVISSQKGHGMM  117

Query  499  FPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEE  678
            FPKGGWE DES+++AA RE  EEAGV GE+G  LG W ++S+     +EG M PL V +E
Sbjct  118  FPKGGWELDESMDDAARREALEEAGVRGEMGKVLGCWHYQSRRYQTTYEGIMYPLRVTDE  177

Query  679  LDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            L  WPE   R+R+W + ++ ME C H WM+EAL+ LV++
Sbjct  178  LQQWPEMASRKRTWATVQQVMEGCQHCWMREALEELVAR  216



>ref|XP_006430601.1| hypothetical protein CICLE_v10012837mg [Citrus clementina]
 gb|ESR43841.1| hypothetical protein CICLE_v10012837mg [Citrus clementina]
 gb|KDO50815.1| hypothetical protein CISIN_1g029277mg [Citrus sinensis]
Length=163

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 102/141 (72%), Gaps = 8/141 (6%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            V ++ SRTGR LQRY  +G RQVVGCIPYRY+  KQS    I+     +DLE L++SSQK
Sbjct  20   VGNLVSRTGRHLQRYQ-KGRRQVVGCIPYRYKCVKQSLD--INE----EDLEVLVISSQK  72

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEV-GSCLGKWFFKSKSLGVLHEGFMLP  660
               M+FPKGGWE DES++EAALRET EEAGV G V    LG+W FKS++    ++G+M P
Sbjct  73   GKGMLFPKGGWEIDESIQEAALRETIEEAGVTGIVECELLGEWNFKSRAHNTDYQGYMFP  132

Query  661  LIVLEELDDWPEKDVRQRSWV  723
            L+V ++L +WPEK+VR R WV
Sbjct  133  LLVQDQLAEWPEKNVRSRKWV  153



>ref|XP_002272200.1| PREDICTED: nudix hydrolase 16, mitochondrial [Vitis vinifera]
 emb|CAN81261.1| hypothetical protein VITISV_019710 [Vitis vinifera]
 emb|CBI30125.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 105/162 (65%), Gaps = 12/162 (7%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +RTGR  QRY   GCR V GCIP++YR   +S     +GA     +E L+++S   P 
Sbjct  4    LVARTGRHQQRYE-DGCRLVAGCIPFKYRNSVES-----NGAASQKIVEVLMINSTSGPG  57

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLG------VLHEGFM  654
            ++FPKGGWE DE++EEAALRE  EEAGV G++   LG + FKSK+L        L +  M
Sbjct  58   LLFPKGGWENDETVEEAALREALEEAGVRGDLKHFLGCYLFKSKTLQDESCPEGLCKAAM  117

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALD  780
              L+V EEL  WPE+  R+RSW++  EA+E C HPWM++AL+
Sbjct  118  FALLVKEELPSWPEQSTRERSWLTIPEAIERCRHPWMRKALE  159



>ref|XP_009348278.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Pyrus x bretschneideri]
Length=190

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 112/176 (64%), Gaps = 14/176 (8%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYRE-GKQSAGSIIHGAPLVDDLEFLLVSSQ  480
            +  + +RTGR  QRY   G R V GCIP++YR  G+ S G+          +E L++S+ 
Sbjct  1    MSDLVARTGRHQQRYEA-GHRLVAGCIPFKYRNTGENSDGAC------EKVVEVLMISTT  53

Query  481  KSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLG------VLH  642
            + P ++FPKGGWE DE+++EAA+RE  EEAGV G++  CLG +FFKSK+L        L 
Sbjct  54   RGPGLVFPKGGWENDETVQEAAIREAVEEAGVQGDIMDCLGHYFFKSKTLQDELSPEGLS  113

Query  643  EGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQ  810
            +  M PL+V EEL+ WPE++ R+RSW S  EA E+C H WMK AL+   S+   +Q
Sbjct  114  KAAMFPLLVKEELEFWPEQNNRRRSWHSIPEATELCRHQWMKAALEEGFSRWFAEQ  169



>gb|ABK23596.1| unknown [Picea sitchensis]
Length=232

 Score =   149 bits (377),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 102/163 (63%), Gaps = 10/163 (6%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            ++ +RTGR  QRY+  G R V GCIPYRY   K++A      +    +LE L+V+ Q+  
Sbjct  3    ALVARTGRHRQRYH-DGSRLVAGCIPYRY---KKTADDCNSNSTETRELEVLMVTPQRRQ  58

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFF------KSKSLGVLHEGF  651
             ++FPKGGWE DE+ EEAA RE  EEAGV GE+  CLG W F      K +++    +G+
Sbjct  59   GLLFPKGGWEDDETKEEAACREALEEAGVKGEIECCLGSWDFMSTGHQKDRNVDGCRKGY  118

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALD  780
            M  L+V EEL+ WPEKD RQR WV+ REA + C   WM  ALD
Sbjct  119  MFVLVVTEELESWPEKDARQRKWVTVREARDQCKLQWMCLALD  161



>ref|XP_010556716.1| PREDICTED: nudix hydrolase 17, mitochondrial-like [Tarenaya hassleriana]
Length=153

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 98/152 (64%), Gaps = 8/152 (5%)
 Frame = +1

Query  376  GCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPRMMFPKGGWEQDESLEEAALRE  555
            G   YR++        I     + D+LE L+++SQK   MMFPKGGWE DES+EEAA RE
Sbjct  4    GGGTYRFK--------ISSDGTISDELEVLVITSQKGHAMMFPKGGWELDESVEEAASRE  55

Query  556  TFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIVLEELDDWPEKDVRQRSWVSYRE  735
            + EEAGV G + S LGKW F SKS G  +EG M PL+V E+LD WPE+ +RQR W++  E
Sbjct  56   SLEEAGVLGSIESQLGKWDFLSKSRGTFYEGLMFPLLVKEQLDLWPEQHLRQRIWMTVGE  115

Query  736  AMEVCFHPWMKEALDVLVSQLTLQQEEDENEA  831
            A E C   WMKEALDVL  +L+   ++D  E 
Sbjct  116  AREACRDWWMKEALDVLAERLSSPMKQDNEET  147



>gb|EMT05697.1| Nudix hydrolase 17, mitochondrial [Aegilops tauschii]
Length=164

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 104/162 (64%), Gaps = 10/162 (6%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQ-GCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            + +R GR+LQRY+   G R VVGCIPYR R G               +LE L++SSQK  
Sbjct  4    LVARQGRELQRYSASTGGRIVVGCIPYRVRGGGGEC---------EGELEVLVISSQKGH  54

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGFMLPLIV  669
             MMFPKGGWE DES+++AA RE  EEAGV GE+G  LG W ++S+     +EG M PL V
Sbjct  55   GMMFPKGGWELDESMDDAARREALEEAGVRGEMGKVLGCWHYQSRRYQTTYEGIMYPLRV  114

Query  670  LEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
             +EL  WPE   R+R+W + ++ ME C H WM+EAL+ LV++
Sbjct  115  TDELQQWPEMASRKRTWATVQQVMEGCQHCWMREALEELVAR  156



>ref|NP_001148660.1| nudix hydrolase 4 [Zea mays]
 gb|ACG32420.1| nudix hydrolase 4 [Zea mays]
Length=161

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 106/168 (63%), Gaps = 16/168 (10%)
 Frame = +1

Query  313  MCSRTGRDLQRYN-VQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            + +R GR+LQRY+   G R VVGCIPYR R                 +LE L+++SQK  
Sbjct  5    LVARQGRELQRYSQSTGGRIVVGCIPYRVRRD--------------GELEVLVITSQKGH  50

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKS-LGVLHEGFMLPLI  666
             MMFPKGGWE DES++EAA RE  EEAGV G+    LG W +KS+  +   +EGFM PL 
Sbjct  51   GMMFPKGGWEVDESMDEAARREALEEAGVLGDTEPVLGLWHYKSRRYVDQTYEGFMFPLR  110

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQ  810
            V +EL  WPE   R+R+W + ++AM+ C H WM+EAL+ LV++  + Q
Sbjct  111  VADELHQWPEMASRKRTWATVQQAMDGCPHWWMREALERLVARQAVLQ  158



>ref|XP_002454329.1| hypothetical protein SORBIDRAFT_04g028750 [Sorghum bicolor]
 gb|EES07305.1| hypothetical protein SORBIDRAFT_04g028750 [Sorghum bicolor]
Length=205

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 109/175 (62%), Gaps = 15/175 (9%)
 Frame = +1

Query  292  KLTKVDSMCSRTGRDLQRYN-VQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            + + +  + +R GR+LQRY+   G R VVGCIPYR R             P   +LE L+
Sbjct  41   RASTMAVLVARQGRELQRYSQSTGGRIVVGCIPYRVR-------------PCDGELEVLV  87

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKS-LGVLHE  645
            ++SQK   MMFPKGGWE DES++EAA RE  EEAGV G+    LG W +KS+  +   +E
Sbjct  88   ITSQKGHGMMFPKGGWEVDESMDEAARREALEEAGVLGDTEPVLGFWHYKSRRYVDQTYE  147

Query  646  GFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQ  810
            GFM PL V +EL  WPE   R+R+W + ++ M+ C H WM+EAL+ LV++  + Q
Sbjct  148  GFMFPLRVADELHQWPEMASRKRTWATVQQVMDGCPHWWMREALERLVARHAVLQ  202



>ref|XP_003563991.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Brachypodium 
distachyon]
Length=181

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 110/186 (59%), Gaps = 22/186 (12%)
 Frame = +1

Query  310  SMCSRTGRDLQRYNVQ-GCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK-  483
            +M +R GRDLQRY+   G R VVGC+PYR R      G +          E L++ S+K 
Sbjct  4    AMVARQGRDLQRYSASTGGRIVVGCVPYRVRGDGDGDGEV----------EVLVICSRKK  53

Query  484  --SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEV-GSCLGKWFFKSKSLGVLHEGFM  654
                 +MFPKGGWE DES++EAA RE  EEAGV GE+ G+ LG+W ++S+     +EGFM
Sbjct  54   GAGAGVMFPKGGWELDESMDEAARREALEEAGVRGEITGAPLGRWCYRSRRYDATYEGFM  113

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDENEAR  834
             PL V +EL+ WPE   R R+WV+  EAM+ C H WM+EAL     +L       +N A 
Sbjct  114  FPLRVTDELERWPEMSGRGRAWVTVAEAMDRCPHWWMREALQRFADRL-------DNGAS  166

Query  835  NGMMRN  852
            +G   N
Sbjct  167  DGGAAN  172



>ref|XP_006655976.1| PREDICTED: nudix hydrolase 21, chloroplastic-like [Oryza brachyantha]
Length=170

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 105/171 (61%), Gaps = 20/171 (12%)
 Frame = +1

Query  313  MCSRTGRDLQRY-NVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            M +R GR+LQRY +  G R VVGCIPYR  EG   AG           +E L++SS+K  
Sbjct  5    MVARQGRELQRYSDNTGGRMVVGCIPYRVGEG--GAG-----------VEVLVISSRKKG  51

Query  490  R------MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLGVLHEGF  651
                   +M PKGGWE DES++EAA RE  EEAGV GE G  LG+W ++S+     +EGF
Sbjct  52   AAGEEEAVMLPKGGWELDESMDEAARREALEEAGVLGETGPTLGRWCYRSRRYDATYEGF  111

Query  652  MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTL  804
            + PL V +EL+ WPE   R+R WVS +EAM+ C H WM+EAL +   +  L
Sbjct  112  VFPLRVTDELERWPEMAARRRCWVSPQEAMDRCPHWWMREALQLFADRFRL  162



>ref|XP_010673019.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Beta vulgaris 
subsp. vulgaris]
Length=177

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 104/162 (64%), Gaps = 12/162 (7%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +RTGR  QRY   GCR V GCIP+RYR   +S  +          +E L+++S   P 
Sbjct  4    LVARTGRHQQRYE-DGCRLVAGCIPFRYRSFDESDRTESEKV-----VEVLMINSTSGPG  57

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLG------VLHEGFM  654
            ++FPKGGWE DE++EEAA+RE  EEAGV GE+  CLG + FKSK+L        L +  M
Sbjct  58   LLFPKGGWENDETVEEAAIREAMEEAGVKGELLDCLGYYSFKSKTLQDDFSPEGLCKAAM  117

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALD  780
              L+V EEL+ WPE+  RQR W++  EA++ C HPWM++AL+
Sbjct  118  FALLVKEELEYWPEQSTRQRIWLNITEALDCCRHPWMRQALE  159



>gb|ABR18248.1| unknown [Picea sitchensis]
Length=178

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 109/178 (61%), Gaps = 12/178 (7%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
             + + +RTGR  QRY+ +  R V GCIPYRY+E  ++    ++      +LE L+V S+ 
Sbjct  2    AEELTARTGRHQQRYDNE-YRLVAGCIPYRYKESGEACNGTVN-----RELEVLMVLSRG  55

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSK------SLGVLHE  645
               ++FPKGGWE DESL+EAA RETFEEAGV G +   LG W F+SK      +L   H 
Sbjct  56   GTALIFPKGGWENDESLQEAACRETFEEAGVRGIIKKDLGCWDFRSKRYQDDSNLEGFHR  115

Query  646  GFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEED  819
              M  L+V E+LD WPE++ RQR WV+  EA   C   WM++AL   V+ L+ +Q E+
Sbjct  116  AHMFALLVTEQLDSWPEQNERQRKWVTITEADGRCKDDWMRQALRSCVTYLSSRQMEN  173



>ref|XP_008445383.1| PREDICTED: nudix hydrolase 16, mitochondrial isoform X1 [Cucumis 
melo]
Length=173

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 106/176 (60%), Gaps = 12/176 (7%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +RTGR  QRY+  GCR + GCIP+RYR    S+  I         +E L++ +   P 
Sbjct  4    LVARTGRHQQRYDA-GCRLIAGCIPFRYRSSDGSSDEISDKV-----VEVLMIDTPSGPG  57

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSK------SLGVLHEGFM  654
            ++FPKGGWE DE++EEAA+RE  EEAGV GE+   LG + FKSK      S   L    M
Sbjct  58   LLFPKGGWENDETVEEAAVREAIEEAGVRGELMGFLGDYHFKSKTQQDEFSPDGLCRAAM  117

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLTLQQEEDE  822
              L+V EEL+ WPE++ R RSWV+  EA+E C H WM++AL +  ++   +   DE
Sbjct  118  YALLVTEELECWPEQNTRNRSWVTIPEAIEKCRHAWMRDALAIGFNKWHAENISDE  173



>ref|XP_004953836.1| PREDICTED: nudix hydrolase 18, mitochondrial-like [Setaria italica]
Length=161

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 103/163 (63%), Gaps = 15/163 (9%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQ-GCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            + +R GR+LQRY+ + G R VVGCIPYR R                 +LE L+++SQK  
Sbjct  4    LVARQGRELQRYSQRTGGRIVVGCIPYRVRRDD-------------GELEVLVITSQKGH  50

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLG-VLHEGFMLPLI  666
             MMFPKGGWE+DES++EAA RE  EEAGV G+    LG W ++S+      +EGFM PL 
Sbjct  51   GMMFPKGGWEEDESMDEAARREALEEAGVLGDTEPMLGFWHYQSRRYADQTYEGFMFPLR  110

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            V +EL  WPE   R+R+W +  + M+ C H WM+EAL+ LV++
Sbjct  111  VADELHQWPEMASRKRTWATVNQVMDGCPHWWMREALEKLVAR  153



>ref|XP_010056034.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Eucalyptus 
grandis]
Length=173

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 108/164 (66%), Gaps = 12/164 (7%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQK  483
            ++ + +RTGR  QRY   G R V GC+P++YR   ++   + HG     D+E L+++S  
Sbjct  1    MEGLVARTGRHQQRYK-DGFRLVAGCVPFKYRSAVENGNGLCHG-----DVEVLMINSTS  54

Query  484  SPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLG--VLHEGF--  651
             P ++FPKGGWE DE++E+AA RE  EEAGV G++   +G + FKSK+L   +  EG+  
Sbjct  55   GPGLLFPKGGWEDDETVEQAASREALEEAGVRGDLVHFIGFYEFKSKTLQDELSPEGWCR  114

Query  652  --MLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEAL  777
              +  L+V EEL+ WPE+  RQRSW++  EAME C +PWM+EAL
Sbjct  115  AAVFALLVKEELESWPEQSTRQRSWLTVAEAMECCRYPWMREAL  158



>ref|XP_010907194.1| PREDICTED: nudix hydrolase 16, mitochondrial-like isoform X1 
[Elaeis guineensis]
Length=187

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 104/161 (65%), Gaps = 12/161 (7%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +RTGR  QRY   GCR V GCIP++YR+  +S GS        + +E L+++SQ  P 
Sbjct  4    LVARTGRHQQRYEA-GCRLVAGCIPFKYRKCDESCGSKPK-----NIIEVLMINSQSGPG  57

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKS------LGVLHEGFM  654
            ++FPKGGWE DE++EEAA+RE  EEAG+ G++   LG ++FKSKS         L +  M
Sbjct  58   LLFPKGGWENDETVEEAAVREALEEAGIRGDIMEFLGFYYFKSKSHQDEFCPDGLCKAAM  117

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEAL  777
              + V EEL  WPE+ +RQR W++  EA+E C HPWM+ AL
Sbjct  118  FAMHVKEELGSWPEQSMRQRRWLTIPEALEQCRHPWMQVAL  158



>emb|CDY09425.1| BnaA02g25850D [Brassica napus]
Length=187

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 110/177 (62%), Gaps = 16/177 (9%)
 Frame = +1

Query  289  MKLTKVDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLL  468
            M + K+  + SRTGR  QRYN +G RQVVGCIPYR++    S G I       D++E L+
Sbjct  1    MGVEKMVCLVSRTGRQFQRYN-KGRRQVVGCIPYRFKLS--SDGKI------SDEVEVLV  51

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAAL----RETFEEAGV--YGEVGSCLGKWFFKSKSL  630
            +SSQK   MMFPKGGWE DES          +  F++  +  Y ++   LGKW F SKS 
Sbjct  52   ISSQKGHAMMFPKGGWELDESTFRYVYGTLNQHIFQKKKLISYFQIHQ-LGKWDFLSKSR  110

Query  631  GVLHEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQLT  801
            G  +EG M P++V E+LD WPE+  RQR W++  +A E C   WMKEALDVLV +L+
Sbjct  111  GTYYEGLMFPMLVTEQLDLWPEQHARQRIWMNVVDAREACRDWWMKEALDVLVERLS  167



>ref|XP_008790962.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Phoenix dactylifera]
 ref|XP_008790963.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Phoenix dactylifera]
Length=187

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 103/161 (64%), Gaps = 12/161 (7%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +RTGR  QRY   GCR V GCIP++YR+  +S GS          +E L+++SQ  P 
Sbjct  4    LVARTGRHQQRYEA-GCRLVAGCIPFKYRKCDESCGSKPK-----KIVEVLMINSQSGPG  57

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKS------LGVLHEGFM  654
            ++FPKGGWE DE++EEAALRE  EEAGV G++   LG ++FKSKS         L +  M
Sbjct  58   LLFPKGGWENDETVEEAALREALEEAGVRGDIMEFLGFYYFKSKSHQDEFCPDGLCKAAM  117

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEAL  777
              + V EEL  WPE+ +RQR W+S  EA+E C +PWM+ AL
Sbjct  118  FAMHVTEELGSWPEQSMRQRRWLSIPEALEQCRYPWMQVAL  158



>ref|XP_006477497.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Citrus sinensis]
 gb|KDO41215.1| hypothetical protein CISIN_1g029131mg [Citrus sinensis]
Length=198

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 104/170 (61%), Gaps = 15/170 (9%)
 Frame = +1

Query  304  VDSMCSRTGRDLQRYNVQGCRQVVGCIPYRYR-----EGKQSAGSIIHGAPLVDDLEFLL  468
            +  + +RTGR  QRY   GCR V GCIP++YR     EG            +V   E L+
Sbjct  1    MSELVARTGRHQQRYEA-GCRLVAGCIPFKYRNRNCEEGDGDGDGDGRSEKIV---EVLM  56

Query  469  VSSQKSPRMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLG-----  633
            ++S   P ++FPKGGWE DE++EEAALRE  EEAGV G +   LG + FKSK+L      
Sbjct  57   INSTSGPGLLFPKGGWENDETVEEAALREALEEAGVRGHLKEFLGYYDFKSKTLQDEFSP  116

Query  634  -VLHEGFMLPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALD  780
              L +  M  L+V EEL+ WPE+  RQRSW++  EA+E C HPWM+EAL+
Sbjct  117  EGLCKAAMFALLVKEELESWPEQSTRQRSWLTVPEAIECCRHPWMQEALE  166



>gb|ACF81097.1| unknown [Zea mays]
 gb|AFW73289.1| nudix hydrolase 4 [Zea mays]
Length=162

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 102/163 (63%), Gaps = 16/163 (10%)
 Frame = +1

Query  313  MCSRTGRDLQRYN-VQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            + +R GR+LQRY+   G R VVGCIPYR R                 +LE L ++SQK  
Sbjct  4    LVARQGRELQRYSQSTGGRIVVGCIPYRVR--------------CDGELEVLAITSQKGH  49

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKS-LGVLHEGFMLPLI  666
             MMFPKGGWE DES++EAA RE  EEAGV G+    LG W +KS+  +   +EGFM PL 
Sbjct  50   GMMFPKGGWEVDESMDEAARREALEEAGVLGDTEPVLGLWHYKSRRYVDQTYEGFMFPLR  109

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            V +EL  WPE   R+R+W + ++ M+ C H WM+EAL+ LV++
Sbjct  110  VADELHQWPEMASRKRTWATVQQVMDGCPHWWMREALERLVAR  152



>ref|XP_010931967.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Elaeis guineensis]
Length=187

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 101/161 (63%), Gaps = 12/161 (7%)
 Frame = +1

Query  313  MCSRTGRDLQRYNVQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSPR  492
            + +RTGR  QRY   GCR V GCIP++YR+  +S GS          +E L+++SQ  P 
Sbjct  4    LVARTGRHQQRYEA-GCRLVAGCIPFKYRKCDESCGSKPK-----KIVEVLMINSQSGPG  57

Query  493  MMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKSLG------VLHEGFM  654
            ++FPKGGWE DE++EEAA+RE  EEAGV G++   LG ++FKSKS         L +  M
Sbjct  58   LLFPKGGWENDETVEEAAVREALEEAGVRGDIMEFLGFYYFKSKSHQDEFSPEGLCKAAM  117

Query  655  LPLIVLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEAL  777
              + V EEL  WPE+  R R W++  EA E C HPWM+EAL
Sbjct  118  FAMHVKEELGSWPEQSTRHRRWLTIPEAGEQCRHPWMREAL  158



>ref|NP_001132303.1| uncharacterized protein LOC100193744 [Zea mays]
 gb|ACG28378.1| nudix hydrolase 4 [Zea mays]
Length=162

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 101/163 (62%), Gaps = 16/163 (10%)
 Frame = +1

Query  313  MCSRTGRDLQRYN-VQGCRQVVGCIPYRYREGKQSAGSIIHGAPLVDDLEFLLVSSQKSP  489
            + +R GR+LQRY+   G R VVGCIPYR R                 +LE L ++SQK  
Sbjct  4    LVARQGRELQRYSQSTGGRIVVGCIPYRVR--------------CDGELEVLAITSQKGH  49

Query  490  RMMFPKGGWEQDESLEEAALRETFEEAGVYGEVGSCLGKWFFKSKS-LGVLHEGFMLPLI  666
             MMFPKGGWE DES++EAA RE  EEAGV G     LG W +KS+  +   +EGFM PL 
Sbjct  50   GMMFPKGGWEVDESMDEAARREALEEAGVLGNTEPVLGLWHYKSRRYVDQTYEGFMFPLR  109

Query  667  VLEELDDWPEKDVRQRSWVSYREAMEVCFHPWMKEALDVLVSQ  795
            V +EL  WPE   R+R+W + ++ M+ C H WM+EAL+ LV++
Sbjct  110  VADELHQWPEMASRKRTWATVQQVMDGCPHWWMREALERLVAR  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5132930094402