BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21249_g4_i1 len=1455 path=[3338:0-284 1844:285-310 3092:311-365
1925:366-394 1954:395-1454]

Length=1455
                                                                      Score     E

gb|KDP41719.1|  hypothetical protein JCGZ_16126                         452   4e-153   
ref|XP_011017186.1|  PREDICTED: heat stress transcription factor ...    435   4e-146   
ref|XP_002301176.2|  hypothetical protein POPTR_0002s12640g             435   4e-146   Populus trichocarpa [western balsam poplar]
ref|XP_006374917.1|  heat shock transcription factor HSF31 family...    434   1e-145   
ref|XP_011029683.1|  PREDICTED: heat stress transcription factor ...    432   3e-145   
ref|XP_007017200.1|  Heat shock transcription factor B4                 429   6e-144   
ref|XP_002510200.1|  DNA binding protein, putative                      428   2e-143   Ricinus communis
ref|XP_006434743.1|  hypothetical protein CICLE_v10001482mg             428   3e-143   
ref|XP_006473306.1|  PREDICTED: heat stress transcription factor ...    426   2e-142   
ref|XP_003603058.1|  Heat stress transcription factor B-4               422   3e-141   
ref|XP_011074417.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    422   5e-141   
ref|XP_011083880.1|  PREDICTED: heat stress transcription factor ...    419   3e-140   
ref|XP_002284836.1|  PREDICTED: heat stress transcription factor B-4    417   3e-139   Vitis vinifera
ref|XP_004501560.1|  PREDICTED: heat stress transcription factor ...    416   2e-138   
ref|XP_010112180.1|  Heat stress transcription factor B-4               416   3e-138   
ref|XP_006374916.1|  hypothetical protein POPTR_0014s02700g             413   1e-137   
ref|XP_004238144.1|  PREDICTED: heat stress transcription factor B-4    410   1e-136   
ref|XP_003528294.1|  PREDICTED: heat stress transcription factor B-4    409   5e-136   
ref|XP_009800135.1|  PREDICTED: heat stress transcription factor B-4    406   4e-135   
ref|XP_003523945.1|  PREDICTED: heat stress transcription factor B-4    405   2e-134   
ref|XP_009611319.1|  PREDICTED: heat stress transcription factor B-4    403   7e-134   
ref|XP_010263520.1|  PREDICTED: heat stress transcription factor ...    401   8e-133   
ref|NP_001288049.1|  heat stress transcription factor B-4               401   8e-133   
gb|AIG20081.1|  HSF14                                                   400   9e-133   
ref|XP_007136692.1|  hypothetical protein PHAVU_009G065800g             400   1e-132   
ref|XP_008357386.1|  PREDICTED: heat stress transcription factor ...    400   3e-132   
ref|XP_008444610.1|  PREDICTED: heat stress transcription factor B-4    399   5e-132   
ref|XP_009359791.1|  PREDICTED: heat stress transcription factor B-4    399   8e-132   
ref|XP_004143013.1|  PREDICTED: heat stress transcription factor ...    395   1e-130   
gb|KHG03540.1|  Heat stress transcription factor B-4 -like protein      393   3e-130   
ref|XP_010269531.1|  PREDICTED: heat stress transcription factor ...    393   1e-129   
ref|XP_004141262.1|  PREDICTED: heat stress transcription factor ...    389   9e-129   
gb|AII82334.1|  heat shock transcription factor                         389   1e-128   
ref|XP_006354868.1|  PREDICTED: heat stress transcription factor ...    390   2e-128   
ref|XP_008452568.1|  PREDICTED: heat stress transcription factor ...    388   2e-128   
emb|CDP01323.1|  unnamed protein product                                384   4e-127   
ref|XP_007226488.1|  hypothetical protein PRUPE_ppa026635mg             387   5e-127   
ref|NP_001241604.1|  uncharacterized protein LOC100782841               385   1e-126   
ref|XP_010061734.1|  PREDICTED: heat stress transcription factor ...    384   2e-126   
emb|CAA87080.1|  heat shock transcription factor 5                      385   2e-126   Glycine max [soybeans]
ref|XP_004291096.1|  PREDICTED: heat stress transcription factor ...    380   3e-124   
gb|EYU36312.1|  hypothetical protein MIMGU_mgv1a021807mg                377   6e-123   
ref|XP_010059922.1|  PREDICTED: heat stress transcription factor ...    375   8e-123   
gb|KHN12792.1|  Heat stress transcription factor B-4                    374   3e-122   
ref|XP_003550334.1|  PREDICTED: heat stress transcription factor ...    372   2e-121   
ref|XP_007160861.1|  hypothetical protein PHAVU_001G022900g             370   2e-121   
ref|XP_008220242.1|  PREDICTED: heat stress transcription factor B-4    371   1e-120   
emb|CBI19505.3|  unnamed protein product                                350   5e-114   
ref|XP_010675615.1|  PREDICTED: heat stress transcription factor ...    334   1e-106   
ref|XP_010479105.1|  PREDICTED: heat stress transcription factor ...    322   2e-102   
ref|XP_002891331.1|  hypothetical protein ARALYDRAFT_473862             322   3e-102   
emb|CDY06765.1|  BnaA10g05440D                                          317   9e-101   
ref|XP_009119797.1|  PREDICTED: heat stress transcription factor ...    317   1e-100   
ref|NP_175142.1|  heat stress transcription factor SCHIZORIZA           317   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461505.1|  PREDICTED: heat stress transcription factor ...    317   5e-100   
ref|XP_010500211.1|  PREDICTED: heat stress transcription factor B-4    316   8e-100   
ref|XP_006305155.1|  hypothetical protein CARUB_v10009522mg             313   7e-99    
ref|XP_006393631.1|  hypothetical protein EUTSA_v10012033mg             312   1e-98    
ref|XP_006829889.1|  hypothetical protein AMTR_s00073p00033500          310   9e-98    
emb|CDY17098.1|  BnaC06g00310D                                          306   3e-96    
ref|XP_009107442.1|  PREDICTED: heat stress transcription factor B-4    302   7e-95    
emb|CDY40844.1|  BnaC08g04780D                                          299   1e-93    
ref|XP_010530513.1|  PREDICTED: heat stress transcription factor ...    299   4e-93    
gb|KFK44645.1|  hypothetical protein AALP_AA1G285500                    297   6e-93    
emb|CAA87079.1|  heat shock transcription factor 31                     290   2e-90    Glycine max [soybeans]
ref|XP_010246178.1|  PREDICTED: heat stress transcription factor ...    286   2e-89    
ref|XP_002298460.1|  hypothetical protein POPTR_0001s28040g             284   1e-88    Populus trichocarpa [western balsam poplar]
ref|XP_010922077.1|  PREDICTED: heat stress transcription factor ...    283   4e-88    
ref|XP_008794230.1|  PREDICTED: heat stress transcription factor ...    279   1e-86    
ref|XP_002265293.1|  PREDICTED: heat stress transcription factor ...    279   2e-86    Vitis vinifera
ref|XP_011024992.1|  PREDICTED: heat stress transcription factor ...    277   4e-86    
ref|XP_007015249.1|  Heat shock transcription factor B4                 278   4e-86    
ref|XP_010541155.1|  PREDICTED: heat stress transcription factor ...    278   7e-86    
ref|XP_003556931.1|  PREDICTED: heat stress transcription factor ...    275   3e-85    
ref|XP_007146140.1|  hypothetical protein PHAVU_006G015700g             275   4e-85    
gb|ACU21168.1|  unknown                                                 274   8e-85    Glycine max [soybeans]
ref|XP_007141514.1|  hypothetical protein PHAVU_008G202500g             272   3e-84    
ref|XP_010931521.1|  PREDICTED: heat stress transcription factor ...    271   8e-84    
ref|XP_011036401.1|  PREDICTED: heat stress transcription factor ...    271   1e-83    
ref|XP_010943094.1|  PREDICTED: heat stress transcription factor ...    272   3e-83    
ref|XP_002314009.1|  hypothetical protein POPTR_0009s07220g             270   4e-83    Populus trichocarpa [western balsam poplar]
ref|XP_003545167.1|  PREDICTED: heat stress transcription factor ...    268   2e-82    
ref|XP_008786852.1|  PREDICTED: heat stress transcription factor ...    268   2e-82    
ref|XP_010088963.1|  Heat stress transcription factor B-4               268   3e-82    
ref|XP_006832825.1|  hypothetical protein AMTR_s00095p00016160          268   4e-82    
ref|XP_003518479.1|  PREDICTED: heat stress transcription factor ...    267   5e-82    
ref|XP_010673780.1|  PREDICTED: heat stress transcription factor ...    265   1e-80    
ref|XP_004491224.1|  PREDICTED: heat stress transcription factor ...    263   2e-80    
ref|XP_008779895.1|  PREDICTED: heat stress transcription factor ...    261   4e-79    
gb|KHN38397.1|  Heat stress transcription factor B-4                    258   8e-79    
ref|XP_003617219.1|  Heat stress transcription factor B-4               256   4e-78    
gb|KHN12039.1|  Heat stress transcription factor B-4                    256   4e-78    
gb|ACU16824.1|  unknown                                                 251   1e-76    Glycine max [soybeans]
ref|XP_002981332.1|  hypothetical protein SELMODRAFT_114534             254   2e-76    
ref|XP_002969726.1|  hypothetical protein SELMODRAFT_92634              254   2e-76    
gb|KHN28194.1|  Heat stress transcription factor B-4                    251   5e-76    
gb|KCW51072.1|  hypothetical protein EUGRSUZ_J00680                     251   1e-75    
ref|XP_010031706.1|  PREDICTED: heat stress transcription factor ...    251   2e-75    
gb|KDP43178.1|  hypothetical protein JCGZ_22730                         249   3e-75    
ref|XP_009395938.1|  PREDICTED: heat stress transcription factor ...    246   3e-74    
ref|XP_009383247.1|  PREDICTED: heat stress transcription factor ...    246   6e-74    
ref|XP_009380920.1|  PREDICTED: heat stress transcription factor ...    248   7e-74    
ref|XP_009417632.1|  PREDICTED: heat stress transcription factor ...    248   1e-73    
ref|XP_009391363.1|  PREDICTED: heat stress transcription factor ...    246   6e-73    
gb|EPS66396.1|  heat shock transcription factor                         239   3e-72    
dbj|BAJ87220.1|  predicted protein                                      245   4e-72    
gb|EEC75327.1|  hypothetical protein OsI_11708                          241   7e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_009399944.1|  PREDICTED: heat stress transcription factor ...    238   3e-71    
gb|KHG05479.1|  Heat stress transcription factor B-4 -like protein      239   6e-71    
ref|XP_003561606.1|  PREDICTED: heat stress transcription factor ...    238   1e-70    
gb|AIG20083.1|  HSF16                                                   234   1e-69    
ref|XP_003576600.1|  PREDICTED: heat stress transcription factor ...    236   1e-68    
ref|XP_003559898.1|  PREDICTED: heat stress transcription factor ...    233   2e-68    
ref|XP_006356390.1|  PREDICTED: heat stress transcription factor ...    234   3e-68    
ref|XP_009409312.1|  PREDICTED: heat stress transcription factor ...    233   4e-68    
ref|XP_006651414.1|  PREDICTED: heat stress transcription factor ...    231   5e-68    
ref|XP_009794990.1|  PREDICTED: heat stress transcription factor ...    228   2e-67    
ref|XP_004251349.2|  PREDICTED: heat stress transcription factor ...    228   3e-67    
sp|Q10KX8.1|HFB4D_ORYSJ  RecName: Full=Heat stress transcription ...    229   6e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009383248.1|  PREDICTED: heat stress transcription factor ...    224   7e-66    
ref|NP_001063356.1|  Os09g0455200                                       228   1e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002533289.1|  conserved hypothetical protein                     220   3e-65    Ricinus communis
tpg|DAA45501.1|  TPA: hypothetical protein ZEAMMB73_255145              223   2e-64    
gb|EAZ09360.1|  hypothetical protein OsI_31633                          223   9e-64    Oryza sativa Indica Group [Indian rice]
ref|XP_008656017.1|  PREDICTED: heat stress transcription factor ...    221   1e-63    
ref|XP_001766517.1|  predicted protein                                  216   3e-63    
gb|EAZ07310.1|  hypothetical protein OsI_29557                          220   1e-62    Oryza sativa Indica Group [Indian rice]
sp|Q6Z9R8.1|HFB4A_ORYSJ  RecName: Full=Putative heat stress trans...    216   2e-61    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA63849.1|  TPA: hypothetical protein ZEAMMB73_974979              209   6e-61    
ref|XP_004958473.1|  PREDICTED: heat stress transcription factor ...    213   1e-60    
ref|XP_002965510.1|  hypothetical protein SELMODRAFT_25564              207   2e-60    
ref|XP_010919270.1|  PREDICTED: heat stress transcription factor ...    212   2e-60    
ref|XP_002982987.1|  hypothetical protein SELMODRAFT_15442              207   2e-60    
gb|ACL52755.1|  unknown                                                 211   6e-60    Zea mays [maize]
ref|XP_006658884.1|  PREDICTED: heat stress transcription factor ...    206   1e-58    
ref|XP_004139066.1|  PREDICTED: heat stress transcription factor ...    205   2e-58    
gb|AHZ44772.1|  heat shock factor B4b                                   202   2e-58    
ref|XP_001754155.1|  predicted protein                                  200   2e-58    
ref|XP_008799550.1|  PREDICTED: heat stress transcription factor ...    207   2e-58    
emb|CDP21507.1|  unnamed protein product                                207   3e-58    
ref|NP_001060424.1|  Os07g0640900                                       206   3e-58    Oryza sativa Japonica Group [Japonica rice]
gb|AHZ44771.1|  heat shock factor B4a                                   206   5e-58    
ref|XP_008790507.1|  PREDICTED: heat stress transcription factor ...    206   5e-58    
ref|XP_010278594.1|  PREDICTED: heat stress transcription factor ...    205   9e-58    
ref|XP_010933854.1|  PREDICTED: heat stress transcription factor ...    206   1e-57    
dbj|BAK08075.1|  predicted protein                                      204   1e-57    
gb|EAZ04872.1|  hypothetical protein OsI_27052                          204   1e-57    Oryza sativa Indica Group [Indian rice]
ref|XP_009389775.1|  PREDICTED: heat stress transcription factor ...    203   2e-57    
ref|XP_004154656.1|  PREDICTED: heat stress transcription factor ...    202   3e-57    
ref|XP_008369462.1|  PREDICTED: heat stress transcription factor ...    204   3e-57    
ref|XP_006857851.1|  hypothetical protein AMTR_s00069p00068180          203   5e-57    
gb|KDP31930.1|  hypothetical protein JCGZ_12391                         202   5e-57    
ref|XP_008238806.1|  PREDICTED: heat stress transcription factor ...    203   8e-57    
ref|XP_008450326.1|  PREDICTED: heat stress transcription factor ...    200   1e-56    
ref|XP_007209340.1|  hypothetical protein PRUPE_ppa008441mg             201   4e-56    
dbj|BAI99728.1|  heat stress transcription factor                       199   4e-56    
ref|XP_002283139.1|  PREDICTED: heat stress transcription factor ...    200   5e-56    Vitis vinifera
gb|ADC94861.1|  HSP transcription factor                                200   5e-56    Vitis pseudoreticulata
ref|XP_009345447.1|  PREDICTED: heat stress transcription factor ...    200   8e-56    
ref|XP_010263545.1|  PREDICTED: heat shock factor protein HSF24-like    198   1e-55    
ref|XP_006425894.1|  hypothetical protein CICLE_v10026058mg             197   2e-55    
ref|XP_007158472.1|  hypothetical protein PHAVU_002G155300g             200   2e-55    
gb|KDP25483.1|  hypothetical protein JCGZ_20639                         199   2e-55    
dbj|BAJ85352.1|  predicted protein                                      201   3e-55    
ref|XP_002277765.2|  PREDICTED: heat shock factor protein HSF24         197   3e-55    Vitis vinifera
ref|XP_009760921.1|  PREDICTED: heat stress transcription factor ...    198   4e-55    
ref|XP_004511596.1|  PREDICTED: heat stress transcription factor ...    198   5e-55    
ref|XP_006659656.1|  PREDICTED: heat stress transcription factor ...    199   5e-55    
ref|XP_007047250.1|  Heat shock factor 4                                197   5e-55    
emb|CAN82265.1|  hypothetical protein VITISV_009283                     202   6e-55    Vitis vinifera
ref|XP_009589845.1|  PREDICTED: heat shock factor protein HSF24         197   6e-55    
ref|XP_003578478.1|  PREDICTED: heat stress transcription factor ...    199   8e-55    
gb|AEB26596.1|  heat shock factor B2c                                   198   1e-54    
gb|ABG73443.1|  heat shock factor                                       199   2e-54    Oryza brachyantha
emb|CBI34728.3|  unnamed protein product                                196   2e-54    
ref|XP_009797839.1|  PREDICTED: heat shock factor protein HSF24         195   2e-54    
ref|XP_004957416.1|  PREDICTED: heat stress transcription factor ...    198   3e-54    
ref|XP_010540690.1|  PREDICTED: heat stress transcription factor ...    196   4e-54    
ref|XP_010523506.1|  PREDICTED: heat stress transcription factor ...    196   4e-54    
ref|XP_004957414.1|  PREDICTED: heat stress transcription factor ...    197   4e-54    
ref|XP_006466606.1|  PREDICTED: heat shock factor protein HSF24-like    194   4e-54    
ref|XP_010269874.1|  PREDICTED: heat shock factor protein HSF24         195   4e-54    
ref|XP_010235376.1|  PREDICTED: heat stress transcription factor ...    196   5e-54    
dbj|BAA83710.1|  heat shock factor                                      194   7e-54    Nicotiana tabacum [American tobacco]
ref|XP_007038632.1|  Heat shock transcription factor B2A, putative      195   8e-54    
ref|XP_011099137.1|  PREDICTED: heat shock factor protein HSF24         193   9e-54    
ref|XP_011076201.1|  PREDICTED: heat stress transcription factor ...    195   9e-54    
gb|AFQ93677.1|  heat shock transcription factor HSFB2a                  195   9e-54    
gb|AII99897.1|  heat shock transcription factor                         194   9e-54    
ref|XP_004984281.1|  PREDICTED: heat stress transcription factor ...    194   1e-53    
gb|KCW72116.1|  hypothetical protein EUGRSUZ_E00555                     194   1e-53    
ref|XP_011081009.1|  PREDICTED: heat stress transcription factor ...    194   2e-53    
ref|XP_008680871.1|  PREDICTED: heat shock factor protein 7 isofo...    196   2e-53    
ref|XP_001776501.1|  predicted protein                                  186   2e-53    
gb|KHG06980.1|  Heat stress transcription factor B-2b -like protein     193   2e-53    
ref|XP_003611134.1|  Heat stress transcription factor B-2b              194   3e-53    
ref|XP_008800793.1|  PREDICTED: heat stress transcription factor ...    194   3e-53    
ref|XP_009409313.1|  PREDICTED: heat stress transcription factor ...    192   3e-53    
gb|AFK40914.1|  unknown                                                 194   3e-53    
ref|XP_010550365.1|  PREDICTED: heat shock factor protein HSF24-like    192   3e-53    
ref|NP_001152384.1|  heat shock factor protein 7                        194   4e-53    Zea mays [maize]
ref|XP_007040151.1|  Winged-helix DNA-binding transcription facto...    192   4e-53    
ref|XP_009415832.1|  PREDICTED: heat stress transcription factor ...    193   4e-53    
ref|XP_008652977.1|  PREDICTED: heat stress transcription factor ...    195   5e-53    
gb|AII99900.1|  heat shock transcription factor                         192   6e-53    
ref|XP_003533211.1|  PREDICTED: heat stress transcription factor ...    192   6e-53    
ref|XP_010055608.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    192   7e-53    
ref|XP_009803855.1|  PREDICTED: heat stress transcription factor ...    192   7e-53    
dbj|BAK04233.1|  predicted protein                                      194   7e-53    
ref|XP_006440567.1|  hypothetical protein CICLE_v10021287mg             191   8e-53    
ref|XP_004143930.1|  PREDICTED: heat stress transcription factor ...    192   9e-53    
gb|AFI61331.1|  HSF3                                                    191   1e-52    
ref|XP_010255485.1|  PREDICTED: heat stress transcription factor ...    191   1e-52    
ref|XP_006826240.1|  hypothetical protein AMTR_s00132p00118400          190   1e-52    
ref|XP_011029218.1|  PREDICTED: heat stress transcription factor ...    192   1e-52    
gb|AIG20087.1|  HSF20                                                   191   1e-52    
ref|XP_002872608.1|  hypothetical protein ARALYDRAFT_911518             192   2e-52    
ref|XP_001755703.1|  predicted protein                                  183   2e-52    
ref|XP_008234272.1|  PREDICTED: heat stress transcription factor ...    190   2e-52    
gb|KHG26651.1|  Heat shock factor HSF24                                 190   2e-52    
emb|CDP02491.1|  unnamed protein product                                196   2e-52    
ref|XP_002510816.1|  Heat shock factor protein, putative                191   2e-52    Ricinus communis
ref|XP_009398726.1|  PREDICTED: heat stress transcription factor ...    191   2e-52    
ref|XP_009606739.1|  PREDICTED: heat stress transcription factor ...    191   3e-52    
ref|XP_007218740.1|  hypothetical protein PRUPE_ppa009180mg             190   3e-52    
ref|XP_006477425.1|  PREDICTED: heat stress transcription factor ...    190   3e-52    
ref|XP_010934470.1|  PREDICTED: heat stress transcription factor ...    192   3e-52    
ref|XP_010521560.1|  PREDICTED: heat stress transcription factor ...    192   3e-52    
ref|XP_002298053.1|  heat shock transcription factor HSF29 family...    191   3e-52    Populus trichocarpa [western balsam poplar]
gb|AII99903.1|  heat shock transcription factor                         190   4e-52    
gb|KDP22306.1|  hypothetical protein JCGZ_26137                         190   4e-52    
ref|XP_011084402.1|  PREDICTED: heat stress transcription factor ...    189   5e-52    
ref|XP_009397638.1|  PREDICTED: heat stress transcription factor ...    189   5e-52    
ref|XP_010693477.1|  PREDICTED: heat stress transcription factor ...    190   6e-52    
gb|KHG11685.1|  Heat stress transcription factor B-2b -like protein     189   7e-52    
ref|XP_008340075.1|  PREDICTED: heat shock factor protein HSF24         188   8e-52    
ref|XP_010035111.1|  PREDICTED: heat stress transcription factor ...    188   1e-51    
ref|XP_003555375.1|  PREDICTED: heat stress transcription factor ...    188   1e-51    
gb|KFK31930.1|  hypothetical protein AALP_AA6G177400                    190   1e-51    
ref|XP_006396868.1|  hypothetical protein EUTSA_v10028744mg             190   2e-51    
gb|ADL36733.1|  HSF domain class transcription factor                   187   2e-51    
ref|XP_010940869.1|  PREDICTED: heat stress transcription factor ...    189   2e-51    
ref|XP_003535620.1|  PREDICTED: heat stress transcription factor ...    187   2e-51    
ref|XP_009367059.1|  PREDICTED: heat shock factor protein HSF24         187   2e-51    
ref|XP_007152318.1|  hypothetical protein PHAVU_004G119600g             189   2e-51    
ref|XP_004300764.1|  PREDICTED: heat stress transcription factor ...    189   3e-51    
ref|XP_007202372.1|  hypothetical protein PRUPE_ppa009274mg             187   3e-51    
ref|XP_010422122.1|  PREDICTED: heat stress transcription factor ...    189   3e-51    
ref|XP_008241456.1|  PREDICTED: heat shock factor protein HSF24         187   3e-51    
ref|XP_009603015.1|  PREDICTED: heat stress transcription factor ...    188   4e-51    
ref|XP_007143381.1|  hypothetical protein PHAVU_007G067800g             187   4e-51    
ref|XP_011043547.1|  PREDICTED: heat shock factor protein HSF24         186   4e-51    
ref|XP_008803040.1|  PREDICTED: heat stress transcription factor ...    188   4e-51    
ref|XP_006287969.1|  hypothetical protein CARUB_v10001204mg             189   4e-51    
ref|XP_003537320.1|  PREDICTED: heat shock factor protein HSF24-like    186   5e-51    
ref|XP_008338368.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    186   5e-51    
ref|NP_001150223.1|  AT-HSFB4                                           189   7e-51    Zea mays [maize]
ref|XP_010676525.1|  PREDICTED: heat stress transcription factor ...    187   7e-51    
ref|XP_010455582.1|  PREDICTED: heat stress transcription factor ...    188   7e-51    
ref|XP_008437221.1|  PREDICTED: heat stress transcription factor ...    187   8e-51    
ref|XP_002509743.1|  Heat shock factor protein, putative                187   9e-51    Ricinus communis
sp|P22335.1|HSF24_SOLPE  RecName: Full=Heat shock factor protein ...    186   9e-51    Solanum peruvianum [Peruvian tomato]
ref|XP_010107420.1|  Heat stress transcription factor B-2a              186   1e-50    
ref|XP_004164178.1|  PREDICTED: heat shock factor protein HSF24-like    184   1e-50    
gb|EMT33320.1|  hypothetical protein F775_52216                         186   1e-50    
gb|EMS49965.1|  Heat stress transcription factor B-4c                   185   1e-50    
ref|XP_006339901.1|  PREDICTED: heat shock factor protein HSF24-like    185   1e-50    
gb|EEE69104.1|  hypothetical protein OsJ_28173                          182   2e-50    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009375707.1|  PREDICTED: heat stress transcription factor ...    185   2e-50    
ref|XP_002465224.1|  hypothetical protein SORBIDRAFT_01g034500          185   2e-50    Sorghum bicolor [broomcorn]
gb|KDO60052.1|  hypothetical protein CISIN_1g020146mg                   186   2e-50    
ref|XP_004141916.1|  PREDICTED: heat shock factor protein HSF24-like    184   2e-50    
ref|XP_009130190.1|  PREDICTED: heat stress transcription factor ...    184   3e-50    
ref|XP_006421885.1|  hypothetical protein CICLE_v10005403mg             186   3e-50    
ref|XP_004288037.1|  PREDICTED: heat shock factor protein HSF24-like    184   3e-50    
ref|XP_006358879.1|  PREDICTED: heat stress transcription factor ...    185   4e-50    
ref|XP_009391581.1|  PREDICTED: heat stress transcription factor ...    184   4e-50    
emb|CAB63803.1|  heat shock factor 7                                    185   4e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434580.1|  PREDICTED: heat stress transcription factor ...    186   4e-50    
ref|XP_004957003.1|  PREDICTED: heat stress transcription factor ...    187   5e-50    
ref|XP_004232034.1|  PREDICTED: heat shock factor protein HSF24         184   6e-50    
ref|XP_002460323.1|  hypothetical protein SORBIDRAFT_02g026500          187   6e-50    
ref|XP_007155926.1|  hypothetical protein PHAVU_003G244000g             182   9e-50    
ref|NP_192903.1|  heat stress transcription factor B-2b                 185   9e-50    
ref|XP_003548209.1|  PREDICTED: heat stress transcription factor ...    184   1e-49    
ref|XP_009124795.1|  PREDICTED: heat stress transcription factor ...    185   1e-49    
gb|EPS62621.1|  hypothetical protein M569_12169                         182   1e-49    
gb|EMT20815.1|  Heat stress transcription factor B-2b                   185   1e-49    
ref|NP_001241597.1|  heat shock factor                                  182   1e-49    
ref|XP_006660690.1|  PREDICTED: heat stress transcription factor ...    185   2e-49    
emb|CDX86761.1|  BnaA09g21510D                                          184   2e-49    
gb|EAZ07882.1|  hypothetical protein OsI_30138                          184   2e-49    
ref|XP_009134244.1|  PREDICTED: heat stress transcription factor ...    182   2e-49    
sp|Q6Z9C8.1|HFB2B_ORYSJ  RecName: Full=Heat stress transcription ...    184   2e-49    
gb|AFQ93675.1|  heat shock transcription factor HSFB2b                  183   3e-49    
ref|XP_003517459.1|  PREDICTED: heat stress transcription factor ...    183   3e-49    
emb|CDY59386.1|  BnaC09g52680D                                          183   3e-49    
ref|XP_010547515.1|  PREDICTED: heat shock factor protein HSF24-like    180   3e-49    
ref|NP_001149902.1|  heat shock factor protein 7                        184   3e-49    
ref|XP_010531239.1|  PREDICTED: heat stress transcription factor ...    180   4e-49    
dbj|BAD46358.1|  putative heat shock factor                             184   5e-49    
ref|XP_008440278.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock f...    181   5e-49    
ref|XP_010061278.1|  PREDICTED: heat stress transcription factor ...    182   6e-49    
gb|EAZ09820.1|  hypothetical protein OsI_32108                          184   7e-49    
ref|XP_009371307.1|  PREDICTED: heat stress transcription factor ...    181   8e-49    
ref|XP_004234371.1|  PREDICTED: heat stress transcription factor ...    182   8e-49    
ref|XP_002960464.1|  hypothetical protein SELMODRAFT_39375              173   1e-48    
ref|XP_006590529.1|  PREDICTED: heat stress transcription factor ...    182   1e-48    
gb|EAZ44973.1|  hypothetical protein OsJ_29616                          181   2e-48    
ref|NP_001063726.1|  Os09g0526600                                       184   2e-48    
ref|XP_004515711.1|  PREDICTED: heat stress transcription factor ...    181   2e-48    
emb|CDY64186.1|  BnaC03g73070D                                          180   2e-48    
ref|XP_004496590.1|  PREDICTED: heat stress transcription factor ...    178   3e-48    
emb|CDY67770.1|  BnaCnng56320D                                          178   3e-48    
ref|XP_002864765.1|  hypothetical protein ARALYDRAFT_919451             179   4e-48    
ref|XP_006380704.1|  hypothetical protein POPTR_0007s11030g             177   6e-48    
ref|XP_004974114.1|  PREDICTED: heat stress transcription factor ...    181   6e-48    
ref|XP_004245637.1|  PREDICTED: heat stress transcription factor ...    179   9e-48    
emb|CDX90804.1|  BnaA03g24840D                                          178   1e-47    
ref|NP_001062423.1|  Os08g0546800                                       184   1e-47    
ref|XP_007156806.1|  hypothetical protein PHAVU_002G019100g             176   2e-47    
ref|NP_001281281.1|  heat shock factor protein 4                        176   2e-47    
ref|XP_009381466.1|  PREDICTED: heat stress transcription factor ...    177   2e-47    
ref|XP_002866968.1|  hypothetical protein ARALYDRAFT_490909             176   2e-47    
ref|XP_006590531.1|  PREDICTED: heat stress transcription factor ...    172   3e-47    
ref|NP_201008.2|  heat stress transcription factor B-2a                 176   3e-47    
ref|NP_195416.1|  heat stress transcription factor B-1                  176   3e-47    
ref|XP_008376546.1|  PREDICTED: heat stress transcription factor ...    176   4e-47    
gb|ACN76855.1|  heat shock transcription factor                         175   4e-47    
gb|EAZ43048.1|  hypothetical protein OsJ_27637                          176   4e-47    
emb|CDX86938.1|  BnaC03g52080D                                          176   6e-47    
ref|XP_002446950.1|  hypothetical protein SORBIDRAFT_06g025710          176   6e-47    
ref|XP_003550068.1|  PREDICTED: heat shock factor protein HSF24-like    175   7e-47    
gb|AAC31756.1|  heat shock transcription factor 4                       175   9e-47    
ref|XP_006590530.1|  PREDICTED: heat stress transcription factor ...    171   1e-46    
gb|KHM99149.1|  Heat stress transcription factor B-2a                   173   1e-46    
ref|XP_008439190.1|  PREDICTED: heat stress transcription factor ...    175   1e-46    
ref|XP_004170341.1|  PREDICTED: heat stress transcription factor ...    174   1e-46    
ref|XP_004140783.1|  PREDICTED: heat stress transcription factor ...    174   1e-46    
ref|XP_009151322.1|  PREDICTED: heat stress transcription factor ...    175   1e-46    
ref|XP_010483895.1|  PREDICTED: heat stress transcription factor ...    175   2e-46    
ref|XP_009130189.1|  PREDICTED: heat stress transcription factor ...    173   2e-46    
ref|XP_009138469.1|  PREDICTED: heat stress transcription factor ...    173   2e-46    
gb|EPS72138.1|  hypothetical protein M569_02618                         173   3e-46    
emb|CDY42722.1|  BnaA03g53750D                                          173   3e-46    
gb|KEH17358.1|  heat shock transcription factor B2A                     175   3e-46    
ref|XP_010028256.1|  PREDICTED: heat shock factor protein HSF24         174   3e-46    
gb|KHG00724.1|  Heat stress transcription factor B-2b -like protein     172   8e-46    
ref|XP_006280765.1|  hypothetical protein CARUB_v10026734mg             173   1e-45    
ref|XP_004509144.1|  PREDICTED: heat shock factor protein HSF24-like    171   1e-45    
gb|EMS61082.1|  Heat stress transcription factor B-2b                   174   1e-45    
emb|CDY00246.1|  BnaA06g21470D                                          171   2e-45    
emb|CDX69274.1|  BnaC01g01790D                                          171   2e-45    
ref|XP_010444038.1|  PREDICTED: heat stress transcription factor ...    172   3e-45    
gb|KFK27929.1|  hypothetical protein AALP_AA8G449200                    171   3e-45    
ref|XP_010943066.1|  PREDICTED: heat stress transcription factor ...    172   3e-45    
ref|XP_002321902.2|  hypothetical protein POPTR_0015s13390g             170   5e-45    
gb|KHN01274.1|  Heat shock factor protein HSF24                         170   5e-45    
gb|ABV89640.1|  heat shock factor 4                                     170   6e-45    
ref|XP_009400005.1|  PREDICTED: heat stress transcription factor ...    171   7e-45    
ref|XP_011048671.1|  PREDICTED: heat stress transcription factor ...    169   1e-44    
gb|KCW54959.1|  hypothetical protein EUGRSUZ_I00929                     173   1e-44    
ref|XP_004976526.1|  PREDICTED: heat stress transcription factor ...    169   1e-44    
gb|KEH43737.1|  heat shock transcription factor B2A                     169   1e-44    
ref|XP_008808108.1|  PREDICTED: heat stress transcription factor ...    170   1e-44    
ref|XP_006353396.1|  PREDICTED: heat stress transcription factor ...    170   1e-44    
emb|CAH66855.1|  OSIGBa0103M18.7                                        169   1e-44    
ref|NP_001053591.1|  Os04g0568700                                       169   1e-44    
ref|XP_009393520.1|  PREDICTED: heat stress transcription factor ...    172   2e-44    
ref|XP_009138768.1|  PREDICTED: heat stress transcription factor B-1    168   2e-44    
ref|XP_008661876.1|  PREDICTED: heat shock factor protein 4 isofo...    169   2e-44    
gb|AFK42633.1|  unknown                                                 168   3e-44    
ref|XP_002318823.2|  hypothetical protein POPTR_0012s13430g             168   4e-44    
ref|XP_011030077.1|  PREDICTED: heat stress transcription factor ...    167   5e-44    
emb|CBI31816.3|  unnamed protein product                                167   7e-44    
ref|XP_010093647.1|  Heat shock factor protein HSF24                    170   8e-44    
ref|XP_002273914.2|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    167   9e-44    
ref|XP_004511933.1|  PREDICTED: heat stress transcription factor ...    167   9e-44    
emb|CBI29823.3|  unnamed protein product                                161   1e-43    
ref|XP_009396840.1|  PREDICTED: heat stress transcription factor ...    172   1e-43    
ref|XP_010458062.1|  PREDICTED: heat stress transcription factor ...    167   1e-43    
ref|XP_002284216.1|  PREDICTED: heat stress transcription factor B-3    164   2e-43    
ref|XP_010538799.1|  PREDICTED: heat stress transcription factor ...    167   2e-43    
ref|XP_009410099.1|  PREDICTED: heat stress transcription factor ...    166   3e-43    
ref|XP_010432090.1|  PREDICTED: heat stress transcription factor ...    165   3e-43    
ref|XP_004308106.1|  PREDICTED: heat stress transcription factor ...    166   3e-43    
emb|CDY67248.1|  BnaCnng54110D                                          164   3e-43    
ref|XP_010437260.1|  PREDICTED: heat stress transcription factor B-1    165   3e-43    
ref|XP_010446698.1|  PREDICTED: heat stress transcription factor ...    165   4e-43    
ref|XP_010276853.1|  PREDICTED: heat shock factor protein HSF8          170   4e-43    
ref|XP_010437261.1|  PREDICTED: heat stress transcription factor ...    165   4e-43    
gb|EYU25434.1|  hypothetical protein MIMGU_mgv1a0208322mg               164   5e-43    
gb|KHG03434.1|  Heat shock factor HSF8                                  170   5e-43    
gb|KDP30379.1|  hypothetical protein JCGZ_17108                         170   5e-43    
ref|XP_008797267.1|  PREDICTED: heat stress transcription factor ...    165   6e-43    
gb|KDP26070.1|  hypothetical protein JCGZ_21103                         163   6e-43    
ref|XP_004136787.1|  PREDICTED: heat stress transcription factor ...    163   7e-43    
ref|XP_002527650.1|  Heat shock factor protein HSF8, putative           169   9e-43    
ref|XP_010666616.1|  PREDICTED: heat shock factor protein HSF24         163   1e-42    
ref|XP_008238205.1|  PREDICTED: heat shock factor protein HSF8          169   1e-42    
ref|XP_008777830.1|  PREDICTED: heat stress transcription factor ...    168   1e-42    
ref|XP_010909933.1|  PREDICTED: heat stress transcription factor ...    168   1e-42    
ref|XP_010943416.1|  PREDICTED: heat stress transcription factor ...    168   2e-42    
ref|XP_003611751.1|  Heat shock transcription factor                    167   2e-42    
ref|XP_011028139.1|  PREDICTED: heat shock factor protein HSF8-like     168   2e-42    
ref|XP_001694420.1|  heat shock transcription factor 1                  157   2e-42    
ref|XP_011013884.1|  PREDICTED: heat shock factor protein HSF8-like     168   2e-42    
ref|XP_007209949.1|  hypothetical protein PRUPE_ppa004782mg             167   2e-42    
ref|XP_004159661.1|  PREDICTED: LOW QUALITY PROTEIN: heat stress ...    161   4e-42    
ref|XP_006414192.1|  hypothetical protein EUTSA_v10025116mg             166   5e-42    
ref|XP_006284246.1|  hypothetical protein CARUB_v10005408mg             162   5e-42    
gb|KHG05169.1|  Heat shock factor HSF8                                  167   6e-42    
ref|XP_002893716.1|  ATHSFA1D                                           166   6e-42    
ref|XP_006854048.1|  hypothetical protein AMTR_s00048p00075850          167   6e-42    
ref|XP_002323320.2|  Heat Stress Transcription Factor family protein    160   7e-42    
ref|XP_002529512.1|  Heat shock factor protein, putative                160   7e-42    
ref|XP_011018512.1|  PREDICTED: heat stress transcription factor ...    166   7e-42    
gb|ABL74450.1|  heat shock factor 1                                     169   7e-42    
gb|AEO91550.1|  heat shock transcription factor                         166   8e-42    
ref|XP_007040659.1|  Heat shock transcription factor A1D isoform 1      167   8e-42    
ref|XP_002303429.2|  heat shock transcription factor family protein     166   8e-42    
ref|XP_010056944.1|  PREDICTED: heat stress transcription factor B-3    160   9e-42    
ref|XP_008792312.1|  PREDICTED: heat stress transcription factor ...    165   9e-42    
ref|XP_006368372.1|  heat shock transcription factor family protein     166   9e-42    
ref|XP_004300222.1|  PREDICTED: heat shock factor protein HSF8-like     166   1e-41    
ref|XP_010279495.1|  PREDICTED: heat stress transcription factor ...    159   1e-41    
ref|XP_010096952.1|  Heat shock factor protein HSF8                     166   1e-41    
ref|XP_009619930.1|  PREDICTED: heat shock factor protein HSF8-like     166   1e-41    
ref|XP_010055283.1|  PREDICTED: heat shock factor protein HSF8 is...    166   1e-41    
ref|XP_002868040.1|  heat shock factor                                  165   1e-41    
ref|XP_004512501.1|  PREDICTED: heat shock factor protein HSF8-li...    165   1e-41    
gb|AII99901.1|  heat shock transcription factor                         166   2e-41    
ref|XP_009769104.1|  PREDICTED: heat stress transcription factor ...    164   2e-41    
ref|XP_009611948.1|  PREDICTED: heat stress transcription factor ...    164   2e-41    
ref|XP_010245198.1|  PREDICTED: heat stress transcription factor A-1    165   2e-41    
ref|XP_009395312.1|  PREDICTED: heat stress transcription factor ...    164   2e-41    
ref|XP_009796891.1|  PREDICTED: heat stress transcription factor ...    159   2e-41    
emb|CAN71266.1|  hypothetical protein VITISV_017888                     164   3e-41    
ref|XP_006492933.1|  PREDICTED: heat stress transcription factor ...    159   3e-41    
ref|XP_004304340.1|  PREDICTED: heat stress transcription factor ...    158   3e-41    
ref|XP_009617028.1|  PREDICTED: heat stress transcription factor B-3    159   3e-41    
dbj|BAF01210.1|  heat shock transcription factor HSF1                   164   3e-41    
ref|XP_009395311.1|  PREDICTED: heat stress transcription factor ...    164   3e-41    
ref|XP_004148748.1|  PREDICTED: heat stress transcription factor ...    164   4e-41    
ref|XP_001758292.1|  predicted protein                                  159   4e-41    
ref|XP_006421321.1|  hypothetical protein CICLE_v10005649mg             159   4e-41    
ref|XP_003631489.1|  PREDICTED: heat shock factor protein HSF8          164   4e-41    
ref|XP_007028662.1|  Heat shock factor protein, putative                157   4e-41    
ref|XP_006307334.1|  hypothetical protein CARUB_v10008952mg             164   4e-41    
emb|CAA53761.1|  heat shock factor                                      164   4e-41    
ref|XP_008448660.1|  PREDICTED: heat shock factor protein HSF8-like     164   6e-41    
ref|NP_193510.1|  heat stress transcription factor A-1a                 164   6e-41    
gb|KDO48197.1|  hypothetical protein CISIN_1g025781mg                   158   6e-41    
ref|XP_009781208.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock f...    163   7e-41    
ref|XP_006653688.1|  PREDICTED: heat stress transcription factor ...    158   7e-41    
ref|XP_011084620.1|  PREDICTED: heat stress transcription factor ...    163   7e-41    
ref|XP_008387308.1|  PREDICTED: heat stress transcription factor ...    157   8e-41    
emb|CDP14121.1|  unnamed protein product                                157   8e-41    
ref|NP_001063364.1|  Os09g0456800                                       159   9e-41    
ref|XP_009346396.1|  PREDICTED: heat stress transcription factor ...    163   9e-41    
ref|XP_009340197.1|  PREDICTED: heat stress transcription factor ...    163   1e-40    
ref|XP_011075335.1|  PREDICTED: heat stress transcription factor ...    156   1e-40    
ref|XP_004303209.1|  PREDICTED: heat stress transcription factor ...    162   1e-40    
ref|XP_010269762.1|  PREDICTED: heat stress transcription factor ...    157   1e-40    
ref|XP_010939421.1|  PREDICTED: heat stress transcription factor ...    159   1e-40    
ref|XP_006394443.1|  hypothetical protein EUTSA_v10004690mg             158   1e-40    
ref|XP_011075334.1|  PREDICTED: heat stress transcription factor ...    157   1e-40    
ref|XP_006573849.1|  PREDICTED: heat stress transcription factor ...    162   1e-40    
ref|XP_008244246.1|  PREDICTED: heat stress transcription factor B-3    157   1e-40    
ref|XP_008670235.1|  PREDICTED: heat stress transcription factor ...    158   1e-40    
ref|XP_007157072.1|  hypothetical protein PHAVU_002G040500g             162   1e-40    
gb|EYU18725.1|  hypothetical protein MIMGU_mgv1a012745mg                157   1e-40    
gb|ACG25742.1|  heat shock factor protein 4                             158   1e-40    
ref|XP_006350178.1|  PREDICTED: heat stress transcription factor ...    157   1e-40    
ref|XP_010924707.1|  PREDICTED: heat stress transcription factor ...    162   1e-40    
ref|XP_010908496.1|  PREDICTED: heat stress transcription factor A-1    163   1e-40    
gb|AFQ02690.1|  heat stress transcription factor A-1 like protein       161   1e-40    
ref|XP_008340741.1|  PREDICTED: heat stress transcription factor ...    163   1e-40    
ref|XP_006485538.1|  PREDICTED: heat shock factor protein HSF8-li...    163   1e-40    
ref|NP_001051938.1|  Os03g0854500                                       162   1e-40    
gb|EPS70260.1|  hypothetical protein M569_04499                         157   2e-40    
ref|XP_010540760.1|  PREDICTED: heat stress transcription factor ...    162   2e-40    
ref|XP_011033345.1|  PREDICTED: heat stress transcription factor ...    156   2e-40    
ref|XP_003625136.1|  Heat stress transcription factor B-3               156   2e-40    
ref|XP_008800101.1|  PREDICTED: heat stress transcription factor ...    162   2e-40    
ref|XP_008776696.1|  PREDICTED: heat stress transcription factor ...    162   2e-40    
ref|XP_009600492.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock f...    162   2e-40    
ref|XP_009344306.1|  PREDICTED: heat stress transcription factor ...    162   2e-40    
ref|XP_006604353.1|  PREDICTED: heat stress transcription factor ...    155   2e-40    
ref|XP_002979424.1|  hypothetical protein SELMODRAFT_110881             152   2e-40    
ref|XP_010677345.1|  PREDICTED: heat shock factor protein HSF8-like     162   2e-40    
ref|XP_010916598.1|  PREDICTED: heat stress transcription factor ...    161   3e-40    
ref|XP_009765164.1|  PREDICTED: heat shock factor protein HSF8-like     162   3e-40    
ref|XP_005844236.1|  hypothetical protein CHLNCDRAFT_15492              150   3e-40    
ref|XP_008776668.1|  PREDICTED: heat stress transcription factor ...    161   3e-40    
gb|KFK45015.1|  hypothetical protein AALP_AA1G333600                    161   3e-40    
gb|KDP39800.1|  hypothetical protein JCGZ_03936                         160   3e-40    
gb|KFK30320.1|  hypothetical protein AALP_AA7G246600                    157   3e-40    
ref|XP_008443318.1|  PREDICTED: heat stress transcription factor ...    155   4e-40    
gb|EEE61521.1|  hypothetical protein OsJ_15822                          152   4e-40    



>gb|KDP41719.1| hypothetical protein JCGZ_16126 [Jatropha curcas]
Length=361

 Score =   452 bits (1164),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 260/373 (70%), Positives = 286/373 (77%), Gaps = 38/373 (10%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHH-----PMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTV  684
             VA++H HHHH      +N PSFF      R+S+SP +SDEQ   NNN WCDSP  +S   
Sbjct  121   VAINHHHHHHPHSQLGVNGPSFFPF--SSRVSISPSESDEQ--HNNNNWCDSPPLSSPRG  176

Query  685   IsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT  864
               A  +   G   N SV ALSEDN RLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT
Sbjct  177   GVANAAVINGSGYNSSVTALSEDNERLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT  236

Query  865   PSSNSYPSPL------------------ITQKPLSQLVTYPHPHPPTKHQP-VFNLSSPT  987
             P SNSYPS L                  + QKPL+QL+ Y +P   TK  P V  L+SP+
Sbjct  237   P-SNSYPSSLLLCAPTSTTANPFASNGSLVQKPLNQLLGY-YPPSNTKQVPQVQVLNSPS  294

Query  988   KTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARVLVL  1167
              TSQSS+T++E+P   + C+TKLFG PLQSKKRLHP+  S   +ME     A+KAR LVL
Sbjct  295   NTSQSSLTILEEP--NNGCKTKLFGVPLQSKKRLHPEYASNTGTME-----ANKAR-LVL  346

Query  1168  EKDDLALHLMPPS  1206
             EKDDL L+LMPPS
Sbjct  347   EKDDLGLNLMPPS  359



>ref|XP_011017186.1| PREDICTED: heat stress transcription factor B-4-like [Populus 
euphratica]
Length=364

 Score =   435 bits (1118),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 251/375 (67%), Positives = 281/375 (75%), Gaps = 39/375 (10%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHP--MNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFAS--STVI  687
             VA++  H H P  +N  SFF    P R S+SP DSDEQ  ANN  WCDSP   S     +
Sbjct  121   VAINQHHPHSPFGVNGTSFFPF--PSRTSISPSDSDEQ--ANN--WCDSPPLTSPPKGGV  174

Query  688   sagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTP  867
             +     GGGG  N SV+ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQNHVKPV P
Sbjct  175   ATATVIGGGGGFNSSVSALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQNHVKPVAP  234

Query  868   SSNSY-------PSPLIT-----------QKPLSQLVTYPHPHPPTKHQPV----FNLSS  981
             S++         PSP  T           QKPL+QL+ Y     PT  + +      ++S
Sbjct  235   SNSYSSSLLLCGPSPYATTNHVTSNGSLVQKPLNQLLGYYPTTAPTNPKQIPQVHVLINS  294

Query  982   PTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARVL  1161
             PT TSQSS+T++E+    + C+TKLFG PLQ+KKRLHP+  S P +ME +     KAR L
Sbjct  295   PTTTSQSSLTILEE-ANNNGCKTKLFGVPLQTKKRLHPEYGSNPGNMETS-----KAR-L  347

Query  1162  VLEKDDLALHLMPPS  1206
             VL+KDDL L+LMP S
Sbjct  348   VLDKDDLGLNLMPLS  362



>ref|XP_002301176.2| hypothetical protein POPTR_0002s12640g [Populus trichocarpa]
 gb|EEE80449.2| hypothetical protein POPTR_0002s12640g [Populus trichocarpa]
Length=364

 Score =   435 bits (1118),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 251/375 (67%), Positives = 281/375 (75%), Gaps = 39/375 (10%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHP--MNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFAS--STVI  687
             VA++  H H P  +N PSFF    P R S+SP DSDEQ  ANN  WCDSP   S     +
Sbjct  121   VAINQHHPHSPFGVNGPSFFPF--PSRTSISPSDSDEQ--ANN--WCDSPPLTSPPRGGV  174

Query  688   sagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTP  867
             +     GGGG  N SV+ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQNHVKPV P
Sbjct  175   ATATVIGGGGGFNSSVSALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQNHVKPVAP  234

Query  868   SSNSY-------PSPLIT-----------QKPLSQLVTYPHPHPPTKHQPV----FNLSS  981
             S++         PSP  T           QKPL+QL+ Y     PT  + +      ++S
Sbjct  235   SNSYSSSLLLCGPSPYATTNHVTSNGSLVQKPLNQLLGYYPTTAPTNPKQIPQVHVLINS  294

Query  982   PTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARVL  1161
             PT TSQSS+T++E+    + C+TKLFG  LQ+KKRLHP+  S P +ME +     KAR L
Sbjct  295   PTTTSQSSLTILEE-ANNNGCKTKLFGVSLQTKKRLHPEYGSNPGNMETS-----KAR-L  347

Query  1162  VLEKDDLALHLMPPS  1206
             VL+KDDL L+LMP S
Sbjct  348   VLDKDDLGLNLMPLS  362



>ref|XP_006374917.1| heat shock transcription factor HSF31 family protein [Populus 
trichocarpa]
 gb|ABK95877.1| unknown [Populus trichocarpa]
 gb|ERP52714.1| heat shock transcription factor HSF31 family protein [Populus 
trichocarpa]
Length=368

 Score =   434 bits (1115),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 257/384 (67%), Positives = 285/384 (74%), Gaps = 53/384 (14%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHH-------PMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP-----  663
             VA++  HHH         +N PSFF   +  R S+SP DSDEQ  ANNN WCDSP     
Sbjct  121   VAINQHHHHQHHPHSPFGVNGPSFFPFSS--RTSISPSDSDEQ--ANNN-WCDSPPLTSP  175

Query  664   --SFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYF  837
                 AS+TVI      GGGG  N SV ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYF
Sbjct  176   PRGVASATVI------GGGGGYNSSVFALSEDNERLRRSNNMLMSELAHMKKLYNDIIYF  229

Query  838   VQNHVKPVTPSSNSY-------PSPLIT-----------QKPLSQLVTY---PHPHPPTK  954
             VQNHVKPV PS++         P+P  T           QKPL+QL+ Y     P+ P +
Sbjct  230   VQNHVKPVAPSNSYSSSLLLCGPAPYATANPVTSNGSLAQKPLNQLLGYYPTTAPNNPKQ  289

Query  955   HQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaa  1134
                V  L+SPT TSQSS+T +E+    + C+TKLFG PL SKKRLHP+  S P +ME   
Sbjct  290   APQVHVLNSPTTTSQSSLTFLEE-ANNNGCKTKLFGVPLHSKKRLHPEYGSNPGNME---  345

Query  1135  aaaHKARVLVLEKDDLALHLMPPS  1206
                +KAR +VL+KDDL L+LMPPS
Sbjct  346   --TNKAR-MVLDKDDLGLNLMPPS  366



>ref|XP_011029683.1| PREDICTED: heat stress transcription factor B-4-like [Populus 
euphratica]
Length=368

 Score =   432 bits (1112),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 255/384 (66%), Positives = 283/384 (74%), Gaps = 53/384 (14%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHH-------PMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP-----  663
             VA++  HHH         +N PSFF   +  R S+SP DSDEQ    NN WCDSP     
Sbjct  121   VAINQHHHHQHHPHSPFGVNGPSFFPFSS--RTSISPSDSDEQA---NNIWCDSPPLTSP  175

Query  664   --SFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYF  837
                 AS+TVI      GGGG  N SV ALSEDN RLRRSNNMLMSELAHM+KLYNDI YF
Sbjct  176   PRGVASATVI------GGGGGYNSSVFALSEDNERLRRSNNMLMSELAHMKKLYNDISYF  229

Query  838   VQNHVKPVTPSSNSY-------PSPLIT-----------QKPLSQLVTY---PHPHPPTK  954
             V+NHVKPV PS++         P+P  T           QKPL+QL+ Y     P+ P +
Sbjct  230   VENHVKPVAPSNSYSSSLLLCGPAPYATANPVTSNGSLAQKPLNQLLGYYPTTAPNNPKQ  289

Query  955   HQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaa  1134
                V  L+SPT TSQSS+T +E+    + C+TKLFG PLQSKKRLHP+  S P +ME   
Sbjct  290   APQVHVLNSPTTTSQSSLTFLEE-ANNNGCKTKLFGVPLQSKKRLHPEYGSNPGNME---  345

Query  1135  aaaHKARVLVLEKDDLALHLMPPS  1206
                +KAR LVL+KDDL L+LMPPS
Sbjct  346   --TNKAR-LVLDKDDLGLNLMPPS  366



>ref|XP_007017200.1| Heat shock transcription factor B4 [Theobroma cacao]
 gb|EOY14425.1| Heat shock transcription factor B4 [Theobroma cacao]
Length=361

 Score =   429 bits (1103),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 254/376 (68%), Positives = 292/376 (78%), Gaps = 44/376 (12%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA++LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MAVILDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHP----MNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFAS----  675
             VA++H HHHHP    +N PSFF    P R+S+SP DSDEQ  AN   WCDSP  +S    
Sbjct  121   VAINHHHHHHPHSPLVNAPSFFPF--PSRVSISPADSDEQ--AN---WCDSPPLSSPRGG  173

Query  676   -STVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
                 + AG  GGG G  + SV ALSEDN RLRRSNN+LMSELAHMRKLYNDIIYFVQNHV
Sbjct  174   TGVSVVAGGGGGGVGGYSSSVTALSEDNERLRRSNNLLMSELAHMRKLYNDIIYFVQNHV  233

Query  853   KPVTPSSNSYPS------------PLIT------QKPLSQLVTYPHPHPPTKHQPVFNLS  978
             KPVTPS++  PS            P++T      QKPL+QL+ Y +P+ P +   V  L+
Sbjct  234   KPVTPSNSYSPSLLLCGPPSSAAPPVVTTNSSLLQKPLNQLLGY-YPNSPKQSPQVQVLN  292

Query  979   SPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARV  1158
             SP+ TSQSS+T++E+  +++ C+TKLFG PLQSKKRLHP+  +  ++ME      +KAR 
Sbjct  293   SPSATSQSSLTILEE-ASSNSCKTKLFGVPLQSKKRLHPEYGA--ANME-----TNKAR-  343

Query  1159  LVLEKDDLALHLMPPS  1206
             LVLEKDDL L+LMP S
Sbjct  344   LVLEKDDLGLNLMPSS  359



>ref|XP_002510200.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF52387.1| DNA binding protein, putative [Ricinus communis]
Length=362

 Score =   428 bits (1100),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 254/376 (68%), Positives = 281/376 (75%), Gaps = 43/376 (11%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA MLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDD TFVVWRPPEFA
Sbjct  1     MAFMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDATFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHH----PMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFAS-STV  684
             VA++H HHH      +N PSFF   +  R+S+SP +SDEQ   NNN WCDSP   S    
Sbjct  121   VAINHHHHHPHSPLGVNGPSFFPFSS--RVSISPSESDEQ-PNNNNNWCDSPPLTSPRGG  177

Query  685   IsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT  864
             +   +   GGG  N SV ALSEDN RLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT
Sbjct  178   VPNASVINGGGGYNSSVTALSEDNERLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT  237

Query  865   PSSNSYPSPL-----------------ITQKPLSQLVTYPHPHPPTKHQ---PVFNLSSP  984
             P SNSYPS L                 + QKPL+QL+ Y +P P T  +    V  L+SP
Sbjct  238   P-SNSYPSSLLLCAPTSTATPFTSNGSLIQKPLNQLLGYYNP-PSTNSKLVPQVQVLNSP  295

Query  985   TKTSQSSVTLVEDPPAADLCR-TKLFGFPLQSKKRLHPD-QYSPPSSMEaaaaaaHKARV  1158
             T TSQSS+T +++      C+ TKLFG PLQSKKRLH +   S   +ME +     KAR 
Sbjct  296   TSTSQSSLTFLDEG-----CKNTKLFGVPLQSKKRLHSEYNASHTGNMETS-----KAR-  344

Query  1159  LVLEKDDLALHLMPPS  1206
             L+LEKDDL L+LMPPS
Sbjct  345   LMLEKDDLGLNLMPPS  360



>ref|XP_006434743.1| hypothetical protein CICLE_v10001482mg [Citrus clementina]
 gb|ESR47983.1| hypothetical protein CICLE_v10001482mg [Citrus clementina]
Length=383

 Score =   428 bits (1101),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 255/395 (65%), Positives = 288/395 (73%), Gaps = 60/395 (15%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDH+VSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHVVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHP---------MNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP---  663
             VA++H HHHH          +N PSFF    P R+S+SP DSDE +    N WCDSP   
Sbjct  121   VAINHHHHHHQHPHSHSPVLVNGPSFFPF--PNRVSISPSDSDEHV----NNWCDSPPRG  174

Query  664   --SFASSTVIsagnsgggg-------gynngsvaaLSEDNVRLRRSNNMLMSELAHMRKL  816
                   S V+S+G   GGG          N SV ALSEDN RLRRSNNMLMSELAHMRKL
Sbjct  175   GKGTGVSAVMSSGAGCGGGYNNNNNNININTSVTALSEDNERLRRSNNMLMSELAHMRKL  234

Query  817   YNDIIYFVQNHVKPVTPSSNSYPSPL-------------------ITQKPLSQLVTY---  930
             YNDIIYFVQNHVKPVTPS++  PS L                   + QKPL+QL+ Y   
Sbjct  235   YNDIIYFVQNHVKPVTPSNSYSPSLLLCNTTPSAAAAPMCANTTPLVQKPLNQLLGYYPT  294

Query  931   --PHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQY  1104
                +P   T HQ    L+SPT TSQSS+T++E+ P ++ C+TKLFG PLQSKKR+HP+  
Sbjct  295   NGTNPKQATHHQ-AHVLNSPTATSQSSLTILEE-PNSNSCKTKLFGVPLQSKKRVHPEYT  352

Query  1105  SP-PSSMEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
             S  P++ E      +KAR LV++KDDL L+LMPPS
Sbjct  353   SNYPANTE-----TNKAR-LVMDKDDLGLNLMPPS  381



>ref|XP_006473306.1| PREDICTED: heat stress transcription factor B-4-like [Citrus 
sinensis]
 gb|KDO84134.1| hypothetical protein CISIN_1g016692mg [Citrus sinensis]
Length=384

 Score =   426 bits (1095),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 254/397 (64%), Positives = 286/397 (72%), Gaps = 63/397 (16%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDH+VSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHVVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHP---------MNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP---  663
             VA++H HHHH          +N PSFF    P R+S+SP DSDE +    N WCDSP   
Sbjct  121   VAINHHHHHHQHPHSHSPVLVNGPSFFPF--PNRVSISPSDSDEHV----NNWCDSPPRG  174

Query  664   --SFASSTVIsa-------gnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKL  816
                   S V+S+        N+       N SV ALSEDN RLRRSNNMLMSELAHMRKL
Sbjct  175   GKGTGVSAVMSSGAGCGGGYNNNNNNINLNTSVTALSEDNERLRRSNNMLMSELAHMRKL  234

Query  817   YNDIIYFVQNHVKPVTPSSNSYPSPL---------------------ITQKPLSQLVTY-  930
             YNDIIYFVQNHVKPVTP SNSYP  L                     + QKPL+QL+ Y 
Sbjct  235   YNDIIYFVQNHVKPVTP-SNSYPPSLLLCNTTPSAAAAAPMCANTTPLVQKPLNQLLGYY  293

Query  931   ----PHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPD  1098
                  +P   T HQ    L+SPT TSQSS+T++E+ P ++ C+TKLFG PLQSKKR+HP+
Sbjct  294   PTNGTNPKQATHHQ-AHVLNSPTATSQSSLTILEE-PNSNSCKTKLFGVPLQSKKRVHPE  351

Query  1099  QYSP-PSSMEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
               S  P++ E      +KAR LV++KDDL L+LMPPS
Sbjct  352   YASNYPANTE-----TNKAR-LVMDKDDLGLNLMPPS  382



>ref|XP_003603058.1| Heat stress transcription factor B-4 [Medicago truncatula]
 gb|AES73309.1| heat shock transcription factor [Medicago truncatula]
Length=373

 Score =   422 bits (1086),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 237/382 (62%), Positives = 277/382 (73%), Gaps = 44/382 (12%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDD+TFVVWRPPEFA
Sbjct  1     MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDSTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP-  516
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANE+FK+GEKHLLCEIHRRKT+QP 
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEYFKKGEKHLLCEIHRRKTSQPQ  120

Query  517   QVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPD--SDEQLTANNNAWCDSPSFASSTVIs  690
             Q  ++  HH    N P  F  ++  R+S+SP +  SDEQL    N WCDSP   S + ++
Sbjct  121   QTGINMNHHQQHHNVPPSFFPFSNTRVSISPSNDYSDEQL----NNWCDSPPLTSPSFVN  176

Query  691   agnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPS  870
              G         N SV ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQNHVKPV P 
Sbjct  177   GGTQTTATNNYNTSVTALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQNHVKPVAP-  235

Query  871   SNSYPSPLI------------------TQKPLSQLVTYPHPHPP------TKHQP--VFN  972
             SNSY S  +                   QKP++QL+ Y + +P       T++Q     N
Sbjct  236   SNSYSSSFLLPQASNSTPMNGGGNVSMVQKPMNQLLGYYNSNPKHVSHLQTQNQTHHGMN  295

Query  973   LSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYS-PPSSMEaaaaaaHK  1149
             ++SPT TS+SS+T+VE   + +  +TKLFG  LQSKKR+HP+  S  P+S+E      +K
Sbjct  296   VNSPTNTSRSSITMVEGLNSNNCSKTKLFGVSLQSKKRVHPECGSNNPNSLE-----TNK  350

Query  1150  ARVLVLEKD---DLALHLMPPS  1206
             AR LVLEK+   DL L+LMPPS
Sbjct  351   AR-LVLEKEHDFDLGLNLMPPS  371



>ref|XP_011074417.1| PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor 
B-4-like [Sesamum indicum]
Length=371

 Score =   422 bits (1085),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 250/389 (64%), Positives = 275/389 (71%), Gaps = 60/389 (15%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP------------  663
             VA++H HHHHP+   SFF    P R+S+SPPDSDEQ     N WCDSP            
Sbjct  121   VALNHQHHHHPITGQSFFPY--PSRVSISPPDSDEQP----NNWCDSPPPLPSPTGAVPP  174

Query  664   --SFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYF  837
               + AS  V S  N+G    +       LSEDN RLRR+NNMLMSELAHMRKLYNDIIYF
Sbjct  175   VGNAASGGVCSGXNNGTTTSFAA-----LSEDNERLRRNNNMLMSELAHMRKLYNDIIYF  229

Query  838   VQNHVKPVTP------------SSNS---YPSPL----ITQKPLSQLVTYPHPHPPTKHQ  960
             VQNHVKPV P            SSNS     +P+    + QKPL+QL+ Y       K  
Sbjct  230   VQNHVKPVAPSNSFSSSLFLCNSSNSSAPAATPINGSSLLQKPLNQLIGYQQMAANPKQG  289

Query  961   PVF-------NLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSS  1119
               F       + SSP+KTSQSSVT++E+P   D  RTKLFG PL SKKRLHP+  S    
Sbjct  290   NGFLSSFNINSSSSPSKTSQSSVTILEEPTNNDAYRTKLFGVPLSSKKRLHPEYNS----  345

Query  1120  MEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
                 +   +K R LVLEKDDL L+LMPPS
Sbjct  346   ----STETNKTR-LVLEKDDLGLNLMPPS  369



>ref|XP_011083880.1| PREDICTED: heat stress transcription factor B-4-like [Sesamum 
indicum]
Length=347

 Score =   419 bits (1078),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 243/379 (64%), Positives = 273/379 (72%), Gaps = 64/379 (17%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDS K+VPAPFLTKTYQLVDDP TDHIVSWGEDD+TFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSQKTVPAPFLTKTYQLVDDPTTDHIVSWGEDDSTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagn  699
             VA   L+HHH +    FF    P R+S+SPPDSDE+       WCDSP+   +  +    
Sbjct  121   VA---LNHHH-LTGQGFFPY--PTRVSISPPDSDEK-------WCDSPNGNGNGSV----  163

Query  700   sgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNS  879
                   YNN S+AALSEDN RLRR+NNML+SELAHMRKLYNDIIYFVQNHVKPV P SNS
Sbjct  164   ------YNNNSLAALSEDNERLRRNNNMLISELAHMRKLYNDIIYFVQNHVKPVAP-SNS  216

Query  880   YPSPL-------------------ITQKPLSQLVTYPHPHPPTKHQ-----PVFNLSSPT  987
             Y S L                   + QKPL+QL+         K Q       FNL+S +
Sbjct  217   YSSSLFLCNSSSAAACTPINGSSAMQQKPLNQLIG--QNQTTGKKQVNTLFGAFNLNSSS  274

Query  988   K-----TSQSSVTLVEDPPA-ADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHK  1149
                   TSQSS+T++E+  A  + CRTKLFG PL SKKRLHP+ Y+  SS+E      +K
Sbjct  275   AAASKTTSQSSLTILEEAAANVEPCRTKLFGVPLPSKKRLHPECYN--SSVE-----TNK  327

Query  1150  ARVLVLEKDDLALHLMPPS  1206
              R LVLEKDDL L+LMPPS
Sbjct  328   TR-LVLEKDDLGLNLMPPS  345



>ref|XP_002284836.1| PREDICTED: heat stress transcription factor B-4 [Vitis vinifera]
 emb|CAN66983.1| hypothetical protein VITISV_004457 [Vitis vinifera]
Length=363

 Score =   417 bits (1073),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 251/378 (66%), Positives = 280/378 (74%), Gaps = 46/378 (12%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKT+QPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTSQPQ  120

Query  520   VAVD-HLHHHHPMN---EPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVI  687
             V ++ H HHH P+     P FF    PGR+S+SPPDSD+Q  AN   WCDSP+ +S T  
Sbjct  121   VPMNHHHHHHSPLGVNAGPGFFPF--PGRVSISPPDSDDQ--AN---WCDSPTLSSPTA-  172

Query  688   sagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTP  867
              A       G  N SV ALSEDN RLRRSN++LMSELAHMRKLYNDIIYFVQNHVKPV P
Sbjct  173   -ATGVSVVSGGYNSSVTALSEDNERLRRSNSILMSELAHMRKLYNDIIYFVQNHVKPVAP  231

Query  868   SSNSYPSPLI----------------------TQKPLSQLVTYPHPHP---PTKHQPVFN  972
              SNSYPS L+                       QKPL+QL+     +P   P  H     
Sbjct  232   -SNSYPSSLVICNPPSSATTAAATITCSSTAMVQKPLNQLLGCYQSNPKQAPRNHGMGSF  290

Query  973   LSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKA  1152
              SS T +S+SS+T++E+   +  CRTKLFG PLQSKKRLHP+  S  +SME      +KA
Sbjct  291   NSSTTTSSKSSLTVLEETNGSS-CRTKLFGVPLQSKKRLHPEYASTTTSME-----TNKA  344

Query  1153  RVLVLEKDDLALHLMPPS  1206
             R LVL+KDDL L+LMPPS
Sbjct  345   R-LVLDKDDLGLNLMPPS  361



>ref|XP_004501560.1| PREDICTED: heat stress transcription factor B-4-like [Cicer arietinum]
Length=375

 Score =   416 bits (1069),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 241/385 (63%), Positives = 280/385 (73%), Gaps = 48/385 (12%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDD+TFVVWRPPEFA
Sbjct  1     MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPNTDHIVSWGEDDSTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANE+FK+GEKHLLCEIHRRKT QPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEYFKKGEKHLLCEIHRRKTTQPQ  120

Query  520   ---VAVDHLHHHHPMNE--PSFFSAYNPGRLSVSPPD--SDEQLTANNNAWCDSPSFASS  678
                + ++H HHH  +    PSFF   N  R+S+SPP+  SDEQ     N WCDSP   S 
Sbjct  121   QTSINMNHHHHHSQLGNIPPSFFPFSN-TRVSISPPNDYSDEQT----NNWCDSPPLTSP  175

Query  679   TVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKP  858
             T    G +       N SV ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQNHVKP
Sbjct  176   TSFIHGTTTTTTTNYNTSVTALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQNHVKP  235

Query  859   VTPSSNSY-----------PSPL------ITQKPLSQLVTY-----PHPHPPTKHQP---  963
             VTP SNSY           P+P+      + Q+P++ ++ Y      +P   T  QP   
Sbjct  236   VTP-SNSYSSSFLLPQASTPTPVNVSNVSMVQRPMNNILGYYSTSTNNPKHVTHFQPQNQ  294

Query  964   VFNLSSP--TKTSQSSVTLVEDPPA-ADLCRTKLFGFPLQSKKRLHPDQYSP-PSSMEaa  1131
              + ++SP  T TS+SS+T+VE   +  + C+TKLFG  LQSKKR+HP+  S  P+++E  
Sbjct  295   SYAVNSPTNTNTSRSSITIVEGHNSNTNNCKTKLFGVSLQSKKRVHPECGSNIPTNLE--  352

Query  1132  aaaaHKARVLVLEKDDLALHLMPPS  1206
                 +KAR LVLEKDDL L+LMPPS
Sbjct  353   ---TNKAR-LVLEKDDLGLNLMPPS  373



>ref|XP_010112180.1| Heat stress transcription factor B-4 [Morus notabilis]
 gb|EXC32846.1| Heat stress transcription factor B-4 [Morus notabilis]
Length=394

 Score =   416 bits (1069),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 249/398 (63%), Positives = 281/398 (71%), Gaps = 55/398 (14%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHH--------PMNEPSFFS-AYNPGRLSVSPPDSDEQLTANNNAWCDSPSFA  672
             V+++H HHHH         +N PSFF  +   GR+S+SP DSD+    NN + CDSP   
Sbjct  121   VSLNHHHHHHHPHSHHQIGINGPSFFPFSSTTGRVSISPSDSDDN--PNNWSSCDSPPLM  178

Query  673   SS---------TVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYND  825
             SS           +S GN GGGGG    SV ALSEDN RLRRSN+MLMSELAHMRKLYND
Sbjct  179   SSPRGPTAAIVGGVSLGNFGGGGGGVTSSVTALSEDNERLRRSNSMLMSELAHMRKLYND  238

Query  826   IIYFVQNHVKPVTPSSNSYP--------------------SPLITQKPLSQLVTY-----  930
             IIYFVQNHVKPV PS+ SYP                    S ++ QKPL+QL  Y     
Sbjct  239   IIYFVQNHVKPVAPSNVSYPAASPVLLCNASNGGGATNNASSVVLQKPLNQLFGYYPSGT  298

Query  931   -----PHPHPPTKHQPVFNLSSPTKTSQSSVTLVED-PPAADLCRTKLFGFPLQSKKRLH  1092
                  P       H     L+SP+ T++SSVT++E+     + C+TKLFG PL SKKRLH
Sbjct  299   THVNNPKVQLNNLHANHGGLNSPSTTAKSSVTILEERNTTTNGCKTKLFGVPLHSKKRLH  358

Query  1093  PDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
             P+  S  ++        +KAR LVLEKDDL  +LMPPS
Sbjct  359   PEYGSGNAT---NNMENNKAR-LVLEKDDLGFNLMPPS  392



>ref|XP_006374916.1| hypothetical protein POPTR_0014s02700g [Populus trichocarpa]
 gb|ERP52713.1| hypothetical protein POPTR_0014s02700g [Populus trichocarpa]
Length=349

 Score =   413 bits (1061),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 244/377 (65%), Positives = 270/377 (72%), Gaps = 58/377 (15%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP-------SFASS  678
             VA++  HHH       F          V+ P         NN WCDSP         AS+
Sbjct  121   VAINQHHHHQHHPHSPF---------GVNGP--------TNNNWCDSPPLTSPPRGVASA  163

Query  679   TVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKP  858
             TVI      GGGG  N SV ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQNHVKP
Sbjct  164   TVI------GGGGGYNSSVFALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQNHVKP  217

Query  859   VTPSSNSY-------PSPLIT-----------QKPLSQLVTY---PHPHPPTKHQPVFNL  975
             V PS++         P+P  T           QKPL+QL+ Y     P+ P +   V  L
Sbjct  218   VAPSNSYSSSLLLCGPAPYATANPVTSNGSLAQKPLNQLLGYYPTTAPNNPKQAPQVHVL  277

Query  976   SSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKAR  1155
             +SPT TSQSS+T +E+    + C+TKLFG PL SKKRLHP+  S P +ME      +KAR
Sbjct  278   NSPTTTSQSSLTFLEE-ANNNGCKTKLFGVPLHSKKRLHPEYGSNPGNME-----TNKAR  331

Query  1156  VLVLEKDDLALHLMPPS  1206
              +VL+KDDL L+LMPPS
Sbjct  332   -MVLDKDDLGLNLMPPS  347



>ref|XP_004238144.1| PREDICTED: heat stress transcription factor B-4 [Solanum lycopersicum]
Length=360

 Score =   410 bits (1054),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 232/370 (63%), Positives = 265/370 (72%), Gaps = 33/370 (9%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDD+TFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP-  516
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCEIHRRKTAQP 
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPV  120

Query  517   -QVAVDHLHHHHPMNE--PSFFSAYNPGRLSVSPPDSDEQLTANNNA-WCDSPSFASSTV  684
               ++V+H H +H  +   P++ S YNP RLSVSPPDSD+QL    N  WCDSP   ++  
Sbjct  121   QSMSVNHPHSYHTGSGFFPNYPSNYNP-RLSVSPPDSDDQLYQQQNINWCDSPCSNNNNA  179

Query  685   IsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT  864
                         N  +V ALSEDN RLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT
Sbjct  180   ---------SNNNTNTVTALSEDNDRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT  230

Query  865   PSSNSYPSPLI--TQKPLSQLVTYPHPHPPTKHQPVFN--------------LSSPTKTS  996
             PSS+     L+  +  P+ Q     H H    +Q + N              +S    + 
Sbjct  231   PSSSYNTCSLLPASATPIVQKNMNIH-HHQFGYQQITNPKNIVISNINTNNIVSPSKTSQ  289

Query  997   QSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKD  1176
              SSVT++++    D   TKLFG PL SKKR+HP +YS            +KAR++VLEK+
Sbjct  290   SSSVTILDEGNGGDNTSTKLFGVPLMSKKRVHP-EYSSSYYSTTNMVEKNKARLMVLEKN  348

Query  1177  DLALHLMPPS  1206
             DL L+LMPPS
Sbjct  349   DLGLNLMPPS  358



>ref|XP_003528294.1| PREDICTED: heat stress transcription factor B-4 [Glycine max]
 gb|ABC47863.1| Heat shock transcription factor (HSF) [Glycine max]
 gb|KHN22329.1| Heat stress transcription factor B-4 [Glycine soja]
Length=363

 Score =   409 bits (1051),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 238/380 (63%), Positives = 274/380 (72%), Gaps = 50/380 (13%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHP-------MNEPSFFSAYNPGRLSVSPP-DSDEQLTANNNAWCDSPSFAS  675
                 + HHHH        ++ P+FF      R+S+SP  DSD+Q  AN   WCDSP   S
Sbjct  121   QGSMNHHHHHSHSPLGVNVSVPTFFPF--SSRVSISPSNDSDDQ--AN---WCDSPPRGS  173

Query  676   STVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
             ++++   N        N SV ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQNHVK
Sbjct  174   TSLV---NGAAAAANYNTSVTALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQNHVK  230

Query  856   PVTPSS-----------------NSYPSPLITQKPLSQLVTYPHPHPPTKHQPV-----F  969
             PV PS+                  S  +  +TQ+P +QL+ Y   +P      +     +
Sbjct  231   PVAPSNSYSSSLLLCNTPSATPITSGGNVSMTQRPTNQLLGYYSTNPKQGATQITQPQTY  290

Query  970   NLSSPTKTSQSSVTLVEDPPA-ADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaH  1146
              ++SPT TS+SS+T+VE P +  + C+TKLFG  LQSKKR+HPD  S P +        +
Sbjct  291   VVNSPTNTSRSSITIVEGPNSNINSCKTKLFGVSLQSKKRVHPDYGSNPET--------N  342

Query  1147  KARVLVLEKDDLALHLMPPS  1206
             KAR LVLEKDDL L+LMPPS
Sbjct  343   KAR-LVLEKDDLGLNLMPPS  361



>ref|XP_009800135.1| PREDICTED: heat stress transcription factor B-4 [Nicotiana sylvestris]
Length=352

 Score =   406 bits (1044),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 236/377 (63%), Positives = 264/377 (70%), Gaps = 55/377 (15%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA+MLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDD+TF+VWRPPEFA
Sbjct  1     MAMMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDSTFIVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHPMNEPSFFSA-------YNPGRLSVSPPDSDEQLTAN---NNAWCDSPSF  669
             ++++  HHHH +N     S         N  RLS+SPPDSDE L      N  WCDSP+ 
Sbjct  121   ISMN--HHHHSLNHQMNMSGPNFFPNYPNNNRLSISPPDSDELLLQQQQPNINWCDSPTT  178

Query  670   ASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
              +S+             NN +V ALSEDN RLRRSNNMLMSELAHMRKLYNDIIYFVQNH
Sbjct  179   ITSS-----------NNNNTTVTALSEDNERLRRSNNMLMSELAHMRKLYNDIIYFVQNH  227

Query  850   VKPVTPSSNSYPSPLI--TQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQ--------  999
             VKPV PSS+  PS L+  +  P+ Q       H     Q + N       S         
Sbjct  228   VKPVAPSSSYNPSSLLPASATPIVQ------KHMINPRQGMINNGMNIMMSNFNNVNSPS  281

Query  1000  -----SSVTLVEDPPAADLC---RTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKAR  1155
                  SSVT++E+  AAD+     TKLFG PL SKKR+HP +YS    +E      +KAR
Sbjct  282   KTSQSSSVTILEE-AAADMGINRSTKLFGVPLMSKKRVHP-EYSSFKMVE-----TNKAR  334

Query  1156  VLVLEKDDLALHLMPPS  1206
              LVLEKDDL L+LMPPS
Sbjct  335   -LVLEKDDLGLNLMPPS  350



>ref|XP_003523945.1| PREDICTED: heat stress transcription factor B-4 [Glycine max]
 gb|ABC47851.1| heat shock transcription factor [Glycine max]
 gb|KHN04494.1| Heat stress transcription factor B-4 [Glycine soja]
Length=363

 Score =   405 bits (1040),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 229/381 (60%), Positives = 275/381 (72%), Gaps = 52/381 (14%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA++LDNCEGILLSLDSHKSVPAPFLTKTYQLVD+P TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MAVLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDEPTTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHP-------MNEPSFFSAYNPGRLSVSPP-DSDEQLTANNNAWCDSPSFAS  675
               + + HHHH        +N P+FF      R+S+S   DSD+Q     + WCDSP   +
Sbjct  121   QGIMNHHHHHAHSPLGVNVNVPTFFPF--SSRVSISTSNDSDDQ-----SNWCDSPPRGA  173

Query  676   STVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
             ++++    +G      N SV ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQNHVK
Sbjct  174   TSLV----NGAAAANYNTSVTALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQNHVK  229

Query  856   PVTPSS-----------------NSYPSPLITQKPLSQLVTYPHPHPPTKHQPV-----F  969
             PV PS+                 +S  +  + Q+P++QL+ Y   +P      +     +
Sbjct  230   PVAPSNSYSSSLLLCNTPSATPISSANNVSMMQRPMNQLLGYYSTNPKQGATQITQPQTY  289

Query  970   NLSSPTKTSQSSVTLVEDPPAADL--CRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaa  1143
              ++SPT TS+SS+T+ E P ++++  C+TKLFG  LQSKKR+HPD  S P +        
Sbjct  290   VVNSPTNTSRSSITIFEGPASSNINSCKTKLFGVSLQSKKRVHPDCGSNPET--------  341

Query  1144  HKARVLVLEKDDLALHLMPPS  1206
             ++AR LVLEKDDL L+LMPPS
Sbjct  342   NRAR-LVLEKDDLGLNLMPPS  361



>ref|XP_009611319.1| PREDICTED: heat stress transcription factor B-4 [Nicotiana tomentosiformis]
Length=352

 Score =   403 bits (1036),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 234/376 (62%), Positives = 263/376 (70%), Gaps = 53/376 (14%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLD+CEGILLSLDS KSVPAPFLTKTYQLVDDP TDH+VSWGEDD+TF+VWRPPEFA
Sbjct  1     MALMLDSCEGILLSLDSQKSVPAPFLTKTYQLVDDPTTDHVVSWGEDDSTFIVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHPMNEPSFFSA-------YNPGRLSVSPPDSDEQLTAN--NNAWCDSPSFA  672
             ++++  HHHH +N     S         N  RLS+SPPDSDE L     N  WCDSP+  
Sbjct  121   ISMN--HHHHSLNHQMSMSGPNFFPNYPNNNRLSISPPDSDELLQQQQPNINWCDSPTTL  178

Query  673   SSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
             +S+             NN +V ALSEDN RLRRSNNMLMSELAHMRKLYNDIIYFVQNHV
Sbjct  179   TSS-----------NNNNTTVTALSEDNERLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  227

Query  853   KPVTPSSNSYPSPLI--TQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQ---------  999
             KPV PSS+  PS L+  +  P+ Q       H     Q + N       S          
Sbjct  228   KPVAPSSSYNPSSLLPASATPIVQ------KHMINPRQGMINNGMNIMMSNFNNVNSPSK  281

Query  1000  ----SSVTLVEDPPAADLC---RTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARV  1158
                 SSVT++E+  AAD+     TKLFG PL SKKR+HP +YS   +M       +KAR 
Sbjct  282   TSQSSSVTILEE-AAADMGINRSTKLFGVPLMSKKRVHP-EYSSSFNM----GETNKAR-  334

Query  1159  LVLEKDDLALHLMPPS  1206
             LVLEKDDL L+LMPPS
Sbjct  335   LVLEKDDLGLNLMPPS  350



>ref|XP_010263520.1| PREDICTED: heat stress transcription factor B-4-like [Nelumbo 
nucifera]
Length=365

 Score =   401 bits (1030),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 238/382 (62%), Positives = 273/382 (71%), Gaps = 52/382 (14%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGED+TTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDETTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKT+QPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTSQPQ  120

Query  520   VAVDHLHHHHP------MNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASST  681
             V+++H H H P      +  P FF    PGR+S+S  DSDEQ  AN   WC+S   +S  
Sbjct  121   VSINH-HPHSPIGAAGAIGSPGFFPF--PGRVSISSSDSDEQ--AN---WCESSPLSSPR  172

Query  682   VIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPV  861
                  +  GGGG  + SV+ALSEDN RLRRSN+MLMSELAHM+KLYNDIIYFVQNHV+PV
Sbjct  173   G--GASVYGGGGCVSSSVSALSEDNERLRRSNSMLMSELAHMKKLYNDIIYFVQNHVRPV  230

Query  862   TPSSNSYPSPL------------------------ITQKPLSQLVTYPHPHPPTKHQPVF  969
              P SNSYPS L                        I QKP  QL+ +     P   QP +
Sbjct  231   AP-SNSYPSSLIICNPSPGTPNQQTSSIANAPSTAIVQKPFHQLLGFYQSSSPK--QPSY  287

Query  970   NLSS--PTKTSQSSVTLVEDP-PAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaa  1140
                S   +  S +S T++++P   ++  RTKLFG PL SKKRLHP+  SPP+SM+ +   
Sbjct  288   TKGSFNSSAPSNASSTILQEPHNNSNNSRTKLFGVPLHSKKRLHPEPTSPPTSMDTS---  344

Query  1141  aHKARVLVLEKDDLALHLMPPS  1206
               KAR L+L  DDL L+LMPPS
Sbjct  345   --KAR-LMLSNDDLGLNLMPPS  363



>ref|NP_001288049.1| heat stress transcription factor B-4 [Malus domestica]
 gb|ADL36735.1| HSF domain class transcription factor [Malus domestica]
Length=383

 Score =   401 bits (1031),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 246/394 (62%), Positives = 272/394 (69%), Gaps = 58/394 (15%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALM+DNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWG+DDTTFVVWRPPEFA
Sbjct  1     MALMIDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGDDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP-  516
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQP 
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPH  120

Query  517   QVAVD-----------HLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWC--D  657
             QV +            + HHHH    P FF   +PG  S+SP DSDEQ       WC  D
Sbjct  121   QVGLSHHHHHHSQLGMNGHHHH----PGFFPFPSPG--SISPSDSDEQPN-----WCDSD  169

Query  658   SPSFASST------VIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLY  819
             SP   S T      + S  N+      NN +VA L+EDN RLRRSN MLMSELAHMRKLY
Sbjct  170   SPPLLSPTGGINTNINSNNNNFMNINNNNTTVAGLAEDNERLRRSNTMLMSELAHMRKLY  229

Query  820   NDIIYFVQNHVKPVTPSSNSYPSPLITQKP-----------LSQLVTY--PHPHPPTKHQ  960
             NDIIYFVQNHVKPV P SNSYPS ++   P           L+QL+ Y    P P  K  
Sbjct  230   NDIIYFVQNHVKPVAP-SNSYPSSMLLCNPQPPKHNGPNSNLNQLLGYYPAAPPPNAKQN  288

Query  961   P--VFNLSSP---TKTSQSSVTLVED-----PPAADLCR-TKLFGFP-LQSKKRLHPDQY  1104
             P  + N SSP   T +  SSVT++ED     P   + C+ TKLFG P L SKKRLHP++Y
Sbjct  289   PHHIMNSSSPMSNTTSKSSSVTILEDHHQQPPSGNNGCKNTKLFGVPLLHSKKRLHPEEY  348

Query  1105  SPPSSMEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
                +        A KAR L+LEKDDL LHLMPPS
Sbjct  349   GSNNHHGNNMMEASKAR-LILEKDDLGLHLMPPS  381



>gb|AIG20081.1| HSF14 [Gossypium hirsutum]
Length=343

 Score =   400 bits (1027),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 228/362 (63%), Positives = 265/362 (73%), Gaps = 34/362 (9%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL+LDNCE ILLSLDSHKSVPAPFLTKTYQLVDDP TD IVSWGE DTTFVVWRPPEFA
Sbjct  1     MALVLDNCEDILLSLDSHKSVPAPFLTKTYQLVDDPTTDKIVSWGEYDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEF NEFFK+GEK LLCEIHR KT+QPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFGNEFFKKGEKQLLCEIHRGKTSQPQ  120

Query  520   VAVDHLHHHHP--MNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsa  693
             VA++H +H H   +N PSFF    P R+S+SP  SDEQ  AN   WCDSP  +S+ V   
Sbjct  121   VAINHHYHSHSPFVNAPSFFPF--PSRVSISPAASDEQ--AN---WCDSPILSSARV---  170

Query  694   gnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPS-  870
             G      G  N SV ALSEDN +LRR NN+L SELAHM K+YNDIIYFVQNHVK VTPS 
Sbjct  171   GTGVSVFGGYNSSVTALSEDNEKLRRRNNLLTSELAHMTKIYNDIIYFVQNHVKHVTPSN  230

Query  871   ----------SNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVE  1020
                       S S  +  + QKPL+Q + Y +P+     Q  F L++PT  S+SS+T++E
Sbjct  231   PYPPNMLLCGSQSAANSSLLQKPLNQFLGY-YPNSTKPAQVQF-LNTPTAASKSSLTILE  288

Query  1021  DPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMP  1200
             +  +++ C+TKLFG PL SKKRLHP +Y   +S        +K R LVLE +DL L+LMP
Sbjct  289   E-TSSNSCKTKLFGVPLHSKKRLHP-EYGATNS------ETNKVR-LVLENEDLGLNLMP  339

Query  1201  PS  1206
             PS
Sbjct  340   PS  341



>ref|XP_007136692.1| hypothetical protein PHAVU_009G065800g [Phaseolus vulgaris]
 gb|ESW08686.1| hypothetical protein PHAVU_009G065800g [Phaseolus vulgaris]
Length=364

 Score =   400 bits (1029),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 230/384 (60%), Positives = 271/384 (71%), Gaps = 57/384 (15%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHP-------MNEPSFFSAYNPGRLSVSPP-DSDEQLTANNNAWCDSPSFAS  675
                 + HHHH        +  P+FF      R S+SP  DSD+Q       WCDSP   +
Sbjct  121   QGSMNHHHHHSHSPLGVNVGVPTFFPF--SSRASISPSNDSDDQTN-----WCDSPPRGA  173

Query  676   STVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
             ++++       G    + SV ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQNHVK
Sbjct  174   TSLM------NGAANYSTSVTALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQNHVK  227

Query  856   PVTPSSNSY----------PSPL------ITQKPLSQLVTYPHPHPPTKHQPV-------  966
             PV PS++             +P+      + Q+P++Q + Y   +P     P+       
Sbjct  228   PVAPSNSYSSSLLLCNTPAATPINGANVSMMQRPMNQFLGYYSTNPKQGTTPLTQHQQHQ  287

Query  967   ---FNLSSPTKTSQSSVTLVEDPPA-ADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaa  1134
                ++++SP+ TS+SS+T+VE P    + C+TKLFG  LQSKKR+HPD  S         
Sbjct  288   PQTYHVNSPSNTSRSSITIVEGPSGNINSCKTKLFGVSLQSKKRVHPDYGS--------N  339

Query  1135  aaaHKARVLVLEKDDLALHLMPPS  1206
             +  +KAR LVL+KDDL L+LMPPS
Sbjct  340   SETNKAR-LVLDKDDLGLNLMPPS  362



>ref|XP_008357386.1| PREDICTED: heat stress transcription factor B-4-like [Malus domestica]
Length=381

 Score =   400 bits (1028),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 246/392 (63%), Positives = 273/392 (70%), Gaps = 56/392 (14%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALM+DNCE ILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWG+DDTTFVVWRPPEFA
Sbjct  1     MALMIDNCESILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGDDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP-  516
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQP 
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPH  120

Query  517   QVAVDHL----------HHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWC--DS  660
             QV ++H            HHH    PSFFS   P R S+SP DSDEQ       WC  DS
Sbjct  121   QVGLNHHHHHHSPLGMNGHHH----PSFFSF--PSRGSISPSDSDEQPN-----WCESDS  169

Query  661   PSFASST------VIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYN  822
             P   S T      + +  N+     +NN +VA L+EDN RLRRSNNMLMSEL HMRKLYN
Sbjct  170   PPLLSPTGGINTNINTNNNTFMNINHNNTTVAGLAEDNERLRRSNNMLMSELTHMRKLYN  229

Query  823   DIIYFVQNHVKPVTPSSNSYPSPLITQKP-----------LSQLVTY--PHPHPPTKHQP  963
             DIIYFVQNHVKPV P SNSYPS ++   P           L+QL  Y    P P  K  P
Sbjct  230   DIIYFVQNHVKPVAP-SNSYPSSMLLCNPQPPKPNGXNGXLNQLQGYYPAAPPPNAKQNP  288

Query  964   --VFNLSSP--TKTSQSSVTLVED-----PPAADLCR-TKLFGFP-LQSKKRLHPDQYSP  1110
               + N SSP    TS+SSVT++ED     P + + C+ TKLFG P L SKKRLHP++Y  
Sbjct  289   HHIMNSSSPMSNTTSKSSVTILEDHHQQPPSSNNGCKNTKLFGVPLLHSKKRLHPEEYGS  348

Query  1111  PSSMEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
              +        A KAR L+LEKDDL L LMPPS
Sbjct  349   NNHHGNNMMEASKAR-LILEKDDLGLQLMPPS  379



>ref|XP_008444610.1| PREDICTED: heat stress transcription factor B-4 [Cucumis melo]
Length=375

 Score =   399 bits (1026),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 227/382 (59%), Positives = 268/382 (70%), Gaps = 42/382 (11%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             M++MLDNCEGILLSLDSHKSVPAPFL+KTYQLVDDP+TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MSVMLDNCEGILLSLDSHKSVPAPFLSKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFF++GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFRKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFA---------  672
             +   H HH   +N PSFF      R+S+SP DSDEQ+      WCDSP  A         
Sbjct  121   LPYSH-HHLGNINGPSFFPFST--RVSISPSDSDEQIN-----WCDSPPVAPRATGTGGY  172

Query  673   --SSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQN  846
                 + I + NS         SV ALSEDN RLRR+N+ML+SEL+HMRKLYNDIIYFVQN
Sbjct  173   SVMGSGIISNNSRASNYNMMSSVTALSEDNERLRRNNSMLISELSHMRKLYNDIIYFVQN  232

Query  847   HVKPVTPSSNSYPSPLI---------TQKPLSQLVTY----------PHPHPPTKHQPVF  969
             HVKPV+P SNS+PS L+         +QKPL+  +             H   P       
Sbjct  233   HVKPVSP-SNSFPSLLLSHHPSSTANSQKPLNHFLGISPPNTTSTTTNHFSVPGTIVTTH  291

Query  970   NLSSPTKTSQSSVTLVEDPPA-ADLCRTKLFGFPL-QSKKRLHPDQYSPPSSMEaaaaaa  1143
              +SSPT TS+S+VT ++   A  + C+TKLFG  +  SKKR+HPD  +   S+ +  +  
Sbjct  292   FVSSPTATSKSAVTELDVGEADNNSCKTKLFGVAISSSKKRMHPDTTTNYVSICSNVSDT  351

Query  1144  HKARVLVLEK-DDLALHLMPPS  1206
             +K   L+LEK D+L L+LMPPS
Sbjct  352   NKNSRLILEKGDNLGLNLMPPS  373



>ref|XP_009359791.1| PREDICTED: heat stress transcription factor B-4 [Pyrus x bretschneideri]
Length=382

 Score =   399 bits (1025),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 245/393 (62%), Positives = 271/393 (69%), Gaps = 57/393 (15%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALM+DNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWG+DDTTFVVWRPPEFA
Sbjct  1     MALMIDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGDDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP-  516
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQP 
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPH  120

Query  517   QVAVD----------HLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWC--DS  660
             QV +           + HHHH    P FF   +PG  S+SP DSDEQ       WC  DS
Sbjct  121   QVGLSHHHHHSQLGMNGHHHH----PGFFPFPSPG--SISPSDSDEQPN-----WCDSDS  169

Query  661   PSFASST------VIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYN  822
             P   S T      + S  N+      NN +VA L+EDN RLRRSN MLMSELAHMRKLYN
Sbjct  170   PPLLSPTGGINTNINSNNNNFMNINNNNTTVAGLAEDNERLRRSNTMLMSELAHMRKLYN  229

Query  823   DIIYFVQNHVKPVTPSSNSYPSPLITQKP-----------LSQLVTY--PHPHPPTKHQP  963
             DIIYFVQNHVKPV P SNSYPS ++   P           L+QL+ Y    P P  K  P
Sbjct  230   DIIYFVQNHVKPVAP-SNSYPSSMLLCNPQPPKHNGPNGNLNQLLGYYPAAPPPNAKQNP  288

Query  964   --VFNLSSP---TKTSQSSVTLVED-----PPAADLCR-TKLFGFP-LQSKKRLHPDQYS  1107
               + N SSP   T +  SSVT++ED     P   + C+ TKLFG P L SKKRLHP++Y 
Sbjct  289   HHIMNSSSPMSNTTSKSSSVTILEDHHQQPPSGNNGCKNTKLFGVPLLHSKKRLHPEEYG  348

Query  1108  PPSSMEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
               +        A KAR L+LEKDDL LHLMPPS
Sbjct  349   SNNHHGNNMMEASKAR-LILEKDDLGLHLMPPS  380



>ref|XP_004143013.1| PREDICTED: heat stress transcription factor B-4-like [Cucumis 
sativus]
 ref|XP_004166417.1| PREDICTED: heat stress transcription factor B-4-like [Cucumis 
sativus]
 gb|KGN62495.1| hypothetical protein Csa_2G356690 [Cucumis sativus]
Length=374

 Score =   395 bits (1016),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 226/382 (59%), Positives = 268/382 (70%), Gaps = 43/382 (11%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             M++MLDNCEGILLSLDSHKSVPAPFL+KTYQLVDDP+TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MSVMLDNCEGILLSLDSHKSVPAPFLSKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFF++GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFRKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP------------  663
             +   H HH   +N PSFF      R+S+SP DSDEQ+      WCDSP            
Sbjct  121   LPYTH-HHLGNINGPSFFPFST--RVSISPSDSDEQIN-----WCDSPPVPPRATGTGGY  172

Query  664   SFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQ  843
             S   S +IS  +S       +   A LSEDN RLRR+N+ML+SEL+HMRKLYNDIIYFVQ
Sbjct  173   SVMGSGIISNNSSTSNYNMMSSVTA-LSEDNERLRRNNSMLISELSHMRKLYNDIIYFVQ  231

Query  844   NHVKPVTPSSNSYPSPLI--------TQKPLSQLVTY----------PHPHPPTKHQPVF  969
             NHVKPV+P SNS+PS L+        +QKPL+  +             H   P       
Sbjct  232   NHVKPVSP-SNSFPSLLLSHHPSTTNSQKPLNHFLGISPPNTTSTTTNHFSVPGTIVTTH  290

Query  970   NLSSPTKTSQSSVTLVEDPPA-ADLCRTKLFGFPL-QSKKRLHPDQYSPPSSMEaaaaaa  1143
              +SSPT TS+S+VT ++   A  + C+TKLFG  +  SKKR+HPD  +   S+ +  +  
Sbjct  291   FVSSPTATSKSAVTELDVGEADNNSCKTKLFGVAISSSKKRMHPDTTTNYVSICSNVSDT  350

Query  1144  HKARVLVLEK-DDLALHLMPPS  1206
             +K   L+LEK D+L L+LMPPS
Sbjct  351   NKNSRLILEKGDNLGLNLMPPS  372



>gb|KHG03540.1| Heat stress transcription factor B-4 -like protein [Gossypium 
arboreum]
Length=325

 Score =   393 bits (1009),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 232/360 (64%), Positives = 259/360 (72%), Gaps = 48/360 (13%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHK VPAPFLTKTYQLVDDP TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKPVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANE+FK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEYFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHH---------HHPMNEPSFFSAY-NPGRLSVSPPDSDEQLTANNNAWCDSPSF  669
             V     H+           PM   + +  +  P R+S+SPPDSDEQ T     WCDSP  
Sbjct  121   VTAALNHYNHHHRHLHTQSPMVNNTHYGYFPFPSRVSISPPDSDEQTT----NWCDSPPL  176

Query  670   ASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
             +S+T       GGGG YNN SV ALSEDN RLRRSNN+L+SELAHM+KLYNDIIYFVQNH
Sbjct  177   SSTT-------GGGGSYNNSSVTALSEDNERLRRSNNLLISELAHMKKLYNDIIYFVQNH  229

Query  850   VKPVTPSSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPP  1029
             VKPVTPS++  PS L+                P +H   +  +SPT   Q    L E+P 
Sbjct  230   VKPVTPSNSYSPSLLLCS--------------PNQHHFGYYPNSPTPQVQ---VLNEEPN  272

Query  1030  AADLCRTKLFGFPLQSKKRLHPD-QYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
                  +TKLFG PLQSKKRLHP+   S  ++ME      HK R LVLEKDD+ L+LMP S
Sbjct  273   NK---KTKLFGVPLQSKKRLHPEYGGSTAANME-----THKPR-LVLEKDDIGLNLMPSS  323



>ref|XP_010269531.1| PREDICTED: heat stress transcription factor B-4-like [Nelumbo 
nucifera]
Length=376

 Score =   393 bits (1010),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 237/389 (61%), Positives = 269/389 (69%), Gaps = 55/389 (14%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGED TTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDGTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFAN+FFK+GEKHLLCEIHRRKT+QPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANDFFKKGEKHLLCEIHRRKTSQPQ  120

Query  520   VAVDHLHHHHPMNEPSFFSAYN---------PGRLSVSPPDSDEQLTANNNAWCDSPSFA  672
             V++ H HH H        +A           P R+S+SP DSDEQ       WCDS   +
Sbjct  121   VSISHHHHPHHHPHSPIGAAGAIGGPGFFPFPSRVSISPSDSDEQTN-----WCDSSPMS  175

Query  673   SSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
             S    ++   GGGGG  N SV+ALSEDN RLRRSN+MLMSELAHM+KLYNDIIYFVQNHV
Sbjct  176   SPRGGASVFGGGGGGCGNNSVSALSEDNERLRRSNSMLMSELAHMKKLYNDIIYFVQNHV  235

Query  853   KPVTPSSNSYPSPLI--------------------TQKPLSQLVTY--PHPHPPTKHQPV  966
             +PV P SNSYPS L+                     QKP  QL+ +    P  P+  +  
Sbjct  236   RPVAP-SNSYPSSLVICNPSPTPTPPITNLPAASMVQKPFHQLLGFYQSSPKQPSHVKDS  294

Query  967   FNLSSPTKTSQSSVTLVEDP---------PAADLCRTKLFGFPLQSKKRLHPDQYSPPSS  1119
             FN S+P   S +S+ ++E+P               RTKLFG  L SKKRLHP+Q S P+S
Sbjct  295   FNSSTP---SNASIAVLEEPNDNDDDNNHNNNSNSRTKLFGVSLHSKKRLHPEQTSLPTS  351

Query  1120  MEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
             M+      +KAR  VL KDDL L+LMPPS
Sbjct  352   MD-----TNKAR-FVLAKDDLGLNLMPPS  374



>ref|XP_004141262.1| PREDICTED: heat stress transcription factor B-4-like [Cucumis 
sativus]
 ref|XP_004173378.1| PREDICTED: heat stress transcription factor B-4-like [Cucumis 
sativus]
 gb|KGN55206.1| hypothetical protein Csa_4G639930 [Cucumis sativus]
Length=329

 Score =   389 bits (999),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 223/356 (63%), Positives = 256/356 (72%), Gaps = 34/356 (10%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLD C+G+LLSLDSHK++PAPFLTKTYQLVDDP+TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDTCDGVLLSLDSHKAIPAPFLTKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFF++GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFRKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHH-HHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsag  696
             V V+  H  H P+N P F+  +   RLS+SP DSD+Q    NN WCDSPS  ++      
Sbjct  121   VTVNQHHQPHSPLN-PGFYH-FPTARLSISPSDSDDQ----NNYWCDSPSPNNNNN----  170

Query  697   nsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSN  876
                        SV ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQNHVKPV P SN
Sbjct  171   ----------NSVTALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQNHVKPVAP-SN  219

Query  877   SY-----PSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADL  1041
             SY      S L    P+ +   + H H     Q    + + T  ++S VT++E+      
Sbjct  220   SYQYSTTTSLLSDGFPVVRQPNHYHHHHHHHQQVSSQIRNNTVGTKSFVTILEEEQQQQ-  278

Query  1042  CRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMPPSC  1209
              +TKLFG  +QSKKRLHP+          +    +KAR LVLEKDDL L+LMPPS 
Sbjct  279   TKTKLFGVAIQSKKRLHPE-----YGNSNSNNNNNKAR-LVLEKDDLGLNLMPPSA  328



>gb|AII82334.1| heat shock transcription factor [Gossypium hirsutum]
Length=332

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 220/361 (61%), Positives = 262/361 (73%), Gaps = 55/361 (15%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALM+D CEG+LLSL+ H++VPAPFLTKTYQLVD+P TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMVDTCEGVLLSLEPHQAVPAPFLTKTYQLVDEPTTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VP+RWEFANEFFK+G KHLLCEIHRRKTAQP 
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPERWEFANEFFKKGGKHLLCEIHRRKTAQPS  120

Query  520   VAVDHLHHHHP------MNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASST  681
             +     HH+HP      +N PSFF    P ++S+SP D D           DSP  +S  
Sbjct  121   IN----HHYHPHIPHSALNAPSFFPF--PSQVSISPTDMD-----------DSPPLSS--  161

Query  682   VIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPV  861
                     G  G    SV ALSEDN RLRRSN++LMSEL HMRKLY+DIIYFVQNHVKPV
Sbjct  162   ------PRGATGGYGSSVTALSEDNERLRRSNSLLMSELTHMRKLYSDIIYFVQNHVKPV  215

Query  862   TPSSNSYPSPLIT-------------QKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQS  1002
             TP ++  PS L++             QKPL+Q + Y   +P + +     L+SPT TSQS
Sbjct  216   TPGNSYSPSLLLSGPPPAVNTNTSLLQKPLNQFLGY---YPKSPNPQFQGLNSPTATSQS  272

Query  1003  SVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDL  1182
             S+T+VE+ P+++ C+T+LFG PLQSKKRLHP +YS  ++ME +     KAR LVLEKDDL
Sbjct  273   SLTIVEE-PSSNSCKTRLFGVPLQSKKRLHP-EYSTAANMETS-----KAR-LVLEKDDL  324

Query  1183  A  1185
             +
Sbjct  325   S  325



>ref|XP_006354868.1| PREDICTED: heat stress transcription factor B-4-like [Solanum 
tuberosum]
Length=372

 Score =   390 bits (1002),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 230/375 (61%), Positives = 258/375 (69%), Gaps = 31/375 (8%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDD+TFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDSTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCEIHRRKTAQP 
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPI  120

Query  520   VAVDHLHHHHPMNEPSFF----SAYNPGRLSVSPPDSDEQLTANNNA-WCDSPSFASSTV  684
               +    HH       FF    + YNP R S+SPPDSDEQ     N  WCDS    SS  
Sbjct  121   QNMSMNPHHSYHTGSGFFPNYPTNYNP-RHSISPPDSDEQFFQQQNINWCDS---PSSNN  176

Query  685   IsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT  864
              ++ N+      N  +V ALSEDN RLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT
Sbjct  177   NASNNNFTNINTNTNTVTALSEDNDRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT  236

Query  865   PSSNSYPSPLI--TQKPLSQLVTYPHPHPPTKHQPVFN------------------LSSP  984
             PSS+     L+  +  P+ Q     + H    +Q + N                  +S  
Sbjct  237   PSSSYNTCSLLPASATPIVQKNMNMNIHHQFGYQQITNPKNVAISNINNNNNNNNVVSPS  296

Query  985   TKTSQSSVTLV-EDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARVL  1161
               +  SSVT++ E     D   TKLFG PL SKKR+HP +YS            +KAR++
Sbjct  297   KTSQSSSVTILDEGNGGGDNRSTKLFGVPLMSKKRVHP-EYSSSYYSTTNMVETNKARLM  355

Query  1162  VLEKDDLALHLMPPS  1206
             VLEK+DL L+LMPPS
Sbjct  356   VLEKNDLGLNLMPPS  370



>ref|XP_008452568.1| PREDICTED: heat stress transcription factor B-4-like [Cucumis 
melo]
Length=327

 Score =   388 bits (997),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 226/356 (63%), Positives = 258/356 (72%), Gaps = 36/356 (10%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLD+C+G+LLSLDSHK++PAPFLTKTYQLVDDP+TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDSCDGVLLSLDSHKAIPAPFLTKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFF++GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFRKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHH-HPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsag  696
             V V+  H    P+N P F+  +   RLS+SP DSD+Q    NN WCDSPS  ++      
Sbjct  121   VTVNQHHQSLSPLN-PGFYH-FPTARLSISPSDSDDQ----NNYWCDSPSPNNNNN----  170

Query  697   nsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSN  876
                      N SV ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQNHVKPV P SN
Sbjct  171   ---------NNSVTALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQNHVKPVAP-SN  220

Query  877   SY-----PSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADL  1041
             SY      S L    P+ +   + H H     Q   N +  TK   S VT++E+      
Sbjct  221   SYQYSTSTSLLSDGFPVVRQPNHYHHHHQVSSQIRNNTTVGTK---SFVTILEEEQQQQQ  277

Query  1042  CRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMPPSC  1209
              +TKLFG  +QSKKRLHP+  +  S+        +KAR LVLEKDDL L+LMPPS 
Sbjct  278   PKTKLFGVAIQSKKRLHPEYGNSHSN------NNNKAR-LVLEKDDLGLNLMPPSA  326



>emb|CDP01323.1| unnamed protein product [Coffea canephora]
Length=299

 Score =   384 bits (986),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 219/367 (60%), Positives = 247/367 (67%), Gaps = 88/367 (24%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPQ  120

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagn  699
             VA++H HHHHP+N P     + P                         S +SS+V     
Sbjct  121   VAINHHHHHHPLNNPISSPTFFPN------------------------SISSSSV-----  151

Query  700   sgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNS  879
                          ALSEDN RLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPV P SN+
Sbjct  152   ------------TALSEDNERLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVAP-SNT  198

Query  880   YPSPL------------------ITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSS  1005
             +PS L                  + QKPL+QL+ + H H P +++P+             
Sbjct  199   FPSSLLPSSATPIIHNTTNSSSSLMQKPLNQLIGFHHHHYPKQNEPM-------------  245

Query  1006  VTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLA  1185
                     ++++ RTKLFG PL SKKRLHP+          +    +KAR LV+EKDDL 
Sbjct  246   -------DSSNISRTKLFGVPLHSKKRLHPE-------CSNSMVETNKAR-LVMEKDDLG  290

Query  1186  LHLMPPS  1206
             L+LMPPS
Sbjct  291   LNLMPPS  297



>ref|XP_007226488.1| hypothetical protein PRUPE_ppa026635mg [Prunus persica]
 gb|EMJ27687.1| hypothetical protein PRUPE_ppa026635mg [Prunus persica]
Length=389

 Score =   387 bits (994),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 241/404 (60%), Positives = 268/404 (66%), Gaps = 70/404 (17%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALM+DNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDD TFVVWRPPEFA
Sbjct  1     MALMMDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDATFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP-  516
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQP 
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPH  120

Query  517   QVAVDHL--------------HHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWC  654
             QV   H                HHH    PSFF    P R S+SP DSDE        WC
Sbjct  121   QVGFSHHHHHHHNSHSPLGINGHHH----PSFFPF--PSRGSISPSDSDEPPN-----WC  169

Query  655   DS-----PSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLY  819
             DS     PS          N+      NN SV  L+EDN RLRRSN+MLMSELAHMRKLY
Sbjct  170   DSDSPPLPSPTGGINNHNNNNNNFMSINNASVTGLAEDNERLRRSNSMLMSELAHMRKLY  229

Query  820   NDIIYFVQNHVKPVTPSSNSYPSPLITQKP-----------------LSQLVTYPHPHPP  948
             NDIIYFVQNHVKPV P SNSYPS L+   P                  +QL+ Y +P P 
Sbjct  230   NDIIYFVQNHVKPVAP-SNSYPSSLLLCNPPPNSMAPAATATKPSNNFNQLLGY-YPAPA  287

Query  949   TKHQPVFNLSSPT-------------KTSQSSVTLVED--PPAADLCR-TKLFGFP-LQS  1077
             T  +   ++S+ T              +  SSVT++ED   P+++ C+ TKLFG P L S
Sbjct  288   TNAKQTPHMSTTTHHHVMNSSSPSNTTSKSSSVTILEDQQQPSSNGCKNTKLFGVPLLHS  347

Query  1078  KKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMPPSC  1209
             KKRLHP++Y   S+   +   A KAR L+LEKDDL LHLMPPS 
Sbjct  348   KKRLHPEEYG--SNHGTSMMEASKAR-LILEKDDLGLHLMPPSA  388



>ref|NP_001241604.1| uncharacterized protein LOC100782841 [Glycine max]
 gb|ACU17709.1| unknown [Glycine max]
 gb|KHN35686.1| Heat stress transcription factor B-4 [Glycine soja]
Length=370

 Score =   385 bits (989),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 225/381 (59%), Positives = 269/381 (71%), Gaps = 45/381 (12%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL+LDNCE ILLSLD+HKSVPAPFLTKTYQLVDDP+TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALLLDNCESILLSLDTHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKT----  507
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEK+LLCEIHRRKT    
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKNLLCEIHRRKTHHQH  120

Query  508   AQPQVAVDHLHHHHP--MNEPSFFSAYNPGRLSVSPP-DSDEQLTANNNAWCDSPSFASS  678
              Q   A+++ HHHH   +N  S F  +N  RLSVSP  DSDE +  N   WCDSP    +
Sbjct  121   HQQVQAMNNHHHHHKFGLNVSSIFPFHN-NRLSVSPSHDSDEVIIPN---WCDSPPRGVA  176

Query  679   TVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKP  858
              V    N+      N  +V ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQNHVKP
Sbjct  177   GV----NNNNSSSNNYNTVTALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQNHVKP  232

Query  859   VTPS-SNSYPSPLITQKPLSQLVTYPHPHPPTKHQ--PVFNLSSPTKT------------  993
             V PS +N++PS L+     S +     P   T+ Q  P+ N+S+  +             
Sbjct  233   VAPSNNNNFPSFLLCSDN-SNINNNTSPQTQTQAQASPMSNVSTVQRQLKQFVGCYSNNT  291

Query  994   ---------SQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaH  1146
                      + SS+T+VE+  +++ C+TKLFG  LQSKKR+HP +Y   + ++  ++  +
Sbjct  292   KQARAVNSPTNSSITIVEEEASSNSCKTKLFGVSLQSKKRVHP-EYGSNNVLQ--SSETN  348

Query  1147  KARVLVLEKDD-LALHLMPPS  1206
             KAR L LE D+ L L+LMPPS
Sbjct  349   KAR-LALENDELLGLNLMPPS  368



>ref|XP_010061734.1| PREDICTED: heat stress transcription factor B-4-like [Eucalyptus 
grandis]
 gb|KCW68721.1| hypothetical protein EUGRSUZ_F02327 [Eucalyptus grandis]
Length=365

 Score =   384 bits (987),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 225/378 (60%), Positives = 270/378 (71%), Gaps = 43/378 (11%)
 Frame = +1

Query  157   IMALMLDNC-EGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPE  333
             +  LM+D C EG+L+++++ K+VPAPFLTKTYQLVDDP+TDHIVSWG+DD+TFVVWRPPE
Sbjct  1     MAQLMVDKCGEGLLVAVEAQKAVPAPFLTKTYQLVDDPSTDHIVSWGDDDSTFVVWRPPE  60

Query  334   FARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQ  513
             FARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFF++GEKHLLCEIHRRKTAQ
Sbjct  61    FARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFRKGEKHLLCEIHRRKTAQ  120

Query  514   PQVAVDHLHHHHPMN--EPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP--------  663
             PQ+   H H   P++   P+FF    P RLS+SP DSD+Q +++   WCDSP        
Sbjct  121   PQLTHHHPHSASPLSGPTPAFFPF--PSRLSISPSDSDDQHSSH---WCDSPPPPPPPPL  175

Query  664   ----SFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDII  831
                 S       S G       YN+ +V ALSEDN RLRRSNNMLMSELAHM+KLYNDII
Sbjct  176   SSPRSGCGGHNNSVGPVASAANYNSSAVTALSEDNERLRRSNNMLMSELAHMKKLYNDII  235

Query  832   YFVQNHVKPVTPSSNSYPSPLITQKPLSQLVTYPHPHPP-----------TKH-QPVFNL  975
             YFVQNHVKPV PS+ S+  P + QKP +QL+ Y +               T H +PV  +
Sbjct  236   YFVQNHVKPVAPSTYSWSPPSMVQKPSNQLLGYNNYANAIAAPNNNSCVVTNHVKPV--V  293

Query  976   SSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPD-QYSPPSSMEaaaaaaHKA  1152
              S +  +QSS+T++EDPP  +  + KLFG PL SKKRLHP+   SP   ME      +KA
Sbjct  294   RSNSNVTQSSLTILEDPPVMN--KMKLFGVPLLSKKRLHPEYNSSPVGYME-----TNKA  346

Query  1153  RVLVLEKDDLALHLMPPS  1206
             R LVLEKDDL L+LMPPS
Sbjct  347   R-LVLEKDDLGLNLMPPS  363



>emb|CAA87080.1| heat shock transcription factor 5 [Glycine max]
Length=370

 Score =   385 bits (988),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 225/381 (59%), Positives = 268/381 (70%), Gaps = 45/381 (12%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL+LDNCE ILLSLD+HKSVPAPFLTKTYQLVDDP+TDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALLLDNCESILLSLDTHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKT----  507
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEK+LLCEIHRRKT    
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKNLLCEIHRRKTHHQH  120

Query  508   AQPQVAVDHLHHHHP--MNEPSFFSAYNPGRLSVSPP-DSDEQLTANNNAWCDSPSFASS  678
              Q   A+++ HHHH   +N  S F  +N  RLSVSP  DSDE +  N   WCDSP    +
Sbjct  121   HQQVQAMNNHHHHHKFGLNVSSIFPFHN-NRLSVSPSHDSDEVIIPN---WCDSPPRGVA  176

Query  679   TVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKP  858
              V    N+      N  +V ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQNHVKP
Sbjct  177   GV----NNNNSSSNNYNTVTALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQNHVKP  232

Query  859   VTPS-SNSYPSPLITQKPLSQLVTYPHPHPPTKHQ--PVFNLSSPTKT------------  993
             V PS +N++PS L+     S +     P   T+ Q  P+ N+S+  +             
Sbjct  233   VAPSNNNNFPSFLLCSDN-SNINNNTSPQTQTQAQASPMSNVSTVQRQLKQFVGCYSNNT  291

Query  994   ---------SQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaH  1146
                      + SS+T+VE+   ++ C+TKLFG  LQSKKR+HP +Y   + ++  ++  +
Sbjct  292   KQARAVNSPTNSSITIVEEEANSNSCKTKLFGVSLQSKKRVHP-EYGSNNVLQ--SSETN  348

Query  1147  KARVLVLEKDD-LALHLMPPS  1206
             KAR L LE D+ L L+LMPPS
Sbjct  349   KAR-LALENDELLGLNLMPPS  368



>ref|XP_004291096.1| PREDICTED: heat stress transcription factor B-4-like [Fragaria 
vesca subsp. vesca]
Length=386

 Score =   380 bits (975),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 241/400 (60%), Positives = 266/400 (67%), Gaps = 67/400 (17%)
 Frame = +1

Query  160   MALMLDNC-EGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEF  336
             MALM+DNC EGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFVVWRPPEF
Sbjct  1     MALMIDNCGEGILLSLDSHKSVPAPFLTKTYQLVDDPVTDHIVSWGEDDTTFVVWRPPEF  60

Query  337   ARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP  516
             ARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQP
Sbjct  61    ARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQP  120

Query  517   -QVAVDH--------LHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSF  669
              Q+ ++H        L  HH +  P FF      R S SP DSD+        WCD    
Sbjct  121   TQLPINHHQYHPHSPLGSHHVVTGPGFFPF---PRGSNSPSDSDDFPN-----WCDDSPP  172

Query  670   ASSTVIsagnsgg-------gggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDI  828
                +   +G  GG              +V ALSEDN RLRRSN MLMSEL HMRKLYNDI
Sbjct  173   PLVSSPPSGCGGGPLNTGYCSNVATTTTVTALSEDNERLRRSNTMLMSELNHMRKLYNDI  232

Query  829   IYFVQNHVKPVTPSSNSYPSPLI-----------------TQKPLSQLVTYPHPHPPTK-  954
             IYFVQNHVKPV P SNSYP  L+                   KPL+Q+  Y H +P    
Sbjct  233   IYFVQNHVKPVAP-SNSYPGSLLLCNPTQNTLNPNNSSAAIHKPLNQVFGY-HNNPKQTQ  290

Query  955   --HQPV--------FNLSSPTKT-SQSSVTLVEDPPA-ADLCRTKLFGFP-LQSKKRLHP  1095
               HQP+         N+SSPT   S SSVT++ED P   + C+TKLFG P L SKKRLHP
Sbjct  291   PHHQPMAHVMMNNNVNVSSPTTAKSTSSVTIIEDRPGNNNGCKTKLFGVPLLHSKKRLHP  350

Query  1096  D--QYSPPSSMEaaaaaaHKARVLVLEKD-DLALHLMPPS  1206
             +    S  ++MEA      KAR L+LEKD DL LHLMPPS
Sbjct  351   EYNNGSNHTAMEAT-----KAR-LILEKDHDLGLHLMPPS  384



>gb|EYU36312.1| hypothetical protein MIMGU_mgv1a021807mg [Erythranthe guttata]
Length=388

 Score =   377 bits (967),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 240/402 (60%), Positives = 264/402 (66%), Gaps = 69/402 (17%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL LDNC+GI+LSLDS KSVPAPFLTKTYQLVDDPATDHIVSWGEDD TFVVWRPPEFA
Sbjct  1     MALTLDNCDGIMLSLDSQKSVPAPFLTKTYQLVDDPATDHIVSWGEDDATFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKT+QPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTSQPQ  120

Query  520   VAVDHLHHHHP--MNEPSFFSAY--NPGRL-SVSPPDSD------EQLTANNNAWCDSP-  663
             V+  + H HH       S+ S++   P R  S+SPPDS       +Q   NNN WCDSP 
Sbjct  121   VSHQNHHLHHHHFAGGQSYNSSFPNYPSRADSISPPDSSDEYIHHQQPINNNNNWCDSPP  180

Query  664   ------SFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYND  825
                       S V +   SGGGG  +  S+ ALSEDN RLRR+NNML+SELAHMRKLYND
Sbjct  181   PLSSPTGGGVSVVTNPNCSGGGGYSSAVSLTALSEDNERLRRNNNMLVSELAHMRKLYND  240

Query  826   IIYFVQNHVKPVTPSSNSYPSPL----------------------ITQKPLSQLV--TYP  933
             IIYFVQNHVKPV P SNSY S L                      I QKPL+QL+  TY 
Sbjct  241   IIYFVQNHVKPVAP-SNSYHSSLFLCNTSSSSPTTAAAAINGGSSILQKPLNQLIGSTYH  299

Query  934   HPHPPTKHQPVFN----------LSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPL-QSK  1080
             H H  T      N            S    S  S  +VED       RTKLFG PL  SK
Sbjct  300   HHHQQTAATTNPNKVTNNNNNGLFGSLNINSSPSSKIVED-------RTKLFGVPLISSK  352

Query  1081  KRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
             KRLHP+     SSM+      +K R LVLEKDDL  +LMPPS
Sbjct  353   KRLHPEF---KSSMD----TTNKTR-LVLEKDDLGFNLMPPS  386



>ref|XP_010059922.1| PREDICTED: heat stress transcription factor B-4-like [Eucalyptus 
grandis]
 gb|KCW66402.1| hypothetical protein EUGRSUZ_F00215 [Eucalyptus grandis]
Length=350

 Score =   375 bits (962),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 210/357 (59%), Positives = 263/357 (74%), Gaps = 20/357 (6%)
 Frame = +1

Query  160   MALMLDN-CEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEF  336
             MAL+L+N CEGILLSL+S KS+PAPFLTKTYQLVDDP TD+IVSWG+D+TTFVVWRPPEF
Sbjct  1     MALLLENSCEGILLSLESQKSIPAPFLTKTYQLVDDPTTDYIVSWGDDETTFVVWRPPEF  60

Query  337   ARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP  516
             ARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFF++GEKHLLCEIHRRK+ QP
Sbjct  61    ARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFRKGEKHLLCEIHRRKSPQP  120

Query  517   -QVAVDHLHHHHPMNEPSFFSAYNPGRLS-VSPPDSDEQLTANNNAWCDSPSFASSTVIs  690
              QV ++H +   P+     +  +  GR++ ++PP+SDE     ++   ++P+ +      
Sbjct  121   QQVPINHQYPPSPIGGCGSYFPFVGGRVNCIAPPESDELTWCESSPLINTPNVSVVDNFV  180

Query  691   agnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPS  870
             + N+G      +  VAAL++DN RLRRSN ML SELAHMRKLYNDIIYFVQNHVKPVTPS
Sbjct  181   SYNNGPSSSSPSSVVAALAKDNERLRRSNEMLTSELAHMRKLYNDIIYFVQNHVKPVTPS  240

Query  871   SNSYPSPLITQKPLSQLVTYPHPHPPTKH--QPVFNLS-SPTKTSQSSVTLVEDPPAADL  1041
             ++     +I+ +       +P  +   KH  Q   NL+ SPT TSQSSVT++++  A + 
Sbjct  241   NS-----IISNQAFGN---FPATNGHKKHVAQVGNNLADSPTNTSQSSVTILDEEDATNC  292

Query  1042  --CRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
                + KLFG PL+SKKRLHPD+Y+P    E      +KAR LVLE D+L L+LMPPS
Sbjct  293   SSSKMKLFGVPLRSKKRLHPDKYAPSKIAE---TNNNKAR-LVLENDELRLNLMPPS  345



>gb|KHN12792.1| Heat stress transcription factor B-4 [Glycine soja]
Length=374

 Score =   374 bits (961),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 223/386 (58%), Positives = 263/386 (68%), Gaps = 51/386 (13%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL+LDNCE ILLSLD+HKSVPAPFLTKTYQLV+DP+TDHIVSWGE DTTFVVWRPPEFA
Sbjct  1     MALLLDNCESILLSLDTHKSVPAPFLTKTYQLVEDPSTDHIVSWGEGDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKT----  507
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+G K+LLCEIHRRKT    
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGAKNLLCEIHRRKTPHQH  120

Query  508   -----AQPQVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPP-DSDEQLTANNNAWCDSPSF  669
                  A       + HH   +N P FF  +N  RLS+SPP DSDE +  N   WCDSP  
Sbjct  121   HQEVQAMNNHHHHYHHHQFGLNVPPFFPFHN-SRLSISPPHDSDELIIPN---WCDSPPR  176

Query  670   ASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
               ++V    N+      N  +V ALSEDN RLRRSNNMLMSE+ HM+KLYN IIYFVQNH
Sbjct  177   GVASV----NNNNNNNNNYNTVTALSEDNERLRRSNNMLMSEIEHMKKLYNGIIYFVQNH  232

Query  850   VKPVTPS-SNSYPSPLIT-----------------QKPLSQLVTYPHPHPP--------T  951
             VKPV PS +N++PS L+                    P+S + T      P        T
Sbjct  233   VKPVAPSNNNTFPSFLLCSNNINSNSNNNTSSQPQASPMSNVSTVQRQVKPFLGCYSNNT  292

Query  952   KHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaa  1131
             K     N SSPT    SS+T+VE+  +++ C+TKLFG  LQSKKR+HPD+Y     ++ +
Sbjct  293   KQARAVN-SSPT---NSSITIVEEEASSNSCKTKLFGVSLQSKKRVHPDEYGSNYILQ-S  347

Query  1132  aaaaHKARVLVLEKDD-LALHLMPPS  1206
             +   +KAR LVLE D+ L L+LMPPS
Sbjct  348   SQTNNKAR-LVLENDELLGLNLMPPS  372



>ref|XP_003550334.1| PREDICTED: heat stress transcription factor B-4-like [Glycine 
max]
Length=374

 Score =   372 bits (955),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 222/386 (58%), Positives = 262/386 (68%), Gaps = 51/386 (13%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL+LDNCE ILLSLD+HKSVPAPFLTKTYQLV+DP+TDHIVSWGE DTTFVVWRPPEFA
Sbjct  1     MALLLDNCESILLSLDTHKSVPAPFLTKTYQLVEDPSTDHIVSWGEGDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKT----  507
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+G K+LLCEIHRRKT    
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGAKNLLCEIHRRKTPHQH  120

Query  508   -----AQPQVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPP-DSDEQLTANNNAWCDSPSF  669
                  A       + HH   +N P FF  +N  RLS+SPP DSDE +  N   WCDSP  
Sbjct  121   HQEVQAMNNHHHHYHHHQFGLNVPPFFPFHN-SRLSISPPHDSDELIIPN---WCDSPPR  176

Query  670   ASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
               ++V    N+      N  +V ALSEDN RLRRSNNMLMSE+ HM+KLYN IIYFVQNH
Sbjct  177   GVASV----NNNNNNNNNYNTVTALSEDNERLRRSNNMLMSEIEHMKKLYNGIIYFVQNH  232

Query  850   VKPVTPS-SNSYPSPLITQ-----------------KPLSQLVTYPHP--------HPPT  951
             VKPV PS +N++PS L+                    P+S + T               T
Sbjct  233   VKPVAPSNNNTFPSFLLCSNNINSNSNNNTSSQPQASPMSNVSTVQRQVKQFLGCYSNNT  292

Query  952   KHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaa  1131
             K     N SSPT    SS+T+VE+  +++ C+TKLFG  LQSKKR+HPD+Y     ++ +
Sbjct  293   KQARAVN-SSPT---NSSITIVEEEASSNSCKTKLFGVSLQSKKRVHPDEYGSNYILQ-S  347

Query  1132  aaaaHKARVLVLEKDD-LALHLMPPS  1206
             +   +KAR LVLE D+ L L+LMPPS
Sbjct  348   SETNNKAR-LVLENDELLGLNLMPPS  372



>ref|XP_007160861.1| hypothetical protein PHAVU_001G022900g [Phaseolus vulgaris]
 gb|ESW32855.1| hypothetical protein PHAVU_001G022900g [Phaseolus vulgaris]
Length=339

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 215/359 (60%), Positives = 250/359 (70%), Gaps = 34/359 (9%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL+LDNC+ ILLSLD+HKSVPAPFLTKTYQLVDDP+TDHIVSWGED  TFVVWRPPEFA
Sbjct  1     MALLLDNCDSILLSLDTHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDHATFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEK LLCEIHRRKT Q  
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKQLLCEIHRRKTHQQH  120

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPP-DSDEQLTANNNAWCDSPSFASSTVIsag  696
                   HH   +N P FF  +N   L+VSPP DSDE        WCDSP  A +T     
Sbjct  121   HQQQVHHHQFGLNVPPFFPFHN--TLTVSPPHDSDELPN-----WCDSPPRAVTT-----  168

Query  697   nsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSN  876
              +      ++ +V ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQNHVKPV P SN
Sbjct  169   GNNIINNNSHNTVTALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQNHVKPVAP-SN  227

Query  877   SYPSPLIT---------QKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPP  1029
             +YPS L+             + Q V     +  TK     N  SPT    SS+T+VE+ P
Sbjct  228   TYPSLLLCSNNNNSHINNVSVKQFVGCYSNN--TKQARAVN--SPT---NSSITIVEEEP  280

Query  1030  AADLCRTKLFGFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
             +++ C+TKLFG  LQSKKR+HP+      S     +  +K+R++V   +   L+LMPPS
Sbjct  281   SSNSCKTKLFGVSLQSKKRVHPEY----GSNNLQTSETNKSRLVVENDEFFGLNLMPPS  335



>ref|XP_008220242.1| PREDICTED: heat stress transcription factor B-4 [Prunus mume]
Length=389

 Score =   371 bits (952),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 232/404 (57%), Positives = 260/404 (64%), Gaps = 70/404 (17%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALM+DNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDD TFVVWRPPEFA
Sbjct  1     MALMMDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDATFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP-  516
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTAQP 
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTAQPH  120

Query  517   QVAVDHL---------------HHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAW  651
             QV   H                 HHHP   P   S       S  PP+           W
Sbjct  121   QVGFSHHHHHHHHNPHSPLGINGHHHPSFFPFPSSGSISPSDSDEPPN-----------W  169

Query  652   CDS-----PSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKL  816
             CDS     PS          N+      NN SV  L+EDN RLRRSN++LMSELAHMRKL
Sbjct  170   CDSDSPPLPSPTGGINNHNNNNNNFMNINNASVTGLAEDNERLRRSNSVLMSELAHMRKL  229

Query  817   YNDIIYFVQNHVKPVTPSSNSYPSPLITQKP----------------LSQLVTYPHPHPP  948
             YNDIIYFVQNHVKPV P SNSYPS L+   P                 +QL+ Y +P P 
Sbjct  230   YNDIIYFVQNHVKPVAP-SNSYPSSLLLSNPPPNSMAPAATATKPSNFNQLLGY-YPAPA  287

Query  949   TKHQPVFNLSSPT-------------KTSQSSVTLVED--PPAADLCR-TKLFGFP-LQS  1077
             T  +   ++S+                +  SSVT++ED   P+++ C+ TKLFG P L S
Sbjct  288   TNAKQTPHMSTTIHHHVMNSSSPSNTTSKSSSVTILEDQQQPSSNGCKNTKLFGVPLLHS  347

Query  1078  KKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMPPSC  1209
             KKRLHP++Y   S+   +   A KAR L+LEKDDL LHLMPPS 
Sbjct  348   KKRLHPEEYG--SNHGTSMMEASKAR-LILEKDDLGLHLMPPSA  388



>emb|CBI19505.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   350 bits (897),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 206/349 (59%), Positives = 223/349 (64%), Gaps = 70/349 (20%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA
Sbjct  1     MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKT+QPQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTSQPQ  120

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagn  699
             V         PMN               SP   +E+L  +N                   
Sbjct  121   V---------PMNHHH---------HHHSPLGDNERLRRSN-------------------  143

Query  700   sgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNS  879
                                       ++LMSELAHMRKLYNDIIYFVQNHVKPV P SNS
Sbjct  144   --------------------------SILMSELAHMRKLYNDIIYFVQNHVKPVAP-SNS  176

Query  880   YPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLF  1059
             YPS L+   P S   T       +    V    + T TS  S   V +      CRTKLF
Sbjct  177   YPSSLVICNPPSSATTAAATITCSSTAMVQKPLNHTTTSSKSSLTVLEETNGSSCRTKLF  236

Query  1060  GFPLQSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
             G PLQSKKRLHP+  S  +SME      +KAR LVL+KDDL L+LMPPS
Sbjct  237   GVPLQSKKRLHPEYASTTTSME-----TNKAR-LVLDKDDLGLNLMPPS  279



>ref|XP_010675615.1| PREDICTED: heat stress transcription factor B-4-like [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 203/389 (52%), Positives = 251/389 (65%), Gaps = 60/389 (15%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL+LD+C+GI+LSLD+ KSVPAPFLTKTY LVDDP+TDH+VSWGEDD+TFVVWRPPEFA
Sbjct  1     MALLLDHCDGIILSLDTTKSVPAPFLTKTYHLVDDPSTDHVVSWGEDDSTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLP YFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLC+IHRRKT Q Q
Sbjct  61    RDLLPKYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCDIHRRKTGQHQ  120

Query  520   VA-------VDHLHHHHPMNEPSFFSAYNPG---RLSVSPPDSDEQLTANNNAWCDSPSF  669
                        HL+  HP    ++ +A  PG   R+S+SPP+SD   +A++   CD+ + 
Sbjct  121   QTNTHCSSNTTHLNFSHP-GANAYLAACFPGGGNRVSLSPPNSD---SADDYIECDNNNN  176

Query  670   A------------SSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRK  813
                           S+   + +          ++  LSEDN RLRRSN MLMSEL HMRK
Sbjct  177   NNNNNNIHHGNNLDSSSPLSSSPASSKCSYADALTTLSEDNERLRRSNTMLMSELTHMRK  236

Query  814   LYNDIIYFVQNHVK-----PVTPSSNSYPS-PLIT------QKP---LSQLVTYPHPHPP  948
             LYNDIIYFVQNHVK       TP++NSYPS PL+T      +KP   LSQ +        
Sbjct  237   LYNDIIYFVQNHVKPVTVTTTTPTNNSYPSPPLVTAVNSMPKKPALNLSQFI------KN  290

Query  949   TKHQPVFNLSSPTKTSQSSVTLVEDPPAA----DLCRTKLFGFPLQSKKRLHPDQYSPPS  1116
             +        ++ T T++ + + +ED  ++      C+T+LFG P+QSKKRLHPDQ     
Sbjct  291   SNFSTSDEFTTATATNKGNFSSLEDNESSTTTTTCCKTRLFGVPIQSKKRLHPDQ-----  345

Query  1117  SMEaaaaaaHKARVLVLEKDDLALHLMPP  1203
                      +KAR +    D L L+LMPP
Sbjct  346   ----TVEINYKARSMFGNHDRLGLNLMPP  370



>ref|XP_010479105.1| PREDICTED: heat stress transcription factor B-4-like [Camelina 
sativa]
Length=357

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 204/373 (55%), Positives = 237/373 (64%), Gaps = 49/373 (13%)
 Frame = +1

Query  160   MALMLDNC---------EGILLSLDSH-KSVPAPFLTKTYQLVDDPATDHIVSWGEDDTT  309
             MA+M++N          E I L ++   K+VPAPFLTKTYQLVDDPATDH+VSWG+DDTT
Sbjct  1     MAMMVENSYGGYGGGGGERIQLMVEGQGKAVPAPFLTKTYQLVDDPATDHVVSWGDDDTT  60

Query  310   FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCE  489
             FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCE
Sbjct  61    FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCE  120

Query  490   IHRRKTAQ--PQVAVDHLHHHH------PMNEPSFFSAYNPGRLSVSPPDSDEQLTANNN  645
             IHRRKT+Q  PQ     + HHH      P +  SFF    P R  V+ P+ D       +
Sbjct  121   IHRRKTSQMIPQQHSPFMTHHHHGPPQIPFSGGSFFPLPPPQR--VTTPEDD-------H  171

Query  646   AWCDSPSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYND  825
              WCDSP  +   VI    +          V ALSEDN RLRRSN +LMSELAHM+KLYND
Sbjct  172   YWCDSPP-SRPRVIIPQQTNNTIHDTAAQVTALSEDNERLRRSNTVLMSELAHMKKLYND  230

Query  826   IIYFVQNHVKPVTPSSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVF--NLSSPTKTSQ  999
             IIYFVQNHVKPV PS++   S L  Q+    L  Y                L+S   TSQ
Sbjct  231   IIYFVQNHVKPVAPSNSYLSSFLQKQQQPPTLDYYNTTATVNATTTNLHHGLNSSPPTSQ  290

Query  1000  SSVTLVEDPP------AADLCRTKLFGFPL-QSKKRLHPDQYSPPSSMEaaaaaaHKARV  1158
             SS+T++ED        + ++ +TKLFG  L  SKKR H   +S  SS         K R 
Sbjct  291   SSITVLEDDTNHHQDQSNNMRKTKLFGVSLPSSKKRSH--HFSDQSS---------KTR-  338

Query  1159  LVLEKDDLALHLM  1197
             LVL+K DLAL+LM
Sbjct  339   LVLDKSDLALNLM  351



>ref|XP_002891331.1| hypothetical protein ARALYDRAFT_473862 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67590.1| hypothetical protein ARALYDRAFT_473862 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   322 bits (824),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 204/376 (54%), Positives = 240/376 (64%), Gaps = 56/376 (15%)
 Frame = +1

Query  160   MALMLDNC---------EGILLSLDSH-KSVPAPFLTKTYQLVDDPATDHIVSWGEDDTT  309
             MA+M++N          E I L ++   K+VPAPFLTKTYQLVDDPATDH+VSWG+DDTT
Sbjct  1     MAMMVENSYGGYGGGNGERIQLMVEGQGKAVPAPFLTKTYQLVDDPATDHVVSWGDDDTT  60

Query  310   FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCE  489
             FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCE
Sbjct  61    FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCE  120

Query  490   IHRRKTAQ--PQVAVDHLHHHH-----PMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNA  648
             IHRRKT+Q  PQ     + HHH     P +  SFF    P    V+ P+ D       + 
Sbjct  121   IHRRKTSQMIPQQHSPFMSHHHAPPQIPFSGGSFF----PLPPHVTTPEED-------HY  169

Query  649   WCDSPSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDI  828
             WCDSP      +                V ALSEDN RLRRSN +LMSELAHM+KLYNDI
Sbjct  170   WCDSPPSRPRVI----PPQTTTIDTAAQVTALSEDNERLRRSNTVLMSELAHMKKLYNDI  225

Query  829   IYFVQNHVKPVTPSSNSYPSPLITQKPLSQLVTYPHPHPPTKHQP-VFNLSSPTKTSQSS  1005
             IYFVQNHVKPV PS+++Y S  + QK   Q  T  + +  T +   +  L+S   TSQSS
Sbjct  226   IYFVQNHVKPVAPSNSNYLSSFL-QKQQQQPPTLDYYNTATVNATNLHALNSSPPTSQSS  284

Query  1006  VTLVEDPP-----AADLCRTKLFGFPL-QSKKRLH--PDQYSPPSSMEaaaaaaHKARVL  1161
             +T++ED        +++ +TKLFG  L  SKKR H   DQ S             K R L
Sbjct  285   ITVLEDDTNHHHDQSNMRKTKLFGVSLPSSKKRSHHFSDQTS-------------KTR-L  330

Query  1162  VLEKDDLALHLMPPSC  1209
             VL+K DLAL+LM  S 
Sbjct  331   VLDKSDLALNLMTAST  346



>emb|CDY06765.1| BnaA10g05440D [Brassica napus]
Length=329

 Score =   317 bits (813),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 229/363 (63%), Gaps = 48/363 (13%)
 Frame = +1

Query  160   MALMLDNCEGI-------LLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVV  318
             MA ML+N  G        L+     K+VPAPFLTKTYQLVDDPATDH+VSWG+DDTTF+V
Sbjct  1     MAKMLENSYGYGNGERIQLMVEGQGKAVPAPFLTKTYQLVDDPATDHVVSWGDDDTTFIV  60

Query  319   WRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHR  498
             WRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCEIHR
Sbjct  61    WRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCEIHR  120

Query  499   RKTAQ--PQVAVDHLHHHHPMNEP-SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSF  669
             RKT+Q  P      + HH P   P S  +++ P      PP +D     +++ WC+SPS 
Sbjct  121   RKTSQMIPNQHSPFITHHPPPQIPFSGGASFFP-----LPPRADASAAMDDHYWCESPSP  175

Query  670   ASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
                 V             +  VA L+EDN RLRR+N +LMSELAHM+KLYNDIIYFVQNH
Sbjct  176   RPRVV---------PTTADAQVAVLTEDNERLRRTNTVLMSELAHMKKLYNDIIYFVQNH  226

Query  850   VKPVTPSSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDP-  1026
             VKPV P SNS+        P    + Y +      H P         TSQSS+TL+ED  
Sbjct  227   VKPVAP-SNSFLQKQQQPPPPPPPIDYYNNATVPNHSP--------PTSQSSITLLEDDT  277

Query  1027  -PAADLCRTKLFGFPL-QSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMP  1200
              P +   +TKLFG  L  SKKR H   +S  SS         K R LVL+K DL L+LM 
Sbjct  278   NPESITRKTKLFGVSLASSKKRSH--HFSDQSS---------KTR-LVLDKSDLGLNLMT  325

Query  1201  PSC  1209
              S 
Sbjct  326   AST  328



>ref|XP_009119797.1| PREDICTED: heat stress transcription factor B-4-like [Brassica 
rapa]
Length=329

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 229/363 (63%), Gaps = 48/363 (13%)
 Frame = +1

Query  160   MALMLDNCEGI-------LLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVV  318
             MA ML+N  G        L+     K+VPAPFLTKTYQLVDDPATDH+VSWG+DDTTF+V
Sbjct  1     MAKMLENSYGYGTGERIQLMVEGQGKAVPAPFLTKTYQLVDDPATDHVVSWGDDDTTFIV  60

Query  319   WRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHR  498
             WRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCEIHR
Sbjct  61    WRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCEIHR  120

Query  499   RKTAQ--PQVAVDHLHHHHPMNEP-SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSF  669
             RKT+Q  P      + HH P   P S  +++ P      PP +D     +++ WC+SPS 
Sbjct  121   RKTSQMIPNQHSPFITHHPPPQIPFSGGASFFP-----LPPRADASAAMDDHYWCESPSP  175

Query  670   ASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
                 V             +  VA L+EDN RLRR+N +LMSELAHM+KLYNDIIYFVQNH
Sbjct  176   RPRVV---------PTTADAQVAVLTEDNERLRRTNTVLMSELAHMKKLYNDIIYFVQNH  226

Query  850   VKPVTPSSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDP-  1026
             VKPV P SNS+        P    + Y +      H P         TSQSS+TL+ED  
Sbjct  227   VKPVAP-SNSFLQKQQQPPPPPPPIDYYNNATVPNHSP--------PTSQSSITLLEDDT  277

Query  1027  -PAADLCRTKLFGFPL-QSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMP  1200
              P +   +TKLFG  L  SKKR H   +S  SS         K R LVL+K DL L+LM 
Sbjct  278   NPESITRKTKLFGVSLASSKKRSH--HFSDQSS---------KTR-LVLDKSDLGLNLMT  325

Query  1201  PSC  1209
              S 
Sbjct  326   AST  328



>ref|NP_175142.1| heat stress transcription factor SCHIZORIZA [Arabidopsis thaliana]
 sp|Q9C635.1|HSFB4_ARATH RecName: Full=Heat stress transcription factor B-4; Short=AtHsfB4; 
AltName: Full=AtHsf-02 [Arabidopsis thaliana]
 gb|AAG50634.1|AC083835_19 heat shock transcription factor, putative [Arabidopsis thaliana]
 dbj|BAH30337.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32124.1| heat stress transcription factor SCHIZORIZA [Arabidopsis thaliana]
Length=348

 Score =   317 bits (812),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 204/377 (54%), Positives = 240/377 (64%), Gaps = 57/377 (15%)
 Frame = +1

Query  160   MALMLDNC---------EGILLSLDSH-KSVPAPFLTKTYQLVDDPATDHIVSWGEDDTT  309
             MA+M++N          E I L ++   K+VPAPFLTKTYQLVDDPATDH+VSWG+DDTT
Sbjct  1     MAMMVENSYGGYGGGGGERIQLMVEGQGKAVPAPFLTKTYQLVDDPATDHVVSWGDDDTT  60

Query  310   FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCE  489
             FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCE
Sbjct  61    FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCE  120

Query  490   IHRRKTAQ--PQVAVDHLHHHH-----PMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNA  648
             IHRRKT+Q  PQ     + HHH     P +  SFF    P    V+ P+ D       + 
Sbjct  121   IHRRKTSQMIPQQHSPFMSHHHAPPQIPFSGGSFFPLPPP---RVTTPEED-------HY  170

Query  649   WCDSPSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDI  828
             WCD    +   VI               V ALSEDN RLRRSN +LMSELAHM+KLYNDI
Sbjct  171   WCDDSPPSRPRVI------PQQIDTAAQVTALSEDNERLRRSNTVLMSELAHMKKLYNDI  224

Query  829   IYFVQNHVKPVTPSSN-SYPSPLITQKPLSQLVTYPHPHPPTKHQPVFN-LSSPTKTSQS  1002
             IYFVQNHVKPV PS+N SY S  + ++   Q  T  + +  T +    N L+S   TSQS
Sbjct  225   IYFVQNHVKPVAPSNNSSYLSSFLQKQQQQQPPTLDYYNTATVNATNLNALNSSPPTSQS  284

Query  1003  SVTLVEDP-----PAADLCRTKLFGFPL-QSKKRLH--PDQYSPPSSMEaaaaaaHKARV  1158
             S+T++ED        +++ +TKLFG  L  SKKR H   DQ S             K R 
Sbjct  285   SITVLEDDHTNHHDQSNMRKTKLFGVSLPSSKKRSHHFSDQTS-------------KTR-  330

Query  1159  LVLEKDDLALHLMPPSC  1209
             LVL++ DLAL+LM  S 
Sbjct  331   LVLDQSDLALNLMTAST  347



>ref|XP_010461505.1| PREDICTED: heat stress transcription factor B-4-like [Camelina 
sativa]
Length=361

 Score =   317 bits (811),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 207/384 (54%), Positives = 239/384 (62%), Gaps = 67/384 (17%)
 Frame = +1

Query  160   MALMLDNC---------EGILLSLDSH-KSVPAPFLTKTYQLVDDPATDHIVSWGEDDTT  309
             MA+M++N          E I L ++   K+VPAPFLTKTYQLVDDPATDH+VSWG+DDTT
Sbjct  1     MAMMVENSYGDYGGGGGERIQLMVEGQGKAVPAPFLTKTYQLVDDPATDHVVSWGDDDTT  60

Query  310   FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCE  489
             FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCE
Sbjct  61    FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCE  120

Query  490   IHRRKTAQ--PQVAVDHLHHHH------PMNEPSFFSAYNPGRLSVSPPDSDEQLTANNN  645
             IHRRKT+Q  PQ     + HHH      P +  SFF    P R  V+ P+ D       +
Sbjct  121   IHRRKTSQMIPQQHSPFMSHHHHGPPQIPFSGGSFFPLPPPPR--VTTPEDD-------H  171

Query  646   AWCDSPSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYND  825
              WCDSP  +   VI               V ALSEDN RLRRSN +LMSELAHM+KLYND
Sbjct  172   YWCDSPP-SRPRVIIPQQPNNTIHDTAAQVTALSEDNERLRRSNTVLMSELAHMKKLYND  230

Query  826   IIYFVQNHVKPVTPSSNSYPSPLITQKPLSQLVTYPHPHPPT-------------KHQPV  966
             IIYFVQNHVKPV P SNSY S  + ++   Q        PPT                  
Sbjct  231   IIYFVQNHVKPVAP-SNSYLSSFLQKQQQQQQQ------PPTLDYYYTTATVNATTTNLQ  283

Query  967   FNLSSPTKTSQSSVTLVEDPP------AADLCRTKLFGFPL-QSKKRLHPDQYSPPSSME  1125
               L+S   TSQSS+T++ED        + ++ +TKLFG  L  SKKR H   +S  SS  
Sbjct  284   HGLNSSPPTSQSSITVLEDDTNHHHDQSNNMRKTKLFGVSLPSSKKRSH--HFSDQSS--  339

Query  1126  aaaaaaHKARVLVLEKDDLALHLM  1197
                    K R LVL+K DLAL+LM
Sbjct  340   -------KTR-LVLDKSDLALNLM  355



>ref|XP_010500211.1| PREDICTED: heat stress transcription factor B-4 [Camelina sativa]
Length=361

 Score =   316 bits (810),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 205/378 (54%), Positives = 237/378 (63%), Gaps = 55/378 (15%)
 Frame = +1

Query  160   MALMLDNC---------EGILLSLDSH-KSVPAPFLTKTYQLVDDPATDHIVSWGEDDTT  309
             MA+M++N          E I L ++   K+VPAPFLTKTYQLVDDPATDH+VSWG+DDTT
Sbjct  1     MAMMVENSYGGYGGGGGERIQLMVEGQGKAVPAPFLTKTYQLVDDPATDHVVSWGDDDTT  60

Query  310   FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCE  489
             FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCE
Sbjct  61    FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCE  120

Query  490   IHRRKTAQ--PQVAVDHLHHHH-------PMNEPSFFSAYNPGRLSVSPPDSDEQLTANN  642
             IHRRKT+Q  PQ     + HHH       P +  SFF    P R  V+ P+ D       
Sbjct  121   IHRRKTSQMIPQQHSPFMSHHHHHGPPQIPFSGGSFFPLPPPPR--VTTPEDD-------  171

Query  643   NAWCDSPSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYN  822
             + WCDSP  +   VI               V ALSEDN RLRRSN +LMSELAHM+KLYN
Sbjct  172   HYWCDSPP-SRPRVIIPQQPNNTIHDTAAQVTALSEDNERLRRSNTVLMSELAHMKKLYN  230

Query  823   DIIYFVQNHVKPVTPSSNSYPSPLITQK------PLSQLVTYPHPHPPTKHQPVFNLSSP  984
             DIIYFVQNHVKPV P SNSY S  + ++      P             T       L+S 
Sbjct  231   DIIYFVQNHVKPVAP-SNSYLSSFLQKQQQQQQPPTLDYYNTTATVNATATNLQHGLNSS  289

Query  985   TKTSQSSVTLVED------PPAADLCRTKLFGFPL-QSKKRLHPDQYSPPSSMEaaaaaa  1143
               TSQSS+T++ED        + ++ +TKLFG  L  SKKR H   +S  SS        
Sbjct  290   PPTSQSSITVLEDNTNHHHDQSNNVRKTKLFGVSLPSSKKRSH--HFSDQSS--------  339

Query  1144  HKARVLVLEKDDLALHLM  1197
              K R LVL+K DLAL+LM
Sbjct  340   -KTR-LVLDKSDLALNLM  355



>ref|XP_006305155.1| hypothetical protein CARUB_v10009522mg, partial [Capsella rubella]
 gb|EOA38053.1| hypothetical protein CARUB_v10009522mg, partial [Capsella rubella]
Length=363

 Score =   313 bits (803),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 203/373 (54%), Positives = 236/373 (63%), Gaps = 53/373 (14%)
 Frame = +1

Query  160   MALMLDNC---------EGILLSLDSH-KSVPAPFLTKTYQLVDDPATDHIVSWGEDDTT  309
             MA+M++N          E I L ++   K+VPAPFLTKTYQLVDDPATDH+VSWG+DDTT
Sbjct  15    MAMMVENSYGGYGGGGGERIQLMVEGQGKAVPAPFLTKTYQLVDDPATDHVVSWGDDDTT  74

Query  310   FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCE  489
             FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCE
Sbjct  75    FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCE  134

Query  490   IHRRKTAQ--PQVAVDHLHHHH--------PMNEPSFFSAYNPGRLSVSPPDSDEQLTAN  639
             IHRRKT+Q  PQ     + HHH        P +  SFF    P    V+ P+ D      
Sbjct  135   IHRRKTSQMIPQQHSPFMSHHHGHHAPPQVPFSGGSFF----PLPPRVTTPEED------  184

Query  640   NNAWCDSPSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLY  819
              + WCD    +   VI               V ALSEDN RLRRSN +LMSELAHM+KLY
Sbjct  185   -HYWCDDSPPSRPRVI---PQHNNIDTTAAQVTALSEDNERLRRSNTVLMSELAHMKKLY  240

Query  820   NDIIYFVQNHVKPVTPSSNSYPSPLITQKP--LSQLVTYPHPHPPTKHQPVFNLSSPTKT  993
             NDIIYFVQNHVKPV PS++   S L  Q+P  L    T    +  T +     L+S   T
Sbjct  241   NDIIYFVQNHVKPVAPSNSYLSSFLQKQQPPTLDYYNTATTVNATTNNNLNHGLNSSPPT  300

Query  994   SQSSVTLVEDPP----AADLCRTKLFGFPL-QSKKRLHPDQYSPPSSMEaaaaaaHKARV  1158
             SQSS+T++ED        ++ +TKLFG  L  SKKR H   +S  SS         K R 
Sbjct  301   SQSSITVLEDDTNNHDQRNMRKTKLFGVSLPSSKKRSH--HFSDQSS---------KTR-  348

Query  1159  LVLEKDDLALHLM  1197
             LVL+K DLAL+LM
Sbjct  349   LVLDKSDLALNLM  361



>ref|XP_006393631.1| hypothetical protein EUTSA_v10012033mg [Eutrema salsugineum]
 gb|ESQ30917.1| hypothetical protein EUTSA_v10012033mg [Eutrema salsugineum]
Length=343

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 232/363 (64%), Gaps = 42/363 (12%)
 Frame = +1

Query  160   MALMLDNC----------EGILLSLDSH-KSVPAPFLTKTYQLVDDPATDHIVSWGEDDT  306
             MA+M++N           E I L ++   K+VPAPFLTKTYQLVDDPATDH+VSWG+DDT
Sbjct  1     MAMMVENSYGYGGGGGTGERIQLMVEGQGKAVPAPFLTKTYQLVDDPATDHVVSWGDDDT  60

Query  307   TFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLC  486
             TF+VWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLC
Sbjct  61    TFIVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLC  120

Query  487   EIHRRKTAQ--PQVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDS  660
             EIHRRKT+Q  P      + HH P   P  FS+      ++ P D    +  +++ WCDS
Sbjct  121   EIHRRKTSQMIPNQHSPFITHHPPPQNP--FSSGGASFFTLPPRDVSAAM--DDHYWCDS  176

Query  661   PSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFV  840
                     +            +  V AL+EDN RLRRSN +LMSELAHM+KLYNDIIYFV
Sbjct  177   SPPPRPRSV--------PTTVDAQVTALTEDNERLRRSNTVLMSELAHMKKLYNDIIYFV  228

Query  841   QNHVKPVTPSSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVE  1020
             QNHVKPV P SNSY S  + ++    L   P  +      P  N  +   TSQSS+T++E
Sbjct  229   QNHVKPVAP-SNSYLSSFLQKQQQPPLPPQPLDYYNNATVPNLNALNSPPTSQSSITVLE  287

Query  1021  DPP---AADLCRTKLFGFPL-QSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLAL  1188
             D      ++  +TKLFG  L  SKKR H   +S  SS         K R LVL+K DL L
Sbjct  288   DETNNHESNTRKTKLFGVSLPSSKKRSH--HFSDQSS---------KTR-LVLDKSDLGL  335

Query  1189  HLM  1197
             +LM
Sbjct  336   NLM  338



>ref|XP_006829889.1| hypothetical protein AMTR_s00073p00033500 [Amborella trichopoda]
 gb|ERM97305.1| hypothetical protein AMTR_s00073p00033500 [Amborella trichopoda]
Length=341

 Score =   310 bits (794),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 193/356 (54%), Positives = 236/356 (66%), Gaps = 45/356 (13%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             M ++++NCEGI+LS++SHKSVPAPFLTKTYQLVDDP+TDHIVSWGED +TFVVWRPPEFA
Sbjct  1     MDILVENCEGIMLSVESHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDHSTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANE+F++GEK LLCEIHRRKT    
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEYFRKGEKQLLCEIHRRKTP---  117

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPP--DSDEQLTANNNAWCDSPSFASSTVIsa  693
                     HHP   P     + P  ++   P  DSD++       WCDS S +SS     
Sbjct  118   --------HHP---PQALLPFAPRLMAPPSPFMDSDDR-----GMWCDSTSESSSPS---  158

Query  694   gnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSS  873
                        G+V+ALSEDN RLRRSN+ML+SELA+MRKLYNDIIYFVQNHV PV PS+
Sbjct  159   ---PPLLSNGAGTVSALSEDNERLRRSNSMLLSELAYMRKLYNDIIYFVQNHVVPVAPSN  215

Query  874   NSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTK  1053
              S    +     L+ +           H+   + ++   TS SSVT+VE+       + +
Sbjct  216   ASSSRLIEPSSSLTHVNARAGFTLLGSHR--CHTNNTCSTSGSSVTVVEE------SKPR  267

Query  1054  LFGFPLQSKKRLHPDQYSPP--SSMEaaaaaaHK-ARVLV------LEKDDLALHL  1194
             LFG PLQ+ KR HPD  SP   ++  +  A  HK AR LV       ++DDLAL+L
Sbjct  268   LFGVPLQANKRPHPDP-SPDDVATCASTTAPPHKWARGLVETVSVLSKEDDLALNL  322



>emb|CDY17098.1| BnaC06g00310D [Brassica napus]
Length=330

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 199/373 (53%), Positives = 231/373 (62%), Gaps = 67/373 (18%)
 Frame = +1

Query  160   MALMLDNCEGI----------LLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTT  309
             MA ML+N  G           L+     K+VPAPFLTKTYQLV+DPATDH+VSWG+DDTT
Sbjct  1     MATMLENSYGYDNGGTGERIQLMVEGQGKAVPAPFLTKTYQLVEDPATDHVVSWGDDDTT  60

Query  310   FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCE  489
             F+VWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFF+RGEKHLLCE
Sbjct  61    FIVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFRRGEKHLLCE  120

Query  490   IHRRKTAQ--PQVAVDHLHHHHPMNEP-SFFSAYNPGRLSVSPPDSDEQLTA-NNNAWCD  657
             IHRRKT+Q  P      + HH P   P S  +++ P      PP  D    A +++ WC+
Sbjct  121   IHRRKTSQMIPNQHSPFITHHPPPQIPFSGGASFFP-----LPPRVDAATAAMDDHYWCE  175

Query  658   SPSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYF  837
             SPS     V             +  VA L+EDN RLRR+N +LMSELAHM+KLYNDIIYF
Sbjct  176   SPSPRPRLV---------PTTLDPQVAVLTEDNERLRRTNTVLMSELAHMKKLYNDIIYF  226

Query  838   VQNHVKPVTPSSNSY------PSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQ  999
             VQNHVKPV P SNS+      P PLI         T P+  PP              TSQ
Sbjct  227   VQNHVKPVAP-SNSFLQKQQQPPPLID---YYNNATVPNHSPP--------------TSQ  268

Query  1000  SSVTLVEDPPAAD--LCRTKLFGFPL-QSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLE  1170
             SS+TL+ED    +    +TKLFG  L  SKKR H   +S  SS         K R LVL+
Sbjct  269   SSITLLEDDTNHESFTRKTKLFGVSLASSKKRSH--HFSDQSS---------KTR-LVLD  316

Query  1171  KDDLALHLMPPSC  1209
             K DL L+LM  S 
Sbjct  317   KSDLGLNLMTAST  329



>ref|XP_009107442.1| PREDICTED: heat stress transcription factor B-4 [Brassica rapa]
 emb|CDY17047.1| BnaA08g04110D [Brassica napus]
Length=335

 Score =   302 bits (774),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 193/371 (52%), Positives = 229/371 (62%), Gaps = 58/371 (16%)
 Frame = +1

Query  160   MALMLDNC---------EGILLSLDSH-KSVPAPFLTKTYQLVDDPATDHIVSWGEDDTT  309
             MA+M++N          E I L ++   K+VPAPFLTKTYQLVDDPATDH+VSWG+DDTT
Sbjct  1     MAMMVENSYGYGSGGTGERIQLMVEGQGKAVPAPFLTKTYQLVDDPATDHVVSWGDDDTT  60

Query  310   FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCE  489
             F+VWRPPEFARDLLP YFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCE
Sbjct  61    FIVWRPPEFARDLLPKYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCE  120

Query  490   IHRRKTAQ--PQVAVDHLHHHHPMNEP-----SFFSAYNPGRLSVSPPDSDEQLTANNNA  648
             IHRRKT+Q  P      + HH P   P     SFF    P R+  +    DE+       
Sbjct  121   IHRRKTSQMIPNQHSPFITHHPPPQIPFSGGASFFPL--PPRVDAAAASMDERY------  172

Query  649   WCDSPSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDI  828
             WC+SP      +             +  V AL+EDN RLRRSN +LMSELAHM+KLYNDI
Sbjct  173   WCESPPPRPRAI---------PTTVDAQVTALTEDNERLRRSNTVLMSELAHMKKLYNDI  223

Query  829   IYFVQNHVKPVTPSSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSV  1008
             IYFVQNHVKPV PS++  PS L  Q+     + Y +      H P         TSQSS+
Sbjct  224   IYFVQNHVKPVAPSNSYLPSFLQKQQQPPPPLDYYNNATVPNHSP--------PTSQSSI  275

Query  1009  TLVEDP---PAADLCRTKLFGFPLQS-KKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKD  1176
             +++E+       +  +TKLFG  L S KKR H   +S  SS         K R LVL+  
Sbjct  276   SVLENETNYKENNTRKTKLFGVSLPSTKKRSH--HFSHQSS---------KTR-LVLDNS  323

Query  1177  DLALHLMPPSC  1209
             DL L+LM  S 
Sbjct  324   DLGLNLMTAST  334



>emb|CDY40844.1| BnaC08g04780D [Brassica napus]
Length=335

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 190/367 (52%), Positives = 227/367 (62%), Gaps = 58/367 (16%)
 Frame = +1

Query  160   MALMLDNC---------EGILLSLDSH-KSVPAPFLTKTYQLVDDPATDHIVSWGEDDTT  309
             MA+M++N          E I   ++   K+VPAPFLTKTYQLVDDPATDH+VSWG+DDTT
Sbjct  1     MAMMVENSYGYGSGGTGERIQFMVEGQGKAVPAPFLTKTYQLVDDPATDHVVSWGDDDTT  60

Query  310   FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCE  489
             F+VWRPPEFARDLLP YFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCE
Sbjct  61    FIVWRPPEFARDLLPKYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCE  120

Query  490   IHRRKTAQ--PQVAVDHLHHHHPMNEP-----SFFSAYNPGRLSVSPPDSDEQLTANNNA  648
             IHRRKT+Q  P      + H  P   P     SFF    P R+  +    D++       
Sbjct  121   IHRRKTSQMIPNQHSPFITHRPPPQIPFSDGTSFFPL--PPRVDAAAASIDDRY------  172

Query  649   WCDSPSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDI  828
             WC+SP      +             +  V AL+EDN RLRRSN +LMSELAHM+KLYNDI
Sbjct  173   WCESPPPRPRAI---------PTTVDAQVTALTEDNERLRRSNTVLMSELAHMKKLYNDI  223

Query  829   IYFVQNHVKPVTPSSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSV  1008
             IYFVQNHVKPV PS++  PS L  Q+     + Y +      H P         TSQSS+
Sbjct  224   IYFVQNHVKPVAPSNSYLPSFLQKQQQPPPPLDYYNNATVPNHSP--------PTSQSSI  275

Query  1009  TLVEDP---PAADLCRTKLFGFPL-QSKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKD  1176
             +++E+       +  +TKLFG  L  SKKRLH   +S  SS         K R LVL+  
Sbjct  276   SVLENETNYKENNTRKTKLFGVSLPSSKKRLH--HFSHQSS---------KTR-LVLDNS  323

Query  1177  DLALHLM  1197
             DL L+LM
Sbjct  324   DLGLNLM  330



>ref|XP_010530513.1| PREDICTED: heat stress transcription factor B-4-like [Tarenaya 
hassleriana]
Length=374

 Score =   299 bits (766),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 194/386 (50%), Positives = 232/386 (60%), Gaps = 54/386 (14%)
 Frame = +1

Query  160   MALMLDNCEG-----ILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWR  324
             M +M+++  G     +    ++ K+VPAPFLTKTYQLVDDP TD IVSWG+DD+TFVVWR
Sbjct  1     MMMMMESYGGEERMVLTAETEAGKAVPAPFLTKTYQLVDDPTTDQIVSWGDDDSTFVVWR  60

Query  325   PPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK  504
             PPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCEIHRRK
Sbjct  61    PPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCEIHRRK  120

Query  505   TAQPQVAVDHLHHHHP------MNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCD---  657
             TAQ         HHH          PSFF  + P R+++S    D  L+     WCD   
Sbjct  121   TAQSPPPSQPPFHHHQSAPIPFAGGPSFF-PFQP-RVTLSTAADDVDLSG--AYWCDPPP  176

Query  658   SPSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYF  837
                    ++  +G++       +  V AL+EDN RLRRSN +LMSELAHM+KLYNDIIYF
Sbjct  177   PRHHHHHSITRSGDNSSAAAAYDRKVTALTEDNERLRRSNRLLMSELAHMKKLYNDIIYF  236

Query  838   VQNHVKPVTPSSNSYPSPLIT--QKPLS-QLVTYPHPHPPTK-----HQPVFNLSSPTKT  993
             VQNHVKP TP SN  PS L+   QKP S + + Y       K     H    + S  + T
Sbjct  237   VQNHVKPATP-SNPCPSSLLMKHQKPSSNESIDYYKTSTSRKNNLNIHVMNSSSSPTSNT  295

Query  994   SQSSVTLVEDPPAAD---------------LC-RTKLFG--FPLQSKKRLHPDQYSPPSS  1119
             SQSS+T ++D    +                C RTKLFG   PL  K+    D      +
Sbjct  296   SQSSITAIDDSNNGNESDNDKNNGEIRHESTCRRTKLFGVSIPLMKKRSHQSDHLRVDQT  355

Query  1120  MEaaaaaaHKARVLVLEKDDLALHLM  1197
                      K+R LVLEK DL L+LM
Sbjct  356   --------RKSR-LVLEKSDLGLNLM  372



>gb|KFK44645.1| hypothetical protein AALP_AA1G285500 [Arabis alpina]
Length=331

 Score =   297 bits (761),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 223/358 (62%), Gaps = 62/358 (17%)
 Frame = +1

Query  184   EGILLSLDSH-KSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNY  360
             E I L ++   K+VPAPFLTKTYQLVDDP TDH+VSWG+DDTTF+VWRPPEFARDLLPNY
Sbjct  17    ERIQLMVEGQGKAVPAPFLTKTYQLVDDPETDHVVSWGDDDTTFIVWRPPEFARDLLPNY  76

Query  361   FKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLH  540
             FKHNNFSSFVRQLNTYGFRK+VPDRWEFANE+FKRGEKHLLCEIHRRKT Q    +    
Sbjct  77    FKHNNFSSFVRQLNTYGFRKIVPDRWEFANEYFKRGEKHLLCEIHRRKTCQ---MIQQQQ  133

Query  541   HHHPMNEPSF---FSAYNPGRLSVSPPDSDEQLTANNNAWCD-------SPSFASSTVIs  690
              H P   P     FSA++          SD     +++ WCD        P  A+ T + 
Sbjct  134   QHSPFITPPHIHPFSAFSLPPPPPRLSPSD---VMDDHYWCDDSPPSRLQPPRATPTTV-  189

Query  691   agnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPS  870
                        +  + AL+EDN RLRRSN +LMSELAHM+KLYNDIIYFVQNHVKPV   
Sbjct  190   -----------DAQLIALTEDNERLRRSNTVLMSELAHMKKLYNDIIYFVQNHVKPVA--  236

Query  871   SNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLC--  1044
                  +P   QK   Q + Y +  P T       L+SP  TSQSS+T++ED         
Sbjct  237   -----APSYFQKQQQQPLDYYNTAPVT-------LNSP-PTSQSSITVLEDDNFDQSYLG  283

Query  1045  ---RTKLFGFPLQ-SKKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHLMPPS  1206
                +TKLFG  LQ SKKR H   +S  SS         K R LVL+K DLAL+LM  S
Sbjct  284   FGRKTKLFGVSLQSSKKRSH--HFSDQSS---------KTR-LVLDKSDLALNLMTAS  329



>emb|CAA87079.1| heat shock transcription factor 31 [Glycine max]
Length=306

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 219/324 (68%), Gaps = 52/324 (16%)
 Frame = +1

Query  331   EFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTA  510
             EFAR+LLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFK+GEKHLLCEIHRRKTA
Sbjct  1     EFARNLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKKGEKHLLCEIHRRKTA  60

Query  511   QPQVAVDHLHHHHP-------MNEPSFFSAYNPGRLSVSPP-DSDEQLTANNNAWCDSPS  666
             QPQ  + + HHHH        +N P+FF      R+S+S   DSD+Q     + WCDSP 
Sbjct  61    QPQQGIMNHHHHHAHSPLGVNVNVPTFFPF--SSRVSISTSNDSDDQ-----SNWCDSPP  113

Query  667   FASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQN  846
               +++++    +G      N SV ALSEDN RLRRSNNMLMSELAHM+KLYNDIIYFVQN
Sbjct  114   RGATSLV----NGAAAANYNTSVTALSEDNERLRRSNNMLMSELAHMKKLYNDIIYFVQN  169

Query  847   HVKPVTPSS-----------------NSYPSPLITQKPLSQLVTYPHPHPPTKHQPV---  966
             HVKPV PS+                 +S  +  + Q+P++QL+ Y   +P      +   
Sbjct  170   HVKPVAPSNSYSSSLLLCNTPSATPISSANNVSMMQRPMNQLLGYYSTNPKQGATQITQP  229

Query  967   --FNLSSPTKTSQSSVTLVEDPPAADL--CRTKLFGFPLQSKKRLHPDQYSPPSSMEaaa  1134
               + ++SPT TS+SS+T+ E P ++++  C+TKLFG  LQSKKR+HPD  S P +     
Sbjct  230   QTYVVNSPTNTSRSSITIFEGPASSNINSCKTKLFGVSLQSKKRVHPDCGSNPET-----  284

Query  1135  aaaHKARVLVLEKDDLALHLMPPS  1206
                ++AR LVLEKDDL L+LMPPS
Sbjct  285   ---NRAR-LVLEKDDLGLNLMPPS  304



>ref|XP_010246178.1| PREDICTED: heat stress transcription factor B-4b-like [Nelumbo 
nucifera]
Length=275

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 164/322 (51%), Positives = 193/322 (60%), Gaps = 49/322 (15%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             M  M++ CE ++LS+D HK+VPAPFLTKTYQLVDDP TDHIVSWGED+TTFVVWRPPEFA
Sbjct  1     MLFMVERCEEMVLSVDYHKAVPAPFLTKTYQLVDDPRTDHIVSWGEDETTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGF+K+V DRWEFANEFF++GEKHLL EIHRRKT+Q  
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFKKIVADRWEFANEFFRKGEKHLLSEIHRRKTSQSS  120

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagn  699
                   +              +P    ++P +        N  W +      S       
Sbjct  121   QQHQQHN-------------IDPTTQFLNPDE--------NGGWIEPAPLPPSN------  153

Query  700   sgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNS  879
                     +  ++ L+EDN RLR+ N ML+SEL HM+KLYNDIIYF+QNHVKPV P   S
Sbjct  154   ------RESDFLSVLTEDNQRLRKRNFMLLSELTHMKKLYNDIIYFLQNHVKPVAPDQRS  207

Query  880   YPS--PLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTK  1053
               S   LI   P  Q  T             F       TS  SVTL E+P        K
Sbjct  208   TSSGPKLIEIAPSFQSQTLLS----------FQTFKTCGTSSCSVTLTEEPNNT----VK  253

Query  1054  LFGFPLQSKKRLHPDQYSPPSS  1119
             LFG  L  KKRLHP++  P  S
Sbjct  254   LFGVSLSGKKRLHPEKIDPEES  275



>ref|XP_002298460.1| hypothetical protein POPTR_0001s28040g [Populus trichocarpa]
 gb|EEE83265.1| hypothetical protein POPTR_0001s28040g [Populus trichocarpa]
Length=270

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 163/317 (51%), Positives = 195/317 (62%), Gaps = 54/317 (17%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA  +D CE ++ +++S K+VPAPFLTKTYQLVDDP TDHIVSWG+D+T+FVVWRPPEF+
Sbjct  1     MAFTVDRCEEMVFTVESQKAVPAPFLTKTYQLVDDPLTDHIVSWGDDETSFVVWRPPEFS  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGF+KVV DRWEFANE+F++G KHLL EIHRRKT+Q  
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFKKVVADRWEFANEYFRKGAKHLLSEIHRRKTSQ--  118

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP--SFASSTVIsa  693
                 H H H+P   P FF           P D          +W D P  S  SST I  
Sbjct  119   ----HHHQHYPEQPPQFF----------QPEDG--------FSWIDPPFQSPKSSTDI--  154

Query  694   gnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSS  873
                          + ALSEDN RLRR N ML+SEL+HM+ LYNDIIYF+QNHVKP+    
Sbjct  155   -------------LTALSEDNQRLRRKNCMLLSELSHMKNLYNDIIYFIQNHVKPMPYEQ  201

Query  874   NSYPSP--LITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCR  1047
              +Y +   LI      Q  T        K+  V    S T +++ S + V          
Sbjct  202   KAYNAAPKLIELGSSCQDQTICSSIQRAKNGTVLGQHSLTLSTEESTSPV----------  251

Query  1048  TKLFGFPLQSKKRLHPD  1098
              KLFG PL   KRLHP+
Sbjct  252   -KLFGVPLSGNKRLHPE  267



>ref|XP_010922077.1| PREDICTED: heat stress transcription factor B-4b-like [Elaeis 
guineensis]
Length=281

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 198/318 (62%), Gaps = 53/318 (17%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA +++ C  +++S+DSHK VPAPFLTKTYQLVDDP TDHIVSWGED+TTFVVWRPPEFA
Sbjct  1     MAFLVERCGEMMVSVDSHKPVPAPFLTKTYQLVDDPCTDHIVSWGEDETTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++GEKHLL EIHRRKT Q  
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGEKHLLSEIHRRKTPQVP  120

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagn  699
                 + H H+  + P F S           PD   ++T+    W + P    S       
Sbjct  121   HHYQYNHQHYHQSPPPFHS-----------PD---EMTS----WIEPPLTLRSG------  156

Query  700   sgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSS--  873
                    +   ++ALSEDN RLRR N++L+SEL HM+KLYNDII+F+QNHV P+ P    
Sbjct  157   -------DAEFLSALSEDNQRLRRKNSLLLSELTHMKKLYNDIIHFIQNHVTPIPPEQRL  209

Query  874   -NSYPSPLITQKPLSQLVTYPHPHPPTKHQPVF--NLSSPTKTSQSSVTLVEDPPAADLC  1044
              N  P  LI   P         P  P++ Q +F  N  S T   +S  T+          
Sbjct  210   LNPRPGRLIELAPDDD-----QPQSPSRLQKLFTKNRRSVTINGESDSTV----------  254

Query  1045  RTKLFGFPLQSKKRLHPD  1098
               KLFG  +  KKRLH +
Sbjct  255   --KLFGVSIHGKKRLHSE  270



>ref|XP_008794230.1| PREDICTED: heat stress transcription factor B-4b-like [Phoenix 
dactylifera]
Length=282

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 165/321 (51%), Positives = 205/321 (64%), Gaps = 52/321 (16%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA +++ C  +++S+DSHK VPAPFLTKTYQLVDDP TDHIVSWGED+TTFVVWRPPEFA
Sbjct  1     MAFLVERCGEMMVSVDSHKPVPAPFLTKTYQLVDDPCTDHIVSWGEDETTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++GEKHLL EIHRRKT  PQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGEKHLLSEIHRRKT--PQ  118

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPP--DSDEQLTANNNAWCDSPSFASSTVIsa  693
             V     HH+H          YN      SPP   S +++T+    W + PS    +    
Sbjct  119   VP----HHYH----------YNHQNYHQSPPPFHSPDEMTS---CWIE-PSLPLRS----  156

Query  694   gnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSS  873
                      +   ++ALSEDN RLRR N++L+SEL HM+KLY+DII+F+Q+HV PV P  
Sbjct  157   --------GDAEFLSALSEDNQRLRRKNSLLLSELTHMKKLYSDIIHFIQDHVAPVPPEQ  208

Query  874   ---NSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLC  1044
                +     LI   P  QL +      P+  Q  F        ++ SVT+ E+   ++  
Sbjct  209   RLVSPRSGRLIELAPDDQLKS------PSGLQNGFT------KNRCSVTITEE---SEYS  253

Query  1045  RTKLFGFPLQSKKRLHPDQYS  1107
               KLFG  +  KKRLH +  S
Sbjct  254   TVKLFGVSIHGKKRLHSETAS  274



>ref|XP_002265293.1| PREDICTED: heat stress transcription factor B-4b [Vitis vinifera]
 emb|CBI24273.3| unnamed protein product [Vitis vinifera]
Length=285

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 161/325 (50%), Positives = 193/325 (59%), Gaps = 55/325 (17%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA  +D CE ++ S++S K+VPAPFLTKTYQLVDDP TDHIVSWGED+TTFVVWRPPEFA
Sbjct  1     MAFTVDKCEEMVFSVESQKAVPAPFLTKTYQLVDDPHTDHIVSWGEDETTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGF+K+V DRWEFANE+F++G KH+L EIHRRKT    
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFKKIVADRWEFANEYFRKGGKHMLSEIHRRKTPHHH  120

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP---SFASSTVIs  690
                 H H       P F                  Q    N+ W DSP     ASS V+ 
Sbjct  121   HQPYHDH----HQPPQFL-----------------QPELENSVWIDSPLPSPTASSDVL-  158

Query  691   agnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT--  864
                             AL++DN RLRR N ML+SELAHM+ LYNDII+F+QNHVKPV   
Sbjct  159   ---------------TALTQDNHRLRRKNFMLLSELAHMKTLYNDIIFFIQNHVKPVAPY  203

Query  865   ---PSSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAA  1035
                P SN+ P  +     L        P+      P    S+       S++ + D    
Sbjct  204   DQRPKSNAAPKLIELDSSLQS------PNVSGMQTPKHRYSA----GNCSMSTLTDDQQT  253

Query  1036  DLCRTKLFGFPLQSKKRLHPDQYSP  1110
             +    KLFG PL  KKRLHP+++ P
Sbjct  254   NNGSFKLFGVPLSGKKRLHPEKFDP  278



>ref|XP_011024992.1| PREDICTED: heat stress transcription factor B-4-like [Populus 
euphratica]
Length=270

 Score =   277 bits (709),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 193/318 (61%), Gaps = 56/318 (18%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA  +D CE ++ +++S K+VPAPFLTKTYQLVDDP TDHIVSWG+D+T+FVVWRPPEF+
Sbjct  1     MAFTVDRCEEMVFTVESQKAVPAPFLTKTYQLVDDPLTDHIVSWGDDETSFVVWRPPEFS  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGF+KVV DRWEFANE F+RG KHLL EIHRRKT+Q  
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFKKVVADRWEFANENFRRGAKHLLSEIHRRKTSQ--  118

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFAS---STVIs  690
                 H H H+P   P FF           P D          +W D P F S   ST I 
Sbjct  119   ----HHHQHYPEQPPRFF----------QPEDG--------FSWID-PPFQSPKPSTDI-  154

Query  691   agnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPS  870
                           + ALSEDN RLRR N ML+SEL+HM+ LYNDIIYF+QNHVKP+   
Sbjct  155   --------------LTALSEDNQRLRRKNCMLLSELSHMKNLYNDIIYFIQNHVKPMPYE  200

Query  871   SNSYPSP--LITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLC  1044
               +Y +   LI      Q  T        K+  V    S T +++ S + V         
Sbjct  201   QKAYNAAPKLIELGSSCQDQTTCSSIQRAKNGTVLGQHSLTLSTEESTSPV---------  251

Query  1045  RTKLFGFPLQSKKRLHPD  1098
               KLFG PL   KRL P+
Sbjct  252   --KLFGVPLSGNKRLRPE  267



>ref|XP_007015249.1| Heat shock transcription factor B4 [Theobroma cacao]
 gb|EOY32868.1| Heat shock transcription factor B4 [Theobroma cacao]
Length=279

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 197/320 (62%), Gaps = 61/320 (19%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA  ++  E ++ S++S K+VPAPFL+KTYQLVDDP TDHIVSWGED+T+FVVWRPPEFA
Sbjct  1     MAFTVERSEELVFSVESQKAVPAPFLSKTYQLVDDPLTDHIVSWGEDETSFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLP+YFKHNNFSSFVRQLNTYGF+KVV DRWEFANE+F++G KHLL EIHRRKT Q  
Sbjct  61    RDLLPSYFKHNNFSSFVRQLNTYGFKKVVADRWEFANEYFRKGAKHLLSEIHRRKTPQ--  118

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPS---FASSTVIs  690
                +H  +HH   +  F          + P +           W +SPS    AS+ V+ 
Sbjct  119   ---NHQQYHHEQ-QTQF----------LKPEEG--------FGWIESPSPSPKASADVL-  155

Query  691   agnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPS  870
                             AL++DN RLRR N ML+SEL HM+ LYNDIIYF+QNHVKPV   
Sbjct  156   ---------------TALTQDNQRLRRKNYMLVSELTHMKNLYNDIIYFIQNHVKPVPYQ  200

Query  871   SNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTS---QSSVTLVEDPPAADL  1041
               +Y            L T      P+   P+ + +    +S   +SS+TL E+P     
Sbjct  201   QKAY-----------NLGTKIREFGPSFQDPIHSGNENATSSVLGKSSMTLTEEPNNT--  247

Query  1042  CRTKLFGFPLQSKKRLHPDQ  1101
                KLFG PL  +KRLHP++
Sbjct  248   --VKLFGVPLSGRKRLHPEK  265



>ref|XP_010541155.1| PREDICTED: heat stress transcription factor B-4-like [Tarenaya 
hassleriana]
Length=317

 Score =   278 bits (712),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 160/280 (57%), Positives = 188/280 (67%), Gaps = 35/280 (13%)
 Frame = +1

Query  148  VASIMALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRP  327
            +A++M +     E ++ + +  K+VPAPFLTKTYQLVDDP TDHIVSWG+DD+TFVVWRP
Sbjct  1    MATMMMMESYGGERVVETAEG-KAVPAPFLTKTYQLVDDPTTDHIVSWGDDDSTFVVWRP  59

Query  328  PEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKT  507
            PEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+VPDRWEFANEFFKRGEKHLLCEIHRRKT
Sbjct  60   PEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVPDRWEFANEFFKRGEKHLLCEIHRRKT  119

Query  508  AQPQVAVDHLHHHHP-----------MNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWC  654
            AQP          H             + P+FF           PP + + +      WC
Sbjct  120  AQPPPPQQQPPFPHHHHHHPPPPPLQFSGPTFFPF---------PPRAADDVDLVGAYWC  170

Query  655  DSPSFASSTVI-----sagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLY  819
            DSP       +       G++       +  V AL+EDN RLRRSN++LMSELAHM+KLY
Sbjct  171  DSPPQPRQPTVHHHISGGGDNAAAAAAYDRQVTALTEDNERLRRSNSVLMSELAHMKKLY  230

Query  820  NDIIYFVQNHVKPVTPSSNSYPSPLI--------TQKPLS  915
            NDIIYFVQNHVKPV+P SNS+PS L+         QKPLS
Sbjct  231  NDIIYFVQNHVKPVSP-SNSFPSSLLLDHHNLNPAQKPLS  269



>ref|XP_003556931.1| PREDICTED: heat stress transcription factor B-4-like [Glycine 
max]
 gb|KHN27366.1| Heat stress transcription factor B-4 [Glycine soja]
Length=271

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 193/316 (61%), Gaps = 52/316 (16%)
 Frame = +1

Query  160   MALMLDNCE-GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEF  336
             MA  LD  E  ++ +L+S KSVPAPFLTKTYQLVDDP TDHIVSWGED+TTFVVWRPPEF
Sbjct  1     MAFTLDRFEENMVFTLESQKSVPAPFLTKTYQLVDDPHTDHIVSWGEDETTFVVWRPPEF  60

Query  337   ARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP  516
             ARDLLPNYFKHNNFSSFVRQLNTYGF+KVV DRWEFANE+F++G KHLLCEIHRRK  Q 
Sbjct  61    ARDLLPNYFKHNNFSSFVRQLNTYGFKKVVADRWEFANEYFRKGAKHLLCEIHRRKAPQ-  119

Query  517   QVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDS--PSFASSTVIs  690
                      HH +     F   +P ++       DE L      W D+  PS   +T I 
Sbjct  120   --------QHHQL-----FHDQSPSQIF----QQDENL-----CWLDTPLPSPKPNTDI-  156

Query  691   agnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPS  870
                           + ALSEDN RLRR N ML+SEL+HM+ LYNDIIYF+QNHVKP  P 
Sbjct  157   --------------LTALSEDNQRLRRKNFMLLSELSHMKSLYNDIIYFIQNHVKP--PP  200

Query  871   SNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRT  1050
                  S +I       LV     H       V   +      +S +T  E+  ++     
Sbjct  201   FEQRSSSVI-----PNLVELDSLHESPNDMGVRRSAKSCVVDKSLITSTEESNSS----V  251

Query  1051  KLFGFPLQSKKRLHPD  1098
             KLFGFPL  +KRLHPD
Sbjct  252   KLFGFPLSGRKRLHPD  267



>ref|XP_007146140.1| hypothetical protein PHAVU_006G015700g [Phaseolus vulgaris]
 gb|ESW18134.1| hypothetical protein PHAVU_006G015700g [Phaseolus vulgaris]
Length=269

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 196/311 (63%), Gaps = 60/311 (19%)
 Frame = +1

Query  184   EGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYF  363
             E ++ S ++ KSVPAPFLTKTYQLV+DP TDHIVSWGEDDTTFVVWRPPEF+RDLLPNYF
Sbjct  10    ENMVFSFETQKSVPAPFLTKTYQLVEDPLTDHIVSWGEDDTTFVVWRPPEFSRDLLPNYF  69

Query  364   KHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHH  543
             KHNNFSSFVRQLNTYGF+KVV DRWEFANE+FK+G KHLLCEIHRRKT Q       LHH
Sbjct  70    KHNNFSSFVRQLNTYGFKKVVADRWEFANEYFKKGAKHLLCEIHRRKTPQ-------LHH  122

Query  544   HHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP--SFASSTVIsagnsggggg  717
                 ++P       P ++       DE L      W D+P  S  SST I          
Sbjct  123   QLYHDQP-------PSQI----LQQDESL-----CWLDTPLSSPKSSTDI----------  156

Query  718   ynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLI  897
                  + ALSEDN RLRR N ML+SEL+HM+ LYNDIIYF+QNHVK       + P    
Sbjct  157   -----LTALSEDNQRLRRKNFMLLSELSHMKSLYNDIIYFIQNHVK-------APPFEQR  204

Query  898   TQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTS----QSSVTLVEDPPAADLCRTKLFGF  1065
             T   + +LV +      + ++P+ N+S  T  S    +S  T  E+  ++     KLFG 
Sbjct  205   TSSAIQKLVEF-----DSLNEPINNISLRTSKSSFVDKSFFTSTEESDSS----VKLFGV  255

Query  1066  PLQSKKRLHPD  1098
              L  +KRLHPD
Sbjct  256   LLSGRKRLHPD  266



>gb|ACU21168.1| unknown [Glycine max]
Length=271

 Score =   274 bits (701),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 193/316 (61%), Gaps = 52/316 (16%)
 Frame = +1

Query  160   MALMLDNCE-GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEF  336
             MA  LD  E  ++ +L+S KSVPAPFLTKTYQLVDDP TDHIVSWGED+TTFVVWRPPEF
Sbjct  1     MAFTLDRFEENMVFTLESQKSVPAPFLTKTYQLVDDPHTDHIVSWGEDETTFVVWRPPEF  60

Query  337   ARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP  516
             ARDLLPNYFKHNNFSSFVRQLNTYGF+KVV DRWEFANE+F++G KHLLCEIHRRK  Q 
Sbjct  61    ARDLLPNYFKHNNFSSFVRQLNTYGFKKVVADRWEFANEYFRKGAKHLLCEIHRRKAPQ-  119

Query  517   QVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDS--PSFASSTVIs  690
                      HH +     F   +P ++       DE L      W D+  PS   +T I 
Sbjct  120   --------QHHQL-----FHDQSPSQIF----QQDENL-----CWLDTPLPSPKPNTDI-  156

Query  691   agnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPS  870
                           + ALSEDN RLRR N ML+SEL+HM+ LYNDIIYF+QNHVKP  P 
Sbjct  157   --------------LTALSEDNQRLRRKNFMLLSELSHMKSLYNDIIYFIQNHVKP--PP  200

Query  871   SNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRT  1050
                  S +I       LV     H       V   +      +S +T  E+  ++     
Sbjct  201   FEQRSSSVI-----PNLVELDLLHESPNDMGVRRSAKSCVVDKSLITSTEESNSS----V  251

Query  1051  KLFGFPLQSKKRLHPD  1098
             KLFGFPL  +KRLHPD
Sbjct  252   KLFGFPLSGRKRLHPD  267



>ref|XP_007141514.1| hypothetical protein PHAVU_008G202500g [Phaseolus vulgaris]
 gb|ESW13508.1| hypothetical protein PHAVU_008G202500g [Phaseolus vulgaris]
Length=269

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 161/313 (51%), Positives = 192/313 (61%), Gaps = 50/313 (16%)
 Frame = +1

Query  160   MALMLDNCE-GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEF  336
             MA  LD CE  ++ +++S KSVPAPFLTKTYQLVDDP TDHIVSWG+D+TTFVV RPPEF
Sbjct  1     MAFTLDRCEDSMVFTMESQKSVPAPFLTKTYQLVDDPCTDHIVSWGDDETTFVVRRPPEF  60

Query  337   ARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP  516
             ARDLLPNYFKHNNFSSFVRQLNTYGF+KV  DRWEFANE+F++G KHLLCEIHRRKT  P
Sbjct  61    ARDLLPNYFKHNNFSSFVRQLNTYGFKKVAADRWEFANEYFRKGSKHLLCEIHRRKT--P  118

Query  517   QVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsag  696
              +   H H H   ++PS           +  PD        N  W D+P   S       
Sbjct  119   HLYQQHYHMH---DQPS----------QLLQPDE-------NLCWIDTPPLPSPP-----  153

Query  697   nsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSN  876
                      N  +AALSEDN RLRR N ML+SEL HM+ LYNDIIYF+QNH+ P +    
Sbjct  154   --------GNDILAALSEDNQRLRRKNFMLLSELTHMKNLYNDIIYFIQNHISPASYEQR  205

Query  877   SYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKL  1056
             S  + L     L +L + P         P F   + +   + S+    D P + +   KL
Sbjct  206   SSSAIL----KLVELESSPQA-------PNFIRPAKSHIMEKSLVSSSDEPNSSV---KL  251

Query  1057  FGFPLQSKKRLHP  1095
             FG PL  KKRLHP
Sbjct  252   FGVPLCGKKRLHP  264



>ref|XP_010931521.1| PREDICTED: heat stress transcription factor B-4b-like [Elaeis 
guineensis]
Length=268

 Score =   271 bits (694),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 159/311 (51%), Positives = 194/311 (62%), Gaps = 51/311 (16%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA +++ C  +++S+DSHK VPAPFLTKTYQLVDDP TDHIVSWGED+TTFVVWRPPEFA
Sbjct  1     MAFLMERCGEMMVSVDSHKPVPAPFLTKTYQLVDDPCTDHIVSWGEDETTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++GEKHLL EIHRRK+  PQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGEKHLLSEIHRRKS--PQ  118

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagn  699
             V   +  H+H  + P F             PD          +W + P    S       
Sbjct  119   VPHHYHQHYHHRSPPPF-----------QGPD-------ETTSWIEPPLPLPSG------  154

Query  700   sgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNS  879
                    +   ++ALSEDN RL+R N++L+SEL HM+KLYNDIIYF+Q+HV PV P    
Sbjct  155   -------DAEFLSALSEDNQRLKRKNSLLLSELTHMKKLYNDIIYFIQSHVTPVPPDQR-  206

Query  880   YPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLF  1059
                 L+  +P S+L       P    + + N  S T T +S  T+            KLF
Sbjct  207   ----LVNPRP-SRLADDRLQTPSELQKALKNHFSATITGESDSTV------------KLF  249

Query  1060  GFPLQSKKRLH  1092
             G  +  KKRLH
Sbjct  250   GVSIHGKKRLH  260



>ref|XP_011036401.1| PREDICTED: heat stress transcription factor B-4b-like [Populus 
euphratica]
Length=271

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 154/317 (49%), Positives = 188/317 (59%), Gaps = 53/317 (17%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA  +D CE ++ +++S K+VPAPFLTKTYQLVDDP TDH+VSWG+D+TTFVVWRPPEFA
Sbjct  1     MAFTVDRCEEMVFTVESQKAVPAPFLTKTYQLVDDPLTDHVVSWGDDETTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             R+LLPNYFKHNNFSSFVRQLNTYGF+KVV DRWEFANE F++G K LL EIHRRKT+Q  
Sbjct  61    RELLPNYFKHNNFSSFVRQLNTYGFKKVVTDRWEFANEHFRKGAKQLLSEIHRRKTSQ--  118

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagn  699
                 H H H+P     F  + + G   + PP               SP      ++    
Sbjct  119   ----HQHQHYPDQATQFLQSEDHGFGWIDPP-------------FPSPKPCVDHIL----  157

Query  700   sgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNS  879
                          ALSEDN RLRR N ML+SEL+HM+ LYNDIIYF+QNHVKPV     +
Sbjct  158   ------------TALSEDNQRLRRKNCMLLSELSHMKNLYNDIIYFIQNHVKPVPYEQKA  205

Query  880   YPSPLITQKPLS----QLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCR  1047
             Y +     +P S    Q + +             +L+  T+ S S V             
Sbjct  206   YDTVPKLIEPGSSCQDQTICFGVQRAKNGVLGKHSLTFSTEESSSPV-------------  252

Query  1048  TKLFGFPLQSKKRLHPD  1098
              KLFG PL   KRLHP+
Sbjct  253   -KLFGVPLIDNKRLHPE  268



>ref|XP_010943094.1| PREDICTED: heat stress transcription factor B-4c-like [Elaeis 
guineensis]
Length=341

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 184/366 (50%), Positives = 225/366 (61%), Gaps = 49/366 (13%)
 Frame = +1

Query  172   LDNC--EGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDD-TTFVVWRPPEFAR  342
             ++ C   G   ++++HK+VPAPFLTKTYQLVDDP+TDHIVSWG+D  +TFVVWRPPEFAR
Sbjct  1     MERCWESGGGGAVEAHKAVPAPFLTKTYQLVDDPSTDHIVSWGDDRVSTFVVWRPPEFAR  60

Query  343   DLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQV  522
             DLLPNYFKHNNFSSFVRQLNTYGFRKVVP+RWEFANEFF++GEKHLLCEIHRRKT+    
Sbjct  61    DLLPNYFKHNNFSSFVRQLNTYGFRKVVPERWEFANEFFRKGEKHLLCEIHRRKTSNSAA  120

Query  523   AVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagns  702
                      P +    +  +      V PP            W DSPS     + + GN 
Sbjct  121   PSPSSPPLFPPHHLPLYHHFPDDHHLVGPPQ-----------WRDSPSPRLLALGNGGNG  169

Query  703   gggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSY  882
             GG       + AAL E+N RLRR+N  L+SEL+HMRKLYNDIIYFVQNHV+PV PSS + 
Sbjct  170   GGAPPPPPATAAALVEENERLRRNNAALLSELSHMRKLYNDIIYFVQNHVRPVAPSSAA-  228

Query  883   PSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDP-PAAD-------  1038
              S L+     + +    +PH     +   N    + TS SS+T+ E+P P  D       
Sbjct  229   -STLLLSATNAGVAGSFYPH----RKGGLNSGG-STTSSSSLTIAEEPSPPLDNNTNNNN  282

Query  1039  ----LCRTKLFGFPLQS------KKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLAL  1188
                   R KLFG PL        K+ LH D  + PS+         K R LVLE+DDL+L
Sbjct  283   GESSSSRPKLFGVPLSERSTSTHKRGLHLDAPTSPST---------KPR-LVLEEDDLSL  332

Query  1189  HLMPPS  1206
             +LMPPS
Sbjct  333   NLMPPS  338



>ref|XP_002314009.1| hypothetical protein POPTR_0009s07220g [Populus trichocarpa]
 gb|EEE87964.1| hypothetical protein POPTR_0009s07220g [Populus trichocarpa]
Length=272

 Score =   270 bits (689),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 187/323 (58%), Gaps = 64/323 (20%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA  +D CE ++ +++S K+VPAPFLTKTYQLVDDP TDH+VSWG+D+TTFVVWRPPEFA
Sbjct  1     MAFTVDRCEEMVFTVESQKAVPAPFLTKTYQLVDDPLTDHVVSWGDDETTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             R+LLPNYFKHNNFSSFVRQLNTYGF+KVV DRWEFANE+F++G K LL EIHRRKT    
Sbjct  61    RELLPNYFKHNNFSSFVRQLNTYGFKKVVTDRWEFANEYFRKGAKQLLSEIHRRKTIS--  118

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSP------PDSDEQLTANNNAWCDSPSFASST  681
                 H H H+P     F  + + G   + P      P+ D  LTA               
Sbjct  119   ---QHHHQHYPDQATQFLQSEDHGFGWIDPPFPSPKPNVDHILTA---------------  160

Query  682   VIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPV  861
                                 LSEDN +LRR N ML+SEL+HM+ LYNDIIYF+QNHVKPV
Sbjct  161   --------------------LSEDNQKLRRKNCMLLSELSHMKNLYNDIIYFIQNHVKPV  200

Query  862   TPSSNSYPSPLITQKPLS----QLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPP  1029
                  +Y +     +P S    Q + +             +L+  T+ S S V       
Sbjct  201   PNEQKAYNTVPKLIEPGSSCQDQTICFGVQRAKNGVLGKHSLTFSTEESSSPV-------  253

Query  1030  AADLCRTKLFGFPLQSKKRLHPD  1098
                    KLFG PL   KRLHP+
Sbjct  254   -------KLFGVPLIDNKRLHPE  269



>ref|XP_003545167.1| PREDICTED: heat stress transcription factor B-4b-like [Glycine 
max]
Length=270

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 156/314 (50%), Positives = 188/314 (60%), Gaps = 53/314 (17%)
 Frame = +1

Query  160   MALMLDNCE-GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEF  336
             MA  LD CE  ++ +++SHKSVPAPFLTKTYQLVDDP TDHIVSWG+D+TTFVV RPPEF
Sbjct  1     MAFTLDRCEDSMVFTMESHKSVPAPFLTKTYQLVDDPRTDHIVSWGDDETTFVVRRPPEF  60

Query  337   ARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP  516
             ARDLLPNYFKHNNFSSFVRQLNTYGF+KV  DRWEFANE+F++G KHLLCEIHRRKT   
Sbjct  61    ARDLLPNYFKHNNFSSFVRQLNTYGFKKVAADRWEFANEYFRKGAKHLLCEIHRRKTPHH  120

Query  517   QVAVDHLHHHHP-MNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsa  693
                  H+H   P + +P                         N  W D+P   S      
Sbjct  121   YQQHYHMHDQPPHLLQPE-----------------------ENMCWIDTPPLPSP-----  152

Query  694   gnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSS  873
                          + ALSEDN RLRR N ML+SEL HM+ LYNDIIYF+QNHV P +   
Sbjct  153   -------KPGTDILTALSEDNQRLRRKNLMLLSELTHMKNLYNDIIYFIQNHVSPASYDE  205

Query  874   NSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTK  1053
                 S ++    L +L + P+   P K          ++ ++ S+    D P + +   K
Sbjct  206   QRSRSAILK---LLELDSSPNVIRPAK----------SRITEKSLGTSSDEPNSSV---K  249

Query  1054  LFGFPLQSKKRLHP  1095
             LFG PL  KKRLHP
Sbjct  250   LFGVPLCGKKRLHP  263



>ref|XP_008786852.1| PREDICTED: heat stress transcription factor B-4b-like [Phoenix 
dactylifera]
Length=279

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 194/316 (61%), Gaps = 55/316 (17%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA ++  C  +++S+DSHK VPAPFLTKTYQLVDDP TDHIVSWGE++TTFVVWRPPEFA
Sbjct  1     MAFLMGRCGEMMVSVDSHKPVPAPFLTKTYQLVDDPCTDHIVSWGEEETTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++GEKHLL EIHRRK+  PQ
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGEKHLLTEIHRRKS--PQ  118

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPP--DSDEQLTANNNAWCDSPSFASSTVIsa  693
             V   + H+H   +E              SPP     +++T+    W + P    S     
Sbjct  119   VPHHYHHNHQHYHE--------------SPPPFQGPDEMTS----WIEPPLPLPSG----  156

Query  694   gnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSS  873
                      +   ++ALSEDN RLRR N++L+SEL+HM+KLYNDIIYF+QNHV    P  
Sbjct  157   ---------DAEFLSALSEDNQRLRRKNSLLLSELSHMKKLYNDIIYFIQNHVTSTPPDR  207

Query  874   ---NSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLC  1044
                N  P  LI   P  QL +     P    +   N  S T    S  T+          
Sbjct  208   RLVNPRPGRLIELAPDDQLQS-----PSELQKGSKNRFSATMPGDSDSTV----------  252

Query  1045  RTKLFGFPLQSKKRLH  1092
               KLFG  +  KKRLH
Sbjct  253   --KLFGVSIHGKKRLH  266



>ref|XP_010088963.1| Heat stress transcription factor B-4 [Morus notabilis]
 gb|EXB37178.1| Heat stress transcription factor B-4 [Morus notabilis]
Length=299

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 197/309 (64%), Gaps = 23/309 (7%)
 Frame = +1

Query  190   ILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKH  369
             ++ +++S K+VPAPFLTKTYQLVDDP TDH+VSWG+D TTFVVWRPPEFARDLLPNYFKH
Sbjct  1     MVFTVESQKAVPAPFLTKTYQLVDDPLTDHVVSWGDDHTTFVVWRPPEFARDLLPNYFKH  60

Query  370   NNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTA----QPQVAVDHL  537
             NNFSSFVRQLNTYGF+K+V DRWEF+NE+F++G KHLL EIHRRKT+    QPQ    H 
Sbjct  61    NNFSSFVRQLNTYGFKKIVADRWEFSNEYFRKGAKHLLSEIHRRKTSQQHQQPQNYHHHH  120

Query  538   HHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsggggg  717
             H H  MN   FF A           D D   T+ N  W +     +S++  A +      
Sbjct  121   HDHLLMNS-HFFQAL----------DHDHHKTSTNFGWNNINILETSSL--APSPKTCTS  167

Query  718   ynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLI  897
              ++  + +L+EDN RLRR N +L+SEL HM+ LYNDIIYF+QNHVKPV PS+ S P   +
Sbjct  168   DDHNILTSLTEDNQRLRRKNFLLLSELTHMKSLYNDIIYFIQNHVKPVMPSTLS-PISTV  226

Query  898   TQKPLSQLVTYPHPHPPTKHQPVFNLS-SPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQ  1074
                 + +LV      P      V  ++ S    S +S  + E+         KLFG  L 
Sbjct  227   NSSSIPKLVGLGSSSPVPAVSEVKTMAISEICGSGNSREISEEKNGG----VKLFGVSLS  282

Query  1075  SKKRLHPDQ  1101
              +KRLHP++
Sbjct  283   GRKRLHPEK  291



>ref|XP_006832825.1| hypothetical protein AMTR_s00095p00016160 [Amborella trichopoda]
 gb|ERM98103.1| hypothetical protein AMTR_s00095p00016160 [Amborella trichopoda]
Length=291

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 165/310 (53%), Positives = 197/310 (64%), Gaps = 41/310 (13%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             M L+++    +L+SL++ K+VPAPFLTKTYQLV+DP TDHIVSWGEDDT+FVVWRPPEFA
Sbjct  1     MGLVVEGVGEMLVSLENQKAVPAPFLTKTYQLVNDPCTDHIVSWGEDDTSFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGE HLLCEIHRRK   P 
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEMHLLCEIHRRKATHPP  120

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagn  699
                        ++  + FS Y        P +SDE  T     + +SP  + +T      
Sbjct  121   PPPPPPPPPLTLSHLNTFSLY------TKPFESDELQT-----YPESPLSSPNTT-----  164

Query  700   sgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNS  879
                          AL+EDN RLRRSN++L+SEL+HMR+LYN IIYF+QNHVKPV     S
Sbjct  165   ---------DLATALAEDNKRLRRSNSLLLSELSHMRRLYNGIIYFLQNHVKPVPHPKFS  215

Query  880   YPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLF  1059
              P PLITQ+ L   + +  P   T+ +   NL              EDP    +   KLF
Sbjct  216   DP-PLITQQRLHDSIGFEDPLKETEERER-NLGEEE----------EDP----INTVKLF  259

Query  1060  GFPLQSKKRL  1089
             G PL  +KRL
Sbjct  260   GVPLHGRKRL  269



>ref|XP_003518479.1| PREDICTED: heat stress transcription factor B-4b [Glycine max]
Length=273

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 160/313 (51%), Positives = 187/313 (60%), Gaps = 48/313 (15%)
 Frame = +1

Query  160   MALMLDNCE-GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEF  336
             MA  LD CE  ++ +++SHKSVPAPFLTKTYQLVDDP TDHIVSWG+D+TTFVV RPPEF
Sbjct  1     MAFTLDRCEDSMVFTMESHKSVPAPFLTKTYQLVDDPHTDHIVSWGDDETTFVVRRPPEF  60

Query  337   ARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP  516
             ARDLLPNYFKHNNFSSFVRQLNTYGF+KV  DRWEFANE+F++G KHLLCEIHRRKT   
Sbjct  61    ARDLLPNYFKHNNFSSFVRQLNTYGFKKVAADRWEFANEYFRKGAKHLLCEIHRRKTPHH  120

Query  517   QVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsag  696
                  H+H   P                +  PD        N  W D+P   S       
Sbjct  121   YQQHYHMHDQPP---------------QLLQPDE-------NMCWIDAPPLPSPK-----  153

Query  697   nsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSN  876
                         +AALSEDN RLRR N ML+SEL HM+ LYNDIIYF+QNHV P      
Sbjct  154   -------PGTDILAALSEDNQRLRRKNFMLLSELTHMKNLYNDIIYFIQNHVSPAASYDE  206

Query  877   SYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKL  1056
                   I +  + +L + P+   PTK + +          +S VT   D P  +    KL
Sbjct  207   QRSRSAILK--MVELDSSPNVIRPTKSRIM---------EKSLVTNSSDEP--NNSSVKL  253

Query  1057  FGFPLQSKKRLHP  1095
             FG PL  KKRLHP
Sbjct  254   FGVPLCGKKRLHP  266



>ref|XP_010673780.1| PREDICTED: heat stress transcription factor B-4-like [Beta vulgaris 
subsp. vulgaris]
Length=300

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 183/296 (62%), Gaps = 39/296 (13%)
 Frame = +1

Query  205   DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
             +S KSVPAPFLTKTYQLVDDP TDHIVSWGED+T+FVVWRPPEFARDLLPNYFKHNNFSS
Sbjct  38    ESQKSVPAPFLTKTYQLVDDPRTDHIVSWGEDETSFVVWRPPEFARDLLPNYFKHNNFSS  97

Query  385   FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
             FVRQLNTYGF+KVV DRWEFANE+F++GEKHLLCEIHRRKT Q      H H  H  ++ 
Sbjct  98    FVRQLNTYGFKKVVADRWEFANEYFRKGEKHLLCEIHRRKTPQ------HHHQIHYQDQI  151

Query  565   SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaL  744
                S Y P     SP D        N++W +    +              G  N  + AL
Sbjct  152   LLPSQYIP-----SPTDE-------NSSWINIDQSSPLPS-----PKPSNGPANDILTAL  194

Query  745   SEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQLV  924
             +EDN RLR+ N ML+SEL HM+ LYNDIIYF+QNHVKP  P+ N+        +P++   
Sbjct  195   TEDNQRLRKRNFMLLSELNHMKTLYNDIIYFIQNHVKPAVPNGNNNDQ----NRPVN--F  248

Query  925   TYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLH  1092
                   PP     +  L    + ++   T   D         KLFG PL SKKRLH
Sbjct  249   NAMAAAPPK----LIELDDQNQENRQGDTSKRD------TMIKLFGVPLHSKKRLH  294



>ref|XP_004491224.1| PREDICTED: heat stress transcription factor B-4b-like [Cicer 
arietinum]
Length=257

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 158/319 (50%), Positives = 180/319 (56%), Gaps = 73/319 (23%)
 Frame = +1

Query  160   MALMLDNCE--GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPE  333
             MA  L+ CE   ++ +++S KSVPAPFL KTYQLVDDP TDHIVSWG+D TTFVVWRPPE
Sbjct  1     MAFTLERCEDNNMVFTMESQKSVPAPFLIKTYQLVDDPLTDHIVSWGDDQTTFVVWRPPE  60

Query  334   FARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQ  513
             FARDLLPN+FKHNNFSSFVRQLNTYGF+KVV DRWEFANE+FK+G KHLLCEIHRRKT Q
Sbjct  61    FARDLLPNFFKHNNFSSFVRQLNTYGFKKVVADRWEFANEYFKKGAKHLLCEIHRRKTPQ  120

Query  514   PQVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDS--PSFASSTVI  687
                                                DE +      W D+  PS  SST  
Sbjct  121   HYQQQ-------------------YYEQQQQHFQQDESI-----CWIDTSLPSPKSST--  154

Query  688   sagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTP  867
                            + ALSEDN RLRR N ML+SEL HM+ LYNDIIYF+QNHV P T 
Sbjct  155   -----------GTDILTALSEDNQRLRRKNFMLLSELTHMKNLYNDIIYFIQNHVTPAT-  202

Query  868   SSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVT-LVEDPPAADLC  1044
                                   H    + +  +  L S TK S +  T   +D      C
Sbjct  203   ----------------------HFEQRSNNNKIVELDSATKISTNDATHQFKD------C  234

Query  1045  RT--KLFGFPLQSKKRLHP  1095
              T  KLFG PL  KKRLHP
Sbjct  235   NTSVKLFGVPLCGKKRLHP  253



>ref|XP_008779895.1| PREDICTED: heat stress transcription factor B-4c-like [Phoenix 
dactylifera]
Length=339

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 176/366 (48%), Positives = 219/366 (60%), Gaps = 51/366 (14%)
 Frame = +1

Query  172   LDNC--EGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDD-TTFVVWRPPEFAR  342
             ++ C   G   ++++HK+VPAPFLTKTYQLVDDP+TDHIVSWG+D  +TFVVWRPPEFAR
Sbjct  1     MERCWESGGGGAVEAHKAVPAPFLTKTYQLVDDPSTDHIVSWGDDRVSTFVVWRPPEFAR  60

Query  343   DLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQV  522
             DLLPNYFKHNNFSSFVRQLNTYGFRKVVP+RWEFANEFF++GEKHLLCEIHRRKT+    
Sbjct  61    DLLPNYFKHNNFSSFVRQLNTYGFRKVVPERWEFANEFFRKGEKHLLCEIHRRKTSNSAA  120

Query  523   AVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagns  702
                      P +    +  +      V PP            W DSPS     + + GN 
Sbjct  121   PSPSSPPLFPPHHLPLYHHFPDDHHLVGPPQ-----------WRDSPSPRLLALGNGGNG  169

Query  703   gggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSY  882
             G        + A + E+N RLRR+N  L+SELAHMRKLYNDIIYFVQNHV+PV PSS + 
Sbjct  170   GAPPAPPATAAALV-EENERLRRNNAALLSELAHMRKLYNDIIYFVQNHVRPVAPSSAA-  227

Query  883   PSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDP-PAADL------  1041
              + L++        ++ H      H+     S  + TS SS+T+ E+P P  D       
Sbjct  228   STLLLSATNAGGAGSFYH------HRKGGLNSGGSTTSSSSLTIAEEPSPPLDNNTNNNN  281

Query  1042  -----CRTKLFGFPLQS------KKRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLAL  1188
                   R KLFG PL        K+  H D  + PS+         K R+++ E  DL L
Sbjct  282   GESSSARPKLFGVPLGERSTSTHKRGFHLDAPTSPST---------KPRLVLGE--DLGL  330

Query  1189  HLMPPS  1206
             +LMPPS
Sbjct  331   NLMPPS  336



>gb|KHN38397.1| Heat stress transcription factor B-4 [Glycine soja]
Length=262

 Score =   258 bits (660),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 154/302 (51%), Positives = 181/302 (60%), Gaps = 47/302 (16%)
 Frame = +1

Query  190   ILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKH  369
             ++ +++SHKSVPAPFLTKTYQLVDDP TDHIVSWG+D+TTFVV RPPEFARDLLPNYFKH
Sbjct  1     MVFTMESHKSVPAPFLTKTYQLVDDPHTDHIVSWGDDETTFVVRRPPEFARDLLPNYFKH  60

Query  370   NNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHH  549
             NNFSSFVRQLNTYGF+KV  DRWEFANE+F++G KHLLCEIHRRKT        H+H   
Sbjct  61    NNFSSFVRQLNTYGFKKVAADRWEFANEYFRKGAKHLLCEIHRRKTPHHYQQHYHMHDQP  120

Query  550   PMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynng  729
             P                +  PD        N  W D+P   S                  
Sbjct  121   P---------------QLLQPDE-------NMCWIDAPPLPSPK------------PGTD  146

Query  730   svaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKP  909
              +AALSEDN RLRR N ML+SEL HM+ LYNDIIYF+QNHV P            I +  
Sbjct  147   ILAALSEDNQRLRRKNFMLLSELTHMKNLYNDIIYFIQNHVSPAASYDEQRSRSAILK--  204

Query  910   LSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRL  1089
             + +L + P+   PTK + +          +S VT   D P  +    KLFG PL  KKRL
Sbjct  205   MVELDSSPNVIRPTKSRIM---------EKSLVTNSSDEP--NNSSVKLFGVPLCGKKRL  253

Query  1090  HP  1095
             HP
Sbjct  254   HP  255



>ref|XP_003617219.1| Heat stress transcription factor B-4 [Medicago truncatula]
 gb|AET00178.1| heat shock transcription factor [Medicago truncatula]
Length=254

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 183/318 (58%), Gaps = 74/318 (23%)
 Frame = +1

Query  160   MALMLDNCE-GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEF  336
             MA  L+ CE  ++ +++S KSVPAPFLTKTYQLVDDP TDHIVSW +D+TTFVVWRPPEF
Sbjct  1     MAFTLERCEDNMVFTMESQKSVPAPFLTKTYQLVDDPLTDHIVSWSDDETTFVVWRPPEF  60

Query  337   ARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP  516
             ARDLLPN+FKHNNFSSFVRQLNTYGF+KVV DRWEFAN++FK+G KHLLCEIHRRKT Q 
Sbjct  61    ARDLLPNFFKHNNFSSFVRQLNTYGFKKVVADRWEFANDYFKKGAKHLLCEIHRRKTPQH  120

Query  517   QVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP--SFASSTVIs  690
                  +               + P          DE +      W DSP  S  S+T I 
Sbjct  121   YQQQYYEQSP---------QIFQP----------DESI-----CWIDSPLPSPKSNTDIL  156

Query  691   agnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTP-  867
                              LSEDN RLRR N ML+SEL+HM+ LYNDIIYF+QNHV P +P 
Sbjct  157   TA---------------LSEDNQRLRRKNFMLLSELSHMKNLYNDIIYFIQNHVSPASPF  201

Query  868   --SSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADL  1041
                SN+  + L       +LV      P   +    N SS                    
Sbjct  202   EQRSNNSATIL-------KLVELDSSSPQLPNDKDCNSSS--------------------  234

Query  1042  CRTKLFGFPLQSKKRLHP  1095
                KLFG PL  KKR+HP
Sbjct  235   --VKLFGVPLCGKKRVHP  250



>gb|KHN12039.1| Heat stress transcription factor B-4 [Glycine soja]
Length=255

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 179/299 (60%), Gaps = 52/299 (17%)
 Frame = +1

Query  202   LDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFS  381
             ++SHKSVPAPFLTKTYQLVDDP TDHIVSWG+D+TTFVV RPPEFARDLLPNYFKHNNFS
Sbjct  1     MESHKSVPAPFLTKTYQLVDDPRTDHIVSWGDDETTFVVRRPPEFARDLLPNYFKHNNFS  60

Query  382   SFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHP-MN  558
             SFVRQLNTYGF+KV  DRWEFANE+F++G KHLLCEIHRRKT        H+H   P + 
Sbjct  61    SFVRQLNTYGFKKVAADRWEFANEYFRKGAKHLLCEIHRRKTPHHYQQHYHMHDQPPHLL  120

Query  559   EPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsva  738
             +P                         N  W D+P   S                   + 
Sbjct  121   QPE-----------------------ENMCWIDTPPLPSPK------------PGIDILT  145

Query  739   aLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQ  918
             ALSEDN RLRR N ML+SEL HM+ LYNDIIYF+QNHV P +       S ++    L +
Sbjct  146   ALSEDNQRLRRKNLMLLSELTHMKNLYNDIIYFIQNHVSPASYDEQRSRSAILK---LLE  202

Query  919   LVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHP  1095
             L + P+   P K          ++ ++ S+    D P + +   KLFG PL  KKRLHP
Sbjct  203   LDSSPNVIRPAK----------SRITEKSLGTSSDEPNSSV---KLFGVPLCGKKRLHP  248



>gb|ACU16824.1| unknown [Glycine max]
Length=231

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 155/236 (66%), Gaps = 35/236 (15%)
 Frame = +1

Query  160  MALMLDNCE-GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEF  336
            MA  LD CE  ++ +++SHKSVPAPFLTKTYQLVDDP TDHIVSWG+D+TTFVV RPPEF
Sbjct  1    MAFTLDRCEDSMVFTMESHKSVPAPFLTKTYQLVDDPHTDHIVSWGDDETTFVVRRPPEF  60

Query  337  ARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP  516
            ARDLLPNYFKHNNFSSFVRQLNTYGF+KV  DRWEFANE+F++G KHLLCEIHRRKT   
Sbjct  61   ARDLLPNYFKHNNFSSFVRQLNTYGFKKVAADRWEFANEYFRKGAKHLLCEIHRRKTPHH  120

Query  517  QVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsag  696
                 H+H   P                +  PD        N  W D+P   S       
Sbjct  121  YQQHYHMHDQPP---------------QLLQPDE-------NMCWIDAPPLPSPK-----  153

Query  697  nsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT  864
                        +AALSEDN RLRR N ML+SEL HM+ LYNDIIYF+QNHV P  
Sbjct  154  -------PGTDILAALSEDNQRLRRKNFMLLSELTHMKNLYNDIIYFIQNHVSPAA  202



>ref|XP_002981332.1| hypothetical protein SELMODRAFT_114534 [Selaginella moellendorffii]
 gb|EFJ17520.1| hypothetical protein SELMODRAFT_114534 [Selaginella moellendorffii]
Length=320

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 148/329 (45%), Positives = 196/329 (60%), Gaps = 62/329 (19%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL  D+ +G +LS+DSH+ VPAPFLTKTYQLVDD A++ IVSWGED +TFVVWRPPEFA
Sbjct  1     MALSFDSSDGCVLSVDSHRVVPAPFLTKTYQLVDDAASNDIVSWGEDGSTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFAN+FF++GE+HLLCEIHRRK    Q
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANDFFRKGERHLLCEIHRRKA---Q  117

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANN----------NAWCDSPSF  669
              ++ HL H+  ++  +  S  +P +L+ +   +     A               C + S 
Sbjct  118   CSLAHLQHYGSLSPST--SGDDPQQLACNSSAAAAAAAAAAAWSSSPLHSPRGICSASST  175

Query  670   ASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
             A+  VI              +  +LS++N RLRR N +L+SELA ++KLY+D + F+Q++
Sbjct  176   AA--VI------------TATSLSLSDENERLRRDNCILLSELARLQKLYDDALLFLQHN  221

Query  850   VKP---VTPSSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVE  1020
             ++P   ++PSS    S    Q+ +    T P          +   + P            
Sbjct  222   MRPAAKLSPSSPGRASVDDQQRDVEDDHTSP--------GGMIKSAGP------------  261

Query  1021  DPPAADLCRTKLFGFPLQSKKRLHPDQYS  1107
                       KLFG  L  +KRLHPDQ +
Sbjct  262   ----------KLFGVVLHGRKRLHPDQQA  280



>ref|XP_002969726.1| hypothetical protein SELMODRAFT_92634 [Selaginella moellendorffii]
 gb|EFJ28850.1| hypothetical protein SELMODRAFT_92634 [Selaginella moellendorffii]
Length=319

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/328 (45%), Positives = 193/328 (59%), Gaps = 61/328 (19%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MAL  D+ +G +LS+DSH+ VPAPFLTKTYQLVDD A++ IVSWGED +TFVVWRPPEFA
Sbjct  1     MALSFDSSDGCVLSVDSHRVVPAPFLTKTYQLVDDAASNDIVSWGEDGSTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFAN+FF++GE+HLLCEIHRRK    Q
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANDFFRKGERHLLCEIHRRKA---Q  117

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANN---------NAWCDSPSFA  672
              ++ HL H+  ++  +  S  +P +L+ +   +     A              C + S A
Sbjct  118   CSLAHLQHYGSLSPST--SGDDPQQLACNSSAAAAAAAAAAWSSSPLHSPRGICSASSTA  175

Query  673   SSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
             +                  +  +LS++N RLRR N +L+SELA ++KLY+D + F+Q+++
Sbjct  176   AVVT--------------ATSLSLSDENERLRRDNCILLSELARLQKLYDDALLFLQHNM  221

Query  853   KPV---TPSSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVED  1023
             +P    +PSS    S    Q+ +    T P          +   + P             
Sbjct  222   RPAAKFSPSSPGRASVDDQQRDVEDDHTSP--------GGMIKSAGP-------------  260

Query  1024  PPAADLCRTKLFGFPLQSKKRLHPDQYS  1107
                      KLFG  L  +KRLHPDQ +
Sbjct  261   ---------KLFGVVLHGRKRLHPDQQA  279



>gb|KHN28194.1| Heat stress transcription factor B-4 [Glycine soja]
Length=255

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 150/301 (50%), Positives = 178/301 (59%), Gaps = 53/301 (18%)
 Frame = +1

Query  190   ILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKH  369
             ++ + +S KSVPAPFLTKTYQLVDDP TDHIVSWGED+TTFVVW+PPEFARDLLPNYFKH
Sbjct  1     MVFTFESQKSVPAPFLTKTYQLVDDPHTDHIVSWGEDETTFVVWKPPEFARDLLPNYFKH  60

Query  370   NNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHH  549
             NNFSSFVRQLNTYGF+KVV DRWEFANE+F++G KHLLCEIHRRK  Q          HH
Sbjct  61    NNFSSFVRQLNTYGFKKVVADRWEFANEYFRKGAKHLLCEIHRRKAPQ---------QHH  111

Query  550   PMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynng  729
              +     F    P ++       DE L      W D+P  +S               N  
Sbjct  112   QL-----FHDQLPSQIL----QKDESL-----CWLDTPLPSSK-------------PNTD  144

Query  730   svaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKP  909
              + ALSEDN  LRR N ML+SEL+HM+ LYNDIIYF+QNHVK          SP   Q+ 
Sbjct  145   ILTALSEDNQTLRRKNFMLLSELSHMKSLYNDIIYFIQNHVK----------SPPFEQRS  194

Query  910   LS---QLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSK  1080
              S   +LV     H       V   +      +S VT  E+  ++     KLFG  L  +
Sbjct  195   SSVIPKLVELDSLHESPNDMGVLRTAKSCVVDKSLVTSTEESNSS----VKLFGVTLSGR  250

Query  1081  K  1083
             K
Sbjct  251   K  251



>gb|KCW51072.1| hypothetical protein EUGRSUZ_J00680 [Eucalyptus grandis]
Length=302

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 174/304 (57%), Gaps = 42/304 (14%)
 Frame = +1

Query  196   LSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNN  375
             LS++  K+VPAPFLTKTYQLVDDP TDHIVSWGE++ TFVVWRPPEFARDLLPNYFKHNN
Sbjct  31    LSVELQKAVPAPFLTKTYQLVDDPRTDHIVSWGEEEATFVVWRPPEFARDLLPNYFKHNN  90

Query  376   FSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHH--  549
             FSSFVRQLNTYGF+K+V DRWEFANE+F++G KHLLCEIHRRKT Q      H  H H  
Sbjct  91    FSSFVRQLNTYGFKKIVADRWEFANEYFRKGAKHLLCEIHRRKTPQ------HQSHDHTP  144

Query  550   PMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynng  729
             P   P FF    P   ++  P +D                A                   
Sbjct  145   PPPLPHFFQ---PVDENLCWPSADPPFPPQPKPLPHGDVLA-------------------  182

Query  730   svaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKP  909
                 L+EDN RLRR N ML+SEL HM+ LYNDIIYF+QNHVKP+     +  +  +    
Sbjct  183   ---VLTEDNQRLRRKNLMLLSELTHMKSLYNDIIYFIQNHVKPLPHDPANNHNDHLDSIS  239

Query  910   LSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRL  1089
             + +L+             +  L    ++ +          A      KLFG  L  KKRL
Sbjct  240   VPKLIELDSDQEGDTCSRMARLKKAGRSGEE---------AGRGSNFKLFGVSLSGKKRL  290

Query  1090  HPDQ  1101
             HP++
Sbjct  291   HPEK  294



>ref|XP_010031706.1| PREDICTED: heat stress transcription factor B-4b-like [Eucalyptus 
grandis]
Length=308

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 174/304 (57%), Gaps = 42/304 (14%)
 Frame = +1

Query  196   LSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNN  375
             LS++  K+VPAPFLTKTYQLVDDP TDHIVSWGE++ TFVVWRPPEFARDLLPNYFKHNN
Sbjct  37    LSVELQKAVPAPFLTKTYQLVDDPRTDHIVSWGEEEATFVVWRPPEFARDLLPNYFKHNN  96

Query  376   FSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHH--  549
             FSSFVRQLNTYGF+K+V DRWEFANE+F++G KHLLCEIHRRKT Q      H  H H  
Sbjct  97    FSSFVRQLNTYGFKKIVADRWEFANEYFRKGAKHLLCEIHRRKTPQ------HQSHDHTP  150

Query  550   PMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynng  729
             P   P FF    P   ++  P +D                A                   
Sbjct  151   PPPLPHFFQ---PVDENLCWPSADPPFPPQPKPLPHGDVLA-------------------  188

Query  730   svaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKP  909
                 L+EDN RLRR N ML+SEL HM+ LYNDIIYF+QNHVKP+     +  +  +    
Sbjct  189   ---VLTEDNQRLRRKNLMLLSELTHMKSLYNDIIYFIQNHVKPLPHDPANNHNDHLDSIS  245

Query  910   LSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRL  1089
             + +L+             +  L    ++ +          A      KLFG  L  KKRL
Sbjct  246   VPKLIELDSDQEGDTCSRMARLKKAGRSGEE---------AGRGSNFKLFGVSLSGKKRL  296

Query  1090  HPDQ  1101
             HP++
Sbjct  297   HPEK  300



>gb|KDP43178.1| hypothetical protein JCGZ_22730 [Jatropha curcas]
Length=283

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 148/326 (45%), Positives = 184/326 (56%), Gaps = 65/326 (20%)
 Frame = +1

Query  160   MALMLD-----NCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWR  324
             MA +L+     + E ++  ++S K+VPAPFLTKTYQLVDDP TDHIVSWG+D T+FVVWR
Sbjct  1     MAFILERSSNSSIEEMVFCVESQKAVPAPFLTKTYQLVDDPLTDHIVSWGDDQTSFVVWR  60

Query  325   PPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK  504
             PPEF+RDLLPNYFKHNNFSSFVRQLNTYGF+KVV DRWEFANE+F++G KHLL EIHRRK
Sbjct  61    PPEFSRDLLPNYFKHNNFSSFVRQLNTYGFKKVVADRWEFANEYFRKGAKHLLSEIHRRK  120

Query  505   TAQPQVAVDHLHHHHPMNEPSF-------FSAYNPGRLSVSPPD-SDEQLTANNNAWCDS  660
             T+Q      H H +   + P         F   N     + PP  +++ LTA        
Sbjct  121   TSQTHHQQQHFHDNQSSSLPQILQQDQENFGWNNLDSSFLCPPKPTNDILTA--------  172

Query  661   PSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFV  840
                                        LSEDN RLRR N ML+SEL+HM+ LYNDIIYF+
Sbjct  173   ---------------------------LSEDNQRLRRKNYMLLSELSHMKTLYNDIIYFI  205

Query  841   QNHVKPVTPSSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVE  1020
             QNHVKP TP+               Q +T  +   P     +  L    K + ++     
Sbjct  206   QNHVKPTTPN-------------YEQKITNYNATSP----KIVELLGSVKNNNNNNKSSI  248

Query  1021  DPPAADLCRTKLFGFPLQSKKRLHPD  1098
                  +    KLFG  L  KKR+H +
Sbjct  249   SSNLNEESNIKLFGVSLSGKKRVHQE  274



>ref|XP_009395938.1| PREDICTED: heat stress transcription factor B-4b-like [Musa acuminata 
subsp. malaccensis]
Length=263

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 177/307 (58%), Gaps = 77/307 (25%)
 Frame = +1

Query  172   LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLL  351
             +++   +++S+DS K VPAPFLTKTYQLVDDP TD IVSWG D+ TFVVWRPPEFARDLL
Sbjct  1     MESSGDMVVSMDSAKPVPAPFLTKTYQLVDDPCTDPIVSWGGDEGTFVVWRPPEFARDLL  60

Query  352   PNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVD  531
             PNYFKH+NFSSFVRQLNTYGFRK+  DRWEFANE+F+RGEKHLL EIHRRKT+Q    V 
Sbjct  61    PNYFKHSNFSSFVRQLNTYGFRKIAADRWEFANEYFRRGEKHLLSEIHRRKTSQ----VP  116

Query  532   HLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsggg  711
                H HP                              +AW + PS      +   ++   
Sbjct  117   QFFHCHP-----------------------------QHAWIEPPSAVPGGDVDFLSA---  144

Query  712   ggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSP  891
                       LSEDN RLR+ N++L+SEL  M+KLYNDIIYF+Q+HV P          P
Sbjct  145   ----------LSEDNQRLRKKNSLLLSELTRMKKLYNDIIYFIQHHVAP----------P  184

Query  892   LITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPL  1071
             +  +   ++LV  P   P  ++QP+   + P                      KLFGFP+
Sbjct  185   VAPEPRHARLVELP---PCDQNQPLPATAEPDSG------------------VKLFGFPI  223

Query  1072  QSKKRLH  1092
               KKRL+
Sbjct  224   HGKKRLN  230



>ref|XP_009383247.1| PREDICTED: heat stress transcription factor B-4b-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=263

 Score =   246 bits (627),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 148/306 (48%), Positives = 180/306 (59%), Gaps = 52/306 (17%)
 Frame = +1

Query  172   LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLL  351
             ++  E ++ S++S K VP PFLTKTYQLVDD  TDHIVSWGED TTFVVWRPPEFARDLL
Sbjct  1     MERSEEMMGSMESPKQVPPPFLTKTYQLVDDACTDHIVSWGEDHTTFVVWRPPEFARDLL  60

Query  352   PNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVD  531
             PNYFKHNNFSSFVRQLNTYGFRK+  DRWEFANE+F+RGEKHLL EIHRRKT Q    V 
Sbjct  61    PNYFKHNNFSSFVRQLNTYGFRKIAADRWEFANEYFRRGEKHLLTEIHRRKTPQ----VP  116

Query  532   HLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsggg  711
             H  H+ P           P     SP           N+W ++P   S            
Sbjct  117   HSLHYQP-----------PQHYHQSPQPLHPAYEV--NSWIETPLAVSG-----------  152

Query  712   ggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSP  891
                +   ++ALSEDN RLR++N++L++EL  M+KLYNDI+ F+Q HV  V          
Sbjct  153   --GDTNFLSALSEDNQRLRKNNSLLLTELTRMKKLYNDIVCFIQQHVTAV----------  200

Query  892   LITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPL  1071
                  P+ +LV YP         P  + S     +QSSVTL++    A     KLFG P+
Sbjct  201   ---DHPVQRLVAYPR-QTGLLALPELHCSK----NQSSVTLIQ----ATDNTLKLFGVPI  248

Query  1072  QSKKRL  1089
                K L
Sbjct  249   HGNKTL  254



>ref|XP_009380920.1| PREDICTED: heat stress transcription factor B-4c-like [Musa acuminata 
subsp. malaccensis]
Length=349

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 141/240 (59%), Positives = 165/240 (69%), Gaps = 33/240 (14%)
 Frame = +1

Query  187  GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDT-TFVVWRPPEFARDLLPNYF  363
            G  ++ +++K +PAPFLTKTYQLVDDPATDHIVSWG+D T TFVVWRPPEFARD+LPNYF
Sbjct  8    GGGVAAETNKPLPAPFLTKTYQLVDDPATDHIVSWGDDRTSTFVVWRPPEFARDVLPNYF  67

Query  364  KHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTA---------QP  516
            KHNNFSSFVRQLNTYGFRKVVP+RWEFANEFF++GEKHLLCEIHRRKT            
Sbjct  68   KHNNFSSFVRQLNTYGFRKVVPERWEFANEFFRKGEKHLLCEIHRRKTCSPSSSSFPFAS  127

Query  517  QVAVDHLHHHHPMNEPSFFSAYNPGRLSV-----SPPDSDEQLTANNNAWCDSPSFASST  681
                  L+HH        F  Y   RL+V     + P S   L   N+         ++ 
Sbjct  128  SPPSFPLYHH--------FDDY---RLAVPHWQDATPSSRILLLGGNDV-------DAAN  169

Query  682  VIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPV  861
             +   +  GGGG    + AAL ++N RLRRSN  L+SELAHMRKLYNDIIYFVQNHV+PV
Sbjct  170  AVRMVSGVGGGGGGQATAAALLDENERLRRSNAALLSELAHMRKLYNDIIYFVQNHVRPV  229



>ref|XP_009417632.1| PREDICTED: heat stress transcription factor B-4c-like [Musa acuminata 
subsp. malaccensis]
Length=343

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 207/378 (55%), Gaps = 81/378 (21%)
 Frame = +1

Query  175   DNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDD-TTFVVWRPPEFARDLL  351
             D  +G++   + ++ VPAPFLTKTYQLVDDPATDH+VSWG+D  +TFVVWRPPEFARD+L
Sbjct  10    DGGDGVV---EGNRPVPAPFLTKTYQLVDDPATDHVVSWGDDRVSTFVVWRPPEFARDIL  66

Query  352   PNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQV---  522
             P+YFKHNNFSSFVRQLNTYGFRKVVP+RWEFANEFF++GEKHLLCEIHRRKTA       
Sbjct  67    PSYFKHNNFSSFVRQLNTYGFRKVVPERWEFANEFFRKGEKHLLCEIHRRKTASASSLFP  126

Query  523   -----AVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSF----AS  675
                  ++  L+HHH  +                    D+QL + +     SP       +
Sbjct  127   LPSSPSLFPLYHHHAFD--------------------DQQLPSPHWREVASPRLLVLGTN  166

Query  676   STVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
             S V     +  GGG    +  AL E+N RLRRSN  LMSEL+HMR+LYNDIIY VQNHV+
Sbjct  167   SCVGGNDTATRGGGQGPATATALIEENERLRRSNAALMSELSHMRQLYNDIIYLVQNHVR  226

Query  856   PV------TPSSNSYPSPLITQKPLS-----------QLVTYPHPHPPTKHQPVFNLSSP  984
             PV        S+N   S    Q+                +    P PP+          P
Sbjct  227   PVAPSSAAAASANFLLSSAYNQRRAGLNSGSTTSSSSLTIAGSEPSPPSPLHRSAKNHHP  286

Query  985   TKTSQSSVTLVEDPPAADLCRTKLFGFPL------QSKKRLHPDQYSPPSSMEaaaaaaH  1146
                  SS             R +LFG PL       SK+ L  D+ + PS+         
Sbjct  287   DNGESSSA------------RPRLFGVPLDGCSISSSKRGLQADEPTSPST---------  325

Query  1147  KARVLVLEKDDLALHLMP  1200
             K R LV +  DL L+LMP
Sbjct  326   KPR-LVPQNMDLGLNLMP  342



>ref|XP_009391363.1| PREDICTED: heat stress transcription factor B-4c-like [Musa acuminata 
subsp. malaccensis]
Length=358

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 174/375 (46%), Positives = 205/375 (55%), Gaps = 82/375 (22%)
 Frame = +1

Query  211   HKSVPAPFLTKTYQLVDDPATDHIVSWGEDD-TTFVVWRPPEFARDLLPNYFKHNNFSSF  387
             HK VPAPFLTKTYQLVDDPATDHIVSWG+D  +TFVVWRPPEFARD+LPNYFKHNNFSSF
Sbjct  19    HKPVPAPFLTKTYQLVDDPATDHIVSWGDDRVSTFVVWRPPEFARDILPNYFKHNNFSSF  78

Query  388   VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQ----------PQVAVDHL  537
             VRQLNTYGFRKVVP+RWEFANEFF++GEKHLLCEIHRRK+A           P +   + 
Sbjct  79    VRQLNTYGFRKVVPERWEFANEFFRKGEKHLLCEIHRRKSASVSSSLPLPSSPPLFPLYH  138

Query  538   HHH---HPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgg  708
             HHH   H +  P +  A +P  L +     D  + + N+             +       
Sbjct  139   HHHFDEHQLAGPHWRDAPSPRLLVL----GDSSIVSGNDIDTTMRGGGGKEPV-------  187

Query  709   gggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPS------  870
                     VAAL E+N RLRRSN  L+SELAHMR+LYNDIIYFVQNHV+PV PS      
Sbjct  188   -------MVAALVEENERLRRSNAALLSELAHMRQLYNDIIYFVQNHVRPVAPSSAAVAS  240

Query  871   -----SNSYPSPLITQK-------PLSQLVTYPHPHPPTKHQPVFN---LSSPTKTSQSS  1005
                  S++Y       K           +V  P P  P   Q   N    +S     +SS
Sbjct  241   ANFLLSSAYNQRRTGLKSGSTTSSSSLTIVEEPSPPSPHLEQSPKNHHHHNSGNCNGESS  300

Query  1006  VTLVEDPPAADLCRTKLFGFPLQS--------KKRLHPDQYSPPSSMEaaaaaaHKARVL  1161
              T           R KLFG  L          K+   PD+ + PS+             L
Sbjct  301   ST-----------RPKLFGVSLDGCSSSSSSSKRGWQPDEPTSPSTRPR----------L  339

Query  1162  VLEKDDLALHLMPPS  1206
              L+K DL  HLMPPS
Sbjct  340   ALDKMDLGFHLMPPS  354



>gb|EPS66396.1| heat shock transcription factor, partial [Genlisea aurea]
Length=217

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 167/247 (68%), Gaps = 39/247 (16%)
 Frame = +1

Query  160  MALMLDNCEGILLSLDS-HKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEF  336
            MA++L+N +G+LLSL+S  KS+PAPFLTKTYQLVDDPATDHIVSWGE  +TFVVWRPP+F
Sbjct  1    MAVLLENLDGLLLSLESPQKSLPAPFLTKTYQLVDDPATDHIVSWGERHSTFVVWRPPDF  60

Query  337  ARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTA--  510
            +RD+LP YFKHNNFSSFVRQLNTYGFRK+VP+RWEFANEFF+RGEKHLL EIHRRK+A  
Sbjct  61   SRDVLPKYFKHNNFSSFVRQLNTYGFRKIVPERWEFANEFFRRGEKHLLSEIHRRKSAPP  120

Query  511  --QPQVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTV  684
               PQ  V + HHH    E                             W   P      V
Sbjct  121  PPLPQDLVGN-HHHRGFFEEGI------------------------EKWSPPPPPPPPHV  155

Query  685  IsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT  864
                         + ++  L+EDN RLRRSN++LM+EL  M++LYNDI+YFVQNHVKP++
Sbjct  156  ---------HRRRSRTLTELAEDNERLRRSNDILMTELTQMKRLYNDIMYFVQNHVKPLS  206

Query  865  PSSNSYP  885
            PS +  P
Sbjct  207  PSHSFNP  213



>dbj|BAJ87220.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 174/373 (47%), Positives = 205/373 (55%), Gaps = 69/373 (18%)
 Frame = +1

Query  232   FLTKTYQLVDDPATDHIVSWGEDD-TTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY  408
             FLTKTYQLVDDPATDHIVSWG+D  +TFVVWRPPEFARD+LPNYFKHNNFSSFVRQLNTY
Sbjct  26    FLTKTYQLVDDPATDHIVSWGDDRVSTFVVWRPPEFARDILPNYFKHNNFSSFVRQLNTY  85

Query  409   GFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTA--------------------QPQVAV  528
             GFRKVVP+RWEFANEFF++GEK LLCEIHRRKT+                     P V+V
Sbjct  86    GFRKVVPERWEFANEFFRKGEKQLLCEIHRRKTSGSTTSSSPPPFFAPPHFPLFHPGVSV  145

Query  529   DHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQ----LTANNNAWCDSPSFASSTVIsag  696
              H HH   + E    +A+    +    P   EQ    L A       SP    +      
Sbjct  146   AH-HHQQFVGEDGAMAAHAGMGVPFMQPHWREQGAPRLLALGGPAAPSPGVEGNG-----  199

Query  697   nsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSN  876
                        S A L ++N RLRRSN  L+ EL+HMRKLYNDIIYFVQNHV+PV PS  
Sbjct  200   --------RATSAAVLMDENERLRRSNTALLQELSHMRKLYNDIIYFVQNHVRPVAPS--  249

Query  877   SYPSPLITQKPLSQLVTYPHPHPP--TKHQPVFNLSSPTKTSQSSVTLVED--PPAADLC  1044
               P+     + L   +  P   PP  T      N S  + TS SS+T+ ++  PP   L 
Sbjct  250   --PAAATFLQGLGNGMQ-PRKMPPATTGAGNGLNTSGGSTTSSSSLTIADELSPPPNHLS  306

Query  1045  R-----------------TKLFGFPLQSKKRLHPDQYSPPSSMEaaaaa--aHKARVLVL  1167
                               TKLFG  L S   +      PPS  E   +   A KAR LVL
Sbjct  307   AEKSGGEAGSSSAALSAPTKLFGVHL-SAAPVGAGSKRPPSPEEELPSTPPATKAR-LVL  364

Query  1168  EKDDLALHLMPPS  1206
             E DDL+L + PP+
Sbjct  365   ESDDLSLSVAPPA  377



>gb|EEC75327.1| hypothetical protein OsI_11708 [Oryza sativa Indica Group]
Length=289

 Score =   241 bits (615),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 157/241 (65%), Gaps = 30/241 (12%)
 Frame = +1

Query  217  SVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQ  396
            + PAPFL+KTYQLVDDP+TD +VSWGED+ TFVVWRPPEFARDLLPNYFKHNNFSSFVRQ
Sbjct  16   AAPAPFLSKTYQLVDDPSTDDVVSWGEDEATFVVWRPPEFARDLLPNYFKHNNFSSFVRQ  75

Query  397  LNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK----TAQPQVAVDHLHHHHPMNEP  564
            LNTYGFRK+V DRWEFANEFF++G KHLL EIHRRK    +         +H H+P+   
Sbjct  76   LNTYGFRKIVADRWEFANEFFRKGAKHLLSEIHRRKSSSCSQPQPPPPFPMHQHYPL---  132

Query  565  SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPS-FASSTVIsagnsgggggynngsvaa  741
            S FS     R       +          +C SP+ +A                    +AA
Sbjct  133  SLFSPPTTPRSPPVGAAAAAAYHFQEE-YCSSPADYAGGG--------------GDLLAA  177

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQL  921
            LSEDN +LRR N++L+SELAHMRKLYNDIIYF+QNHV+PV P       PL+      +L
Sbjct  178  LSEDNRQLRRRNSLLLSELAHMRKLYNDIIYFLQNHVEPVAP-------PLLAAATSCRL  230

Query  922  V  924
            V
Sbjct  231  V  231



>ref|XP_009399944.1| PREDICTED: heat stress transcription factor B-4b-like [Musa acuminata 
subsp. malaccensis]
Length=260

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 148/320 (46%), Positives = 188/320 (59%), Gaps = 63/320 (20%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
             MA +++ C  +  S+ SH+ VPAPFLTKTYQ+VDDP TDHIVSWGED+TTFVVWRPPEFA
Sbjct  1     MAFLVERCGEMAASMVSHRPVPAPFLTKTYQIVDDPDTDHIVSWGEDETTFVVWRPPEFA  60

Query  340   RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
             RDLLPNYFKHNNFSSFVRQLNTYGFRK+  DRWEFANEFF++G KHLL EIHRRK +Q  
Sbjct  61    RDLLPNYFKHNNFSSFVRQLNTYGFRKIAADRWEFANEFFRKGGKHLLSEIHRRKASQAS  120

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagn  699
              + +HL H                 L+ SPP     L    ++W + P  A+        
Sbjct  121   QSYNHLQHQ---------------LLNHSPP--PHHLPDEASSWIEPPPTAAGG------  157

Query  700   sgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNS  879
                    +   ++ALS+DN RLRR N++L+SEL HM+KLYNDI++F+QNHV  V+   + 
Sbjct  158   -------DADFLSALSQDNQRLRRRNSLLLSELTHMKKLYNDIMHFLQNHVASVSTDQSC  210

Query  880   YPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLF  1059
                                   P  H+ V +  S ++  +            D    KLF
Sbjct  211   A--------------------DPRGHRLVMDSQSGSQWHR------------DEGSIKLF  238

Query  1060  GFPLQ-SKKRLHPDQYSPPS  1116
             G PL  +KKR+H +  S  S
Sbjct  239   GVPLHDNKKRVHLETESETS  258



>gb|KHG05479.1| Heat stress transcription factor B-4 -like protein [Gossypium 
arboreum]
Length=312

 Score =   239 bits (611),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 183/316 (58%), Gaps = 59/316 (19%)
 Frame = +1

Query  172   LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLL  351
             ++  E ++LS++    VPAPFLTKTYQLVDDP TDHIVSWGE++T+FVVWR  EFA++LL
Sbjct  1     MERSEELVLSVEPQNPVPAPFLTKTYQLVDDPLTDHIVSWGENETSFVVWRITEFAKNLL  60

Query  352   PNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVD  531
             PNYFKHNNFSSFVRQLNTYGF+KVV DRWEFANE F++G KHLL EIHRRKT        
Sbjct  61    PNYFKHNNFSSFVRQLNTYGFKKVVADRWEFANENFRKGAKHLLSEIHRRKT--------  112

Query  532   HLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsggg  711
             H +HH             P +L + P DS          W +SPS +             
Sbjct  113   HRNHH---------DQQQPQQLFLKPEDS--------YGWMESPSPSPRG----------  145

Query  712   ggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPV--TPSSNSYP  885
                +   + AL++DN RLRR N ML+SEL HM+ LYNDIIYF+QNHVKPV     +N+  
Sbjct  146   --SSTDILTALTQDNQRLRRKNYMLVSELTHMKTLYNDIIYFIQNHVKPVPYQQKANTVG  203

Query  886   SPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAA-DLCRTKLFG  1062
             S +I   P S +                   S T+T+++SV          +    +LFG
Sbjct  204   SNIIQLGPSSHV-------------------SGTETAETSVLGNSSSLTVPNNSNVQLFG  244

Query  1063  FPLQSKKRLHPDQYSP  1110
              PL   +RL    Y P
Sbjct  245   VPLIDNERLEHLMYLP  260



>ref|XP_003561606.1| PREDICTED: heat stress transcription factor B-4d-like [Brachypodium 
distachyon]
Length=300

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/256 (52%), Positives = 155/256 (61%), Gaps = 56/256 (22%)
 Frame = +1

Query  160  MALMLDNCEGILLSLDS--------HKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFV  315
            MA +++ C G ++   S         K VPAPFLTKTYQLVDDP TDH+VSWGED+ TFV
Sbjct  1    MAFLVERCSGEMVVSSSSMEHMAAAAKPVPAPFLTKTYQLVDDPCTDHVVSWGEDEATFV  60

Query  316  VWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIH  495
            VWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++G KHLL EIH
Sbjct  61   VWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAKHLLSEIH  120

Query  496  RRKTAQPQVAVDHL--------------HHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLT  633
            RRK++                       HHH  + + ++         S SP DS   L 
Sbjct  121  RRKSSCSSSQPLPPPPPQPYLSLFSPPPHHHPQLAQGAYHRFQEEEEYSSSPADSGGDLL  180

Query  634  ANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRK  813
            A                                   LSEDN +LRR N++L+SELAHMRK
Sbjct  181  AT----------------------------------LSEDNRQLRRRNSLLLSELAHMRK  206

Query  814  LYNDIIYFVQNHVKPV  861
            LYNDIIYF+QNHV+PV
Sbjct  207  LYNDIIYFLQNHVEPV  222



>gb|AIG20083.1| HSF16 [Gossypium hirsutum]
Length=258

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 143/314 (46%), Positives = 182/314 (58%), Gaps = 59/314 (19%)
 Frame = +1

Query  172   LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLL  351
             ++  E ++LS++    VPAPFLTKTYQLVDDP TDHIVSWGE++T+FVVWR  EFA++ L
Sbjct  1     MERSEELVLSVEPQNPVPAPFLTKTYQLVDDPLTDHIVSWGENETSFVVWRITEFAKNPL  60

Query  352   PNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVD  531
             PNYFKHNNFSSFVRQLNTYGF+KVV DRWEFANE F++G KHLL EIHRRKT        
Sbjct  61    PNYFKHNNFSSFVRQLNTYGFKKVVADRWEFANENFRKGAKHLLSEIHRRKT--------  112

Query  532   HLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsggg  711
             H +HH            +P +L + P DS          W +SPS +             
Sbjct  113   HRNHH---------DQQHPQQLFLKPEDS--------YGWMESPSPSPRG----------  145

Query  712   ggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPV--TPSSNSYP  885
                +   + AL++DN RLRR N ML+SEL HM+ LYNDIIYF+QN VKPV     +N+  
Sbjct  146   --SSTHILTALTQDNQRLRRKNYMLVSELTHMKTLYNDIIYFIQNRVKPVPYQQKANTVG  203

Query  886   SPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAA-DLCRTKLFG  1062
             S +I   P S +                   S T+T+++SV          +    KLFG
Sbjct  204   SNIIQLGPSSHV-------------------SGTETAETSVLGNSSSLTVPNNSNVKLFG  244

Query  1063  FPLQSKKRLHPDQY  1104
              PL   +R  P ++
Sbjct  245   VPLIDNERFAPRKH  258



>ref|XP_003576600.1| PREDICTED: heat stress transcription factor B-4c-like [Brachypodium 
distachyon]
Length=404

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 154/237 (65%), Gaps = 27/237 (11%)
 Frame = +1

Query  232  FLTKTYQLVDDPATDHIVSWGEDD-TTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY  408
            FLTKTYQLVDDPATDHIVSWG+D  +TFVVWRPPEFARD+LPNYFKHNNFSSFVRQLNTY
Sbjct  27   FLTKTYQLVDDPATDHIVSWGDDRVSTFVVWRPPEFARDILPNYFKHNNFSSFVRQLNTY  86

Query  409  GFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTA---------------------QPQVA  525
            GFRKVVP+RWEFANEFF++GEK LLCEIHRRKT+                      P V+
Sbjct  87   GFRKVVPERWEFANEFFRKGEKQLLCEIHRRKTSGSTTSPSPPPFFAPPHFPLFHHPGVS  146

Query  526  VDHLHHHHPMNEPSFF--SAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagn  699
            V   HH   + +      +A+  G L    P   ++  + + A   +   A   +  +  
Sbjct  147  VAQHHHQQFVGDDGVIAAAAHGMGVLPFMQPHWQQREQSQSAAPVATRLLA---LGPSSE  203

Query  700  sgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPS  870
             G     N  +  AL  +N RLRRSN  L+ EL+HMRKLYNDIIYFVQNHV+PV PS
Sbjct  204  GGSRAANNAAAAGALMAENERLRRSNAALLQELSHMRKLYNDIIYFVQNHVRPVAPS  260



>ref|XP_003559898.1| PREDICTED: heat stress transcription factor B-4b-like [Brachypodium 
distachyon]
Length=313

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 149/351 (42%), Positives = 186/351 (53%), Gaps = 95/351 (27%)
 Frame = +1

Query  160   MALMLDNCEGILLSLDS-----------HKSVPAPFLTKTYQLVDDPATDHIVSWGEDDT  306
             MA +++ C  +++S++S            K+VPAPFL+KTY+LVDDP TDHIVSWGED+ 
Sbjct  1     MAFLVERCGEMVVSMESSAHGGGGGVGGGKAVPAPFLSKTYELVDDPCTDHIVSWGEDEA  60

Query  307   TFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLC  486
             TFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++G KHLL 
Sbjct  61    TFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAKHLLA  120

Query  487   EIHRRKTAQ-----------------------------PQVAVDHLHHHHPMNEPSFFSA  579
             EIHRRK++Q                             P +A    HHHHPM      S+
Sbjct  121   EIHRRKSSQPPPPLPHHHHAYHHLHHHHHHLGTAFSPPPPLAA---HHHHPM------SS  171

Query  580   YNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLSEDNV  759
             Y+       PP               +P+  S+     G+ G      +     L   N 
Sbjct  172   YH---FQEDPP---------------APAIGSNNNGGQGSGGEFLAALSEDNRELRRRN-  212

Query  760   RLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQLVTYPHP  939
                   ++L+SELAHM+KLYNDIIYF+QNHV PV+  +   PS LI+             
Sbjct  213   ------SVLLSELAHMKKLYNDIIYFLQNHVAPVSLPTPQTPSNLISGI-----------  255

Query  940   HPPTKHQPVFNLSSPTKTSQSSVTLVE-DPPAAD-LCRTKLFGFPLQSKKR  1086
                     V   +     + SS  L+E D    D     KLFG  L+  KR
Sbjct  256   --------VHGGAGAAANTNSSCRLMELDEEGEDETASVKLFGVALKRTKR  298



>ref|XP_006356390.1| PREDICTED: heat stress transcription factor B-2a-like [Solanum 
tuberosum]
Length=374

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 127/254 (50%), Positives = 157/254 (62%), Gaps = 45/254 (18%)
 Frame = +1

Query  181  CEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNY  360
            C    + L   K++ APFLTKTYQLVDDP++DHIVSWGE +TTFVVWRPPEFA+DLLPNY
Sbjct  6    CCDQEMFLTMQKAMVAPFLTKTYQLVDDPSSDHIVSWGEYETTFVVWRPPEFAKDLLPNY  65

Query  361  FKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLH  540
            FKHNNFSSFVRQLNTYGF+K+VP+RWEFANE+FK+G+KHLLCEI RRK+   Q     LH
Sbjct  66   FKHNNFSSFVRQLNTYGFKKIVPERWEFANEYFKKGQKHLLCEIQRRKSTPQQ-----LH  120

Query  541  HHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggy  720
            +  P +E    S Y+    + S  D D  L                              
Sbjct  121  NLTPYHEHITRSIYHQETQNPSSVDHDILLA-----------------------------  151

Query  721  nngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLIT  900
                   L++DN RLR+ N +L+SEL HM+ LYNDIIYF+QNH+KPV        S  + 
Sbjct  152  -------LTQDNERLRKRNIVLLSELTHMKNLYNDIIYFIQNHIKPVEEKF----SVFLL  200

Query  901  QKPLSQLVTYPHPH  942
             + L+Q +   H H
Sbjct  201  NEDLNQKIVDHHRH  214



>ref|XP_009409312.1| PREDICTED: heat stress transcription factor B-4c isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=352

 Score =   233 bits (595),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 154/218 (71%), Gaps = 8/218 (4%)
 Frame = +1

Query  211  HKSVPAPFLTKTYQLVDDPATDHIVSWGEDD-TTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            HK VPAPFLTKTYQLVDDPATDHIVSWG+D  +TFVVWRP EFARD+LPNYFKHNNFSSF
Sbjct  25   HKPVPAPFLTKTYQLVDDPATDHIVSWGDDRVSTFVVWRPSEFARDVLPNYFKHNNFSSF  84

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRKVVP+RWEFANEFF++GEK LLCEIHRRKT     +   L    P+  P 
Sbjct  85   VRQLNTYGFRKVVPERWEFANEFFRKGEKELLCEIHRRKTCSSSSSSFPLASSLPLFPP-  143

Query  568  FFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLS  747
             F      RL+ SP   D   +++           S+  I  G   GGGG    +   L 
Sbjct  144  -FHHLEDYRLA-SPHWHDA--SSSRFLLLGGNDVNSTNAIRIGGGCGGGGQPTAAA--LL  197

Query  748  EDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPV  861
            E+N RLRRSN  L+SEL HMRKLYNDIIYFVQNHV+PV
Sbjct  198  EENERLRRSNAALLSELFHMRKLYNDIIYFVQNHVRPV  235



>ref|XP_006651414.1| PREDICTED: heat stress transcription factor B-4d-like [Oryza 
brachyantha]
Length=294

 Score =   231 bits (589),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 127/240 (53%), Positives = 160/240 (67%), Gaps = 21/240 (9%)
 Frame = +1

Query  160  MALMLDNCEG--ILLSLDSHKSV-PAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPP  330
            MA +++ C G  +++S D   +  PAPFL+KTY+LVDDP++DH+VSWGED  TFVVWRPP
Sbjct  1    MAFLVERCGGGEMVVSSDGRGAAAPAPFLSKTYELVDDPSSDHVVSWGEDGATFVVWRPP  60

Query  331  EFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK--  504
            EFARDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++G KHLL +IHRRK  
Sbjct  61   EFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAKHLLSKIHRRKSS  120

Query  505  ---TAQPQVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFAS  675
               +  P +    +H H+P++  S             P  +          +C SPS  S
Sbjct  121  SSCSHPPPLLPLPMHQHYPLSLFSPPPPTTTTTTRSPPVGAAAAAYHFQEEYC-SPS--S  177

Query  676  STVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
              V+S G+               S DN +LRR N++L+SELAHMRKLY+DIIYF+QNHV+
Sbjct  178  DVVVSGGDLLAAR----------SGDNRQLRRRNSLLLSELAHMRKLYDDIIYFLQNHVE  227



>ref|XP_009794990.1| PREDICTED: heat stress transcription factor B-4-like [Nicotiana 
sylvestris]
Length=254

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 133/291 (46%), Positives = 171/291 (59%), Gaps = 65/291 (22%)
 Frame = +1

Query  220   VPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQL  399
             + APFLTKTYQLVDD +++HIVSWGE+DTTFVVW+P EFA+DLLPNYFKHNNFSSFVRQL
Sbjct  18    MAAPFLTKTYQLVDDQSSNHIVSWGENDTTFVVWKPLEFAKDLLPNYFKHNNFSSFVRQL  77

Query  400   NTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPSFFSA  579
             NTYGF+K+VPDR EF+NE FK+G+KHLLC+I RRK+   Q     LHH  P +E      
Sbjct  78    NTYGFKKIVPDRCEFSNENFKKGQKHLLCKIQRRKSTTQQ-----LHHLKPYHE------  126

Query  580   YNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLSEDNV  759
              N  +  +  P      T NN      PS     ++                  L++DN 
Sbjct  127   -NITKNILYQPK-----TQNN------PSTDDFLLL-----------------TLTQDNQ  157

Query  760   RLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQLVTYPHP  939
             RLR+ NN+L+SELAHM+ LYN+IIYF+QN+VKPV   S  +   L+ +    ++  + H 
Sbjct  158   RLRKRNNLLLSELAHMKNLYNNIIYFIQNYVKPVDQKSCLF---LLNEGLNLRVNDHRHD  214

Query  940   HPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLH  1092
             H                     V + ++ P +     KLFG  L  KKRLH
Sbjct  215   H--------------------QVNIEDEEPKSS--SVKLFGVSLCGKKRLH  243



>ref|XP_004251349.2| PREDICTED: heat stress transcription factor B-4b-like [Solanum 
lycopersicum]
Length=240

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 138/296 (47%), Positives = 172/296 (58%), Gaps = 70/296 (24%)
 Frame = +1

Query  214   KSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVR  393
             K++ APFLTKTYQLVDDP++DHIVSWGE + TFVVWRPPEFA+DLLPNYFKHNNFSSFVR
Sbjct  7     KAMVAPFLTKTYQLVDDPSSDHIVSWGEYENTFVVWRPPEFAKDLLPNYFKHNNFSSFVR  66

Query  394   QLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPSFF  573
             QLNTYGF+K+VP+RWEFANE FK+G+KHLLCEI RR++   Q     LHH  P  E    
Sbjct  67    QLNTYGFKKIVPERWEFANEHFKKGQKHLLCEIQRRRSTPQQ-----LHHLTPYQEHITR  121

Query  574   SAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLSED  753
             S Y+     +  P                    SSTV            ++  + AL++D
Sbjct  122   SIYHQ---EIQNP--------------------SSTV------------DHDILLALTQD  146

Query  754   NVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQLVTYP  933
             N RLR+ N +L+SEL  M+ LYNDIIYF+QNHVKPV   S  +            L+   
Sbjct  147   NERLRKRNIVLLSELTRMKNLYNDIIYFIQNHVKPVEEKSRVF------------LLNGG  194

Query  934   HPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQ  1101
               H    H+ V N                + P +D  + KLFG  L  KKRL+ ++
Sbjct  195   LNH---HHRQVHNED-------------HEEPKSD--KVKLFGVSLCGKKRLYHER  232



>sp|Q10KX8.1|HFB4D_ORYSJ RecName: Full=Heat stress transcription factor B-4d; AltName: 
Full=Heat stress transcription factor 10; Short=OsHsf-10 [Oryza 
sativa Japonica Group]
 gb|ABF96133.1| heat shock transcription factor family protein, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EEE59109.1| hypothetical protein OsJ_10971 [Oryza sativa Japonica Group]
Length=305

 Score =   229 bits (583),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 163/249 (65%), Gaps = 35/249 (14%)
 Frame = +1

Query  160  MALMLDNCEG-ILLSLD-SHK----------SVPAPFLTKTYQLVDDPATDHIVSWGEDD  303
            MA +++ C G +++S++ SH           + PAPFL+KTYQLVDDP+TD +VSWGED+
Sbjct  1    MAFLVERCGGEMVVSMERSHGRSTTTAAAVTAAPAPFLSKTYQLVDDPSTDDVVSWGEDE  60

Query  304  TTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLL  483
             TFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++G KHLL
Sbjct  61   ATFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAKHLL  120

Query  484  CEIHRRK----TAQPQVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAW  651
             EIHRRK    +         +H H+P+   S FS     R       +          +
Sbjct  121  SEIHRRKSSSCSQPQPPPPFPMHQHYPL---SLFSPPTTPRSPPVGAAAAAAYHFQEE-Y  176

Query  652  CDSPS-FASSTVIsagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDI  828
            C SP+ +A                    +AALSEDN +LRR N++L+SELAHMRKLYNDI
Sbjct  177  CSSPADYAGGG--------------GDLLAALSEDNRQLRRRNSLLLSELAHMRKLYNDI  222

Query  829  IYFVQNHVK  855
            IYF+QNHV+
Sbjct  223  IYFLQNHVE  231



>ref|XP_009383248.1| PREDICTED: heat stress transcription factor B-4b-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=256

 Score =   224 bits (572),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 141/306 (46%), Positives = 173/306 (57%), Gaps = 59/306 (19%)
 Frame = +1

Query  172   LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLL  351
             ++  E ++ S++S K VP PFLTKTYQLVDD  TDHIVSWGED TTFVVWRPPEFARDLL
Sbjct  1     MERSEEMMGSMESPKQVPPPFLTKTYQLVDDACTDHIVSWGEDHTTFVVWRPPEFARDLL  60

Query  352   PNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVD  531
             PNYFKHNNFSSF       GFRK+  DRWEFANE+F+RGEKHLL EIHRRKT Q    V 
Sbjct  61    PNYFKHNNFSSF-------GFRKIAADRWEFANEYFRRGEKHLLTEIHRRKTPQ----VP  109

Query  532   HLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsggg  711
             H  H+ P           P     SP           N+W ++P   S            
Sbjct  110   HSLHYQP-----------PQHYHQSPQPLHPAYEV--NSWIETPLAVSG-----------  145

Query  712   ggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSP  891
                +   ++ALSEDN RLR++N++L++EL  M+KLYNDI+ F+Q HV  V          
Sbjct  146   --GDTNFLSALSEDNQRLRKNNSLLLTELTRMKKLYNDIVCFIQQHVTAV----------  193

Query  892   LITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPL  1071
                  P+ +LV YP         P  + S     +QSSVTL++    A     KLFG P+
Sbjct  194   ---DHPVQRLVAYPR-QTGLLALPELHCSK----NQSSVTLIQ----ATDNTLKLFGVPI  241

Query  1072  QSKKRL  1089
                K L
Sbjct  242   HGNKTL  247



>ref|NP_001063356.1| Os09g0455200 [Oryza sativa Japonica Group]
 sp|Q67U94.1|HFB4C_ORYSJ RecName: Full=Heat stress transcription factor B-4c; AltName: 
Full=Heat stress transcription factor 22; Short=OsHsf-22 [Oryza 
sativa Japonica Group]
 dbj|BAD38277.1| putative heat shock transcription factor HSF5 [Oryza sativa Japonica 
Group]
 dbj|BAF25270.1| Os09g0455200 [Oryza sativa Japonica Group]
 dbj|BAH00976.1| unnamed protein product [Oryza sativa Japonica Group]
Length=394

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 164/371 (44%), Positives = 195/371 (53%), Gaps = 73/371 (20%)
 Frame = +1

Query  229   PFLTKTYQLVDDPATDHIVSWGEDD-TTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNT  405
             PFLTKTYQLVDDPATDHIVSWG+D  +TFVVWRPPEFARD+LPNYFKHNNFSSFVRQLNT
Sbjct  24    PFLTKTYQLVDDPATDHIVSWGDDRVSTFVVWRPPEFARDILPNYFKHNNFSSFVRQLNT  83

Query  406   YGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTA----------------------QPQ  519
             YGFRKVVP+RWEFANEFF++GEK LL EIHRRKT+                       P 
Sbjct  84    YGFRKVVPERWEFANEFFRKGEKQLLTEIHRRKTSSASTASPSPPPFFAPPHFPLFHHPG  143

Query  520   VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQL-TANNNAWCDSPSFASSTVIsag  696
             VA    HHH  + +    +A+  G     P   +  L  A        P+ + S+     
Sbjct  144   VAAAQ-HHHAFVGDDGVVAAHGIGMPFPQPHWREPNLPVATRLLALGGPAPSPSSA----  198

Query  697   nsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT----  864
                 GG     + A L E+N RLRRSN  L+ ELAHMRKLYNDIIYFVQNHV+PV     
Sbjct  199   --EAGGAGRAATAAVLMEENERLRRSNTALLQELAHMRKLYNDIIYFVQNHVRPVAPSPA  256

Query  865   ----------------PSSNSYPSPLITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTS  996
                              ++N   +   +    S L     P PP + Q +    S  +  
Sbjct  257   AAAFLQGLGMQARKKPAAANVLNNSGGSTTSSSSLTIAEEPSPPPQQQHLAGEKSGGEAG  316

Query  997   QSSVTLVEDPPAADLCRTKLFGFPLQ-------SKKRLHPDQYSPPSSMEaaaaaaHKAR  1155
              SS      P       TKLFG  L        SK+   P+++ P S          K R
Sbjct  317   NSSAARSSAP-------TKLFGVHLSAAPCGAGSKRASSPEEHPPTSPAT-------KPR  362

Query  1156  VLVLEKDDLAL  1188
              LVLE DDL+L
Sbjct  363   -LVLECDDLSL  372



>ref|XP_002533289.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29100.1| conserved hypothetical protein [Ricinus communis]
Length=191

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%), Gaps = 4/131 (3%)
 Frame = +1

Query  160  MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
            MAL+++ CE ++ S++S K+VPAPFLTKTYQLVDDP TDHIVSWG+D TTFVVWRPPEFA
Sbjct  1    MALVMERCEEMVFSVESQKAVPAPFLTKTYQLVDDPLTDHIVSWGDDQTTFVVWRPPEFA  60

Query  340  RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
            RDLLPNYFKHNNFSSFVRQLNTYGF+KVV DRWEFANE+F++G KHLL EIHRRKT Q Q
Sbjct  61   RDLLPNYFKHNNFSSFVRQLNTYGFKKVVADRWEFANEYFRKGAKHLLSEIHRRKTPQHQ  120

Query  520  VAVDHLHHHHP  552
                H H H P
Sbjct  121  ----HFHDHQP  127



>tpg|DAA45501.1| TPA: hypothetical protein ZEAMMB73_255145, partial [Zea mays]
Length=324

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 139/217 (64%), Gaps = 30/217 (14%)
 Frame = +1

Query  223  PAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLN  402
            PAPFLTKT+QLV+D  TDH+VSWGED  TFVVWRPPEFARDLLP+YFKHNNFSSFVRQLN
Sbjct  49   PAPFLTKTFQLVEDHRTDHVVSWGEDGATFVVWRPPEFARDLLPSYFKHNNFSSFVRQLN  108

Query  403  TYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQ------PQVAVDHLHHHHPMNEP  564
            TYGFRK+V DRWEFANEFF++G KHLL EIHRRK++                H  P +  
Sbjct  109  TYGFRKIVADRWEFANEFFRKGAKHLLSEIHRRKSSSCSQPPQKLQPPPLPQHQRPYDLS  168

Query  565  SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaL  744
             FF    P R   S       +   ++    +  F ++                     L
Sbjct  169  LFFPPPQPPRHPTSGY---HVVQEEDHGHGGNKDFLAT---------------------L  204

Query  745  SEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            SEDN  LRR N++L+SELAHMR+LYNDIIYF+QNHV+
Sbjct  205  SEDNRELRRRNSLLLSELAHMRRLYNDIIYFLQNHVE  241



>gb|EAZ09360.1| hypothetical protein OsI_31633 [Oryza sativa Indica Group]
Length=394

 Score =   223 bits (569),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 149/233 (64%), Gaps = 31/233 (13%)
 Frame = +1

Query  229  PFLTKTYQLVDDPATDHIVSWGEDD-TTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNT  405
            PFLTKTYQLVDDPATDHIVSWG+D  +TFVVWRPPEFARD+LPNYFKHNNFSSFVRQLNT
Sbjct  24   PFLTKTYQLVDDPATDHIVSWGDDRVSTFVVWRPPEFARDILPNYFKHNNFSSFVRQLNT  83

Query  406  YGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTA----------------------QPQ  519
            YGFRKVVP+RWEFANEFF++GEK LL EIHRRKT+                       P 
Sbjct  84   YGFRKVVPERWEFANEFFRKGEKQLLTEIHRRKTSSASTASPSPPPFFAPPHFPLFHHPG  143

Query  520  VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQL-TANNNAWCDSPSFASSTVIsag  696
            VA    HHH  + +    +A+  G     P   +  L  A        P+ + S+     
Sbjct  144  VAAAQ-HHHAFVGDDGVVAAHGIGMPFPQPHWREPNLPVATRLLALGGPAPSPSSA----  198

Query  697  nsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
                GG     + A L E+N RLRRSN  L+ ELAHMRKLYNDIIYFVQNHV+
Sbjct  199  --EAGGAGRAATAAVLMEENERLRRSNTALLQELAHMRKLYNDIIYFVQNHVR  249



>ref|XP_008656017.1| PREDICTED: heat stress transcription factor B-4d-like [Zea mays]
Length=332

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 139/217 (64%), Gaps = 30/217 (14%)
 Frame = +1

Query  223  PAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLN  402
            PAPFLTKT+QLV+D  TDH+VSWGED  TFVVWRPPEFARDLLP+YFKHNNFSSFVRQLN
Sbjct  50   PAPFLTKTFQLVEDHRTDHVVSWGEDGATFVVWRPPEFARDLLPSYFKHNNFSSFVRQLN  109

Query  403  TYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQ------PQVAVDHLHHHHPMNEP  564
            TYGFRK+V DRWEFANEFF++G KHLL EIHRRK++                H  P +  
Sbjct  110  TYGFRKIVADRWEFANEFFRKGAKHLLSEIHRRKSSSCSQPPQKLQPPPLPQHQRPYDLS  169

Query  565  SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaL  744
             FF    P R   S       +   ++    +  F ++                     L
Sbjct  170  LFFPPPQPPRHPTSGY---HVVQEEDHGHGGNKDFLAT---------------------L  205

Query  745  SEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            SEDN  LRR N++L+SELAHMR+LYNDIIYF+QNHV+
Sbjct  206  SEDNRELRRRNSLLLSELAHMRRLYNDIIYFLQNHVE  242



>ref|XP_001766517.1| predicted protein [Physcomitrella patens]
 gb|EDQ68582.1| predicted protein [Physcomitrella patens]
Length=230

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 143/221 (65%), Gaps = 25/221 (11%)
 Frame = +1

Query  193  LLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHN  372
            +L  D H+SVPAPFLTKTY LV+DPAT+ IVSWGED TTFVVWRPPEFARDLLPNYFKHN
Sbjct  1    MLFYDCHRSVPAPFLTKTYHLVNDPATNDIVSWGEDGTTFVVWRPPEFARDLLPNYFKHN  60

Query  373  NFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHP  552
            NFSSFVRQLNTYGFRKVVP+RWEFAN++F+RGE+HLLCEIHRRK  QP            
Sbjct  61   NFSSFVRQLNTYGFRKVVPERWEFANDYFRRGERHLLCEIHRRKALQPASGTGSAQQSR-  119

Query  553  MNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngs  732
                           S+SP  S E     + AW    S  SS + S         +    
Sbjct  120  ---------------SLSPSTSIE-----DQAW----SPISSPMSSPLPISVPTQHPTLP  155

Query  733  vaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            V ++S++N RLR+ NN+L+ E++ +R+LY + +  +    K
Sbjct  156  VMSISDENERLRKDNNLLLCEVSRLRRLYEETVSIIHQQYK  196



>gb|EAZ07310.1| hypothetical protein OsI_29557 [Oryza sativa Indica Group]
Length=380

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 150/363 (41%), Positives = 190/363 (52%), Gaps = 48/363 (13%)
 Frame = +1

Query  232   FLTKTYQLVDDPATDHIVSWGEDD-----TTFVVWRPPEFARDLLPNYFKHNNFSSFVRQ  396
             FLTKTYQLVDDPATDH+VSW +DD     ++FVVWRPPEFARD+LPNYFKH+NFSSFVRQ
Sbjct  26    FLTKTYQLVDDPATDHVVSWEDDDGGESASSFVVWRPPEFARDILPNYFKHSNFSSFVRQ  85

Query  397   LNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP-----QVAVDHLHHHHPMNE  561
             LNTYGFRKVVP+RWEFANEFF++GEK LLCEIHRRK+A                      
Sbjct  86    LNTYGFRKVVPERWEFANEFFRKGEKQLLCEIHRRKSAAATWPPFPPPPPPFFAPRHFAA  145

Query  562   PSFFSAYNP---GRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngs  732
              +FF   +    GRL      ++ +    + A   +PS    + +    +          
Sbjct  146   GAFFRHGDGMLHGRLGALVTTTERRHWFESAALPVAPSSRLLSQLGPVIAPARRAAATPE  205

Query  733   vaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSY----------  882
               AL +DN RL R N  L+ ELAHMRKLY+DIIYFVQNHV+PV PS  +           
Sbjct  206   EEALMQDNHRLLRGNAALVQELAHMRKLYSDIIYFVQNHVRPVAPSPAAAAALHGLGVLR  265

Query  883   PSPLITQKPLSQL-------VTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADL  1041
             P P   + P S++        T        + QP        +T++  +  V        
Sbjct  266   PPPAGGKAPASEVRGASGRSATSSSSFTVAEDQPTLLALRLPRTTEKIINEVSGGNGGG-  324

Query  1042  CRTKLFGFPLQSK---------KRLHPDQYSPPSSMEaaaaaaHKARVLVLEKDDLALHL  1194
              RTKLFG  L S          ++  P Q  PP+S           R LV+E  +L L +
Sbjct  325   -RTKLFGVHLSSADEQTSSGASRKRSPPQEQPPTS-------PAPKRTLVVEHSELRLSI  376

Query  1195  MPP  1203
             + P
Sbjct  377   VSP  379



>sp|Q6Z9R8.1|HFB4A_ORYSJ RecName: Full=Putative heat stress transcription factor B-4a; 
AltName: Full=Heat stress transcription factor 20; Short=OsHsf-20 
[Oryza sativa Japonica Group]
 dbj|BAD09860.1| putative heat shock transcription factor [Oryza sativa Japonica 
Group]
Length=380

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 141/221 (64%), Gaps = 13/221 (6%)
 Frame = +1

Query  232  FLTKTYQLVDDPATDHIVSWGEDD-----TTFVVWRPPEFARDLLPNYFKHNNFSSFVRQ  396
            FLTKTYQLVDDPATDH+VSW +DD     ++FVVWRPPEFARD+LPNYFKH+NFSSFVRQ
Sbjct  26   FLTKTYQLVDDPATDHVVSWEDDDGGESASSFVVWRPPEFARDILPNYFKHSNFSSFVRQ  85

Query  397  LNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP-----QVAVDHLHHHHPMNE  561
            LNTYGFRKVVP+RWEFANEFF++GEK LLCEIHRRK+A                      
Sbjct  86   LNTYGFRKVVPERWEFANEFFRKGEKQLLCEIHRRKSAAATWPPFPPPPPPFFAPRHFAA  145

Query  562  PSFFSAYNP---GRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngs  732
             +FF   +    GRL      ++ +    + A   +PS    + +    +          
Sbjct  146  GAFFRHGDGMLHGRLGALVTTTERRHWFESAALPVAPSSRLLSQLGPVIAPARRAAATPE  205

Query  733  vaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
              AL ++N RL R N  L+ ELAHMRKLY+DIIYFVQNHV+
Sbjct  206  EEALMQENHRLLRGNAALVQELAHMRKLYSDIIYFVQNHVR  246



>tpg|DAA63849.1| TPA: hypothetical protein ZEAMMB73_974979 [Zea mays]
 gb|AIB05984.1| HSF transcription factor, partial [Zea mays]
Length=187

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 109/121 (90%), Gaps = 2/121 (2%)
 Frame = +1

Query  160  MALMLDNCEGILLSLDS--HKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPE  333
            MA +++ C  +++S++S   K VPAPFLTKTYQLVDDP TDHIVSWG+DDTTFVVWRPPE
Sbjct  1    MAFLVERCGEMVVSMESPHAKPVPAPFLTKTYQLVDDPCTDHIVSWGDDDTTFVVWRPPE  60

Query  334  FARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQ  513
            FARDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++G KHLL EIHRRK++Q
Sbjct  61   FARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAKHLLAEIHRRKSSQ  120

Query  514  P  516
            P
Sbjct  121  P  121



>ref|XP_004958473.1| PREDICTED: heat stress transcription factor B-4b-like [Setaria 
italica]
Length=310

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 109/123 (89%), Gaps = 4/123 (3%)
 Frame = +1

Query  160  MALMLDNCEGILLSLDSH----KSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRP  327
            MA +++ C  +++S+++     K VPAPFLTKTYQLVDDP TDHIVSWGEDDTTFVVWRP
Sbjct  1    MAFLVERCGEMVVSMETSPTHAKPVPAPFLTKTYQLVDDPCTDHIVSWGEDDTTFVVWRP  60

Query  328  PEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKT  507
            PEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++G KHLL EIHRRK+
Sbjct  61   PEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAKHLLAEIHRRKS  120

Query  508  AQP  516
            +QP
Sbjct  121  SQP  123


 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 63/116 (54%), Gaps = 17/116 (15%)
 Frame = +1

Query  742   LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVT-PSSNSYPSPLITQKPLSQ  918
             LSEDN +LRR N++L+SELAHM+KLYNDIIYF+QNHV PVT PSS ++ + L +    S 
Sbjct  192   LSEDNRQLRRRNSLLLSELAHMKKLYNDIIYFLQNHVAPVTSPSSAAHHASLPSAGAASS  251

Query  919   LVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKR  1086
                            +  L   + +        ED   A     KLFG  LQ KK+
Sbjct  252   C-------------RLMELDPGSPSPPPRPEAAED---AGDGTVKLFGVALQGKKK  291



>ref|XP_002965510.1| hypothetical protein SELMODRAFT_25564, partial [Selaginella moellendorffii]
 gb|EFJ32930.1| hypothetical protein SELMODRAFT_25564, partial [Selaginella moellendorffii]
Length=178

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 137/214 (64%), Gaps = 36/214 (17%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            SH+SVPAPFLTKT+ LVDD +TD +VSW ED TTFVVWRPPEFA+D+LPNYFKHNNFSSF
Sbjct  1    SHRSVPAPFLTKTFHLVDDSSTDDVVSWSEDGTTFVVWRPPEFAKDILPNYFKHNNFSSF  60

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+V DRWEFANE+F++G++ LLCEIHRRKT QP           P+ + S
Sbjct  61   VRQLNTYGFRKIVSDRWEFANEYFRKGQQDLLCEIHRRKTGQPNTM-------QPIRQTS  113

Query  568  FFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLS  747
                     ++ + P    +          +P F ++  I                    
Sbjct  114  TAEDILWSHVTTTSPVPSPR----------APHFTAAVSI-------------------C  144

Query  748  EDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
            ++N RLRR N +LMSEL+ +R+L ++++ FVQN 
Sbjct  145  DENERLRRDNCILMSELSRLRRLNDEVLLFVQNQ  178



>ref|XP_010919270.1| PREDICTED: heat stress transcription factor B-2c-like [Elaeis 
guineensis]
Length=326

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 124/301 (41%), Positives = 161/301 (53%), Gaps = 37/301 (12%)
 Frame = +1

Query  196   LSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNN  375
             ++ D  +S+P PFLTKTYQLVDDPA D ++SW ED TTF+VWRP EFARDLLP YFKHNN
Sbjct  17    VAADGQRSMPTPFLTKTYQLVDDPAIDDVISWNEDGTTFIVWRPAEFARDLLPKYFKHNN  76

Query  376   FSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPM  555
             FSSFVRQLNTYGFRK+VPDRWEFANE F+RGEK LLC+IHRRK   P      +    P 
Sbjct  77    FSSFVRQLNTYGFRKMVPDRWEFANECFRRGEKRLLCDIHRRKIT-PAAVQAAIPVAVPA  135

Query  556   NEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsv  735
             N        +PG         DEQ+ ++N+      S        A  +G          
Sbjct  136   NR-----GGSPGN------SGDEQVLSSNS------SPGGGQQPPAAGAGRAPPPGCSGA  178

Query  736   aaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLS  915
             A L E+N RLRR N  L  EL  M+ L N+I   +  +                +Q+   
Sbjct  179   AELMEENERLRRENMQLSHELGQMKNLCNNIFLLMSKYAS--------------SQQQGC  224

Query  916   QLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHP  1095
                +     PP +  P  +L    ++ ++     E+ P+     T+LFG P++ K+ L  
Sbjct  225   ATASAASGGPPLEVAPPLDLMPLMRSPEAERVNAEEGPS-----TRLFGVPIRLKRSLCD  279

Query  1096  D  1098
             D
Sbjct  280   D  280



>ref|XP_002982987.1| hypothetical protein SELMODRAFT_15442, partial [Selaginella moellendorffii]
 gb|EFJ15796.1| hypothetical protein SELMODRAFT_15442, partial [Selaginella moellendorffii]
Length=178

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 137/214 (64%), Gaps = 36/214 (17%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            SH+SVPAPFLTKT+ LVDD +TD +VSW ED TTF+VWRPPEFA+D+LPNYFKHNNFSSF
Sbjct  1    SHRSVPAPFLTKTFHLVDDSSTDDVVSWSEDGTTFIVWRPPEFAKDILPNYFKHNNFSSF  60

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+V DRWEFANE+F++G++ LLCEIHRRKT QP           P+ + S
Sbjct  61   VRQLNTYGFRKIVSDRWEFANEYFRKGQQDLLCEIHRRKTGQPNTM-------QPIRQTS  113

Query  568  FFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLS  747
                     ++ + P    +          +P F ++  I                    
Sbjct  114  TAEDILWSHVTTTSPVPSPR----------APHFTAAVSI-------------------C  144

Query  748  EDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
            ++N RLRR N +LMSEL+ +R+L ++++ FVQN 
Sbjct  145  DENERLRRDNCILMSELSRLRRLNDEVLLFVQNQ  178



>gb|ACL52755.1| unknown [Zea mays]
Length=323

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 109/121 (90%), Gaps = 2/121 (2%)
 Frame = +1

Query  160  MALMLDNCEGILLSLDS--HKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPE  333
            MA +++ C  +++S++S   K VPAPFLTKTYQLVDDP TDHIVSWG+DDTTFVVWRPPE
Sbjct  1    MAFLVERCGEMVVSMESPHAKPVPAPFLTKTYQLVDDPCTDHIVSWGDDDTTFVVWRPPE  60

Query  334  FARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQ  513
            FARDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++G KHLL EIHRRK++Q
Sbjct  61   FARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAKHLLAEIHRRKSSQ  120

Query  514  P  516
            P
Sbjct  121  P  121



>ref|XP_006658884.1| PREDICTED: heat stress transcription factor B-4b-like [Oryza 
brachyantha]
Length=261

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 106/128 (83%), Gaps = 10/128 (8%)
 Frame = +1

Query  160  MALMLDNCEGILLSLDSH----------KSVPAPFLTKTYQLVDDPATDHIVSWGEDDTT  309
            MA +++ C  +++S++            K VPAPFLTKTYQLVDDP TDHIVSWGEDD T
Sbjct  1    MAFLVERCGEMVVSMEMSPPGVHGGAPAKPVPAPFLTKTYQLVDDPCTDHIVSWGEDDAT  60

Query  310  FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCE  489
            FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++G KHLL E
Sbjct  61   FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAKHLLAE  120

Query  490  IHRRKTAQ  513
            IHRRK++Q
Sbjct  121  IHRRKSSQ  128


 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 57/112 (51%), Gaps = 11/112 (10%)
 Frame = +1

Query  754   NVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQLVTYP  933
             N +LRR N++L+SELAHM+KLYNDIIYF+QNHV PVT           T  P S ++   
Sbjct  140   NRQLRRRNSLLLSELAHMKKLYNDIIYFLQNHVAPVT----------TTAAPSSAMLAAA  189

Query  934   HPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRT-KLFGFPLQSKKR  1086
             H H P    PV           S     + P A     T KLFG  L  KK+
Sbjct  190   HQHLPGGAAPVSCRLMELDPPDSPPPQPKTPAAEGGGDTVKLFGVSLHGKKK  241



>ref|XP_004139066.1| PREDICTED: heat stress transcription factor B-4b-like [Cucumis 
sativus]
 gb|KGN66561.1| hypothetical protein Csa_1G629180 [Cucumis sativus]
Length=257

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 164/302 (54%), Gaps = 65/302 (22%)
 Frame = +1

Query  199   SLDSHKSV-PAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNN  375
             S++S K+  PAPFL+KTY LV+DP TDHIVSWG+  TTF+VWRP EFA  +LPNYFKHNN
Sbjct  17    SVESQKANNPAPFLSKTYDLVEDPTTDHIVSWGQSLTTFIVWRPSEFATHILPNYFKHNN  76

Query  376   FSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPM  555
             FSSFVRQLNTYGF+K+V +RWEF NE FK+GEK LL EI RRK+           H+H  
Sbjct  77    FSSFVRQLNTYGFKKIVAERWEFGNENFKKGEKQLLLEIQRRKS-----------HNHNN  125

Query  556   NEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsv  735
             N                P            + C + + +S   I               +
Sbjct  126   NSQQI------------PFQLFHLHQQQQLSLCYTTTSSSDPDI---------------L  158

Query  736   aaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLS  915
             AAL++DN RLRR N ML+SELA M+ LY+DIIYF+QN+VKP+    N Y       + + 
Sbjct  159   AALTQDNRRLRRRNFMLLSELAQMKNLYSDIIYFIQNNVKPL---DNKY-----CNRSVP  210

Query  916   QLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHP  1095
             +LV               +  S        + L E          KLFG P++ KKR+ P
Sbjct  211   KLVE-------------LDPPSSPTPMSPEIRLEEGNGMV-----KLFGVPIRGKKRVLP  252

Query  1096  DQ  1101
             ++
Sbjct  253   EE  254



>gb|AHZ44772.1| heat shock factor B4b, partial [Triticum aestivum]
Length=179

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 108/133 (81%), Gaps = 14/133 (11%)
 Frame = +1

Query  160  MALMLDNCEGILLSLD--------------SHKSVPAPFLTKTYQLVDDPATDHIVSWGE  297
            MA +++ C  +++S++              + K VPAPFLTKTYQLVDDP TDHIVSWGE
Sbjct  1    MAFLVERCGEMVVSMEMGSGAPGAHGGGGIAGKPVPAPFLTKTYQLVDDPCTDHIVSWGE  60

Query  298  DDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKH  477
            DD TFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++G KH
Sbjct  61   DDATFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAKH  120

Query  478  LLCEIHRRKTAQP  516
            LL EIHRRK++QP
Sbjct  121  LLAEIHRRKSSQP  133



>ref|XP_001754155.1| predicted protein [Physcomitrella patens]
 gb|EDQ81056.1| predicted protein [Physcomitrella patens]
Length=116

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 104/116 (90%), Gaps = 1/116 (1%)
 Frame = +1

Query  160  MALMLDNCE-GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEF  336
            M+L  DN E G +L  D H+S+PAPFLTKTY LV+DP+T+ IVSWGE +TTFVVWRPPEF
Sbjct  1    MSLSFDNSETGCMLLFDCHRSIPAPFLTKTYHLVNDPSTNEIVSWGETNTTFVVWRPPEF  60

Query  337  ARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK  504
            ARDLLP YFKHNNFSSFVRQLNTYGFRK+VP+RWEFA++FF+RGE+HLLCEIHRRK
Sbjct  61   ARDLLPKYFKHNNFSSFVRQLNTYGFRKIVPERWEFASDFFRRGERHLLCEIHRRK  116



>ref|XP_008799550.1| PREDICTED: heat stress transcription factor B-2b [Phoenix dactylifera]
Length=324

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/306 (41%), Positives = 156/306 (51%), Gaps = 50/306 (16%)
 Frame = +1

Query  190   ILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKH  369
             + +  D  +S+P PFLTKTYQLVDDPA D ++SW ED  TFVVWRP EFARDLLP YFKH
Sbjct  17    VTVVADGQRSMPTPFLTKTYQLVDDPAIDDVISWNEDGNTFVVWRPAEFARDLLPKYFKH  76

Query  370   NNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAV-----DH  534
             NNFSSFVRQLNTYGFRK+VPDRWEFANE F+RGEK LLC+IHRRK     V V       
Sbjct  77    NNFSSFVRQLNTYGFRKIVPDRWEFANECFRRGEKRLLCDIHRRKITPAAVQVAAPANQG  136

Query  535   LHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggg  714
             L   +  +E +  S  +PGR    PP +  +  A        P   SS            
Sbjct  137   LSPGNSGDEQALSSNSSPGREQQQPPAAVGRPAA--------PPGCSSV-----------  177

Query  715   gynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPL  894
                      L E+N RLRR N  L  EL  M+ L N+I+  +  +               
Sbjct  178   -------PELMEENERLRRENMQLSHELGQMKNLCNNILLLMSKYAS-------------  217

Query  895   ITQKPLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQ  1074
              +Q+  +         PP +  P   L    ++ +      E  P+     T+LFG P+ 
Sbjct  218   -SQQLGAAAGGGGGGGPPLEVAPPLELMPARRSPEEERVKAEVGPS-----TRLFGVPIG  271

Query  1075  SKKRLH  1092
              K+ L 
Sbjct  272   LKRSLR  277



>emb|CDP21507.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 130/299 (43%), Positives = 166/299 (56%), Gaps = 39/299 (13%)
 Frame = +1

Query  205   DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
             D  +S+P PFLTKTYQLVDD   D ++SW ED +TF+VW P EFARDLLP YFKHNNFSS
Sbjct  22    DGPRSLPTPFLTKTYQLVDDRTIDDVISWNEDGSTFIVWNPTEFARDLLPKYFKHNNFSS  81

Query  385   FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
             FVRQLNTYGFRKVVPDRWEF+N+ F+RGEK LLC+I RRK A P VA   +    P+  P
Sbjct  82    FVRQLNTYGFRKVVPDRWEFSNDCFRRGEKGLLCDIQRRKLAAPPVAGATI---SPVTVP  138

Query  565   ---SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsv  735
                +  SA  P R +VSP DS E+   ++ +   SPS    T               GS 
Sbjct  139   TPTAAVSAIPPPR-TVSPTDSGEEQVVSSTS---SPSGFRETAT-----------AGGST  183

Query  736   aaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFV---QNHVKPVTPSSNSYPSPLITQK  906
             A L  +N RLR+ N  L  EL+HM+ + +++   +    NH    T +S +  S     K
Sbjct  184   AELIGENERLRKENMQLNKELSHMKSMCSNVYVLMSNYSNHSNGATANSKAEGSSSQALK  243

Query  907   PLSQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKK  1083
              L  L       PP   +P+F+ S  T          ED  A D    ++FG  +  K+
Sbjct  244   ALDLL-------PP---KPIFDESGATTECGG-----EDRMAVDEAGARIFGVSIGVKR  287



>ref|NP_001060424.1| Os07g0640900 [Oryza sativa Japonica Group]
 sp|Q7XHZ0.1|HFB4B_ORYSJ RecName: Full=Heat stress transcription factor B-4b; AltName: 
Full=Heat stress transcription factor 12; Short=OsHSF12; Short=rHsf12; 
AltName: Full=Heat stress transcription factor 19; 
Short=OsHsf-19 [Oryza sativa Japonica Group]
 dbj|BAC79970.1| putative heat shock transcription factor HSF5 [Oryza sativa Japonica 
Group]
 gb|AAQ23066.1| heat shock factor RHSF12 [Oryza sativa Japonica Group]
 dbj|BAD31269.1| putative heat shock transcription factor HSF5 [Oryza sativa Japonica 
Group]
 dbj|BAF22338.1| Os07g0640900 [Oryza sativa Japonica Group]
 dbj|BAG88932.1| unnamed protein product [Oryza sativa Japonica Group]
Length=310

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 108/128 (84%), Gaps = 10/128 (8%)
 Frame = +1

Query  160  MALMLDNCEGILLSLD----------SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTT  309
            MA +++ C  +++S++          + K VPAPFLTKTYQLVDDP TDHIVSWGEDDTT
Sbjct  1    MAFLVERCGEMVVSMEMGPHGGGGAAAGKPVPAPFLTKTYQLVDDPCTDHIVSWGEDDTT  60

Query  310  FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCE  489
            FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++G KHLL E
Sbjct  61   FVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAKHLLAE  120

Query  490  IHRRKTAQ  513
            IHRRK++Q
Sbjct  121  IHRRKSSQ  128


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 65/121 (54%), Gaps = 13/121 (11%)
 Frame = +1

Query  742   LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQL  921
             LSEDN +LRR N++L+SELAHM+KLYNDIIYF+QNHV PVT ++ +  S        + +
Sbjct  189   LSEDNRQLRRRNSLLLSELAHMKKLYNDIIYFLQNHVAPVTTTTTTPSS--------TAM  240

Query  922   VTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRT-KLFGFPLQS-KKRLHP  1095
                 H  P      +  L SP     S        PA D   T KLFG  L   KKR H 
Sbjct  241   AAAQHHLPAAASCRLMELDSP---DHSPPPPPPKTPATDGGDTVKLFGVSLHGRKKRAHR  297

Query  1096  D  1098
             D
Sbjct  298   D  298



>gb|AHZ44771.1| heat shock factor B4a [Triticum aestivum]
Length=320

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 108/134 (81%), Gaps = 15/134 (11%)
 Frame = +1

Query  160  MALMLDNCEGILLSLD---------------SHKSVPAPFLTKTYQLVDDPATDHIVSWG  294
            MA +++ C  +++S++               + K VPAPFLTKTYQLVDDP TDHIVSWG
Sbjct  1    MAFLVERCGEMVVSMEMGSGAAGAHGAGGGVAGKPVPAPFLTKTYQLVDDPCTDHIVSWG  60

Query  295  EDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEK  474
            EDD TFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++G K
Sbjct  61   EDDATFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAK  120

Query  475  HLLCEIHRRKTAQP  516
            HLL EIHRRK++QP
Sbjct  121  HLLAEIHRRKSSQP  134


 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 69/123 (56%), Gaps = 19/123 (15%)
 Frame = +1

Query  742   LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQL  921
             LSEDN +LRR N++L+SELAHM+KLYNDIIYF+QNHV PVT      PS + +Q+     
Sbjct  201   LSEDNRQLRRRNSLLLSELAHMKKLYNDIIYFLQNHVAPVTS-----PSSVASQR-----  250

Query  922   VTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRT-KLFGFPLQ--SKKRLH  1092
                   H P         S+  +  +  + +  D PAA+   T KLFG  L    KKR H
Sbjct  251   ------HMPLPGTAAVATSNSCRLLELDMDVDRDSPAAEEDDTVKLFGVALHHGKKKRAH  304

Query  1093  PDQ  1101
              ++
Sbjct  305   SEE  307



>ref|XP_008790507.1| PREDICTED: heat stress transcription factor B-2b-like [Phoenix 
dactylifera]
Length=329

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 134/219 (61%), Gaps = 26/219 (12%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            D  +S+P PFLTKTYQLVDDP TD ++SW ED +TF+VWRP EFARDLLP YFKHNNFSS
Sbjct  24   DGQRSMPTPFLTKTYQLVDDPTTDDVISWNEDGSTFIVWRPAEFARDLLPKYFKHNNFSS  83

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKT--AQPQVAVDHLHHHHPMN  558
            FVRQLNTYGFRK+VPDRWEFANE FKRGEK LLC+IHRRK   A  Q A+       PM 
Sbjct  84   FVRQLNTYGFRKIVPDRWEFANECFKRGEKRLLCDIHRRKITPAPVQAAI-------PMA  136

Query  559  EPSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsv  735
             P      N G    SP +S DEQ+ ++N+    SP               G        
Sbjct  137  VP-----VNRG---GSPENSGDEQVFSSNS----SPGGGQQPAAVGRALPPGCSSAAE--  182

Query  736  aaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
              L E+N RLRR N  L  EL  M+ L N+I+  +  + 
Sbjct  183  --LMEENERLRRENKQLSHELGQMKNLCNNIVLLMSKYA  219



>ref|XP_010278594.1| PREDICTED: heat stress transcription factor B-2b-like [Nelumbo 
nucifera]
Length=318

 Score =   205 bits (521),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 151/250 (60%), Gaps = 30/250 (12%)
 Frame = +1

Query  187  GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFK  366
            G   + D  +S+P PFLTKTYQLVDDP+ D ++SW ED +TF+VWRP EFARDLLP YFK
Sbjct  10   GESTTGDGQRSLPTPFLTKTYQLVDDPSIDDVISWNEDGSTFIVWRPAEFARDLLPKYFK  69

Query  367  HNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHH  546
            HNNFSSFVRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLC+IHRRK + P  AV      
Sbjct  70   HNNFSSFVRQLNTYGFRKIVPDRWEFANDCFRRGEKKLLCDIHRRKIS-PAAAVS-----  123

Query  547  HPMNEPSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggyn  723
                  +  +A  P   + SP +S D+Q+ ++ +    SPS  ++TV            +
Sbjct  124  ------TVTTATAPAVRTGSPTNSGDDQVVSSTS----SPSAVAATVC--------RTTS  165

Query  724  ngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQ  903
              S A L ++N RLR+ N  L  EL  M+ L N I+  +  +      +S    +  + +
Sbjct  166  CSSTAELLDENERLRKENMHLTHELTQMKNLCNSILALMTKYA-----NSQQENASFLAE  220

Query  904  KPLSQLVTYP  933
            KP S L   P
Sbjct  221  KPSSPLDLLP  230



>ref|XP_010933854.1| PREDICTED: heat stress transcription factor B-2c [Elaeis guineensis]
Length=348

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 134/220 (61%), Gaps = 25/220 (11%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            D  +S+P PFLTKTYQLVDDPA D ++SW ED TTF+VWRP EFARDLLP YFKHNNFSS
Sbjct  27   DGQRSMPTPFLTKTYQLVDDPAIDDVISWNEDGTTFIVWRPAEFARDLLPKYFKHNNFSS  86

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK---TAQPQVAVDHLHHHHPM  555
            FVRQLNTYGFRK+VPDRWEFANE FKRGEK LLC+IHRRK    A  Q A+       PM
Sbjct  87   FVRQLNTYGFRKIVPDRWEFANECFKRGEKRLLCDIHRRKITPAAPVQAAI-------PM  139

Query  556  NEPSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngs  732
              P+            SP +S DEQ+ ++N+      S            G        S
Sbjct  140  AVPANRGG--------SPENSGDEQVLSSNS------SPGGEGQQQPPAVGRVPPPGCTS  185

Query  733  vaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
             A L E+N RLRR N  L  EL  M+ L N+I+  +  + 
Sbjct  186  AAELMEENERLRRENQHLSHELGQMKNLCNNILLLMSKYA  225



>dbj|BAK08075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 107/135 (79%), Gaps = 16/135 (12%)
 Frame = +1

Query  160  MALMLDNCEGILLSLD----------------SHKSVPAPFLTKTYQLVDDPATDHIVSW  291
            MA +++ C  +++S++                  K VPAPFLTKTYQLVDDP TDHIVSW
Sbjct  1    MAFLVERCGEMVVSMEMGSGAHGGGGGGGGGGVGKPVPAPFLTKTYQLVDDPCTDHIVSW  60

Query  292  GEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGE  471
            GEDD TFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++G 
Sbjct  61   GEDDATFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGA  120

Query  472  KHLLCEIHRRKTAQP  516
            KHLL EIHRRK++QP
Sbjct  121  KHLLAEIHRRKSSQP  135


 Score = 76.3 bits (186),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 66/121 (55%), Gaps = 22/121 (18%)
 Frame = +1

Query  742   LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQL  921
             LSEDN +LRR N++L+SELAHM+KLYNDIIYF+QNHV PVT      PS   +Q+     
Sbjct  203   LSEDNRQLRRRNSVLLSELAHMKKLYNDIIYFLQNHVAPVTS-----PSSAASQR-----  252

Query  922   VTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAA--DLCRTKLFGFPLQ--SKKRL  1089
                   HPP    P    S+  +  +  + +    PAA  D    KLFG  L    KKR 
Sbjct  253   -----QHPPL---PGAGASNSCRLLELDMDVDRGSPAAEDDDDTVKLFGVALHHGKKKRA  304

Query  1090  H  1092
             H
Sbjct  305   H  305



>gb|EAZ04872.1| hypothetical protein OsI_27052 [Oryza sativa Indica Group]
Length=315

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 108/132 (82%), Gaps = 14/132 (11%)
 Frame = +1

Query  160  MALMLDNCEGILLSLD--------------SHKSVPAPFLTKTYQLVDDPATDHIVSWGE  297
            MA +++ C  +++S++              + K VPAPFLTKTYQLVDDP TDHIVSWGE
Sbjct  1    MAFLVERCGEMVVSMEMGPHGGVGGGGGAAAGKPVPAPFLTKTYQLVDDPCTDHIVSWGE  60

Query  298  DDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKH  477
            DDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRK+V DRWEFANEFF++G KH
Sbjct  61   DDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAKH  120

Query  478  LLCEIHRRKTAQ  513
            LL EIHRRK++Q
Sbjct  121  LLAEIHRRKSSQ  132


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 65/121 (54%), Gaps = 13/121 (11%)
 Frame = +1

Query  742   LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQL  921
             LSEDN +LRR N++L+SELAHM+KLYNDIIYF+QNHV PVT ++ +  S        + +
Sbjct  194   LSEDNRQLRRRNSLLLSELAHMKKLYNDIIYFLQNHVAPVTTTTTTPSS--------TAM  245

Query  922   VTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRT-KLFGFPLQS-KKRLHP  1095
                 H  P      +  L SP     S        PA D   T KLFG  L   KKR H 
Sbjct  246   AAAQHHLPAAASCRLMELDSP---DHSPPPPPPKTPATDGGDTVKLFGVSLHGRKKRAHR  302

Query  1096  D  1098
             D
Sbjct  303   D  303



>ref|XP_009389775.1| PREDICTED: heat stress transcription factor B-2b-like [Musa acuminata 
subsp. malaccensis]
Length=304

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 139/223 (62%), Gaps = 32/223 (14%)
 Frame = +1

Query  199  SLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNF  378
            S +  + +P PFLTKTYQLVDDPA D ++SW ED +TFVVWRP EFARD+LP +FKHNNF
Sbjct  26   SYEGQRVMPTPFLTKTYQLVDDPAMDDVISWNEDGSTFVVWRPAEFARDVLPKFFKHNNF  85

Query  379  SSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK---TAQPQVAVDHLHHHH  549
            SSFVRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLC+IHRRK   T  P V+        
Sbjct  86   SSFVRQLNTYGFRKIVPDRWEFANDCFRRGEKGLLCDIHRRKFSPTPAPAVSA-------  138

Query  550  PMNEPSFFSAYNPGRLSVSPPDSDEQ--LTANNNAWCDSPSFASSTVIsagnsgggggyn  723
                        P  L VSP +S+E+  L++ ++  C  P+  +S        G      
Sbjct  139  ------------PPNLVVSPVNSNEEQGLSSTSSPGCVQPAPVTS--------GWAAPGT  178

Query  724  ngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            +G  + L+E+N RLRR N  L  EL  M+ + N+I+  +  + 
Sbjct  179  SGGTSDLAEENSRLRRENKQLSQELGQMKGMCNNIMQLIAKYA  221



>ref|XP_004154656.1| PREDICTED: heat stress transcription factor B-4b-like [Cucumis 
sativus]
Length=257

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 163/302 (54%), Gaps = 65/302 (22%)
 Frame = +1

Query  199   SLDSHKSV-PAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNN  375
             S++S K+  PAPFL+KTY LV+DP TDHIVSWG+  TT +VWRP EFA  +LPNYFKHNN
Sbjct  17    SVESQKANNPAPFLSKTYDLVEDPTTDHIVSWGQSLTTSIVWRPSEFATHILPNYFKHNN  76

Query  376   FSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPM  555
             FSSFVRQLNTYGF+K+V +RWEF NE FK+GEK LL EI RRK+           H+H  
Sbjct  77    FSSFVRQLNTYGFKKIVAERWEFGNENFKKGEKQLLLEIQRRKS-----------HNHNN  125

Query  556   NEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsv  735
             N                P            + C + + +S   I               +
Sbjct  126   NSQQI------------PFQLFHLHQQQQLSLCYTTTSSSDPDI---------------L  158

Query  736   aaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLS  915
             AAL++DN RLRR N ML+SELA M+ LY+DIIYF+QN+VKP+    N Y       + + 
Sbjct  159   AALTQDNRRLRRRNFMLLSELAQMKNLYSDIIYFIQNNVKPL---DNKY-----CNRSVP  210

Query  916   QLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHP  1095
             +LV               +  S        + L E          KLFG P++ KKR+ P
Sbjct  211   KLVE-------------LDPPSSPTPMSPEIRLEEGNGMV-----KLFGVPIRGKKRVLP  252

Query  1096  DQ  1101
             ++
Sbjct  253   EE  254



>ref|XP_008369462.1| PREDICTED: heat stress transcription factor B-2b [Malus domestica]
 ref|XP_008369463.1| PREDICTED: heat stress transcription factor B-2b [Malus domestica]
 ref|XP_008369464.1| PREDICTED: heat stress transcription factor B-2b [Malus domestica]
Length=337

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 142/217 (65%), Gaps = 19/217 (9%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFLTKTYQLVDDP+ D ++SW ED + F+VWRP EFARDLLP YFKHNNFSS
Sbjct  23   DSQRSLPTPFLTKTYQLVDDPSVDDLISWSEDGSAFIVWRPAEFARDLLPKYFKHNNFSS  82

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+FFK+GEK LL EI RRK + P V+         M   
Sbjct  83   FVRQLNTYGFRKVVPDRWEFANDFFKKGEKGLLREIQRRKIS-PSVSAAATVVPPAM---  138

Query  565  SFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
            +  SA  P    VSP +S DEQ+ ++N++   +P+  +  +            ++ S + 
Sbjct  139  AAISALAP---RVSPSNSGDEQVISSNSSPVAAPAMLACRI-----------RSSTSTSD  184

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            + E+N RLR+ N  L  EL  +R L N+I+  + N+ 
Sbjct  185  VLEENERLRKENMQLSHELTQLRGLCNNILALMTNYA  221



>ref|XP_006857851.1| hypothetical protein AMTR_s00069p00068180 [Amborella trichopoda]
 gb|ERN19318.1| hypothetical protein AMTR_s00069p00068180 [Amborella trichopoda]
Length=326

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 134/216 (62%), Gaps = 31/216 (14%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            ++ +S+P PFLTKTYQLVDDP  D ++SW ED +TF+VWRP EFARDLLP YFKHNNFSS
Sbjct  16   EAQRSLPTPFLTKTYQLVDDPTVDDVISWNEDGSTFIVWRPAEFARDLLPKYFKHNNFSS  75

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLCEIHRRK   P   V  +  +HPM   
Sbjct  76   FVRQLNTYGFRKIVPDRWEFANDCFRRGEKRLLCEIHRRKNPSPATTV-PIQGNHPM---  131

Query  565  SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaL  744
               S  N G         DEQ+ ++N+      S A   +I            N + A L
Sbjct  132  ---SPTNSG---------DEQVLSSNS------SPAPREII---------TAANCTAAEL  164

Query  745  SEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
             ++N RLR++N  L  EL  M+ L N I   +  + 
Sbjct  165  IDENERLRKANTQLNQELTQMKTLCNKIFVLMAGYA  200



>gb|KDP31930.1| hypothetical protein JCGZ_12391 [Jatropha curcas]
Length=288

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 135/216 (63%), Gaps = 18/216 (8%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            + +SVPAPFLTKTYQLVDDP TD ++SW E  TTFVVW+  +FA+DLLPNYFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPITDDVISWNESGTTFVVWKTADFAKDLLPNYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPD+WEFANE F+RG K LL EI RRKTA P           P   P 
Sbjct  62   VRQLNTYGFRKIVPDKWEFANENFRRGHKELLSEIRRRKTASP----------APNQTPV  111

Query  568  FFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLS  747
               +   G ++ SP +S E L + + +  DS +  S                    A LS
Sbjct  112  AGKSGGVG-IAASPSNSGEDLGSTSTSSPDSKNPGS-------VETAATMTATAQFADLS  163

Query  748  EDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
             +N +L++ N ML SELA  +K  +++I F+  +VK
Sbjct  164  GENEKLKKDNEMLSSELAQAKKQCDELIAFLTEYVK  199



>ref|XP_008238806.1| PREDICTED: heat stress transcription factor B-2b [Prunus mume]
 ref|XP_008238807.1| PREDICTED: heat stress transcription factor B-2b [Prunus mume]
 ref|XP_008238808.1| PREDICTED: heat stress transcription factor B-2b [Prunus mume]
Length=332

 Score =   203 bits (516),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 140/217 (65%), Gaps = 19/217 (9%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +++P PFLTKTYQLVDDP+ D ++SW ED + F+VWRP EFARDLLP YFKHNNFSS
Sbjct  23   DSQRTLPTPFLTKTYQLVDDPSVDDLISWSEDGSAFIVWRPAEFARDLLPKYFKHNNFSS  82

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ FKRGEK LL EI RRK + P V+         +   
Sbjct  83   FVRQLNTYGFRKVVPDRWEFANDCFKRGEKGLLREIQRRKIS-PSVSASPAAITATL---  138

Query  565  SFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
            +  SA  PG   VSP +S DEQ+ ++N++    P+   S +            +  + + 
Sbjct  139  ATVSAVAPG---VSPSNSGDEQVISSNSSPVAPPATMLSRI-----------RSCTTTSD  184

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            + E+N RLR+ N  L  EL  +R L N+I+  + N+ 
Sbjct  185  VLEENERLRKENMQLSHELTQLRGLCNNILALMTNYA  221



>ref|XP_008450326.1| PREDICTED: heat stress transcription factor B-4b-like [Cucumis 
melo]
Length=257

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 155/302 (51%), Gaps = 65/302 (22%)
 Frame = +1

Query  199   SLDSHKSV-PAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNN  375
             S++S K+  PAPFL+KTY LV+DP TDHIVSWG+  TTF+VWRP EFA  +LPNYFKHNN
Sbjct  17    SVESQKANNPAPFLSKTYDLVEDPTTDHIVSWGQSLTTFIVWRPSEFATHILPNYFKHNN  76

Query  376   FSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPM  555
             FSSFVRQLNTYGF+K+V +RWEF NE FK+GEK LL EI RRK+         +      
Sbjct  77    FSSFVRQLNTYGFKKIVAERWEFGNENFKKGEKQLLLEIQRRKSHNHNNNNQQIPFQFFH  136

Query  556   NEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsv  735
                    +      S + PD    LT                                  
Sbjct  137   LHQQQQLSLCYTTTSSADPDILTALT----------------------------------  162

Query  736   aaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLS  915
                 +DN RLRR N ML+SELA M+ LY+DIIYF+QN+VKP+    N Y       + + 
Sbjct  163   ----QDNRRLRRRNFMLLSELAQMKNLYSDIIYFIQNNVKPL---DNKY-----CNRSVP  210

Query  916   QLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHP  1095
             +LV               +  S        + L E          KLFG P++ KKR+ P
Sbjct  211   KLVE-------------LDSPSSPMPMSPEIRLEEGSGMV-----KLFGVPIRGKKRVLP  252

Query  1096  DQ  1101
             ++
Sbjct  253   EE  254



>ref|XP_007209340.1| hypothetical protein PRUPE_ppa008441mg [Prunus persica]
 gb|EMJ10539.1| hypothetical protein PRUPE_ppa008441mg [Prunus persica]
Length=331

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 139/217 (64%), Gaps = 19/217 (9%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +++P PFLTKTYQLVDDP+ D ++SW ED + F+VWRP EFARDLLP YFKHNNFSS
Sbjct  23   DSQRTLPTPFLTKTYQLVDDPSVDDLISWSEDGSAFIVWRPAEFARDLLPKYFKHNNFSS  82

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ FKRGEK LL EI RRK + P V+         +   
Sbjct  83   FVRQLNTYGFRKVVPDRWEFANDCFKRGEKGLLREIQRRKIS-PSVSASPAAITATL---  138

Query  565  SFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
            +  S   PG   VSP +S DEQ+ ++N++    P+   S +            +  + + 
Sbjct  139  ATVSVVAPG---VSPSNSGDEQVISSNSSPVAPPATMLSRI-----------RSCTTTSD  184

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            + E+N RLR+ N  L  EL  +R L N+I+  + N+ 
Sbjct  185  VLEENERLRKENMQLSHELTQLRGLCNNILALMTNYA  221



>dbj|BAI99728.1| heat stress transcription factor [Carica papaya]
Length=278

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 137/216 (63%), Gaps = 25/216 (12%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            + +SVPAPFLTKTYQLVDDP TD ++SW +   TF+VW+  +FA+DLLPNYFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPITDDVISWSDTGNTFIVWKTADFAKDLLPNYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPD+WEFANE+F+RG+K LL EI RRKT  P               P+
Sbjct  62   VRQLNTYGFRKIVPDKWEFANEYFRRGQKELLSEIRRRKTFSPS--------------PT  107

Query  568  FFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLS  747
                 N G   +SP +S E L +++ +  DS +  S                    A LS
Sbjct  108  PAGGNNAGAGLISPSNSGEDLGSSSTSSPDSKNPGS-----------VETAGTAQFADLS  156

Query  748  EDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            ++N +L+R N ML SELAH +K  +++I F+  +VK
Sbjct  157  DENEKLKRDNQMLSSELAHAKKQCDELIAFLTEYVK  192



>ref|XP_002283139.1| PREDICTED: heat stress transcription factor B-2b [Vitis vinifera]
 ref|XP_010661169.1| PREDICTED: heat stress transcription factor B-2b [Vitis vinifera]
Length=305

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 148/246 (60%), Gaps = 24/246 (10%)
 Frame = +1

Query  187  GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFK  366
            G  L+ +S +S+P PFLTKTYQLVDDPA D ++SW ED +TF+VWRP EFARDLLP YFK
Sbjct  10   GESLAGESQRSLPTPFLTKTYQLVDDPAVDDLISWNEDGSTFIVWRPAEFARDLLPKYFK  69

Query  367  HNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHH  546
            HNNFSSFVRQLNTYGFRKVVPDRWEFAN++F++GEK LL +I RRK + P  A       
Sbjct  70   HNNFSSFVRQLNTYGFRKVVPDRWEFANDYFRKGEKALLRDIQRRKIS-PMAAAAATTVT  128

Query  547  HPMNEPSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggyn  723
                 P    A       VSP +S DEQ+ ++N+    SP+    TV            +
Sbjct  129  VAAVLPVVARA-------VSPTNSGDEQVLSSNS----SPATVPVTV--------HRTSS  169

Query  724  ngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSN---SYPSPL  894
              S   + E+N RLRR N+ L  EL  +R L N+I+  + N+      +       P  L
Sbjct  170  CSSTPEILEENERLRRENSQLTQELTQLRGLCNNILALMTNYAAGQIDAGGIPEGRPLDL  229

Query  895  ITQKPL  912
            +T++ L
Sbjct  230  LTERQL  235



>gb|ADC94861.1| HSP transcription factor [Vitis pseudoreticulata]
Length=305

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 148/246 (60%), Gaps = 24/246 (10%)
 Frame = +1

Query  187  GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFK  366
            G  L+ +S +S+P PFLTKTYQLVDDPA D ++SW ED +TF+VWRP EFARDLLP YFK
Sbjct  10   GESLAGESQRSLPTPFLTKTYQLVDDPAVDDLISWNEDGSTFIVWRPAEFARDLLPKYFK  69

Query  367  HNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHH  546
            HNNFSSFVRQLNTYGFRKVVPDRWEFAN++F++GEK LL +I RRK + P  A       
Sbjct  70   HNNFSSFVRQLNTYGFRKVVPDRWEFANDYFRKGEKALLRDIQRRKIS-PTAAAAATTVT  128

Query  547  HPMNEPSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggyn  723
                 P    A       VSP +S DEQ+ ++N+    SP+    TV            +
Sbjct  129  VAAVLPVVARA-------VSPTNSGDEQVLSSNS----SPATVPVTV--------HRTSS  169

Query  724  ngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSN---SYPSPL  894
              S   + E+N RLRR N+ L  EL  +R L N+I+  + N+      +       P  L
Sbjct  170  CSSTPEILEENERLRRENSQLTQELTQLRGLCNNILALMTNYAAGQIDAGGIPEGRPLDL  229

Query  895  ITQKPL  912
            +T++ L
Sbjct  230  LTERQL  235



>ref|XP_009345447.1| PREDICTED: heat stress transcription factor B-2b [Pyrus x bretschneideri]
 ref|XP_009345448.1| PREDICTED: heat stress transcription factor B-2b [Pyrus x bretschneideri]
 ref|XP_009345449.1| PREDICTED: heat stress transcription factor B-2b [Pyrus x bretschneideri]
Length=335

 Score =   200 bits (509),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 143/217 (66%), Gaps = 19/217 (9%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFLTKTYQLVDDP+ D ++SW ED + F+VWRP EFARDLLP YFKHNNFSS
Sbjct  23   DSQRSLPTPFLTKTYQLVDDPSVDDLISWSEDGSAFIVWRPAEFARDLLPKYFKHNNFSS  82

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+FFK+GEK LL EI RRK + P V+         M   
Sbjct  83   FVRQLNTYGFRKVVPDRWEFANDFFKKGEKGLLREIQRRKIS-PSVSAAATVVPPAM---  138

Query  565  SFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
            +  SA  P    VSP +S DEQ+ ++N++   +P+  +S +            ++ S + 
Sbjct  139  AAISALAP---RVSPSNSGDEQVISSNSSPVAAPAMLASRI-----------RSSTSTSD  184

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            + E+N RLR+ N  L  EL  +R L N+I+  + N+ 
Sbjct  185  VLEENERLRKENMHLSHELTQLRGLCNNILALMTNYA  221



>ref|XP_010263545.1| PREDICTED: heat shock factor protein HSF24-like [Nelumbo nucifera]
Length=291

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 136/221 (62%), Gaps = 35/221 (16%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            +HKSVPAPFLTKT+QLV+D +TD ++SW ++ TTFVVW P +FARDLLPNYFKH+NFSSF
Sbjct  2    AHKSVPAPFLTKTFQLVEDRSTDDMISWNDNGTTFVVWNPADFARDLLPNYFKHSNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLH--HHHPMNE  561
            VRQLN YGFRK+VPDRWEFANE+F+RGEK LL EIHRRKT     A +  +     P++ 
Sbjct  62   VRQLNIYGFRKIVPDRWEFANEYFRRGEKDLLSEIHRRKTTVHTHAGEKSNGVGGGPISF  121

Query  562  PSFFSAYNPGRLSVSPPDSDE----QLTANNNAWCDSPSFASSTVIsagnsgggggynng  729
            P+  S  N G  S + PDS      + T   + W                          
Sbjct  122  PAANSGENLGSSSTTSPDSKNHPSGEATVTQHLW--------------------------  155

Query  730  svaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
                LS++N +LR+ N +L SELA  +K   +II F+  +V
Sbjct  156  ---DLSDENEKLRKDNQLLNSELAQKKKQCEEIIAFLSKYV  193



>ref|XP_006425894.1| hypothetical protein CICLE_v10026058mg [Citrus clementina]
 gb|ESR39134.1| hypothetical protein CICLE_v10026058mg [Citrus clementina]
Length=270

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 127/218 (58%), Gaps = 35/218 (16%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            + +SVPAPFL KTYQLVDDP+TD ++SW E   TF+VW+  +FA+DLLPNYFKHNNFSSF
Sbjct  2    AQRSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFAKDLLPNYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVA--VDHLHHHHPMNE  561
            VRQLNTYGFRK+V D+WEFANE F+RG +  L EI RRKTA  Q A          P N 
Sbjct  62   VRQLNTYGFRKIVADKWEFANENFRRGHREFLTEIRRRKTATGQSAQTAGKTKATSPSN-  120

Query  562  PSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
                S  + G  S S P+S  Q +     + D                            
Sbjct  121  ----SGEDMGSTSTSSPESKNQGSVETAKFAD----------------------------  148

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            LS++N +LRR N  L SELA  +K  +++I F+  +VK
Sbjct  149  LSDENAKLRRDNETLSSELAQAKKQCDELITFLTEYVK  186



>ref|XP_007158472.1| hypothetical protein PHAVU_002G155300g [Phaseolus vulgaris]
 gb|ESW30466.1| hypothetical protein PHAVU_002G155300g [Phaseolus vulgaris]
Length=356

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 137/223 (61%), Gaps = 26/223 (12%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            D  +S+P PFLTKTYQLVDDP+ D ++SW ED T+F+VWRP EFARDLLP YFKHNNFSS
Sbjct  16   DLQRSIPTPFLTKTYQLVDDPSADDLISWNEDGTSFIVWRPAEFARDLLPKYFKHNNFSS  75

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK------TAQPQVAVDHLHHH  546
            FVRQLNTYGFRKVVPDRWEFAN+ F+RGE+ LL +I RRK      TA P V   +    
Sbjct  76   FVRQLNTYGFRKVVPDRWEFANDCFRRGERTLLRDIQRRKILLVPPTAAPSVVTANTVT-  134

Query  547  HPMNEPSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggyn  723
                     +   P   +VSP  S DEQ+ ++N          SS +    N+      +
Sbjct  135  --------VAVAAPAIRAVSPTTSGDEQVLSSN----------SSPIAGNSNNTVHRTTS  176

Query  724  ngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
              +   LSE+N RLR+ N  L  EL+ ++ L N+II  + N+ 
Sbjct  177  CTTAPELSEENERLRKENMQLNQELSQLKSLCNNIIALMTNYA  219



>gb|KDP25483.1| hypothetical protein JCGZ_20639 [Jatropha curcas]
Length=332

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/240 (46%), Positives = 141/240 (59%), Gaps = 22/240 (9%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFLTKTYQLVDDP+ D ++SW ED +TF+VWRP EFARDLLP YFKHNNFSS
Sbjct  20   DSQRSLPTPFLTKTYQLVDDPSVDDLISWNEDGSTFIVWRPAEFARDLLPKYFKHNNFSS  79

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN++F++GEK LL +I RRK +                 P
Sbjct  80   FVRQLNTYGFRKVVPDRWEFANDYFRKGEKGLLRDIQRRKISPTVATAATTATVTVAAIP  139

Query  565  SFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
            +          +VSP  S DEQ+ ++N          SS V +   +      +  +   
Sbjct  140  AVAR-------TVSPTTSGDEQVISSN----------SSPVATQVATPLLRTTSCTTTPE  182

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQL  921
            L E+N RLR+ N  L  EL  ++ L N+I+  + N+      S N+    L   KPL  L
Sbjct  183  LLEENERLRKVNTQLSQELTQLKGLCNNILALMTNYASGQVDSHNN----LAEGKPLDLL  238



>dbj|BAJ85352.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 135/222 (61%), Gaps = 19/222 (9%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
              +S+P PFLTKTYQLV+DPA D ++SWGED +TFVVWRP EFARDLLP YFKHNNFSSF
Sbjct  36   GQRSLPTPFLTKTYQLVEDPAVDDVISWGEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  95

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHH------  549
            VRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLC+IHRRK  Q                  
Sbjct  96   VRQLNTYGFRKIVPDRWEFANDCFRRGEKRLLCDIHRRKVVQSAGLAAAAAAAAAGAVTV  155

Query  550  -----PMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggg  714
                 PM  P   S     +LS     S+EQ+ ++N+   +    A S     G S  GG
Sbjct  156  AAAAIPMALPVTRSGSPELQLS-----SEEQVLSSNSGSAEELPLAPSGS---GGSAPGG  207

Query  715  gynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFV  840
                 S   + E+N RLRR N  L  EL  M+KL N+I+  +
Sbjct  208  AAAGSSSGDMGEENDRLRRDNARLTRELGQMKKLCNNIVSLM  249



>ref|XP_002277765.2| PREDICTED: heat shock factor protein HSF24 [Vitis vinifera]
 emb|CBI21429.3| unnamed protein product [Vitis vinifera]
Length=286

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 133/216 (62%), Gaps = 23/216 (11%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            + +SVPAPFLTKTYQLVDDP+TD ++SW E   TFVVW+  +FA+DLLPNYFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPSTDDVISWSESGNTFVVWKTADFAKDLLPNYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPD+WEFANE+FKRG++ L+ EI RRKT     A             +
Sbjct  62   VRQLNTYGFRKIVPDKWEFANEYFKRGQRELMSEIRRRKTTTSSTA------------QA  109

Query  568  FFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLS  747
                 + G  + SP +S E L + + +  DS +  S                    A LS
Sbjct  110  LPGGKSAGGGTSSPTNSGEDLGSTSTSSPDSKNPGS-----------VETTTTAQFADLS  158

Query  748  EDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            ++N +L++ N  L +ELA  ++   ++I F+  +VK
Sbjct  159  DENEKLKKDNESLSTELAQTKRQCEELIAFLTEYVK  194



>ref|XP_009760921.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana sylvestris]
Length=332

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 135/217 (62%), Gaps = 12/217 (6%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            ++ KS+P PFLTKTYQLVDDPA D ++SW ED TTF+VW+P EFARDLLP YFKHNNFSS
Sbjct  16   ENQKSLPTPFLTKTYQLVDDPAIDELISWNEDGTTFIVWKPAEFARDLLPKYFKHNNFSS  75

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ F+RGEK LL +I RRK +    AV  +     +N  
Sbjct  76   FVRQLNTYGFRKVVPDRWEFANDCFRRGEKGLLRDIQRRKISPAGTAVTAVSPTVAVNAT  135

Query  565  SFFS-AYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsva  738
               + A  P    VSP +S DEQ+ ++N          SS   +A            +  
Sbjct  136  QAVTIAVAPAVRLVSPSNSGDEQVLSSN----------SSPAATAAAVAVLRTTTCTTTP  185

Query  739  aLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
             L E+N RLR+ N  L  EL  +R L N++   + N+
Sbjct  186  ELLEENERLRKENAQLSQELNRLRSLCNNVYNLMSNY  222



>ref|XP_004511596.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511597.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X2 [Cicer arietinum]
Length=337

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 143/230 (62%), Gaps = 31/230 (13%)
 Frame = +1

Query  187  GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFK  366
            G   + DS +S+P PFLTKTYQLVDDP+ D ++SW ED T+F+VW+P EFARDLLP YFK
Sbjct  10   GESATTDSQRSIPTPFLTKTYQLVDDPSADDLISWNEDGTSFIVWKPAEFARDLLPKYFK  69

Query  367  HNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK---TAQPQVAVDHL  537
            HNNFSSFVRQLNTYGFRKVVPDRWEFAN+ F+RGEK+LL +I RRK   TA   +A    
Sbjct  70   HNNFSSFVRQLNTYGFRKVVPDRWEFANDGFRRGEKNLLRDIQRRKISPTAGTSMA----  125

Query  538  HHHHPMNEPSFFSAYNPGRLSVSPP-----DSDEQLTANNNAWCDSPSFASSTVIsagns  702
                     +  +  N   ++V+ P       DEQ+ ++N          SS +++  ++
Sbjct  126  ---------TAVAVANTVTVAVAAPVTPTTSGDEQVVSSN----------SSPIMAHNST  166

Query  703  gggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
                  +  +   L E+N RLR+ N  L +EL+ ++ L N+I+  + N+ 
Sbjct  167  TVHLSTSCTTAPELLEENERLRKENMQLSNELSQLKGLCNNILSMMTNYA  216



>ref|XP_006659656.1| PREDICTED: heat stress transcription factor B-2b-like [Oryza 
brachyantha]
Length=371

 Score =   199 bits (507),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 133/220 (60%), Gaps = 23/220 (10%)
 Frame = +1

Query  211  HKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFV  390
             +SVP PFLTKTYQLVDDPA D ++SW +D +TFVVWRP EFARDLLP YFKHNNFSSFV
Sbjct  34   QRSVPTPFLTKTYQLVDDPAVDDVISWNDDGSTFVVWRPAEFARDLLPKYFKHNNFSSFV  93

Query  391  RQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPSF  570
            RQLNTYGFRK+VPDRWEFAN+ F+RGE+ LLCEIHRRK   P  A            P  
Sbjct  94   RQLNTYGFRKIVPDRWEFANDCFRRGERRLLCEIHRRKVTPPAPAATTGAVTVAATIPMA  153

Query  571  FSAYNPGRLSVSPPDSDEQLTANNNA------WCDSPSFASSTVIsagnsgggggynngs  732
                  G   +S    +EQ+ +++++         +PS + S  +              +
Sbjct  154  LPVTRDGSPVLS---GEEQVISSSSSPEPPFLLPQAPSGSGSGCV--------------A  196

Query  733  vaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
               + E+N RLRR N  L  EL+ M+KL N+I+  +  + 
Sbjct  197  SGDMGEENDRLRRENAQLARELSQMKKLCNNILLLMSKYA  236



>ref|XP_007047250.1| Heat shock factor 4 [Theobroma cacao]
 gb|EOX91407.1| Heat shock factor 4 [Theobroma cacao]
Length=299

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 132/216 (61%), Gaps = 25/216 (12%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            + +SVPAPFLTKTYQLVDDP TD ++SW E+ TTFVVW+  +FA+DLLPNYFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPITDDVISWNENGTTFVVWKTADFAKDLLPNYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRKVVPD+WEFANE FKRG+K LL EI RRKT     A        P +  +
Sbjct  62   VRQLNTYGFRKVVPDKWEFANENFKRGQKELLSEIRRRKTVTSSPANGKTAGVGPSSPTN  121

Query  568  FFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLS  747
              S  + G  S S PDS             +P    +T                  A LS
Sbjct  122  --SGEDLGSTSTSSPDS------------KNPGSVETT-----------PAAVTQFADLS  156

Query  748  EDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            ++N +L++ N ML SELA  +K  ++++ F+   VK
Sbjct  157  DENEKLKKDNEMLSSELAQAKKQCDELVAFLTECVK  192



>emb|CAN82265.1| hypothetical protein VITISV_009283 [Vitis vinifera]
Length=477

 Score =   202 bits (513),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 153/258 (59%), Gaps = 24/258 (9%)
 Frame = +1

Query  151  ASIMALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPP  330
            A +MA +     G  L+ +S +S+P PFLTKTYQLVDDPA D ++SW ED +TF+VWRP 
Sbjct  170  AKLMAPLPVEQTGESLAGESQRSLPTPFLTKTYQLVDDPAVDDLISWNEDGSTFIVWRPA  229

Query  331  EFARDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTA  510
            EFARDLLP YFKHNNFSSFVRQLNTYGFRKVVPDRWEFAN++F++GEK LL +I RRK +
Sbjct  230  EFARDLLPKYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANDYFRKGEKALLRDIQRRKIS  289

Query  511  QPQVAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVI  687
             P  A            P    A       VSP +S DEQ+ ++N+    SP+    TV 
Sbjct  290  -PMAAAAATTVTVAAVLPVVARA-------VSPTNSGDEQVLSSNS----SPATVPVTV-  336

Query  688  sagnsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTP  867
                       +  S   + E+N RLRR N+ L  EL  +R L N+I+  + N+      
Sbjct  337  -------HRTSSCSSTPEILEENERLRRENSQLTQELTQLRGLCNNILALMTNYAAGQID  389

Query  868  SSN---SYPSPLITQKPL  912
            +       P  L+T++ L
Sbjct  390  AGGIPEGRPLDLLTERQL  407



>ref|XP_009589845.1| PREDICTED: heat shock factor protein HSF24 [Nicotiana tomentosiformis]
Length=296

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 132/224 (59%), Gaps = 42/224 (19%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            S ++VPAPFLTKTYQLVDD  TD +VSW E  TTFVVW+  EFA+DLLP YFKHNNFSSF
Sbjct  2    SQRTVPAPFLTKTYQLVDDATTDDVVSWNESGTTFVVWKTAEFAKDLLPTYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPD+WEFANE FKRG+K LL  I RRKT  P               P+
Sbjct  62   VRQLNTYGFRKIVPDKWEFANENFKRGQKELLTAIRRRKTVTPT--------------PA  107

Query  568  FFSAYNPGRLSVSPPDSDEQLT--------ANNNAWCDSPSFASSTVIsagnsgggggyn  723
               +  PG  S SP +S E L         + N    D+P  +  T              
Sbjct  108  GGKSAAPG-TSASPDNSGEDLGSSSTSSPDSKNPGSVDTPGKSQFT--------------  152

Query  724  ngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
                  LS++N +L++ N ML SELA  +K  ++++ F+  +VK
Sbjct  153  -----DLSDENEKLKKDNQMLNSELAQAKKQCDELVAFLNQYVK  191



>ref|XP_003578478.1| PREDICTED: heat stress transcription factor B-2c [Brachypodium 
distachyon]
Length=399

 Score =   199 bits (507),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 138/228 (61%), Gaps = 9/228 (4%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
              +S+P PFLTKTYQLV+DPA D ++SW ED +TFVVWRP EFARDLLP YFKHNNFSSF
Sbjct  36   GQRSLPTPFLTKTYQLVEDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  95

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLC+IHRRK  Q    +            +
Sbjct  96   VRQLNTYGFRKIVPDRWEFANDCFRRGEKRLLCDIHRRKVVQSSAGLAAAAAAAAAGAVT  155

Query  568  FFSAYNPGRLSVS------PPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynng  729
              +A  P  L V+      P  S+EQ+ ++N+    S          +G+  GGG     
Sbjct  156  VATAAIPMALPVTRSGSPEPHSSEEQVLSSNSG---SAEERLPGPSGSGSGLGGGAGGGS  212

Query  730  svaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSS  873
            S   L E+N RLRR N  L  EL  M+KL N+I+  +  +     P  
Sbjct  213  SSGDLGEENDRLRRDNTRLTRELGQMKKLCNNIVLLMSKYAATQQPDG  260



>gb|AEB26596.1| heat shock factor B2c [Hordeum vulgare subsp. vulgare]
Length=362

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 136/223 (61%), Gaps = 21/223 (9%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
              +S+P PFLTKTYQLV+DPA D ++SWGED +TFVVWRP EFARDLLP YFKHNNFSSF
Sbjct  19   GQRSLPTPFLTKTYQLVEDPAVDDVISWGEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  78

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHH------  549
            VRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLC+IHRRK  Q                  
Sbjct  79   VRQLNTYGFRKIVPDRWEFANDCFRRGEKRLLCDIHRRKVVQSAGLAAAAAAAAAGAVTV  138

Query  550  -----PMNEPSFFSAYNPGRLSVSPPDSDEQ-LTANNNAWCDSPSFASSTVIsagnsggg  711
                 PM  P   S     +LS     S+EQ LT N+ +  + P   S +      SG G
Sbjct  139  AAAAIPMALPVTRSGSPELQLS-----SEEQVLTPNSGSAEELPLAPSGSG----GSGPG  189

Query  712  ggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFV  840
            G     S   + E+N RLRR N  L  EL  M+KL N+I+  +
Sbjct  190  GAAAGSSSGDMGEENDRLRRDNARLTRELGQMKKLCNNIVSLM  232



>gb|ABG73443.1| heat shock factor [Oryza brachyantha]
Length=408

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 138/225 (61%), Gaps = 9/225 (4%)
 Frame = +1

Query  199  SLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNF  378
            +L   +S+P PFLTKTYQLVDDPA D ++SW ED +TFVVWRP EFARDLLP YFKHNNF
Sbjct  27   ALAGQRSLPTPFLTKTYQLVDDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNF  86

Query  379  SSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK---TAQPQVAVDHLHHHH  549
            SSFVRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLC+IHRRK    A P   +       
Sbjct  87   SSFVRQLNTYGFRKIVPDRWEFANDCFRRGEKRLLCDIHRRKVVAAAPPSPGMATAAAAV  146

Query  550  PMNEPSFFSAYNPGRLSV----SPPDSDEQLTANNNAWCDSPSFASSTVIsagnsggggg  717
                 +  +A  P  L V    SP  S E+   ++N+   S         S    G GGG
Sbjct  147  ASGAVTVAAAPIPMALPVTRQGSPAHSSEEQVLSSNS--GSGEEHRQASGSGSAPGVGGG  204

Query  718  ynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
                +   + E+N RLRR N  L  EL HM+KL N+I+  +  + 
Sbjct  205  GAVSASGDMGEENERLRRENARLTRELGHMKKLCNNILLLMSKYA  249



>emb|CBI34728.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/246 (46%), Positives = 146/246 (59%), Gaps = 40/246 (16%)
 Frame = +1

Query  187  GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFK  366
            G  L+ +S +S+P PFLTKTYQLVDDPA D ++SW ED +TF+VWRP EFARDLLP YFK
Sbjct  10   GESLAGESQRSLPTPFLTKTYQLVDDPAVDDLISWNEDGSTFIVWRPAEFARDLLPKYFK  69

Query  367  HNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHH  546
            HNNFSSFVRQLNTYGFRKVVPDRWEFAN++F++GEK LL +I RRK + P  A       
Sbjct  70   HNNFSSFVRQLNTYGFRKVVPDRWEFANDYFRKGEKALLRDIQRRKIS-PMAAAAATTVT  128

Query  547  HPMNEPSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggyn  723
                 P    A       VSP +S DEQ+ ++N+    SP    +T++            
Sbjct  129  VAAVLPVVARA-------VSPTNSGDEQVLSSNS----SP----ATIL------------  161

Query  724  ngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSN---SYPSPL  894
                    E+N RLRR N+ L  EL  +R L N+I+  + N+      +       P  L
Sbjct  162  --------EENERLRRENSQLTQELTQLRGLCNNILALMTNYAAGQIDAGGIPEGRPLDL  213

Query  895  ITQKPL  912
            +T++ L
Sbjct  214  LTERQL  219



>ref|XP_009797839.1| PREDICTED: heat shock factor protein HSF24 [Nicotiana sylvestris]
Length=292

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 131/224 (58%), Gaps = 42/224 (19%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            S ++VPAPFLTKTYQLVDD  TD +VSW E  TTFVVW+  EFA+DLLP YFKHNNFSSF
Sbjct  2    SQRTVPAPFLTKTYQLVDDATTDDVVSWNESGTTFVVWKTAEFAKDLLPTYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPD+WEFANE FKRG+K LL  I RRKT  P               P+
Sbjct  62   VRQLNTYGFRKIVPDKWEFANENFKRGQKELLTAIRRRKTVTPT--------------PA  107

Query  568  FFSAYNPGRLSVSPPDSDEQLT--------ANNNAWCDSPSFASSTVIsagnsgggggyn  723
               +  PG  S SP +S E L         + N    D+P                    
Sbjct  108  GGKSVVPG-TSASPDNSGEDLGSSSTSSPDSKNPGSVDTPG-------------------  147

Query  724  ngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
                A LS++N +L++ N ML SELA  +K  ++++ F+  +VK
Sbjct  148  KSQFADLSDENEKLKKDNQMLSSELAQAKKQCDELVAFLNQYVK  191



>ref|XP_004957416.1| PREDICTED: heat stress transcription factor B-2c-like isoform 
X3 [Setaria italica]
Length=395

 Score =   198 bits (503),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 135/230 (59%), Gaps = 33/230 (14%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
              +S+P PFLTKTYQLVDDPA D ++SW ED +TFVVWRP EFARDLLP YFKHNNFSSF
Sbjct  33   GQRSLPTPFLTKTYQLVDDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  92

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHH------  549
            VRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLC+IHRRK A    A              
Sbjct  93   VRQLNTYGFRKIVPDRWEFANDCFRRGEKRLLCDIHRRKVAPAAPAAALATAAAAAASGA  152

Query  550  --------PMNEPSFFSAYNPGRLSVSPPDSDEQ-LTANNNAWCDSPSFASSTVIsagns  702
                    PM  P       PG  ++S   SDEQ L++N+ +  D P    S    A  S
Sbjct  153  VTVAAAPIPMALPVTL----PGSPALS---SDEQVLSSNSGSAEDHPQAVPSGSGGASAS  205

Query  703  gggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            G              E+N RLRR N  L  EL  M+KL N+I+  +  + 
Sbjct  206  GDT-----------GEENERLRRENARLTRELGQMKKLCNNILLLMTKYA  244



>ref|XP_010540690.1| PREDICTED: heat stress transcription factor B-2b [Tarenaya hassleriana]
Length=356

 Score =   196 bits (499),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/240 (46%), Positives = 146/240 (61%), Gaps = 18/240 (8%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFLTKTYQLVDDP+ D ++SW ED TTF+VWRP EFARDLLP YFKHNNFSS
Sbjct  41   DSQRSLPTPFLTKTYQLVDDPSVDDLISWNEDGTTFIVWRPAEFARDLLPKYFKHNNFSS  100

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEF+N+ F++GEK+LL +I RRK +QP           P+   
Sbjct  101  FVRQLNTYGFRKVVPDRWEFSNDCFRKGEKNLLRDIQRRKISQPLAPAAVTVAAVPLAAH  160

Query  565  SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaL  744
                       ++SP +S E+   ++N+   SP+  ++   +AG+       +  +   L
Sbjct  161  -----------AISPSNSGEEQVISSNS---SPAGMAAAAGAAGSGFLQRTTSCTTAPEL  206

Query  745  SEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQLV  924
             E+N RLR+ N  L  EL  ++ LY++I   + N        SN     L   KPL  L+
Sbjct  207  MEENERLRKENMQLSQELRKLKGLYDNIYVLMTNFSAGQVDCSN----LLSEGKPLDLLL  262



>ref|XP_010523506.1| PREDICTED: heat stress transcription factor B-2a [Tarenaya hassleriana]
Length=322

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 125/306 (41%), Positives = 163/306 (53%), Gaps = 56/306 (18%)
 Frame = +1

Query  196   LSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNN  375
             +S +S +SVP PFLTKTYQLVDD + D+++SW ED ++FVVW P  FA DLLP YFKHNN
Sbjct  20    VSGESQRSVPTPFLTKTYQLVDDHSLDNVISWNEDGSSFVVWNPTVFASDLLPRYFKHNN  79

Query  376   FSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPM  555
             FSSFVRQLNTYGFRKVVPDRWEF+N+ F+RGEK LLCEI RRK + P V    L    P+
Sbjct  80    FSSFVRQLNTYGFRKVVPDRWEFSNDCFRRGEKRLLCEIQRRKISPPAVTGASL----PL  135

Query  556   NEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsv  735
              +    +A    +  ++P +S E+   + ++W       S TV         G    G +
Sbjct  136   TDQGIPTA--AAKPVITPSNSGEEQVISPSSW------YSKTV---------GSGGGGGM  178

Query  736   aaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLS  915
               L E+N +LR+ N  L  ELA M+ L NDI   + N                       
Sbjct  179   MELVEENEKLRKQNIQLNRELAQMKNLCNDIFSLMTN-----------------------  215

Query  916   QLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAA---DLCRTKLFGFPLQSKK-  1083
                 Y   HP  +++  ++   P K          + PAA   D    KLFGFP+  K+ 
Sbjct  216   ----YAGSHPNNRYENSYHDVLPAKRFSGET----EKPAAESEDEGSQKLFGFPIGLKRT  267

Query  1084  RLHPDQ  1101
             R   DQ
Sbjct  268   RSGGDQ  273



>ref|XP_004957414.1| PREDICTED: heat stress transcription factor B-2c-like isoform 
X1 [Setaria italica]
Length=401

 Score =   197 bits (502),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 135/230 (59%), Gaps = 33/230 (14%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
              +S+P PFLTKTYQLVDDPA D ++SW ED +TFVVWRP EFARDLLP YFKHNNFSSF
Sbjct  33   GQRSLPTPFLTKTYQLVDDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  92

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHH------  549
            VRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLC+IHRRK A    A              
Sbjct  93   VRQLNTYGFRKIVPDRWEFANDCFRRGEKRLLCDIHRRKVAPAAPAAALATAAAAAASGA  152

Query  550  --------PMNEPSFFSAYNPGRLSVSPPDSDEQ-LTANNNAWCDSPSFASSTVIsagns  702
                    PM  P       PG  ++S   SDEQ L++N+ +  D P    S    A  S
Sbjct  153  VTVAAAPIPMALPVTL----PGSPALS---SDEQVLSSNSGSAEDHPQAVPSGSGGASAS  205

Query  703  gggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            G              E+N RLRR N  L  EL  M+KL N+I+  +  + 
Sbjct  206  GDT-----------GEENERLRRENARLTRELGQMKKLCNNILLLMTKYA  244



>ref|XP_006466606.1| PREDICTED: heat shock factor protein HSF24-like [Citrus sinensis]
Length=270

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 127/218 (58%), Gaps = 35/218 (16%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            + +SVPAPFL KTYQLVDDP+TD ++SW E   TF+VW+  +F++DLLPNYFKHNNFSSF
Sbjct  2    AQRSVPAPFLMKTYQLVDDPSTDDVISWNESGATFIVWKTADFSKDLLPNYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVA--VDHLHHHHPMNE  561
            VRQLNTYGFRK+V D+WEFANE F+RG + LL EI RRKTA    A          P N 
Sbjct  62   VRQLNTYGFRKIVADKWEFANENFRRGHRELLTEIRRRKTATGPSAQTAGKTKATSPSN-  120

Query  562  PSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
                S  + G  S S P+S  Q +     + D                            
Sbjct  121  ----SGEDMGSTSTSSPESKNQGSVETAKFAD----------------------------  148

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            LS++N +LRR N  L SELA  +K  +++I F+  +VK
Sbjct  149  LSDENAKLRRDNETLSSELAQAKKQCDELITFLTEYVK  186



>ref|XP_010269874.1| PREDICTED: heat shock factor protein HSF24 [Nelumbo nucifera]
Length=303

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 138/215 (64%), Gaps = 22/215 (10%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            +H+SVPAPFLTKTYQLV+D +TD ++SW ++ TTFVVW+P +FARDLLPNYFKHNNFSSF
Sbjct  2    AHRSVPAPFLTKTYQLVEDASTDDVISWNDNGTTFVVWKPADFARDLLPNYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPDRWEFANE+F+RGEK LL EIHRRK A  Q+      +       S
Sbjct  62   VRQLNTYGFRKIVPDRWEFANEYFRRGEKELLSEIHRRK-ATVQINAGGKPNEGGGGRSS  120

Query  568  FFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLS  747
                        SP +S E + +++ +  DS + AS                   ++ LS
Sbjct  121  ------------SPVNSGEDMGSSSTSSPDSKNHASDETT---------ATATQHLSDLS  159

Query  748  EDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            ++N +LR+ N +L SEL   +K   ++I F+  ++
Sbjct  160  DENEKLRKDNQLLSSELEQTKKQCEELIAFLSKYI  194



>ref|XP_010235376.1| PREDICTED: heat stress transcription factor B-2b-like [Brachypodium 
distachyon]
Length=345

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 130/218 (60%), Gaps = 11/218 (5%)
 Frame = +1

Query  199  SLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNF  378
            S     + P PFL KTYQLVDDPA D ++SWGE   TFVVWRP EFARD+LP+ FKHNNF
Sbjct  7    SAGQRGAAPTPFLAKTYQLVDDPAVDDVISWGEGGATFVVWRPAEFARDILPSCFKHNNF  66

Query  379  SSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMN  558
            SSFVRQLNTYGFRKVVPDRWEFAN+ F+RGEK LLCEIHRRK   P  AV          
Sbjct  67   SSFVRQLNTYGFRKVVPDRWEFANDLFRRGEKRLLCEIHRRKVTPPTSAV----------  116

Query  559  EPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsva  738
              S  +A  P  L V+   +   L+A       S S +   + SA       G  +G   
Sbjct  117  TVSPAAAAIPMALPVATATTSPVLSAEEQVL-SSSSSSERELPSAFPPPSCSGSGSGVGG  175

Query  739  aLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
             L ++N RLRR N  L  EL HM+KL N+I   +  + 
Sbjct  176  DLGDENQRLRRENARLARELGHMKKLCNNIFALMSKYA  213



>dbj|BAA83710.1| heat shock factor [Nicotiana tabacum]
Length=292

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 131/224 (58%), Gaps = 42/224 (19%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            S ++VPAPFLTKTYQLVDD  TD +VSW E  TTFVVW+  EFA+DL+P YFKHNNFSSF
Sbjct  2    SQRTVPAPFLTKTYQLVDDATTDDVVSWNESGTTFVVWKTAEFAKDLVPTYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPD+WEFANE FKRG+K LL  I RRKT  P               P+
Sbjct  62   VRQLNTYGFRKIVPDKWEFANENFKRGQKELLTAIRRRKTVTPT--------------PA  107

Query  568  FFSAYNPGRLSVSPPDSDEQLT--------ANNNAWCDSPSFASSTVIsagnsgggggyn  723
               +  PG  S SP +S E L         + N    D+P                    
Sbjct  108  GGKSVVPG-TSASPDNSGEDLGSSSTSSPDSKNPGSVDTPG-------------------  147

Query  724  ngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
                A LS++N +L++ N ML SELA  +K  ++++ F+  +VK
Sbjct  148  KSQFADLSDENEKLKKDNQMLSSELAQAKKQCDELVAFLNQYVK  191



>ref|XP_007038632.1| Heat shock transcription factor B2A, putative [Theobroma cacao]
 gb|EOY23133.1| Heat shock transcription factor B2A, putative [Theobroma cacao]
Length=323

 Score =   195 bits (495),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 137/231 (59%), Gaps = 26/231 (11%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            +S +SVP PFLTKTYQLVDD   D ++SW +D +TF+VW P  FARDLLP YFKHNNFSS
Sbjct  20   ESQRSVPTPFLTKTYQLVDDHTIDDVISWNDDGSTFIVWNPTVFARDLLPKYFKHNNFSS  79

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEF+N+ F+RGEK LLCEI RRK   P  A   +         
Sbjct  80   FVRQLNTYGFRKVVPDRWEFSNDCFRRGEKRLLCEIQRRKIMMPTTAAITV---------  130

Query  565  SFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
            S  +A    +  +SP +S DEQ                S VIS+ +S    G      A 
Sbjct  131  STMTAIPIAKPIISPSNSGDEQ----------------SPVISSTSSPSRPGQTGSVTAE  174

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPL  894
            L E+N +LR+ N  L  +LA M+ L N+I   + N+    + SS +   PL
Sbjct  175  LREENEKLRKENVQLNKQLAEMKSLCNNIFNLMSNYASSQSESSFAATKPL  225



>ref|XP_011099137.1| PREDICTED: heat shock factor protein HSF24 [Sesamum indicum]
Length=271

 Score =   193 bits (490),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 134/218 (61%), Gaps = 29/218 (13%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
              +SVPAPFLTKTY LVDDP TD ++SW E  TTFVVW+  EFA+DLLPNYFKHNNFSSF
Sbjct  2    GQRSVPAPFLTKTYHLVDDPKTDDVISWNEAGTTFVVWKTAEFAKDLLPNYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK VPD+WEFANE FKRGEK LL +I RRKTA  Q         +P     
Sbjct  62   VRQLNTYGFRKTVPDKWEFANENFKRGEKELLAQIRRRKTASTQ---------NP-----  107

Query  568  FFSAYNPGRLS--VSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
               +  PG      SP  S E L +++ +  DS +  S              + +  +A 
Sbjct  108  --GSGKPGAADNLASPASSGEDLGSSSTSSPDSKNPGS-----------LETHVSAQLAD  154

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            LS +N +LR+ N ML SELA  RK  +++I F+   VK
Sbjct  155  LSGENEKLRKDNQMLSSELAQTRKQCDELIAFLTQRVK  192



>ref|XP_011076201.1| PREDICTED: heat stress transcription factor B-2a-like [Sesamum 
indicum]
 ref|XP_011076202.1| PREDICTED: heat stress transcription factor B-2a-like [Sesamum 
indicum]
Length=346

 Score =   195 bits (496),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 135/230 (59%), Gaps = 31/230 (13%)
 Frame = +1

Query  178  NCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPN  357
            N  G   + D+ +++P PFLTKTYQLVDD A D ++SW ED +TF+VW P EFARDLLP 
Sbjct  9    NGGGESTAGDTPRTLPTPFLTKTYQLVDDHAIDDVISWNEDGSTFIVWNPTEFARDLLPK  68

Query  358  YFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHL  537
            YFKHNNFSSFVRQLNTYGFRKVVPDRWEF+NE F+RGEK LLC+I RRK           
Sbjct  69   YFKHNNFSSFVRQLNTYGFRKVVPDRWEFSNECFRRGEKKLLCDIQRRKIVTASSTA---  125

Query  538  HHHHPMNEPSFFSAYNPGRLS----VSPPDS-DEQLTANNNAWCDSPSFASSTVIsagns  702
                 +  PS   A  P   +    VSP DS +EQ+ +++N+      F+ ST       
Sbjct  126  -----VATPSAAVAVQPSPAAPPRTVSPSDSGEEQVISSSNSPATVREFSGSTA------  174

Query  703  gggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
                         L  +N RLR+ N  L  EL+ M+ L N+I   + N+ 
Sbjct  175  ------------ELIGENERLRKENVQLNKELSQMKSLCNNIYALMSNYA  212



>gb|AFQ93677.1| heat shock transcription factor HSFB2a [Glycine max]
Length=338

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 105/221 (48%), Positives = 136/221 (62%), Gaps = 42/221 (19%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            +S +S+P PFLTKT+QLVDD + D ++SW +D +TF+VW P  FARDLLP YFKHNNFSS
Sbjct  25   ESQRSIPTPFLTKTFQLVDDQSIDDVISWNDDGSTFIVWNPTVFARDLLPKYFKHNNFSS  84

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEF+NE+F+RGEK LLCEI RRK + P  +            P
Sbjct  85   FVRQLNTYGFRKVVPDRWEFSNEYFRRGEKRLLCEIQRRKISSPASSP---------TAP  135

Query  565  SFFSAYNPGRLS----VSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynng  729
            +  S   P  L+    +SP +S +EQ+T++N+    SP+                     
Sbjct  136  ATVSVTAPMPLTAIPIISPSNSGEEQVTSSNS----SPA---------------------  170

Query  730  svaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
                L ++N RLR+ N  LM ELA MR L N+I   + N+ 
Sbjct  171  ---ELLDENERLRKENVQLMKELAEMRSLCNNIYSLMSNYA  208



>gb|AII99897.1| heat shock transcription factor [Gossypium hirsutum]
Length=295

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 137/219 (63%), Gaps = 25/219 (11%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            + +SVPAPFL KTYQLVDDP TD+++SW E+ T+FVVW+  +FA+DLLPNYFKHNNFSSF
Sbjct  2    AQRSVPAPFLIKTYQLVDDPITDNVISWNENGTSFVVWKTADFAKDLLPNYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRKVVPD+WEFANE FKRG+K LL EI RRKT              P N P+
Sbjct  62   VRQLNTYGFRKVVPDKWEFANENFKRGQKELLSEIRRRKTVTT----------SPANNPA  111

Query  568  FFSAYNPGRLSVSPPDSDEQLTANNNAW---CDSPSFASSTVIsagnsgggggynngsva  738
              +    G  + SP +S E L + + +      +P    +T             N    A
Sbjct  112  --NGKTSGAGASSPTNSGEDLGSTSTSTSPESKNPGSVETT----------PAVNTNQYA  159

Query  739  aLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
             LS++N +L++ N ML SELA  +K  ++++ F+   VK
Sbjct  160  DLSDENEKLKKDNEMLSSELAQAKKQCDELVAFLTECVK  198



>ref|XP_004984281.1| PREDICTED: heat stress transcription factor B-4d-like [Setaria 
italica]
Length=312

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  220  VPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQL  399
            VPAPFLTKT+QLVDDP TDH+VSWGED +TFVVWRPPEFARDLLPNYFKHNNFSSFVRQL
Sbjct  34   VPAPFLTKTFQLVDDPRTDHVVSWGEDGSTFVVWRPPEFARDLLPNYFKHNNFSSFVRQL  93

Query  400  NTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTA  510
            NTYGFRK+V DRWEFANEFFK+G KHLL EIHRRK++
Sbjct  94   NTYGFRKIVADRWEFANEFFKKGAKHLLSEIHRRKSS  130


 Score = 67.4 bits (163),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            LSEDN  LRR N++L+SELAHMR+LYNDIIYF+QNHV+
Sbjct  181  LSEDNRELRRRNSLLLSELAHMRRLYNDIIYFLQNHVE  218



>gb|KCW72116.1| hypothetical protein EUGRSUZ_E00555 [Eucalyptus grandis]
Length=316

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 145/233 (62%), Gaps = 16/233 (7%)
 Frame = +1

Query  196  LSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNN  375
            ++ DS +S+P PFLTKTYQLVDDP  D ++SW ED TTF+VWRP EFARDLLP YFKHNN
Sbjct  11   VAGDSQRSLPTPFLTKTYQLVDDPGVDDLISWNEDGTTFIVWRPAEFARDLLPKYFKHNN  70

Query  376  FSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPM  555
            FSSFVRQLNTYGFRKVVPDRWEFAN+ F++GEK LL +I RRK +    A          
Sbjct  71   FSSFVRQLNTYGFRKVVPDRWEFANDCFRKGEKALLRDIQRRKISPTAAAAGAAAVTVAA  130

Query  556  NEPSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsggg--ggynn  726
               +         L+VSP +S DEQ+ +++     SP  A +T   A  S        + 
Sbjct  131  VGVAG--------LTVSPANSGDEQVISSS-----SPPVALATAAVAAASPSVVHRSPSC  177

Query  727  gsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYP  885
             +   L E+N RL++ N  +  EL+ +R L N+I+  + N+V   + SS++ P
Sbjct  178  TTAPELLEENERLKKENMQMSQELSQLRGLCNNILSLMANYVSRQSDSSSAAP  230



>ref|XP_011081009.1| PREDICTED: heat stress transcription factor B-2b [Sesamum indicum]
Length=311

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 138/229 (60%), Gaps = 22/229 (10%)
 Frame = +1

Query  211  HKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFV  390
             +SVP PFLTKTYQLVDDP+ D  +SW ED TTF+VWRP EFARDLLP YFKHNNFSSFV
Sbjct  21   QRSVPTPFLTKTYQLVDDPSIDDFISWNEDGTTFIVWRPAEFARDLLPKYFKHNNFSSFV  80

Query  391  RQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPSF  570
            RQLNTYGFRKVVPDRWEFAN+ F+RGEK LL +I RRK +    A          NE S 
Sbjct  81   RQLNTYGFRKVVPDRWEFANDCFRRGEKSLLRDIQRRKISAGAAAAATTAIE--CNEHSI  138

Query  571  FSAYNPG-RLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaL  744
              A  PG  + +SP +S D+Q+ ++N++   + +  +  V+                A +
Sbjct  139  TVAVAPGTGIKISPANSGDKQVLSSNSSPAATAATPTPPVL--------------RAAEI  184

Query  745  SEDNVRLRRSNNMLMSELAHMRKL----YNDIIYFVQNHVKPVTPSSNS  879
             E+N RLRR N  L  EL  +R L    YN +  +  N  +   P + +
Sbjct  185  LEENERLRRENWQLRQELNQLRSLCGNIYNLMSIYATNQCEAALPEARA  233



>ref|XP_008680871.1| PREDICTED: heat shock factor protein 7 isoform X1 [Zea mays]
 tpg|DAA48372.1| TPA: heat shock factor protein 7 [Zea mays]
 gb|AIB04797.1| HSF transcription factor, partial [Zea mays]
Length=414

 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 127/222 (57%), Gaps = 22/222 (10%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
              +SVP PFLTKTYQLVDDPA D ++SW +D + F+VWRP EFARDLLP YFKHNNFSSF
Sbjct  64   GQRSVPTPFLTKTYQLVDDPAVDDVISWNDDGSAFIVWRPAEFARDLLPKYFKHNNFSSF  123

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLC+IHRRK   P  A              
Sbjct  124  VRQLNTYGFRKIVPDRWEFANDCFRRGEKRLLCDIHRRKVTLPVAAA---------TRAV  174

Query  568  FFSAYNPGRLSVSPP--DSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
               A  P  L V  P    +EQ+ +           +SS+             +      
Sbjct  175  TVVATIPMALPVDSPVYSGEEQVLS-----------SSSSPEPPSLLQQQPTPSASGSGD  223

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTP  867
            + E+N RLRR N  L  EL  M+KL N+I+  +  +     P
Sbjct  224  MGEENERLRRENAWLARELGQMKKLCNNILLLMSKYAATKQP  265



>ref|XP_001776501.1| predicted protein [Physcomitrella patens]
 gb|EDQ58634.1| predicted protein [Physcomitrella patens]
Length=92

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/92 (92%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  229  PFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY  408
            PFLTKTY LVDDPATD IVSWGED+TTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY
Sbjct  1    PFLTKTYHLVDDPATDDIVSWGEDETTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY  60

Query  409  GFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK  504
            GFRK+VPD WEFAN+FF+RGEKHLLCEIHRRK
Sbjct  61   GFRKIVPDHWEFANKFFRRGEKHLLCEIHRRK  92



>gb|KHG06980.1| Heat stress transcription factor B-2b -like protein [Gossypium 
arboreum]
Length=311

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 131/216 (61%), Gaps = 26/216 (12%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFLTKTYQLVDDP+ D ++SW ED +TF+VWRP EFARDLLP YFKHNNFSS
Sbjct  19   DSQRSLPTPFLTKTYQLVDDPSVDDMISWNEDGSTFIVWRPAEFARDLLPKYFKHNNFSS  78

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ F+RGEK LL +I RRK      A         +  P
Sbjct  79   FVRQLNTYGFRKVVPDRWEFANDCFRRGEKGLLRDIQRRKMTPTTTAPAATVTVAAI--P  136

Query  565  SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaL  744
               S  N G         DEQ+ ++N     SP  A  TV+            + +   L
Sbjct  137  CKVSPSNSG---------DEQVISSN-----SPPLA--TVL--------YRTTSSTTPEL  172

Query  745  SEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
             E+N RLR+ N  L  EL  ++ L N+I+  + N+ 
Sbjct  173  LEENERLRKENMQLNHELTQLKGLCNNILTLMTNYA  208



>ref|XP_003611134.1| Heat stress transcription factor B-2b [Medicago truncatula]
 gb|ACJ85855.1| unknown [Medicago truncatula]
 gb|AES94092.1| heat shock transcription factor B2A [Medicago truncatula]
Length=359

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 134/216 (62%), Gaps = 14/216 (6%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            +S +S+P PFLTKTYQLVDD + D +VSW ED T+F+VW+P EFARDLLP YFKHNNFSS
Sbjct  16   ESQRSIPTPFLTKTYQLVDDSSVDDLVSWNEDGTSFIVWKPAEFARDLLPKYFKHNNFSS  75

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ F+RGEK+LL +I RRK                    
Sbjct  76   FVRQLNTYGFRKVVPDRWEFANDGFRRGEKNLLRDIQRRKILPAAGTAMATAVAAANTVT  135

Query  565  SFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
               +A  P R+ VSP  S DEQ+ ++N          SS +     +      +  +   
Sbjct  136  VAMAA--PVRM-VSPATSGDEQVVSSN----------SSPIAVNNGATVQRSTSCTTAPE  182

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
            L E+N RL++ N  L +EL+ ++ L N+I+  + N+
Sbjct  183  LVEENERLKKENMQLSNELSQLKGLCNNILAMMSNY  218



>ref|XP_008800793.1| PREDICTED: heat stress transcription factor B-2b-like [Phoenix 
dactylifera]
Length=338

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/304 (38%), Positives = 157/304 (52%), Gaps = 35/304 (12%)
 Frame = +1

Query  208   SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
               +S+P PFLTKTYQLVDDP+ D ++SW +D + F+VWRP +FARDLLP YFKHNNFSSF
Sbjct  24    GQRSLPTPFLTKTYQLVDDPSVDDVISWNDDGSAFIVWRPADFARDLLPKYFKHNNFSSF  83

Query  388   VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
             VRQLNTYGFRK+VPDRWEFAN+ F+RGEK LL +IHRRK   PQV         P+    
Sbjct  84    VRQLNTYGFRKIVPDRWEFANDCFRRGEKQLLRDIHRRKIT-PQVG------PAPVPGAM  136

Query  568   FFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLS  747
                   P     SP +S E+   ++N+   +P  + S                     L 
Sbjct  137   LIPVAEPANRVGSPANSGEEQVLSSNSSPGAPPPSGSAA------------------ELR  178

Query  748   EDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQLVT  927
             ++N RLR+ N+ L  E + M+ L N+I+  +  +      SS            ++    
Sbjct  179   DENERLRKENSRLSREFSQMKNLCNNILLLISKYT-----SSQQQGGGEGGGGEVAATTA  233

Query  928   YPHPHPPT-KHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKK-RLHPDQ  1101
                  PP  +  P    +   +     VT+   P +A  C  +LFG  +  K+ R   D 
Sbjct  234   VVEVAPPVLELMPAAEEAEEGRLKAEEVTI--SPSSAGPC-ARLFGVSIGVKRVRGEDDG  290

Query  1102  YSPP  1113
              +PP
Sbjct  291   ENPP  294



>ref|XP_009409313.1| PREDICTED: heat stress transcription factor B-4c isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=307

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 1/101 (1%)
 Frame = +1

Query  211  HKSVPAPFLTKTYQLVDDPATDHIVSWGEDD-TTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            HK VPAPFLTKTYQLVDDPATDHIVSWG+D  +TFVVWRP EFARD+LPNYFKHNNFSSF
Sbjct  25   HKPVPAPFLTKTYQLVDDPATDHIVSWGDDRVSTFVVWRPSEFARDVLPNYFKHNNFSSF  84

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTA  510
            VRQLNTYGFRKVVP+RWEFANEFF++GEK LLCEIHRRKT 
Sbjct  85   VRQLNTYGFRKVVPERWEFANEFFRKGEKELLCEIHRRKTC  125



>gb|AFK40914.1| unknown [Medicago truncatula]
Length=359

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 134/216 (62%), Gaps = 14/216 (6%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            +S +S+P PFLTKTYQLVDD + D +VSW ED T+F+VW+P EFARDLLP YFKHNNFSS
Sbjct  16   ESQRSIPTPFLTKTYQLVDDSSVDDLVSWNEDGTSFIVWKPAEFARDLLPKYFKHNNFSS  75

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ F+RGEK+LL +I RRK                    
Sbjct  76   FVRQLNTYGFRKVVPDRWEFANDGFRRGEKNLLRDIQRRKILPAAGTAMATAVAAANTVT  135

Query  565  SFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
               +A  P R+ VSP  S DEQ+ ++N          SS +     +      +  +   
Sbjct  136  VAMAA--PVRM-VSPATSGDEQVVSSN----------SSPIAVNNGATVQRSTSCTTAPE  182

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
            L E+N RL++ N  L +EL+ ++ L N+I+  + N+
Sbjct  183  LVEENERLKKENMQLSNELSQLKGLCNNILAMMSNY  218



>ref|XP_010550365.1| PREDICTED: heat shock factor protein HSF24-like [Tarenaya hassleriana]
Length=281

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 134/215 (62%), Gaps = 28/215 (13%)
 Frame = +1

Query  211  HKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFV  390
             +SVPAPFL KTYQLVDDP TD +VSW ED + FVVW+  +F+RDLLP +FKHNNFSSFV
Sbjct  6    QRSVPAPFLVKTYQLVDDPTTDDVVSWNEDGSAFVVWKTADFSRDLLPRFFKHNNFSSFV  65

Query  391  RQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPSF  570
            RQLNTYGFRKVVPD+WEFANE F+RG+K LL EI RRK A             PM+  + 
Sbjct  66   RQLNTYGFRKVVPDKWEFANENFRRGQKELLSEIRRRKPA------------APMSSTAV  113

Query  571  FSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLSE  750
             SA     LS S  +S ++L + + ++ D  + AS T                  A LS 
Sbjct  114  NSAGAGAGLS-SQSNSGDELGSTSTSFPDPNNPASVTT---------------QFAELSG  157

Query  751  DNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            +N +LRRSN +L SELA  +K   +++ F+   +K
Sbjct  158  ENEKLRRSNEILSSELASAKKQCEELVAFLSEFLK  192



>ref|NP_001152384.1| heat shock factor protein 7 [Zea mays]
 gb|ACG47338.1| heat shock factor protein 7 [Zea mays]
Length=377

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 127/222 (57%), Gaps = 22/222 (10%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
              +SVP PFLTKTYQLVDDPA D ++SW +D + F+VWRP EFARDLLP YFKHNNFSSF
Sbjct  29   GQRSVPTPFLTKTYQLVDDPAVDDVISWNDDGSAFIVWRPAEFARDLLPKYFKHNNFSSF  88

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPDRWEFAN+ F+RG+K LLC+IHRRK   P  A              
Sbjct  89   VRQLNTYGFRKIVPDRWEFANDCFRRGQKRLLCDIHRRKVTLPVAAA---------TRAV  139

Query  568  FFSAYNPGRLSVSPP--DSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
               A  P  L V  P    +EQ+ +           +SS+             +      
Sbjct  140  TVVATIPMALPVDSPVYSGEEQVLS-----------SSSSPEPPSLLQQQPTPSASGSGD  188

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTP  867
            + E+N RLRR N  L  EL  M+KL N+I+  +  +     P
Sbjct  189  MGEENERLRRENAWLARELGQMKKLCNNILLLMSKYAATKQP  230



>ref|XP_007040151.1| Winged-helix DNA-binding transcription factor family protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOY24652.1| Winged-helix DNA-binding transcription factor family protein, 
putative isoform 1 [Theobroma cacao]
Length=314

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 119/293 (41%), Positives = 155/293 (53%), Gaps = 44/293 (15%)
 Frame = +1

Query  205   DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
             DS +S+P PFLTKTYQLVDDP+ D ++SW +D +TF+VWRP EFARDLLP YFKHNNFSS
Sbjct  19    DSQRSLPTPFLTKTYQLVDDPSVDDLISWNDDGSTFIVWRPAEFARDLLPKYFKHNNFSS  78

Query  385   FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
             FVRQLNTYGFRKVVPDRWEFAN+ F+RGEK LL +I RRK          +         
Sbjct  79    FVRQLNTYGFRKVVPDRWEFANDCFRRGEKGLLRDIQRRK----------ITPAAAAASA  128

Query  565   SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaL  744
             +   A  P +  VSP +SDEQ+ ++N     SP   +               +  +   L
Sbjct  129   TVTVAAVPCK--VSPSNSDEQVISSN-----SPPVVAVV---------HRTTSCTTTPEL  172

Query  745   SEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQLV  924
              E+N RLR+ N  L  EL  ++ L N+I+  + N+           PS L   K L  L 
Sbjct  173   LEENERLRKENMQLNHELTQLKGLCNNILTLMTNYAS----GQLENPSNLAEGKALDLL-  227

Query  925   TYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKK  1083
                         P  N +   +   S   +  +  A D+   KLFG  +  K+
Sbjct  228   ------------PARNSAGTAEDGGSKGAMAMEEEADDVT-PKLFGVSIGVKR  267



>ref|XP_009415832.1| PREDICTED: heat stress transcription factor B-2a-like [Musa acuminata 
subsp. malaccensis]
Length=346

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 122/303 (40%), Positives = 158/303 (52%), Gaps = 34/303 (11%)
 Frame = +1

Query  211   HKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFV  390
              +++P PFLTKTYQLVDDP  D ++SW ED +TFVVWRP EFARDLLP +FKHNNFSSFV
Sbjct  17    QRALPTPFLTKTYQLVDDPEMDDVISWNEDGSTFVVWRPAEFARDLLPKHFKHNNFSSFV  76

Query  391   RQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPSF  570
             RQLNTYGFRK+VPDRWEFAN++F+RGEK LL EIHRRK      AV       P    S 
Sbjct  77    RQLNTYGFRKIVPDRWEFANDYFRRGEKRLLREIHRRK------AVTVAPQPAPAAAASR  130

Query  571   FSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLS  747
              +A      + SP +S +EQ+ +++++    P+ A                    VA L 
Sbjct  131   MTALV--SRARSPTNSGEEQVLSSDSSSGPFPTVAVGPC---------------GVAELG  173

Query  748   EDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQLVT  927
             E+N RLR+ N  L  E+A M+ L   I   +  HV     S            P  +L+ 
Sbjct  174   EENERLRKENERLAREVAQMKSLCGQIASLISRHV-----SDRQEGGGGAEAAPFLELM-  227

Query  928   YPHPHPPTKHQPVFN-LSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQY  1104
                P  P   +  +N +           T  E PP+      +LFG  +  K+    D  
Sbjct  228   ---PARPGAEEAFYNEVEEEEDVKPEDATSEEVPPSPPGASPRLFGVSIGVKRPRSEDGD  284

Query  1105  SPP  1113
              PP
Sbjct  285   GPP  287



>ref|XP_008652977.1| PREDICTED: heat stress transcription factor B-2c-like [Zea mays]
 tpg|DAA62420.1| TPA: hypothetical protein ZEAMMB73_805208 [Zea mays]
 gb|AIB04896.1| HSF transcription factor, partial [Zea mays]
Length=394

 Score =   195 bits (495),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 138/221 (62%), Gaps = 17/221 (8%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
              +S+P PFLTKTYQLVDDPA D ++SW ED +TFVVWRP EFARDLLP YFKHNNFSSF
Sbjct  37   GQRSLPTPFLTKTYQLVDDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSF  96

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPDRWEFAN+FF+RGEK LLC+IHRRK A    A          +   
Sbjct  97   VRQLNTYGFRKMVPDRWEFANDFFRRGEKRLLCDIHRRKVAPAPAAGLATAAAAAASGAV  156

Query  568  FFSAY-NPGRLSVSPP----DSDEQ-LTANNNAWCDSPSFASSTVIsagnsgggggynng  729
              +A   P  L V P      +DE  L++N+ +  D P  A+S  +SA  SG        
Sbjct  157  TVAAAPIPMALPVRPASPSLSTDEHVLSSNSGSAEDHPQAAASGSVSASASGDT------  210

Query  730  svaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
                  E+N RLRR N  L  EL  M+KL N+I+  +  + 
Sbjct  211  -----GEENERLRRENARLTRELGQMKKLCNNILLLMTKYA  246



>gb|AII99900.1| heat shock transcription factor [Gossypium hirsutum]
Length=310

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 134/216 (62%), Gaps = 29/216 (13%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFL+KTYQLVD+ + D ++SW +D +TF+VWRP EFARDLLP YFKHNNFSS
Sbjct  20   DSQRSLPTPFLSKTYQLVDNSSVDDLISWNDDGSTFIVWRPAEFARDLLPKYFKHNNFSS  79

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ FKRGEK LL +I RRK           H+   M   
Sbjct  80   FVRQLNTYGFRKVVPDRWEFANDCFKRGEKGLLRDIQRRKIT---------HNASGMTIA  130

Query  565  SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaL  744
            +     +P         SDEQ+ ++N     SP  A  TV+           +  + A L
Sbjct  131  AVACKPSPSN------SSDEQVISSN-----SPPVA--TVL-------NRTTSCTTTAEL  170

Query  745  SEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
             E+N RLR+ N  L  EL  +++LYN+I+  + N+ 
Sbjct  171  LEENERLRKENMQLNHELTQLKRLYNNIVILMTNYA  206



>ref|XP_003533211.1| PREDICTED: heat stress transcription factor B-2b-like [Glycine 
max]
Length=338

 Score =   192 bits (489),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 135/221 (61%), Gaps = 42/221 (19%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            +S +S+P PFLTKT+QLVDD + D ++SW +D +TF+VW P  FARDLLP YFKHNNFSS
Sbjct  25   ESQRSIPTPFLTKTFQLVDDQSIDDVISWNDDGSTFIVWNPTVFARDLLPKYFKHNNFSS  84

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEF+NE+F+RGEK LLCEI RRK + P  +            P
Sbjct  85   FVRQLNTYGFRKVVPDRWEFSNEYFRRGEKRLLCEIQRRKISSPASSP---------TAP  135

Query  565  SFFSAYNPGRLS----VSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynng  729
            +  S   P  L+    +SP +S +EQ+T++N+    SP+                     
Sbjct  136  ATVSVTAPMPLTAIPIISPSNSGEEQVTSSNS----SPA---------------------  170

Query  730  svaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
                L ++N RLR+ N  L  ELA MR L N+I   + N+ 
Sbjct  171  ---ELLDENERLRKENVQLTKELAEMRSLCNNIYSLMSNYA  208



>ref|XP_010055608.1| PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor 
B-2b [Eucalyptus grandis]
Length=340

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 145/233 (62%), Gaps = 16/233 (7%)
 Frame = +1

Query  196  LSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNN  375
            ++ DS +S+P PFLTKTYQLVDDP  D ++SW ED TTF+VWRP EFARDLLP YFKHNN
Sbjct  11   VAGDSQRSLPTPFLTKTYQLVDDPGVDDLISWNEDGTTFIVWRPAEFARDLLPKYFKHNN  70

Query  376  FSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPM  555
            FSSFVRQLNTYGFRKVVPDRWEFAN+ F++GEK LL +I RRK +    A          
Sbjct  71   FSSFVRQLNTYGFRKVVPDRWEFANDCFRKGEKALLRDIQRRKISPTAAAAGAAAVTVAA  130

Query  556  NEPSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsggg--ggynn  726
               +         L+VSP +S DEQ+ +++     SP  A +T   A  S        + 
Sbjct  131  VGVAG--------LTVSPANSGDEQVISSS-----SPPVALATAAVAAASPSVVHRSPSC  177

Query  727  gsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYP  885
             +   L E+N RL++ N  +  EL+ +R L N+I+  + N+V   + SS++ P
Sbjct  178  TTAPELLEENERLKKENMQMSQELSQLRGLCNNILSLMANYVSRQSDSSSAAP  230



>ref|XP_009803855.1| PREDICTED: heat stress transcription factor B-2b-like [Nicotiana 
sylvestris]
 ref|XP_009803856.1| PREDICTED: heat stress transcription factor B-2b-like [Nicotiana 
sylvestris]
 ref|XP_009803857.1| PREDICTED: heat stress transcription factor B-2b-like [Nicotiana 
sylvestris]
Length=333

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 119/299 (40%), Positives = 155/299 (52%), Gaps = 41/299 (14%)
 Frame = +1

Query  205   DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
             ++ +SVP PFLTKTYQLV+DP+ D +VSW ED +TF+VW P EFARDLLP YFKHNNFSS
Sbjct  17    ETARSVPTPFLTKTYQLVEDPSIDDVVSWNEDGSTFIVWNPTEFARDLLPKYFKHNNFSS  76

Query  385   FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
             FVRQLNTYGFRKVVPDRWEF+N+ F+RG+K LL +I RRK   P +A         +   
Sbjct  77    FVRQLNTYGFRKVVPDRWEFSNDCFRRGDKSLLRDIQRRKVVTP-IATPCAAVTAVVTVA  135

Query  565   SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaL  744
             +  +      +S S    DEQ+ ++N       S A  T                    L
Sbjct  136   APPAQPPRPVISTSDS-GDEQVVSSN-------SSAGGTA------------------GL  169

Query  745   SEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQLV  924
               +N RLR+ N  L  EL+ MR L  +I   + N+  P T  + S  S     KPL  L 
Sbjct  170   LGENERLRKENLQLNKELSQMRSLCGNIYSLMSNYADPSTSGNQSAESTSPAAKPLDLL-  228

Query  925   TYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQ  1101
                   PP +     +++       S     ED       R +LFGF +  K+    D+
Sbjct  229   ------PPKRSVDESDINKAVGDGGSRAE-PED------IRARLFGFSIGMKRAREGDE  274



>dbj|BAK04233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 130/223 (58%), Gaps = 26/223 (12%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
              +S+P PFL KTYQLVDDPA D ++SW ED + FVVWRP EFARDLLP YFKHNNFSSF
Sbjct  40   GQRSLPTPFLNKTYQLVDDPAVDDVISWSEDGSAFVVWRPAEFARDLLPKYFKHNNFSSF  99

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLC+IHRRK      A   +        P 
Sbjct  100  VRQLNTYGFRKIVPDRWEFANDCFRRGEKRLLCDIHRRKVTPTVAATAAVTVAAAAAIPV  159

Query  568  FFSAYNPGRLSVSPPDSDEQLTANN--------NAWCDSPSFASSTVIsagnsgggggyn  723
                    R        DEQ+ +++        N +  +PS++ S  +            
Sbjct  160  ALPVTK--RQGSPVLSGDEQVLSSSSSPEPPFLNQY--APSYSGSGGV------------  203

Query  724  ngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
              +   L E+N+RLRR N+ L  EL  M+KL N+I   +  + 
Sbjct  204  --ASGDLGEENLRLRRENSRLTRELGQMKKLCNNIFVLMSKYT  244



>ref|XP_006440567.1| hypothetical protein CICLE_v10021287mg [Citrus clementina]
 gb|ESR53807.1| hypothetical protein CICLE_v10021287mg [Citrus clementina]
Length=309

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 137/217 (63%), Gaps = 23/217 (11%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFLTKTYQLVDDP+ D +++W  D +TF+VWRP EFARDLLP YFKHNNFSS
Sbjct  16   DSQRSLPTPFLTKTYQLVDDPSVDDLIAWNSDGSTFIVWRPAEFARDLLPKYFKHNNFSS  75

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ F+RGEK LL +I RRK +    A             
Sbjct  76   FVRQLNTYGFRKVVPDRWEFANDCFRRGEKGLLRDIQRRKISPSPAA----------GTA  125

Query  565  SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP-SFASSTVIsagnsgggggynngsvaa  741
               +     R S+SP +S E+   + N+   SP +  ++TVI           +  ++  
Sbjct  126  GTVTVAAVAR-SISPANSGEEQVISANS---SPVAVPTTTVI--------RTTSCTTMPE  173

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            L E+N +LR+ N  L +EL+ ++ L N+I+  + N+ 
Sbjct  174  LLEENEKLRKENAQLNNELSQLKGLCNNILALMTNYA  210



>ref|XP_004143930.1| PREDICTED: heat stress transcription factor B-2b-like [Cucumis 
sativus]
 ref|XP_004173974.1| PREDICTED: heat stress transcription factor B-2b-like [Cucumis 
sativus]
 gb|KGN50137.1| hypothetical protein Csa_5G155480 [Cucumis sativus]
Length=341

 Score =   192 bits (489),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 135/220 (61%), Gaps = 24/220 (11%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFLTKTYQLVDDPA D ++SW ED +TF+VWRP EFARDLLP YFKHNNFSS
Sbjct  16   DSQRSIPTPFLTKTYQLVDDPAVDDLISWNEDGSTFIVWRPAEFARDLLPKYFKHNNFSS  75

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ F++GEK LL +I RRK                +   
Sbjct  76   FVRQLNTYGFRKVVPDRWEFANDCFRKGEKGLLRDIQRRKVVLSVTTTTTTSAAVAVPVT  135

Query  565  SFFSAYNPGRLS--VSPPDS-DEQLTANNNAWCDSP-SFASSTVIsagnsgggggynngs  732
               S   P  L+  +SP +S +EQ+T++N+    SP +F  ST                +
Sbjct  136  VATS---PAVLAHVISPANSAEEQVTSSNS----SPMAFQRSTSC-------------TT  175

Query  733  vaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
               L  +N RLR+ N  L  EL  ++ L N+I+  + N+ 
Sbjct  176  TPELVRENERLRKENMQLSHELTQLKGLCNNILSLMTNYA  215



>gb|AFI61331.1| HSF3 [Triticum aestivum]
Length=314

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 132/224 (59%), Gaps = 28/224 (13%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
              +S+P PFL KTYQLVDDPA D ++SW ED + F+VWRP EFARDLLP YFKHNNFSSF
Sbjct  24   GQRSLPTPFLNKTYQLVDDPAVDDVISWSEDGSAFIVWRPAEFARDLLPKYFKHNNFSSF  83

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLC+IHRRK      A   +        P 
Sbjct  84   VRQLNTYGFRKIVPDRWEFANDCFRRGEKRLLCDIHRRKVTPTVAATAAVTVAAAAAIPV  143

Query  568  FF-SAYNPGRLSVSPPDSDEQLTANN--------NAWCDSPSFASSTVIsagnsgggggy  720
                A   G   +S    DEQ+ +++        N +  +PS++ S  +           
Sbjct  144  ALPVAKRQGSPVLS---GDEQVLSSSSSPEPPFLNQY--APSYSGSGGV-----------  187

Query  721  nngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
               +   L E+N RLRR N+ L  EL  M+KL N+I   +  + 
Sbjct  188  ---ASGDLGEENERLRRENSRLTRELGQMKKLCNNIFVLMSKYT  228



>ref|XP_010255485.1| PREDICTED: heat stress transcription factor B-2b-like [Nelumbo 
nucifera]
Length=314

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 130/216 (60%), Gaps = 23/216 (11%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            D  +S+P PFLTKTYQLVDDP+ D ++SW ED +TF+VWRP EFARDLLP YFKHNNFSS
Sbjct  16   DGQRSLPTPFLTKTYQLVDDPSIDDVISWNEDGSTFIVWRPAEFARDLLPKYFKHNNFSS  75

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLC+IHRRK +    A        P+   
Sbjct  76   FVRQLNTYGFRKIVPDRWEFANDCFRRGEKKLLCDIHRRKISPAVTAAAVTTTAFPV---  132

Query  565  SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaL  744
                A +P         SDEQ+  + +   + P+ A                +  S A L
Sbjct  133  --VRAGSPTN------SSDEQVVTSTSPPSNVPATACRAT------------SCNSAAEL  172

Query  745  SEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
             ++N RLR+ N  L  EL  ++ L N I+  +  + 
Sbjct  173  LDENERLRKENMHLKHELTQLKNLCNSILVLMTKYA  208



>ref|XP_006826240.1| hypothetical protein AMTR_s00132p00118400 [Amborella trichopoda]
 gb|ERM93477.1| hypothetical protein AMTR_s00132p00118400 [Amborella trichopoda]
Length=278

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  214  KSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVR  393
            + VPAPFL+KTYQLVDDPATD +VSW E+ +TFVVWRP EFARDLLPNYFKHNNFSSFVR
Sbjct  9    RQVPAPFLSKTYQLVDDPATDEVVSWNEEGSTFVVWRPAEFARDLLPNYFKHNNFSSFVR  68

Query  394  QLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVA  525
            QLNTYGFRK+VPDRWEF+N+FF+RGEK LLCEIHRRK +   + 
Sbjct  69   QLNTYGFRKIVPDRWEFSNDFFRRGEKALLCEIHRRKASTVAIC  112



>ref|XP_011029218.1| PREDICTED: heat stress transcription factor B-2b [Populus euphratica]
 ref|XP_011029219.1| PREDICTED: heat stress transcription factor B-2b [Populus euphratica]
Length=340

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/224 (46%), Positives = 137/224 (61%), Gaps = 21/224 (9%)
 Frame = +1

Query  199  SLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNF  378
            S DS +S+P PFLTKTYQLVDDP+ D ++SW +D +TF+VWRP EFARDLLP YFKHNNF
Sbjct  29   SGDSQRSLPTPFLTKTYQLVDDPSVDDLISWNDDGSTFIVWRPAEFARDLLPKYFKHNNF  88

Query  379  SSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMN  558
            SSFVRQLNTYGFRKVVPDRWEFAN+ F+RGEK LL +I RRK +                
Sbjct  89   SSFVRQLNTYGFRKVVPDRWEFANDCFRRGEKALLRDIQRRKIS----------------  132

Query  559  EPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASST----VIsagnsgggggynn  726
             P   SA  P  ++V+   +  +  +  N+  D    ++S+      + G +      + 
Sbjct  133  -PMAASAVTPASVTVAAIPTVARAVSPANSGDDQGISSTSSPGGAGTAGGANSFLRTTSC  191

Query  727  gsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKP  858
             +   + E+N RLR+ N+ L  EL  +R L N+I+  + N+  P
Sbjct  192  TTTPEILEENERLRKENSALSHELTQLRGLCNNIMVLMNNYASP  235



>gb|AIG20087.1| HSF20 [Gossypium hirsutum]
Length=326

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 136/226 (60%), Gaps = 24/226 (11%)
 Frame = +1

Query  178  NCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPN  357
            N +    + +S +S+P PFLTKTYQLVDD   D ++SW +D +TF+VW P  FARDLLP 
Sbjct  9    NGDATTGTAESQRSIPTPFLTKTYQLVDDHTIDDVISWNDDGSTFIVWNPTVFARDLLPK  68

Query  358  YFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHL  537
            YFKHNNFSSFVRQLNTYGFRKVVPDRWEF+N++F+RGEK LLCEI RRK + P  A   +
Sbjct  69   YFKHNNFSSFVRQLNTYGFRKVVPDRWEFSNDYFRRGEKRLLCEIQRRKISSPTAAAVTV  128

Query  538  HHHHPMNEPSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggg  714
                    P   +A    +  +SP +S DEQ                S VIS+ +S    
Sbjct  129  A-------PVTVAAIPMAKPIISPSNSGDEQ----------------SPVISSASSPSRL  165

Query  715  gynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
                  +A L ++N +LR+ N  L  +L+ M+ L N+I   + N+ 
Sbjct  166  NQAGTVMAELMKENEKLRKENVQLNKQLSEMKSLCNNIFSLMSNYA  211



>ref|XP_002872608.1| hypothetical protein ARALYDRAFT_911518 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48867.1| hypothetical protein ARALYDRAFT_911518 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/240 (47%), Positives = 141/240 (59%), Gaps = 8/240 (3%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFLTKTYQLV+DP  D ++SW ED TTF+VWRP EFARDLLP YFKHNNFSS
Sbjct  51   DSQRSIPTPFLTKTYQLVEDPVYDELISWNEDGTTFIVWRPAEFARDLLPKYFKHNNFSS  110

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP-QVAVDHLHHHHPMNE  561
            FVRQLNTYGFRKVVPDRWEF+N+ FKRGEK LL +I RRK +QP   A         +  
Sbjct  111  FVRQLNTYGFRKVVPDRWEFSNDCFKRGEKILLRDIQRRKISQPALAAAAAAAAAAVVAS  170

Query  562  PSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
                +A      +VSP +S E+   ++N+   SP+ A++ +            +  +   
Sbjct  171  AVTVAAVPVVAHAVSPSNSGEEQVISSNS---SPAAAAAAIGGVVGGSLQRTTSCITAPE  227

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQL  921
            L E+N RLR+ N  L  EL   + LY +I   + N     TP        L   KPL  L
Sbjct  228  LVEENERLRKDNERLRRELTKYKGLYANIYTLMAN----FTPGREDCAHLLAEGKPLDLL  283



>ref|XP_001755703.1| predicted protein [Physcomitrella patens]
 gb|EDQ79376.1| predicted protein [Physcomitrella patens]
Length=92

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +1

Query  229  PFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY  408
            PFLTKTY LV DP+T+ IVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY
Sbjct  1    PFLTKTYHLVSDPSTNEIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY  60

Query  409  GFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK  504
            GFRKVVPDRWEFAN+FF+RGE+HLLCEI+RRK
Sbjct  61   GFRKVVPDRWEFANDFFRRGERHLLCEIYRRK  92



>ref|XP_008234272.1| PREDICTED: heat stress transcription factor B-2a [Prunus mume]
Length=303

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/229 (45%), Positives = 136/229 (59%), Gaps = 32/229 (14%)
 Frame = +1

Query  211  HKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFV  390
            H+++P PFLTKTYQLVDDP  D ++SW +D ++FVVW P  FARDLLP YFKHNNFSSFV
Sbjct  20   HRALPTPFLTKTYQLVDDPTIDDVISWNDDGSSFVVWNPTVFARDLLPKYFKHNNFSSFV  79

Query  391  RQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPSF  570
            RQLNTYGFRKV+PDRWEF+N+ F+RGEK LLCEI RR+   P  AV       PM   + 
Sbjct  80   RQLNTYGFRKVIPDRWEFSNDCFRRGEKRLLCEIQRRRIMPPAPAV----AVSPMATAAV  135

Query  571  FSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLS  747
                 P    +SP +S +EQ+ +++++   +PS                         L 
Sbjct  136  VPNAKP---MISPSNSGEEQVISSSSSPIRAPS------------------------ELM  168

Query  748  EDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPL  894
            ++N +LR+ N  L  ELA ++ L N+I   V N+    + S   Y  PL
Sbjct  169  DENEKLRKENMQLTKELADVKSLCNNIFSMVSNYAYAQSESGFPYVKPL  217



>gb|KHG26651.1| Heat shock factor HSF24 [Gossypium arboreum]
Length=284

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/312 (38%), Positives = 158/312 (51%), Gaps = 55/312 (18%)
 Frame = +1

Query  208   SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
             + +SVPAPFLTKTYQLVDDP TD+++SW E+ T+FVVW+  +FA+DLLP YFKHNNFSSF
Sbjct  2     AQRSVPAPFLTKTYQLVDDPITDNVISWNENGTSFVVWKTADFAKDLLPTYFKHNNFSSF  61

Query  388   VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQ--PQVAVDHLHHHHPMNE  561
             +RQLNTYGFRKVVPD+WEFAN+ FKRGEK LL +I RRKT    P  A +          
Sbjct  62    IRQLNTYGFRKVVPDKWEFANDNFKRGEKELLSKISRRKTVTSPPASAPEKGKTSGAATP  121

Query  562   PSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
                 S  + G  S S P+S    +   N + D                            
Sbjct  122   SPTNSGEDLGSTSTSSPESKNPGSVETNQFAD----------------------------  153

Query  742   LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQL  921
             LSE+N +L+R   ML  ELA  ++  ++++ F+   VK V P      + ++ Q      
Sbjct  154   LSEENEKLKRDKEMLSIELAQAKRKCDELVAFLTECVK-VEPDQ---INGIMRQGSCGST  209

Query  922   VTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQS--KKRLHP  1095
             +    P        +  +    KTS+            D+   KLFG  L+   KKR   
Sbjct  210   INGEDPG------RICGVDDDEKTSEE-----------DMGSLKLFGVWLKGVEKKRARE  252

Query  1096  D--QYSPPSSME  1125
             +   Y  P + E
Sbjct  253   ETIMYGGPHAKE  264



>emb|CDP02491.1| unnamed protein product [Coffea canephora]
Length=532

 Score =   196 bits (498),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 135/214 (63%), Gaps = 21/214 (10%)
 Frame = +1

Query  211  HKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFV  390
             ++VPAPFLTKTYQLVDDP +D ++SW E  TTFVVW+  EFA+DLLPNYFKHNNFSSFV
Sbjct  3    QRTVPAPFLTKTYQLVDDPCSDDVISWNESGTTFVVWKTAEFAKDLLPNYFKHNNFSSFV  62

Query  391  RQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPSF  570
            RQLNTYGFRK+VPD+WEFAN+ FKRG K LL +I RRKT     + +       +     
Sbjct  63   RQLNTYGFRKIVPDKWEFANDNFKRGRKELLTDIRRRKTTTSTQSTNQAGAGKSL-----  117

Query  571  FSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLSE  750
             +  NP     SP +S E L +++ ++  S S  S   +           +    A LS+
Sbjct  118  -TTANP----TSPANSGEDLGSSSTSFPGSKSPGSVDTL-----------SAEQFADLSD  161

Query  751  DNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            +N +L++ N ML SELA  +K  +D++ F+  HV
Sbjct  162  ENEKLKKDNQMLSSELAQTKKQCDDLVAFLTKHV  195



>ref|XP_002510816.1| Heat shock factor protein, putative [Ricinus communis]
 gb|EEF51418.1| Heat shock factor protein, putative [Ricinus communis]
Length=323

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 142/244 (58%), Gaps = 25/244 (10%)
 Frame = +1

Query  202  LDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFS  381
            ++S +S+P PFLTKTYQLVDDPA D ++SW +D +TF+VW P  FARDLLP YFKHNNFS
Sbjct  15   VESQRSIPTPFLTKTYQLVDDPAIDDVISWNDDGSTFIVWNPTVFARDLLPKYFKHNNFS  74

Query  382  SFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK-TAQPQVA-VDHLHHHHPM  555
            SFVRQLNTYGFRKVVPDRWEF+N+ F+RGEK LLC+I RRK  AQ   A V  +    P 
Sbjct  75   SFVRQLNTYGFRKVVPDRWEFSNDCFRRGEKRLLCDIQRRKINAQSAAAGVPVVPSPQPH  134

Query  556  NEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsv  735
               +  +A    +L +SP  S E+   + N+   SPS                       
Sbjct  135  MHVAVAAAIPVAKLIISPASSGEEQVISTNS---SPSRLGGG----------------PA  175

Query  736  aaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSY----PSPLITQ  903
              L ++N RLR+ N  L  EL  M+ L N+I   V ++     P +  +    P  L++ 
Sbjct  176  TELLDENDRLRKENVHLSKELIEMKNLCNNIFSLVSSYAGNQPPENGGFSAVKPLDLLSV  235

Query  904  KPLS  915
            K LS
Sbjct  236  KQLS  239



>ref|XP_009398726.1| PREDICTED: heat stress transcription factor B-2c-like [Musa acuminata 
subsp. malaccensis]
Length=350

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 131/220 (60%), Gaps = 27/220 (12%)
 Frame = +1

Query  196  LSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNN  375
            +S D  +S+P PFLTKTYQLVDDP+ D ++SW ED +TFVVWRP EFARDLLP YFKHNN
Sbjct  18   VSPDGQRSLPTPFLTKTYQLVDDPSVDDMISWNEDGSTFVVWRPAEFARDLLPKYFKHNN  77

Query  376  FSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHH-P  552
            FSSFVRQLNTYGFRK+VPDRWEFAN+ F+RGEK LLC+IHRRK  Q   AV        P
Sbjct  78   FSSFVRQLNTYGFRKIVPDRWEFANDCFRRGEKRLLCDIHRRKITQAAPAVAGPAAVSVP  137

Query  553  MNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngs  732
            +N               SP +S E+   ++N+              +          + S
Sbjct  138  VNRAG------------SPANSGEEQVLSSNS--------------SPGPPPSVAAGSSS  171

Query  733  vaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
               L+E+N RLR+ N  L  ELA M+ L + I   +  + 
Sbjct  172  SVELTEENERLRKENTRLSRELAQMKSLCSHISVLISKYA  211



>ref|XP_009606739.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana tomentosiformis]
Length=322

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/217 (49%), Positives = 133/217 (61%), Gaps = 12/217 (6%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            ++ +S+P PFLTKTYQLVDDPA D ++SW ED TTF+VW+P EFARDLLP YFKHNNFSS
Sbjct  16   ENQRSLPTPFLTKTYQLVDDPAIDDLISWNEDGTTFIVWKPAEFARDLLPKYFKHNNFSS  75

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ F+RGEK LL +I RRK +    AV  +     +N  
Sbjct  76   FVRQLNTYGFRKVVPDRWEFANDCFRRGEKGLLRDIQRRKISPAGTAVTAVSPTIAVNAA  135

Query  565  SFFS-AYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsva  738
               + A  P     SP +S DEQ+           S  SS   +A  +         +  
Sbjct  136  QTVTIAVAPAVRMASPSNSGDEQVL----------SSNSSPAATAAAAVVLRTTTCTTTP  185

Query  739  aLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
             L E+N RLR+ N  L  EL  +R L N++   + N+
Sbjct  186  ELLEENERLRKENAQLSEELNRLRSLCNNVYNLMSNY  222



>ref|XP_007218740.1| hypothetical protein PRUPE_ppa009180mg [Prunus persica]
 gb|EMJ19939.1| hypothetical protein PRUPE_ppa009180mg [Prunus persica]
Length=303

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 137/232 (59%), Gaps = 36/232 (16%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            S +++P PFLTKTYQLVDDP  D ++SW +D ++FVVW P  FARDLLP YFKHNNFSSF
Sbjct  19   SQRALPTPFLTKTYQLVDDPTIDDVISWNDDGSSFVVWNPTVFARDLLPKYFKHNNFSSF  78

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTA--QPQVAVDHLHHHHPMNE  561
            VRQLNTYGFRKV+PDRWEF+N+ F+RGEK LLCEI RR+     P VAV       PM  
Sbjct  79   VRQLNTYGFRKVIPDRWEFSNDCFRRGEKRLLCEIQRRRIMPPAPSVAV------SPMAT  132

Query  562  PSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsva  738
             +      P    +SP +S +EQ+ +++++   +PS                        
Sbjct  133  AAVVPNAKP---MISPSNSGEEQVISSSSSPIRAPS------------------------  165

Query  739  aLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPL  894
             L ++N +LR+ N  L  ELA ++ L N+I   V N+    + S   Y  PL
Sbjct  166  ELMDENEKLRKENMQLTKELAEVKSLCNNIFSMVSNYAYAQSESGFPYVKPL  217



>ref|XP_006477425.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477426.1| PREDICTED: heat stress transcription factor B-2b-like isoform 
X2 [Citrus sinensis]
Length=309

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 140/232 (60%), Gaps = 23/232 (10%)
 Frame = +1

Query  160  MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA  339
            MA +    E      DS +S+P PFLTKTYQLVDDP+ D +++W  D +TF+VWRP EFA
Sbjct  1    MAPLEQTSESPATGGDSQRSLPTPFLTKTYQLVDDPSVDDLIAWNSDGSTFIVWRPAEFA  60

Query  340  RDLLPNYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQ  519
            RDLLP YFKHNNFSSFVRQLNTYGFRKVVPDRWEFAN+ F+RGEK LL +I RRK +   
Sbjct  61   RDLLPKYFKHNNFSSFVRQLNTYGFRKVVPDRWEFANDCFRRGEKGLLRDIQRRKISPSP  120

Query  520  VAVDHLHHHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSP-SFASSTVIsag  696
             A                +     R S+SP +S E+   + N+   SP +   +TVI   
Sbjct  121  AA----------GTAGTVTVAAVAR-SISPANSGEEQVISANS---SPVAVPPTTVI---  163

Query  697  nsgggggynngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
                    +  ++  L E+N +LR+ N  L +EL+ ++ L N+I+  + N+ 
Sbjct  164  -----RTTSCTTMPELLEENEKLRKENAQLNNELSQLKGLCNNILALMTNYA  210



>ref|XP_010934470.1| PREDICTED: heat stress transcription factor B-2b-like [Elaeis 
guineensis]
Length=358

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 132/215 (61%), Gaps = 23/215 (11%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            S +S+P PFLTKTYQLVDDPA D I+SW +D +TF+VW P +FARDLLP YFKHNNFSSF
Sbjct  24   SQRSIPTPFLTKTYQLVDDPAVDDIISWNDDGSTFIVWHPADFARDLLPKYFKHNNFSSF  83

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+VPDRWEFAN+ F+RGEK LL +IHRRK   PQ A        P+   +
Sbjct  84   VRQLNTYGFRKIVPDRWEFANDCFRRGEKQLLRDIHRRKII-PQAA----PAPTPVPVAT  138

Query  568  FFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaLS  747
              +       + SP +S E+   ++N+   +P  + S                     L 
Sbjct  139  SIAVAMLANQAGSPTNSGEEQVLSSNSSPGAPPPSGSAA------------------ELR  180

Query  748  EDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            ++N RLR+ N+ L  EL+ M+ L ++I+  +  + 
Sbjct  181  DENERLRKENSRLSRELSQMKSLCDNILLLISKYA  215



>ref|XP_010521560.1| PREDICTED: heat stress transcription factor B-4b-like [Tarenaya 
hassleriana]
Length=365

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  PAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLN  402
            PAPFLTKTY+LVDDP TDHIVSWGED TTFVVWRPP+F+RDLLPNYFKHNNFSSFVRQLN
Sbjct  80   PAPFLTKTYELVDDPITDHIVSWGEDQTTFVVWRPPDFSRDLLPNYFKHNNFSSFVRQLN  139

Query  403  TYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQ  513
            TYGF+KVV DRWEFANEFF++G KHL+CEI RRKT Q
Sbjct  140  TYGFKKVVTDRWEFANEFFRKGAKHLMCEIQRRKTPQ  176


 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 63/130 (48%), Gaps = 22/130 (17%)
 Frame = +1

Query  742   LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQL  921
             LSEDN RL R N ML+SEL HM+ LYNDI+YF+QNHVKPV  SS+      IT KP    
Sbjct  242   LSEDNQRLLRKNRMLLSELTHMKNLYNDIVYFIQNHVKPVPSSSDQ-----ITFKPAEHH  296

Query  922   VTYPHPHPPTKHQPVFNLSS----------PTKTSQSSVTL---VEDPPAADLCRTKLFG  1062
                    P  +      + +          P   S+   T+    EDP     C  KLFG
Sbjct  297   HGSVQAIPKIRELDSLRVQADENVDPLAGVPKIGSRLMNTMNSNAEDPS----CTVKLFG  352

Query  1063  FPLQSKKRLH  1092
               L  KKRL 
Sbjct  353   VSLSGKKRLQ  362



>ref|XP_002298053.1| heat shock transcription factor HSF29 family protein [Populus 
trichocarpa]
 gb|EEE82858.1| heat shock transcription factor HSF29 family protein [Populus 
trichocarpa]
Length=343

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 130/225 (58%), Gaps = 27/225 (12%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFLTKTYQLVDDP+ D ++SW +D +TF+VWRP EFARDLLP YFKHNNFSS
Sbjct  31   DSQRSLPTPFLTKTYQLVDDPSVDDLISWNDDGSTFIVWRPAEFARDLLPKYFKHNNFSS  90

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ F+RGEK LL +I RRK +    +            P
Sbjct  91   FVRQLNTYGFRKVVPDRWEFANDCFRRGEKALLRDIQRRKISTMAASAVTSASVTVAAIP  150

Query  565  SFFSAYNP-------GRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggyn  723
            +   A +P       G  S S P         N       SF  +T             +
Sbjct  151  TVARAVSPANSGDDQGISSTSSPGGAGTAGGAN-------SFLRTT-------------S  190

Query  724  ngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKP  858
              +   + E+N RLR+ N+ L  EL  +R L N+I+  + N+  P
Sbjct  191  CTTTPEILEENERLRKENSALSHELTQLRGLCNNIMVLMNNYASP  235



>gb|AII99903.1| heat shock transcription factor [Gossypium hirsutum]
Length=311

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 131/216 (61%), Gaps = 26/216 (12%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFLTKTYQLVDDP+ + ++SW ED +TF+VWRP EFARDLLP YFKHNNFSS
Sbjct  19   DSQRSLPTPFLTKTYQLVDDPSVNDMISWNEDGSTFIVWRPAEFARDLLPKYFKHNNFSS  78

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ F+RGEK LL +I RRK      A         +  P
Sbjct  79   FVRQLNTYGFRKVVPDRWEFANDCFRRGEKGLLRDIQRRKMTPTTTAPAATVTVAAI--P  136

Query  565  SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaL  744
               S  N G         DEQ+ ++N     SP  A  TV+            + +   L
Sbjct  137  CKVSPSNSG---------DEQVISSN-----SPPVA--TVL--------HRTTSSTTPEL  172

Query  745  SEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
             E+N RLR+ N  L  EL  ++ L N+I+  + N+ 
Sbjct  173  LEENERLRKENMQLNHELTQLKGLCNNILTLMTNYA  208



>gb|KDP22306.1| hypothetical protein JCGZ_26137 [Jatropha curcas]
Length=311

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/245 (45%), Positives = 140/245 (57%), Gaps = 24/245 (10%)
 Frame = +1

Query  187  GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFK  366
            G  ++ +S +S+P PFLTKTYQLVDD   D ++SW ED +TF+VW P  FARDLLP YFK
Sbjct  9    GDAVTAESQRSLPTPFLTKTYQLVDDQTIDDVISWNEDGSTFIVWNPTVFARDLLPKYFK  68

Query  367  HNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHH  546
            HNNFSSFVRQLNTYGFRKVVPDRWEF+N+ F+RGEK LL +I RRK +            
Sbjct  69   HNNFSSFVRQLNTYGFRKVVPDRWEFSNDCFRRGEKKLLLDIQRRKISMQAATTVTPPPT  128

Query  547  HPMNEPSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggyn  723
                 P+      P    +SP +S DEQ+ + N+    SPS  +                
Sbjct  129  PMAVTPAAIPMAKP---VISPSNSGDEQVISTNS----SPSRVAQG--------------  167

Query  724  ngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSS--NSYPSPLI  897
            +G  A L ++N RLR+ N  L  EL  M+ L N+I   V N+    +  S  +S    L 
Sbjct  168  SGPNAELLDENDRLRKENVQLTKELTEMKNLCNNIFSLVSNYASTQSEGSFHSSESEGLP  227

Query  898  TQKPL  912
            T KPL
Sbjct  228  TAKPL  232



>ref|XP_011084402.1| PREDICTED: heat stress transcription factor B-2b-like [Sesamum 
indicum]
Length=302

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 114/310 (37%), Positives = 160/310 (52%), Gaps = 37/310 (12%)
 Frame = +1

Query  196   LSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNN  375
             ++ D+ + +  PFLTKTYQLVDD A D ++SW  D + F+VW P EFARDLLP YFKHNN
Sbjct  1     MAADAPRLLATPFLTKTYQLVDDHAIDDVISWNIDGSAFIVWNPTEFARDLLPKYFKHNN  60

Query  376   FSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPM  555
             FSSF+RQLNTYGFRKVVPDRWEF+N+ F+RGEK LL +I RRK A P +A          
Sbjct  61    FSSFIRQLNTYGFRKVVPDRWEFSNDCFRRGEKKLLRDILRRKIATPSLAAKATASVQ--  118

Query  556   NEPSFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngs  732
                   +   P R ++SP DS +EQ+ +++ +   +  F+S+T                 
Sbjct  119   -----LTPAAPPR-TLSPSDSGEEQVVSSSISPPGAREFSSNTA----------------  156

Query  733   vaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPL  912
                L  +N RLR+ N  L  EL HM+ L N+I   V N+   +          ++T+  L
Sbjct  157   --ELIGENERLRKENVQLNKELTHMKNLCNNIYVLVSNYSGSIIADREHSCKLILTETAL  214

Query  913   SQLVTYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLH  1092
                        P    P+        T+ +        P+A+    +LFG P+ +K+   
Sbjct  215   R----------PLDLLPMTRFCEEMATAANGGGENNIRPSAEEISARLFGVPIGAKRGRE  264

Query  1093  PDQYSPPSSM  1122
              +  S    M
Sbjct  265   IEGTSAEDEM  274



>ref|XP_009397638.1| PREDICTED: heat stress transcription factor B-2b-like [Musa acuminata 
subsp. malaccensis]
Length=294

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 126/223 (57%), Gaps = 36/223 (16%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            +  +++P PFLTKTYQLVDDP  D ++SW ED +TFVVW+P EFARD+LP  FKHNNFSS
Sbjct  22   EGQRTIPTPFLTKTYQLVDDPYFDDVISWNEDGSTFVVWQPAEFARDVLPKNFKHNNFSS  81

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK---TAQPQVAVDHLHHHHPM  555
            FVRQLNTYGFRK+  DRWEFANE F+RGEK LLC+IHRRK   TA P  A        P 
Sbjct  82   FVRQLNTYGFRKIASDRWEFANECFRRGEKGLLCDIHRRKLSPTAIPSAA--------PA  133

Query  556  NEPSFFSAYNPG----RLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggyn  723
            N     S+   G    R + S P   +   A   AW    S   ++              
Sbjct  134  NR--VMSSETSGDEQVRSTTSSPSGFQPEPAAVVAWASPGSSGGAS--------------  177

Query  724  ngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
                  L+E+N RLRR N  L  EL  M+ L  +I+  +  + 
Sbjct  178  -----ELAEENNRLRRENKQLSQELGQMKSLCTNIMQLMAKYA  215



>ref|XP_010693477.1| PREDICTED: heat stress transcription factor B-2a [Beta vulgaris 
subsp. vulgaris]
Length=325

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 131/215 (61%), Gaps = 25/215 (12%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            ++ +S+P PFLTKTYQLV+DP+ D ++SW +D ++F+VW P  FARDLLP YFKHNNFSS
Sbjct  17   EAQRSIPTPFLTKTYQLVEDPSIDDVISWNDDGSSFIVWNPTVFARDLLPRYFKHNNFSS  76

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEF+N+ F+RGEK LLCEI RRKT     AV  +         
Sbjct  77   FVRQLNTYGFRKVVPDRWEFSNDAFRRGEKQLLCEIQRRKTT----AVVTVAQQK-----  127

Query  565  SFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
                        +S  DS +EQ+ +N+N    SP     T +   N       NN +   
Sbjct  128  -----------QISGGDSGEEQVISNSN----SPPLGIPTSVYTNNINNHNYSNNNNKGD  172

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQN  846
            L ++N RL+R N  L  EL  M+ L N+I   + N
Sbjct  173  LIDENERLKRENLELNRELTSMKALCNNIFSLMTN  207



>gb|KHG11685.1| Heat stress transcription factor B-2b -like protein [Gossypium 
arboreum]
Length=313

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 137/217 (63%), Gaps = 28/217 (13%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFL+KTYQLVD+P+ D ++SW +D +TF+VWRP EFARDLLP YFKHNNFSS
Sbjct  20   DSQRSLPTPFLSKTYQLVDNPSVDDLISWNDDGSTFIVWRPAEFARDLLPKYFKHNNFSS  79

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ FKRGEK LL +I RRK          + H+   +  
Sbjct  80   FVRQLNTYGFRKVVPDRWEFANDCFKRGEKGLLRDIQRRK----------ITHNASGSAT  129

Query  565  SFFSAYNPGRLSVSPPD-SDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
               +A        SP + SDEQ+ ++N     SP  A  TV+           +  + A 
Sbjct  130  VTIAAVT---CKPSPSNSSDEQVISSN-----SPPVA--TVL-------NRTTSCTTTAE  172

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            L E+N RLR+ N  L  EL  +++L N+I+  + N+ 
Sbjct  173  LLEENERLRKENMQLNHELTQLKRLCNNILNLMTNYA  209



>ref|XP_008340075.1| PREDICTED: heat shock factor protein HSF24 [Malus domestica]
Length=294

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 132/219 (60%), Gaps = 31/219 (14%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            + +SVPAPFLTKTY LVDDP+ D ++SW E  TTFVVW+  +FARDLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYLLVDDPSLDDVISWNESGTTFVVWKTXDFARDLLPKYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK---TAQPQVAVDHLHHHHPMN  558
            VRQLNTYGFRK VPD+WEFANE F+RG+K LL EI RRK   +   Q A+D         
Sbjct  62   VRQLNTYGFRKTVPDKWEFANENFQRGQKELLSEIRRRKPVTSTAAQAALDEKSGG----  117

Query  559  EPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsva  738
             PS            +P +S E+L + + +  DS +  S                   V 
Sbjct  118  -PS------------TPSNSGEELASTSTSSPDSKNPGS-----------VETATLSQVV  153

Query  739  aLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
             LS++N +L+R N  L SELA  +K  N+++ F+  +VK
Sbjct  154  NLSDENKKLKRENENLNSELAQTKKQCNELVGFLVKYVK  192



>ref|XP_010035111.1| PREDICTED: heat stress transcription factor B-2b [Eucalyptus 
grandis]
 gb|KCW46405.1| hypothetical protein EUGRSUZ_K00238 [Eucalyptus grandis]
Length=286

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 129/217 (59%), Gaps = 35/217 (16%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            +S +SVP PFLTKTYQLVDDPA D ++SW  D ++F+VW P  FARDLLP YFKHNNFSS
Sbjct  16   ESQRSVPTPFLTKTYQLVDDPAIDAVISWNGDGSSFIVWNPTVFARDLLPKYFKHNNFSS  75

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEF+N+ F+RGEK LL EIHRRK +    A            P
Sbjct  76   FVRQLNTYGFRKVVPDRWEFSNDCFRRGEKRLLREIHRRKISASPPA------------P  123

Query  565  SFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
            +  +A   GR   SP +S DEQ  +   +W   PS                       + 
Sbjct  124  AIVAA---GRPRASPSNSGDEQGIS---SWSSPPSACGRNC----------------ASE  161

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            + ++N RLRR N +L  EL+ M+ L + I   + N+ 
Sbjct  162  IMDENERLRRENVLLSRELSRMKTLCSSIFSLMSNYA  198



>ref|XP_003555375.1| PREDICTED: heat stress transcription factor B-2a-like [Glycine 
max]
Length=300

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 137/233 (59%), Gaps = 27/233 (12%)
 Frame = +1

Query  187  GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFK  366
            G+  S DS +S+P PFLTKTYQLVDD   D ++SW +  ++F+VW    FA+DLLP YFK
Sbjct  9    GVSTSGDSQRSIPTPFLTKTYQLVDDHTIDDVISWNDSGSSFIVWNTTAFAKDLLPKYFK  68

Query  367  HNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK--TAQPQVAVDHLH  540
            HNNFSSFVRQLNTYGFRKVVPDRWEF+NE+F+RGEK LLCEI RRK  +A P  A     
Sbjct  69   HNNFSSFVRQLNTYGFRKVVPDRWEFSNEYFRRGEKRLLCEIQRRKILSASPPPAGATAT  128

Query  541  HHHPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggy  720
               P   P   SA    +  VSP +S E+   ++N+   SP+ A   ++           
Sbjct  129  VAVP--SPLPLSAIPTAKPIVSPSNSAEEQVLSSNS---SPARAPVELL-----------  172

Query  721  nngsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNS  879
                     ++N RLR+ N +L  EL  MR L N+I   + N+       S++
Sbjct  173  ---------DENERLRKENILLTKELVKMRSLCNNIFNLMSNYANAQADGSSA  216



>gb|KFK31930.1| hypothetical protein AALP_AA6G177400 [Arabis alpina]
Length=378

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 140/242 (58%), Gaps = 10/242 (4%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFLTKTYQLVDDP  D ++SW ED T+F+VWRP EFARDLLP YFKHNNFSS
Sbjct  47   DSQRSIPTPFLTKTYQLVDDPVYDELISWNEDGTSFIVWRPAEFARDLLPKYFKHNNFSS  106

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP-QVAVDHLHHHHPMNE  561
            FVRQLNTYGFRKVVPDRWEF+N+ FKRGEK LL +I RRK +QP   A            
Sbjct  107  FVRQLNTYGFRKVVPDRWEFSNDCFKRGEKILLRDIQRRKISQPAMAAAAAAAAAAVAAS  166

Query  562  PSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
                +A      +VSP +S E+   ++N+   SP+ A++        G           A
Sbjct  167  AVTVAAAPVVVHAVSPSNSGEEQVISSNS---SPAAAAAATGGGAAVGVALQRTTSCTTA  223

Query  742  --LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLS  915
              L E+N RLR+ N  L  EL  ++ LY +I   + N        +N  P      KPL 
Sbjct  224  PELVEENERLRKENVQLSQELTKLKGLYANIYTLMANFTSGQAECANLLPEG----KPLD  279

Query  916  QL  921
             L
Sbjct  280  LL  281



>ref|XP_006396868.1| hypothetical protein EUTSA_v10028744mg [Eutrema salsugineum]
 gb|ESQ38321.1| hypothetical protein EUTSA_v10028744mg [Eutrema salsugineum]
Length=370

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 137/217 (63%), Gaps = 6/217 (3%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFLTKTYQLVDDP  D ++SW ED +TF+VWRP EFARDLLP YFKHNNFSS
Sbjct  46   DSQRSIPTPFLTKTYQLVDDPVYDELISWNEDGSTFIVWRPAEFARDLLPKYFKHNNFSS  105

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEF+N+ F+RGEK LL +I RRK +QP +A         +   
Sbjct  106  FVRQLNTYGFRKVVPDRWEFSNDCFRRGEKILLRDIQRRKISQPAMAAAAAAAAAAVAAS  165

Query  565  SFFSAYNPGRL-SVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
            +   A  P    +VSP +S E+   ++N+   SP+ A++T   A   G            
Sbjct  166  AVTVAAVPAIAHTVSPSNSGEEQVISSNS---SPAAAAATTGGAAAVGAVLQRTTSCTTT  222

Query  742  --LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQN  846
              L E+N RLR+ N  L  EL  ++ LY +I   + N
Sbjct  223  PELIEENERLRKENVQLSQELTKLKGLYANIYSLMAN  259



>gb|ADL36733.1| HSF domain class transcription factor [Malus domestica]
Length=294

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 132/219 (60%), Gaps = 31/219 (14%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            + +SVPAPFLTKTY LVDDP+ D ++SW E  TTFVVW+  +FARDLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYLLVDDPSLDDVISWNESGTTFVVWKTVDFARDLLPKYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK---TAQPQVAVDHLHHHHPMN  558
            VRQLNTYGFRK VPD+WEFANE F+RG+K LL EI RRK   +   Q A+D         
Sbjct  62   VRQLNTYGFRKTVPDKWEFANENFQRGQKELLSEIRRRKPVTSTAAQAALDEKSGG----  117

Query  559  EPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsva  738
             PS            +P +S E+L + + +  DS +  S                   V 
Sbjct  118  -PS------------TPSNSGEELASTSTSSPDSKNPGS-----------VETATLSQVV  153

Query  739  aLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
             LS++N +L+R N  L SELA  +K  N+++ F+  +VK
Sbjct  154  NLSDENKKLKRENENLNSELAQTKKQCNELVGFLVKYVK  192



>ref|XP_010940869.1| PREDICTED: heat stress transcription factor B-2b-like [Elaeis 
guineensis]
Length=358

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 134/217 (62%), Gaps = 21/217 (10%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
              +S+P PFLTKTYQLVDD + D I+SW +D + F+VWRP EFARDLLP YFKHNNFSSF
Sbjct  26   GQRSLPTPFLTKTYQLVDDSSVDDIISWNDDGSAFIVWRPAEFARDLLPKYFKHNNFSSF  85

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK+V DRWEFAN+ F+RGEK LLC+IHRRK   PQ A        P   P 
Sbjct  86   VRQLNTYGFRKIVSDRWEFANDCFRRGEKRLLCDIHRRKII-PQAAPAPAPTPVPAVTPI  144

Query  568  FFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSF--ASSTVIsagnsgggggynngsvaa  741
              +A  P   + SP +S E+   ++N+   SP    A +TV              G    
Sbjct  145  TLAA--PENWAGSPTNSGEEQVLSSNS---SPGALPAPATV-------------AGGAVE  186

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            L ++N RLR+ N+ L  EL+ M+ L N+I+  +  + 
Sbjct  187  LRDENERLRKENSRLSRELSQMKNLCNNIVLLMSKYA  223



>ref|XP_003535620.1| PREDICTED: heat stress transcription factor B-2a-like [Glycine 
max]
Length=289

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 130/222 (59%), Gaps = 28/222 (13%)
 Frame = +1

Query  187  GILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFK  366
            G+  S DS +S+P PFLTKT+QLVDD   DH++SW +  ++F+VW    FA+DLLP YFK
Sbjct  9    GVSTSGDSLRSIPTPFLTKTFQLVDDHTIDHVISWNDSGSSFIVWNTTAFAKDLLPKYFK  68

Query  367  HNNFSSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHH  546
            HNNFSSFVRQLNTYGFRKVVPDRWEF+NE+F+R EK LLCEI RRK   P          
Sbjct  69   HNNFSSFVRQLNTYGFRKVVPDRWEFSNEYFRRDEKRLLCEIQRRKIL-PATPPTRATAT  127

Query  547  HPMNEPSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynn  726
              +  P   S   P +L VSP +S E+   ++N+   SP+                    
Sbjct  128  AAVLSPLPLSTIPPAKLIVSPSNSAEEQVISSNS---SPA--------------------  164

Query  727  gsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
                 L ++N RLR+ N +L  EL  MR L N+I   + N+ 
Sbjct  165  ----ELLDENDRLRKENILLTKELEEMRSLCNNIFNLMSNYA  202



>ref|XP_009367059.1| PREDICTED: heat shock factor protein HSF24 [Pyrus x bretschneideri]
Length=294

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 132/218 (61%), Gaps = 29/218 (13%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            + +SVPAPFLTKTY LVDDP+ D ++SW E  TTFVVW+  +FARDLLP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYLLVDDPSLDDVISWNESGTTFVVWKTVDFARDLLPKYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEPS  567
            VRQLNTYGFRK VPD+WEFANE F+RG+K LL EI RRK      A   L        PS
Sbjct  62   VRQLNTYGFRKTVPDKWEFANENFQRGQKELLSEIRRRKPVTSTAAQAALGEKS--GGPS  119

Query  568  FFSAYNPGRLSVSPPDSDEQLTANNNAWCDS--PSFASSTVIsagnsgggggynngsvaa  741
                        +P +S E+L + + +  DS  P    +T +               VA 
Sbjct  120  ------------TPSNSGEELASTSTSLPDSKNPGSVETTTL-------------SQVAD  154

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            LS++N +L+R N  L SELA  +K  ++++ F+  +VK
Sbjct  155  LSDENKKLKRENENLNSELAQTKKQCDELVGFLVEYVK  192



>ref|XP_007152318.1| hypothetical protein PHAVU_004G119600g [Phaseolus vulgaris]
 gb|ESW24312.1| hypothetical protein PHAVU_004G119600g [Phaseolus vulgaris]
Length=340

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 133/221 (60%), Gaps = 34/221 (15%)
 Frame = +1

Query  199  SLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNF  378
            + DS +S+P PFLTKT+QLVDD + D ++SW +D +TF+VW P  FARDLLP YFKHNNF
Sbjct  20   AADSQRSIPTPFLTKTFQLVDDQSIDDVISWNDDGSTFIVWNPTVFARDLLPKYFKHNNF  79

Query  379  SSFVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMN  558
            SSFVRQLNTYGFRKVVPDRWEF+N+ F+RGEK LL EI RRK + P            + 
Sbjct  80   SSFVRQLNTYGFRKVVPDRWEFSNDCFRRGEKRLLSEIQRRKISLPAPT-------PCLT  132

Query  559  EPSFFSAYNPGRLS----VSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynn  726
             P+      P  L+    +SP +S E+   ++N+   SPS A + ++             
Sbjct  133  APATVVVPTPMPLTAIPIISPSNSGEEQVISSNS---SPSLAPAELV-------------  176

Query  727  gsvaaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNH  849
                   ++N RLR+ N  L  ELA MR L N+I   + N+
Sbjct  177  -------DENERLRKENVQLTKELAEMRSLCNNIYALMSNY  210



>ref|XP_004300764.1| PREDICTED: heat stress transcription factor B-2b-like [Fragaria 
vesca subsp. vesca]
Length=355

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 136/217 (63%), Gaps = 10/217 (5%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            +S +++P PFLTKTY+LVDDP  D ++SW E  +TFVVWRP EFARD+LP YFKHNNFSS
Sbjct  20   ESQRTIPTPFLTKTYELVDDPEADDMISWSEGGSTFVVWRPAEFARDILPKYFKHNNFSS  79

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
            FVRQLNTYGFRKVVPDRWEFAN+ FKRGEK LL EI RRK +    A             
Sbjct  80   FVRQLNTYGFRKVVPDRWEFANDCFKRGEKGLLREIQRRKISPSVSASAATVAAAAAVTA  139

Query  565  SFFSAYNPGRLSVSPPDS-DEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
            +         +SVSP +S DEQ+ ++N++    P+ A +  +           +  S A 
Sbjct  140  AVLPVAA---VSVSPANSGDEQVISSNSSPMAVPTPAPAVTL------LQRARSCNSTAE  190

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHV  852
            + E+N RLR+ N  L +EL  +R L N+I+  + N+ 
Sbjct  191  ILEENERLRKENMQLSNELTQLRGLCNNILGMMTNYA  227



>ref|XP_007202372.1| hypothetical protein PRUPE_ppa009274mg [Prunus persica]
 gb|EMJ03571.1| hypothetical protein PRUPE_ppa009274mg [Prunus persica]
Length=299

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/218 (45%), Positives = 132/218 (61%), Gaps = 29/218 (13%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            + +SVPAPFLTKTYQLVDDP+ D ++SW E  TTFVVW+  +FARD+LP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPSWDDVISWNESGTTFVVWKTVDFARDMLPKYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK--TAQPQVAVDHLHHHHPMNE  561
            VRQLNTYGFRK VPD+WEFAN+ F+RG+K LL EI RRK  TA P  A        P   
Sbjct  62   VRQLNTYGFRKTVPDQWEFANDNFRRGQKELLSEIRRRKSVTAGPGKATASEKSGGP---  118

Query  562  PSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
                          +P +S E++ + + +  DS +  S                 G  + 
Sbjct  119  -------------STPSNSGEEMASTSTSSPDSKNPGS-----------VETAAMGQASD  154

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            LS +N +L++ N  L SELA  +K  ++++ F+ +++K
Sbjct  155  LSGENEKLKKENENLSSELAQTKKQCDELVGFLMDYLK  192



>ref|XP_010422122.1| PREDICTED: heat stress transcription factor B-2b [Camelina sativa]
Length=370

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 141/240 (59%), Gaps = 8/240 (3%)
 Frame = +1

Query  205  DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
            DS +S+P PFLTKTYQLVDDP  D ++SW +D T+F+VWRP EFARDLLP YFKHNNFSS
Sbjct  43   DSQRSIPTPFLTKTYQLVDDPVYDELISWNDDGTSFIVWRPAEFARDLLPKYFKHNNFSS  102

Query  385  FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQP-QVAVDHLHHHHPMNE  561
            FVRQLNTYGFRKVVPDRWEF+N+ F+RGEK LL +I RRK  QP   A            
Sbjct  103  FVRQLNTYGFRKVVPDRWEFSNDCFRRGEKILLRDIQRRKIPQPAMAAAAAAAAAAVAAS  162

Query  562  PSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaa  741
                +A      +VSP +S E+   ++N+   SP+ A++        G     +  +   
Sbjct  163  AVTVAAVPVVAHAVSPSNSGEEQVISSNS---SPAAAAAATGGVVGVGLQRTTSCTTAPE  219

Query  742  LSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQL  921
            L E+N RLR+ N  L  EL  ++ LY +I   + N     TP      + L   KPL  L
Sbjct  220  LVEENERLRKENMQLSQELTKLKSLYANIYTLMAN----FTPGQADCANLLPEGKPLDLL  275



>ref|XP_008241456.1| PREDICTED: heat shock factor protein HSF24 [Prunus mume]
Length=288

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 133/220 (60%), Gaps = 33/220 (15%)
 Frame = +1

Query  208  SHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSF  387
            + +SVPAPFLTKTYQLVDDP+ D ++SW E  TTFVVW+  +FARD+LP YFKHNNFSSF
Sbjct  2    AQRSVPAPFLTKTYQLVDDPSWDDVISWNESGTTFVVWKTVDFARDMLPKYFKHNNFSSF  61

Query  388  VRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRK--TAQPQVAVDHLHHHHPMNE  561
            VRQLNTYGFRK VPD+WEFAN+ F+RG+K LL EI RRK  TA P  A        P   
Sbjct  62   VRQLNTYGFRKTVPDQWEFANDNFRRGQKELLAEIRRRKSVTAGPGKATASEKSGGP---  118

Query  562  PSFFSAYNPGRLSVSPPDSDEQLTANNNAWCDS--PSFASSTVIsagnsgggggynngsv  735
                          +P +S E++ + + +  DS  P    +  +             G  
Sbjct  119  -------------STPSNSGEEMASTSTSSPDSKNPGAVETAAM-------------GQA  152

Query  736  aaLSEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVK  855
            + LS +N +L++ N  L SELA  +K  ++++ F+ +++K
Sbjct  153  SDLSGENEKLKKENENLSSELAQTKKQCDELVGFLMDYLK  192



>ref|XP_009603015.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana tomentosiformis]
 ref|XP_009603016.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana tomentosiformis]
 ref|XP_009603017.1| PREDICTED: heat stress transcription factor B-2b [Nicotiana tomentosiformis]
Length=333

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 159/299 (53%), Gaps = 41/299 (14%)
 Frame = +1

Query  205   DSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSS  384
             ++ +SVP PFLTKTYQLV+DP+ D +VSW ED ++F+VW P EFARDLLP YFKHNNFSS
Sbjct  17    ETARSVPTPFLTKTYQLVEDPSIDDVVSWNEDGSSFIVWNPTEFARDLLPKYFKHNNFSS  76

Query  385   FVRQLNTYGFRKVVPDRWEFANEFFKRGEKHLLCEIHRRKTAQPQVAVDHLHHHHPMNEP  564
             FVRQLNTYGFRKVVPDRWEF+N+ F+RG+K LL +I RRK   P +A         +   
Sbjct  77    FVRQLNTYGFRKVVPDRWEFSNDCFRRGDKSLLRDIQRRKVVTP-IATPCAAVTAVVTVA  135

Query  565   SFFSAYNPGRLSVSPPDSDEQLTANNNAWCDSPSFASSTVIsagnsgggggynngsvaaL  744
             +  +      +S S    DEQ+ ++N          SST               G  A L
Sbjct  136   APPAQPPRPVISTSDS-GDEQVVSSN----------SST---------------GGTAGL  169

Query  745   SEDNVRLRRSNNMLMSELAHMRKLYNDIIYFVQNHVKPVTPSSNSYPSPLITQKPLSQLV  924
               +N RL++ N  L  EL+ MR L  +I   + N+    T  + S  S     KPL  L 
Sbjct  170   LGENERLKKENLQLNKELSQMRSLCGNIYSLMSNYADSSTSGNQSAESISPAVKPLDLL-  228

Query  925   TYPHPHPPTKHQPVFNLSSPTKTSQSSVTLVEDPPAADLCRTKLFGFPLQSKKRLHPDQ  1101
                 P   +  +   N+++    +Q+    +         RT+LFGF +  K+    D+
Sbjct  229   ----PTKLSVDESDINMAAGDGGNQAEPEDI---------RTRLFGFSIGMKRVRDGDE  274



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3947080548888