BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21248_g4_i1 len=2112 path=[9161:0-870 1091:871-894 1115:895-2111]

Length=2112
                                                                      Score     E

ref|XP_009597550.1|  PREDICTED: probable serine/threonine-protein...    697   0.0      
ref|XP_006346683.1|  PREDICTED: probable serine/threonine-protein...    697   0.0      
ref|XP_009758213.1|  PREDICTED: probable serine/threonine-protein...    691   0.0      
ref|XP_004246271.1|  PREDICTED: probable serine/threonine-protein...    691   0.0      
ref|XP_006429556.1|  hypothetical protein CICLE_v10011307mg             675   0.0      
ref|XP_011095120.1|  PREDICTED: probable serine/threonine-protein...    667   0.0      
ref|XP_011095119.1|  PREDICTED: probable serine/threonine-protein...    667   0.0      
ref|XP_006481173.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    660   0.0      
emb|CDP06398.1|  unnamed protein product                                653   0.0      
gb|KHF97547.1|  putative serine/threonine-protein kinase WNK5           642   0.0      
ref|XP_011008755.1|  PREDICTED: probable serine/threonine-protein...    641   0.0      
ref|XP_011008754.1|  PREDICTED: probable serine/threonine-protein...    642   0.0      
ref|XP_007033559.1|  Kinase, putative isoform 1                         640   0.0      
emb|CBI18051.3|  unnamed protein product                                637   0.0      
ref|XP_002532861.1|  kinase, putative                                   629   0.0      Ricinus communis
gb|KDP22777.1|  hypothetical protein JCGZ_00364                         628   0.0      
ref|XP_010653350.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    620   0.0      
ref|XP_008359945.1|  PREDICTED: probable serine/threonine-protein...    611   0.0      
ref|XP_010043077.1|  PREDICTED: probable serine/threonine-protein...    613   0.0      
ref|XP_008388335.1|  PREDICTED: probable serine/threonine-protein...    612   0.0      
ref|XP_009372002.1|  PREDICTED: probable serine/threonine-protein...    611   0.0      
ref|XP_010252091.1|  PREDICTED: probable serine/threonine-protein...    612   0.0      
ref|XP_002268300.1|  PREDICTED: probable serine/threonine-protein...    610   0.0      Vitis vinifera
ref|XP_009346923.1|  PREDICTED: probable serine/threonine-protein...    607   0.0      
ref|XP_010683526.1|  PREDICTED: probable serine/threonine-protein...    606   0.0      
ref|XP_004302543.1|  PREDICTED: probable serine/threonine-protein...    605   0.0      
ref|XP_007017066.1|  No lysine kinase 4 isoform 1                       605   0.0      
ref|XP_007017067.1|  No lysine kinase 4 isoform 2                       602   0.0      
ref|XP_003517007.1|  PREDICTED: probable serine/threonine-protein...    597   0.0      
gb|KDO40186.1|  hypothetical protein CISIN_1g007495mg                   594   0.0      
ref|XP_010108487.1|  putative serine/threonine-protein kinase WNK4      594   0.0      
gb|KDP45717.1|  hypothetical protein JCGZ_17324                         592   0.0      
ref|XP_006432001.1|  hypothetical protein CICLE_v10000645mg             591   0.0      
ref|XP_007142049.1|  hypothetical protein PHAVU_008G248200g             590   0.0      
ref|XP_008242759.1|  PREDICTED: probable serine/threonine-protein...    589   0.0      
gb|KHN14259.1|  Putative serine/threonine-protein kinase WNK5           590   0.0      
ref|XP_002323664.2|  hypothetical protein POPTR_0016s14210g             587   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008370246.1|  PREDICTED: probable serine/threonine-protein...    588   0.0      
ref|NP_001236036.1|  with no lysine kinase 12                           586   0.0      
ref|XP_006574320.1|  PREDICTED: with no lysine kinase 12 isoform X1     587   0.0      
ref|XP_002518280.1|  kinase, putative                                   587   0.0      Ricinus communis
ref|XP_004294736.1|  PREDICTED: probable serine/threonine-protein...    586   0.0      
ref|XP_007206781.1|  hypothetical protein PRUPE_ppa025482mg             584   0.0      
ref|XP_002319412.2|  hypothetical protein POPTR_0013s15110g             585   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011021023.1|  PREDICTED: probable serine/threonine-protein...    585   0.0      
ref|XP_008245055.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    585   0.0      
ref|XP_008370245.1|  PREDICTED: probable serine/threonine-protein...    583   0.0      
ref|XP_009374365.1|  PREDICTED: probable serine/threonine-protein...    583   0.0      
ref|XP_011080727.1|  PREDICTED: probable serine/threonine-protein...    583   0.0      
ref|XP_009374364.1|  PREDICTED: probable serine/threonine-protein...    581   0.0      
ref|XP_006576137.1|  PREDICTED: with no lysine kinase 5 isoform X1      581   0.0      
ref|XP_010922722.1|  PREDICTED: probable serine/threonine-protein...    582   0.0      
ref|XP_010253119.1|  PREDICTED: probable serine/threonine-protein...    578   0.0      
ref|XP_008354540.1|  PREDICTED: probable serine/threonine-protein...    577   0.0      
ref|XP_006595486.1|  PREDICTED: with no lysine kinase 13 isoform X2     576   0.0      
gb|ABQ65855.1|  WNK1                                                    577   0.0      Glycine max [soybeans]
ref|XP_009354752.1|  PREDICTED: probable serine/threonine-protein...    576   0.0      
ref|XP_008384673.1|  PREDICTED: probable serine/threonine-protein...    575   0.0      
ref|XP_008463254.1|  PREDICTED: probable serine/threonine-protein...    576   0.0      
ref|XP_009603875.1|  PREDICTED: probable serine/threonine-protein...    577   0.0      
ref|XP_006595485.1|  PREDICTED: with no lysine kinase 13 isoform X1     574   0.0      
ref|XP_008465303.1|  PREDICTED: probable serine/threonine-protein...    575   0.0      
gb|KHN43739.1|  Putative serine/threonine-protein kinase WNK5           574   0.0      
gb|ABY52426.1|  NN mitogen-activated protein kinase                     574   0.0      Nicotiana tabacum [American tobacco]
ref|XP_004172723.1|  PREDICTED: probable serine/threonine-protein...    572   0.0      
gb|KGN54444.1|  hypothetical protein Csa_4G332110                       572   0.0      
ref|XP_009603876.1|  PREDICTED: probable serine/threonine-protein...    573   0.0      
ref|XP_006350878.1|  PREDICTED: probable serine/threonine-protein...    573   0.0      
ref|XP_004142734.1|  PREDICTED: probable serine/threonine-protein...    572   0.0      
ref|XP_004149364.1|  PREDICTED: probable serine/threonine-protein...    573   0.0      
ref|XP_009757969.1|  PREDICTED: probable serine/threonine-protein...    572   0.0      
ref|XP_008463253.1|  PREDICTED: probable serine/threonine-protein...    570   0.0      
ref|XP_004169120.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    572   0.0      
ref|XP_004490711.1|  PREDICTED: probable serine/threonine-protein...    570   0.0      
ref|XP_011080729.1|  PREDICTED: probable serine/threonine-protein...    570   0.0      
ref|XP_008798574.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    571   0.0      
gb|AAQ83971.2|  mitogen-activated protein kinase                        570   0.0      Nicotiana tabacum [American tobacco]
gb|EYU36911.1|  hypothetical protein MIMGU_mgv1a003239mg                569   0.0      
ref|NP_001237474.1|  with no lysine kinase 5                            569   0.0      
ref|XP_003616019.1|  With no lysine kinase                              568   0.0      
ref|XP_007134689.1|  hypothetical protein PHAVU_010G067900g             568   0.0      
ref|XP_007033560.1|  Kinase, putative isoform 2                         564   0.0      
ref|XP_009757970.1|  PREDICTED: probable serine/threonine-protein...    568   0.0      
emb|CDP04053.1|  unnamed protein product                                567   0.0      
gb|KDO36588.1|  hypothetical protein CISIN_1g010768mg                   561   0.0      
ref|XP_010931349.1|  PREDICTED: probable serine/threonine-protein...    566   0.0      
ref|XP_011041800.1|  PREDICTED: probable serine/threonine-protein...    565   0.0      
ref|XP_011041801.1|  PREDICTED: probable serine/threonine-protein...    565   0.0      
ref|XP_004242485.1|  PREDICTED: probable serine/threonine-protein...    566   0.0      
ref|XP_004242486.1|  PREDICTED: probable serine/threonine-protein...    565   0.0      
gb|KDO36589.1|  hypothetical protein CISIN_1g010768mg                   560   0.0      
ref|XP_010931350.1|  PREDICTED: probable serine/threonine-protein...    563   0.0      
ref|XP_002325649.2|  hypothetical protein POPTR_0019s14910g             562   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004506432.1|  PREDICTED: probable serine/threonine-protein...    560   0.0      
gb|KDO49667.1|  hypothetical protein CISIN_1g010730mg                   556   0.0      
ref|XP_003553219.1|  PREDICTED: probable serine/threonine-protein...    557   0.0      
ref|XP_010091078.1|  putative serine/threonine-protein kinase WNK5      558   0.0      
ref|XP_010535338.1|  PREDICTED: probable serine/threonine-protein...    554   0.0      
ref|XP_010529931.1|  PREDICTED: probable serine/threonine-protein...    554   0.0      
ref|XP_010535337.1|  PREDICTED: probable serine/threonine-protein...    554   0.0      
gb|KFK34409.1|  hypothetical protein AALP_AA5G141100                    551   0.0      
ref|XP_009397082.1|  PREDICTED: probable serine/threonine-protein...    554   0.0      
ref|XP_007146868.1|  hypothetical protein PHAVU_006G077100g             550   0.0      
ref|XP_008792207.1|  PREDICTED: probable serine/threonine-protein...    550   0.0      
ref|XP_008463255.1|  PREDICTED: probable serine/threonine-protein...    548   0.0      
ref|XP_009397081.1|  PREDICTED: probable serine/threonine-protein...    548   0.0      
ref|XP_007140097.1|  hypothetical protein PHAVU_008G084000g             547   0.0      
gb|KHN40619.1|  Putative serine/threonine-protein kinase WNK5           546   0.0      
ref|XP_010503860.1|  PREDICTED: probable serine/threonine-protein...    543   0.0      
ref|XP_009410523.1|  PREDICTED: probable serine/threonine-protein...    539   2e-180   
ref|XP_010426735.1|  PREDICTED: probable serine/threonine-protein...    537   4e-180   
gb|KEH29201.1|  WNK kinase                                              539   5e-180   
ref|XP_010515595.1|  PREDICTED: probable serine/threonine-protein...    536   6e-180   
gb|KDO40188.1|  hypothetical protein CISIN_1g007495mg                   531   6e-179   
gb|KDO40187.1|  hypothetical protein CISIN_1g007495mg                   530   8e-179   
ref|XP_009384321.1|  PREDICTED: probable serine/threonine-protein...    535   5e-178   
ref|XP_006403897.1|  hypothetical protein EUTSA_v10010261mg             531   7e-178   
ref|XP_006290846.1|  hypothetical protein CARUB_v10016958mg             530   2e-177   
gb|KFK34408.1|  hypothetical protein AALP_AA5G141100                    526   3e-176   
ref|XP_006403896.1|  hypothetical protein EUTSA_v10010261mg             527   3e-176   
ref|XP_009603877.1|  PREDICTED: probable serine/threonine-protein...    527   3e-176   
ref|XP_006573394.1|  PREDICTED: probable serine/threonine-protein...    524   1e-175   
ref|NP_001236004.1|  with no lysine kinase 10                           527   2e-175   
emb|CAB63149.1|  MAP kinase                                             525   3e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004492549.1|  PREDICTED: probable serine/threonine-protein...    526   3e-175   
gb|KEH25193.1|  WNK kinase                                              525   4e-175   
ref|NP_566954.2|  putative serine/threonine-protein kinase WNK5         524   4e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009757971.1|  PREDICTED: probable serine/threonine-protein...    522   3e-174   
ref|XP_002876096.1|  map kinase                                         520   1e-173   
ref|XP_006843706.1|  hypothetical protein AMTR_s00007p00211470          524   2e-173   
gb|EPS73758.1|  hypothetical protein M569_00993                         513   1e-172   
emb|CDX78018.1|  BnaA09g32130D                                          518   1e-172   
gb|EPS71002.1|  hypothetical protein M569_03748                         512   3e-172   
ref|XP_010685972.1|  PREDICTED: probable serine/threonine-protein...    516   2e-171   
ref|XP_003623589.1|  With no lysine kinase                              516   4e-171   
emb|CDX73710.1|  BnaC08g22930D                                          513   8e-171   
ref|XP_004500451.1|  PREDICTED: uncharacterized protein LOC101508676    552   1e-170   
dbj|BAJ91424.1|  predicted protein                                      511   5e-169   
dbj|BAJ95861.1|  predicted protein                                      511   7e-169   
gb|AAO16559.1|  mitogen-activated protein kinase                        511   1e-168   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009115849.1|  PREDICTED: probable serine/threonine-protein...    512   1e-168   
dbj|BAJ88098.1|  predicted protein                                      509   4e-168   
gb|KHN29517.1|  Putative serine/threonine-protein kinase WNK5           509   3e-167   
emb|CDY32991.1|  BnaA10g11970D                                          504   3e-167   
gb|KCW52442.1|  hypothetical protein EUGRSUZ_J01843                     505   3e-167   
gb|KCW52443.1|  hypothetical protein EUGRSUZ_J01843                     505   8e-167   
ref|XP_006282057.1|  hypothetical protein CARUB_v10028302mg             503   1e-166   
ref|XP_002864565.1|  hypothetical protein ARALYDRAFT_495950             500   1e-165   
ref|XP_009120345.1|  PREDICTED: probable serine/threonine-protein...    500   2e-165   
emb|CDY32707.1|  BnaA02g07690D                                          498   1e-164   
ref|NP_200643.1|  putative serine/threonine-protein kinase WNK4         498   1e-164   Arabidopsis thaliana [mouse-ear cress]
gb|KCW52444.1|  hypothetical protein EUGRSUZ_J01843                     499   3e-164   
ref|XP_010483414.1|  PREDICTED: probable serine/threonine-protein...    497   4e-164   
ref|XP_006401094.1|  hypothetical protein EUTSA_v10013105mg             493   5e-163   
ref|XP_006401095.1|  hypothetical protein EUTSA_v10013105mg             494   6e-163   
ref|XP_004978535.1|  PREDICTED: probable serine/threonine-protein...    496   9e-163   
emb|CDY69580.1|  BnaCnng64310D                                          491   1e-162   
emb|CDY43861.1|  BnaC09g33820D                                          492   1e-162   
ref|XP_003551613.1|  PREDICTED: probable serine/threonine-protein...    492   2e-162   
ref|NP_001236096.1|  with no lysine kinase 13                           489   2e-161   
ref|XP_009410524.1|  PREDICTED: probable serine/threonine-protein...    488   2e-161   
ref|XP_004978534.1|  PREDICTED: probable serine/threonine-protein...    492   6e-161   
gb|AGA37218.1|  mitogen-activated protein kinase kinase kinase ZI...    486   6e-160   
ref|XP_010032941.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    489   6e-160   
ref|XP_009126762.1|  PREDICTED: probable serine/threonine-protein...    484   2e-159   
emb|CDY02813.1|  BnaC02g10760D                                          488   1e-157   
ref|XP_009126757.1|  PREDICTED: probable serine/threonine-protein...    479   2e-157   
ref|XP_007207424.1|  hypothetical protein PRUPE_ppa004913mg             474   2e-156   
emb|CDX88670.1|  BnaA03g09790D                                          475   4e-156   
ref|XP_011021024.1|  PREDICTED: probable serine/threonine-protein...    471   6e-155   
ref|XP_009132059.1|  PREDICTED: probable serine/threonine-protein...    471   9e-155   
dbj|BAJ94040.1|  predicted protein                                      458   1e-150   
ref|XP_006595487.1|  PREDICTED: with no lysine kinase 13 isoform X3     459   3e-150   
ref|XP_009354759.1|  PREDICTED: probable serine/threonine-protein...    458   3e-150   
ref|XP_009603878.1|  PREDICTED: probable serine/threonine-protein...    456   6e-149   
ref|XP_004977377.1|  PREDICTED: probable serine/threonine-protein...    460   1e-148   
gb|KHN01888.1|  Putative serine/threonine-protein kinase WNK4           456   2e-148   
gb|EMS65351.1|  putative serine/threonine-protein kinase WNK8           456   3e-148   
ref|XP_003577137.1|  PREDICTED: probable serine/threonine-protein...    458   3e-148   
ref|XP_009757972.1|  PREDICTED: probable serine/threonine-protein...    452   2e-147   
gb|AFW64602.1|  putative protein kinase superfamily protein             452   5e-146   
gb|AFW64603.1|  putative protein kinase superfamily protein             451   9e-146   
ref|XP_008679338.1|  PREDICTED: probable serine/threonine-protein...    452   1e-145   
gb|EMT27038.1|  hypothetical protein F775_43856                         441   4e-144   
gb|EPS72856.1|  with no lysine kinase                                   434   2e-142   
ref|XP_002987588.1|  hypothetical protein SELMODRAFT_126389             433   2e-141   
ref|XP_006663741.1|  PREDICTED: probable serine/threonine-protein...    440   2e-141   
ref|XP_002987671.1|  hypothetical protein SELMODRAFT_126444             432   3e-141   
ref|XP_006662669.1|  PREDICTED: probable serine/threonine-protein...    438   7e-141   
ref|XP_002986954.1|  hypothetical protein SELMODRAFT_11342              431   7e-141   
emb|CBI34208.3|  unnamed protein product                                434   2e-139   
gb|ACN40752.1|  unknown                                                 441   2e-138   Picea sitchensis
gb|EPS67881.1|  with no lysine kinase                                   424   3e-138   
gb|EYU45651.1|  hypothetical protein MIMGU_mgv1a004522mg                427   6e-138   
ref|XP_001783954.1|  predicted protein                                  426   8e-138   
gb|ACN87287.1|  with no lysine kinase                                   419   1e-137   Glycine max [soybeans]
ref|XP_010934871.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    434   3e-137   
gb|EAY82030.1|  hypothetical protein OsI_37214                          425   2e-136   Oryza sativa Indica Group [Indian rice]
sp|Q2RBE3.2|WNK7_ORYSJ  RecName: Full=Probable serine/threonine-p...    426   3e-136   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065981.1|  Os12g0114100                                       426   4e-136   Oryza sativa Japonica Group [Japonica rice]
gb|ABA91188.2|  mitogen-activated protein kinase, putative, expre...    424   4e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010674833.1|  PREDICTED: probable serine/threonine-protein...    430   6e-136   
emb|CDO99054.1|  unnamed protein product                                428   1e-135   
ref|XP_009760923.1|  PREDICTED: probable serine/threonine-protein...    427   2e-135   
ref|XP_004299123.1|  PREDICTED: serine/threonine-protein kinase W...    427   4e-135   
emb|CBI26245.3|  unnamed protein product                                421   6e-135   
emb|CDY72128.1|  BnaCnng76130D                                          416   9e-135   
ref|XP_008224319.1|  PREDICTED: probable serine/threonine-protein...    426   1e-134   
ref|XP_009595956.1|  PREDICTED: probable serine/threonine-protein...    425   2e-134   
ref|XP_010256027.1|  PREDICTED: serine/threonine-protein kinase W...    425   3e-134   
ref|XP_007225229.1|  hypothetical protein PRUPE_ppa001963mg             425   3e-134   
ref|XP_011071578.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    423   4e-134   
ref|XP_010277340.1|  PREDICTED: probable serine/threonine-protein...    424   5e-134   
emb|CDY72029.1|  BnaAnng39660D                                          414   7e-134   
ref|XP_003626403.1|  With no lysine kinase                              423   1e-133   
ref|XP_003626402.1|  With no lysine kinase                              423   1e-133   
ref|XP_007147148.1|  hypothetical protein PHAVU_006G099700g             424   1e-133   
gb|AHL77723.1|  mitogen activated kinase kinase kinase ZIK9             415   1e-133   
ref|XP_007144811.1|  hypothetical protein PHAVU_007G185900g             423   1e-133   
ref|XP_003633655.1|  PREDICTED: serine/threonine-protein kinase WNK1    423   1e-133   
ref|XP_009151241.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    415   1e-133   
ref|XP_010025060.1|  PREDICTED: probable serine/threonine-protein...    423   2e-133   
ref|NP_001235958.1|  with no lysine kinase 1                            422   2e-133   
gb|KHN16182.1|  Serine/threonine-protein kinase WNK1                    422   3e-133   
ref|XP_004494680.1|  PREDICTED: serine/threonine-protein kinase W...    423   4e-133   
gb|KHN14724.1|  Serine/threonine-protein kinase WNK1                    422   4e-133   
ref|XP_006489378.1|  PREDICTED: serine/threonine-protein kinase W...    422   4e-133   
ref|XP_006605282.1|  PREDICTED: with no lysine kinase 1 isoform X1      422   4e-133   
ref|XP_009413325.1|  PREDICTED: probable serine/threonine-protein...    423   5e-133   
ref|XP_008804331.1|  PREDICTED: probable serine/threonine-protein...    422   5e-133   
ref|XP_002307209.2|  hypothetical protein POPTR_0005s05140g             422   5e-133   Populus trichocarpa [western balsam poplar]
ref|XP_006589178.1|  PREDICTED: serine/threonine-protein kinase W...    422   5e-133   
ref|XP_002512245.1|  kinase, putative                                   423   5e-133   Ricinus communis
ref|XP_006577277.1|  PREDICTED: serine/threonine-protein kinase W...    422   5e-133   
gb|KDO74608.1|  hypothetical protein CISIN_1g004645mg                   422   5e-133   
ref|XP_008390886.1|  PREDICTED: probable serine/threonine-protein...    422   6e-133   
ref|XP_003591018.1|  With no lysine kinase                              422   6e-133   
ref|XP_008804330.1|  PREDICTED: probable serine/threonine-protein...    421   7e-133   
ref|XP_008355810.1|  PREDICTED: probable serine/threonine-protein...    422   8e-133   
ref|XP_008355813.1|  PREDICTED: probable serine/threonine-protein...    419   9e-133   
emb|CDX80684.1|  BnaC07g27600D                                          412   1e-132   
ref|XP_008813013.1|  PREDICTED: probable serine/threonine-protein...    421   1e-132   
ref|XP_004247358.1|  PREDICTED: probable serine/threonine-protein...    420   2e-132   
ref|XP_008355811.1|  PREDICTED: probable serine/threonine-protein...    421   2e-132   
gb|KHN43209.1|  Serine/threonine-protein kinase WNK1                    419   2e-132   
ref|XP_009344095.1|  PREDICTED: probable serine/threonine-protein...    421   2e-132   
gb|KDP23631.1|  hypothetical protein JCGZ_23464                         420   2e-132   
ref|XP_004495783.1|  PREDICTED: serine/threonine-protein kinase W...    420   2e-132   
gb|KHN15771.1|  Serine/threonine-protein kinase WNK1                    420   3e-132   
ref|NP_001235971.1|  with no lysine kinase 9                            418   3e-132   
emb|CAN72330.1|  hypothetical protein VITISV_035622                     420   3e-132   Vitis vinifera
ref|XP_006419925.1|  hypothetical protein CICLE_v10004410mg             420   3e-132   
ref|XP_006657871.1|  PREDICTED: probable serine/threonine-protein...    419   4e-132   
ref|XP_007034749.1|  Kinase, putative isoform 2                         414   4e-132   
ref|XP_002460895.1|  hypothetical protein SORBIDRAFT_02g037070          418   6e-132   Sorghum bicolor [broomcorn]
ref|XP_006360800.1|  PREDICTED: serine/threonine-protein kinase W...    419   7e-132   
ref|XP_011032469.1|  PREDICTED: probable serine/threonine-protein...    419   8e-132   
ref|XP_011090722.1|  PREDICTED: probable serine/threonine-protein...    417   9e-132   
gb|KDP40168.1|  hypothetical protein JCGZ_02166                         418   9e-132   
ref|XP_009366936.1|  PREDICTED: probable serine/threonine-protein...    419   1e-131   
ref|XP_002991841.1|  hypothetical protein SELMODRAFT_134331             406   1e-131   
gb|KDO74609.1|  hypothetical protein CISIN_1g004645mg                   418   1e-131   
ref|XP_008667526.1|  PREDICTED: LOC100273552 isoform X1                 417   1e-131   
ref|XP_007143254.1|  hypothetical protein PHAVU_007G057000g             417   2e-131   
ref|XP_006606055.1|  PREDICTED: serine/threonine-protein kinase W...    417   2e-131   
ref|XP_008218197.1|  PREDICTED: probable serine/threonine-protein...    417   2e-131   
ref|XP_008218194.1|  PREDICTED: probable serine/threonine-protein...    417   3e-131   
ref|XP_002993000.1|  hypothetical protein SELMODRAFT_136322             405   3e-131   
ref|XP_010326545.1|  PREDICTED: probable serine/threonine-protein...    417   3e-131   
ref|XP_011005686.1|  PREDICTED: probable serine/threonine-protein...    417   3e-131   
ref|XP_007030632.1|  Kinase, putative isoform 1                         416   3e-131   
gb|KDO49668.1|  hypothetical protein CISIN_1g010730mg                   407   4e-131   
ref|XP_004958099.1|  PREDICTED: probable serine/threonine-protein...    416   4e-131   
ref|XP_010466521.1|  PREDICTED: serine/threonine-protein kinase WNK2    411   4e-131   
ref|XP_009417161.1|  PREDICTED: probable serine/threonine-protein...    417   5e-131   
ref|XP_008218196.1|  PREDICTED: probable serine/threonine-protein...    416   6e-131   
ref|XP_010511322.1|  PREDICTED: serine/threonine-protein kinase W...    411   6e-131   
dbj|BAB01779.1|  MAP kinase                                             411   6e-131   Arabidopsis thaliana [mouse-ear cress]
gb|ABH07431.1|  with no lysine kinase 1                                 414   6e-131   Oryza sativa Indica Group [Indian rice]
ref|XP_003562859.1|  PREDICTED: probable serine/threonine-protein...    414   7e-131   
emb|CDP08559.1|  unnamed protein product                                411   9e-131   
emb|CDY59818.1|  BnaA09g51650D                                          407   1e-130   
ref|XP_008340976.1|  PREDICTED: probable serine/threonine-protein...    416   1e-130   
ref|XP_007208060.1|  hypothetical protein PRUPE_ppa001969mg             416   1e-130   
ref|XP_010488266.1|  PREDICTED: serine/threonine-protein kinase W...    410   1e-130   
ref|XP_006406167.1|  hypothetical protein EUTSA_v10020315mg             411   2e-130   
ref|XP_010923386.1|  PREDICTED: probable serine/threonine-protein...    415   2e-130   
ref|NP_001060061.1|  Os07g0572800                                       414   2e-130   
dbj|BAC83145.1|  mitogen activated protein kinase kinase                414   2e-130   
emb|CDY10641.1|  BnaA05g17210D                                          409   3e-130   
gb|EAZ04417.1|  hypothetical protein OsI_26562                          414   3e-130   
sp|A2YMV6.2|WNK1_ORYSI  RecName: Full=Probable serine/threonine-p...    414   3e-130   
ref|XP_004139220.1|  PREDICTED: serine/threonine-protein kinase W...    414   3e-130   
ref|XP_006297307.1|  hypothetical protein CARUB_v10013321mg             409   4e-130   
ref|XP_010906946.1|  PREDICTED: probable serine/threonine-protein...    411   4e-130   
gb|AAC32599.1|  mitogen activated protein kinase kinase                 412   4e-130   
ref|XP_007034748.1|  No lysine kinase 1 isoform 1                       414   5e-130   
ref|NP_188881.1|  serine/threonine-protein kinase WNK2                  409   5e-130   
emb|CDX74162.1|  BnaA03g28850D                                          411   6e-130   
ref|XP_009134793.1|  PREDICTED: serine/threonine-protein kinase WNK1    411   7e-130   
ref|XP_009145330.1|  PREDICTED: serine/threonine-protein kinase WNK2    409   9e-130   
ref|NP_001235988.1|  with no lysine kinase 2                            410   9e-130   
emb|CDY40685.1|  BnaC03g34010D                                          411   1e-129   
ref|XP_006389327.1|  hypothetical protein POPTR_0030s00490g             413   1e-129   
emb|CDY24308.1|  BnaC03g42810D                                          407   1e-129   
ref|XP_010024308.1|  PREDICTED: probable serine/threonine-protein...    413   1e-129   
ref|XP_007212624.1|  hypothetical protein PRUPE_ppa016076mg             403   1e-129   
ref|XP_002991747.1|  hypothetical protein SELMODRAFT_134163             402   1e-129   
ref|XP_006419924.1|  hypothetical protein CICLE_v10004410mg             412   2e-129   
ref|XP_008455759.1|  PREDICTED: probable serine/threonine-protein...    412   2e-129   
gb|KDO40445.1|  hypothetical protein CISIN_1g004564mg                   413   2e-129   
emb|CDY00011.1|  BnaC09g02900D                                          405   2e-129   
ref|XP_006433043.1|  hypothetical protein CICLE_v10000387mg             412   2e-129   
ref|XP_010906947.1|  PREDICTED: probable serine/threonine-protein...    408   2e-129   
ref|XP_002989749.1|  hypothetical protein SELMODRAFT_130367             401   3e-129   
ref|XP_010463978.1|  PREDICTED: serine/threonine-protein kinase W...    410   3e-129   
ref|XP_006408137.1|  hypothetical protein EUTSA_v10020195mg             410   3e-129   
ref|XP_010550938.1|  PREDICTED: serine/threonine-protein kinase W...    410   3e-129   
ref|XP_009625181.1|  PREDICTED: probable serine/threonine-protein...    412   4e-129   
ref|XP_009625180.1|  PREDICTED: probable serine/threonine-protein...    412   4e-129   
emb|CDY38324.1|  BnaC05g30170D                                          405   6e-129   
ref|XP_004142568.1|  PREDICTED: serine/threonine-protein kinase W...    407   7e-129   
ref|XP_006378396.1|  hypothetical protein POPTR_0010s09830g             411   7e-129   
ref|XP_004230120.1|  PREDICTED: probable serine/threonine-protein...    411   7e-129   
ref|XP_006858915.1|  hypothetical protein AMTR_s00068p00045320          412   1e-128   
ref|XP_002517147.1|  conserved hypothetical protein                     410   1e-128   
ref|XP_010649893.1|  PREDICTED: probable serine/threonine-protein...    410   2e-128   
ref|XP_006347798.1|  PREDICTED: serine/threonine-protein kinase W...    410   2e-128   
gb|KHG07577.1|  Serine/threonine-protein kinase WNK1                    410   2e-128   
ref|XP_008447143.1|  PREDICTED: probable serine/threonine-protein...    410   2e-128   
ref|XP_002874418.1|  hypothetical protein ARALYDRAFT_489642             401   3e-128   
ref|XP_006408136.1|  hypothetical protein EUTSA_v10020195mg             407   3e-128   
ref|XP_004155722.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    405   4e-128   
ref|XP_004302023.1|  PREDICTED: serine/threonine-protein kinase W...    409   5e-128   
ref|XP_010488267.1|  PREDICTED: serine/threonine-protein kinase W...    403   6e-128   
ref|XP_009625182.1|  PREDICTED: probable serine/threonine-protein...    408   8e-128   
ref|XP_009780962.1|  PREDICTED: probable serine/threonine-protein...    408   8e-128   
gb|KEH43889.1|  WNK kinase                                              407   9e-128   
ref|XP_004139884.1|  PREDICTED: serine/threonine-protein kinase W...    408   1e-127   
ref|XP_009780968.1|  PREDICTED: probable serine/threonine-protein...    408   1e-127   
emb|CDX92942.1|  BnaA03g36640D                                          401   1e-127   
gb|KFK37900.1|  hypothetical protein AALP_AA3G043900                    406   1e-127   
ref|XP_010685973.1|  PREDICTED: probable serine/threonine-protein...    400   1e-127   
gb|AGA37219.1|  mitogen-activated protein kinase kinase kinase ZI...    402   2e-127   
ref|XP_010090269.1|  Serine/threonine-protein kinase WNK1               407   2e-127   
ref|XP_006588365.1|  PREDICTED: with no lysine kinase 2 isoform X1      407   2e-127   
emb|CDY41908.1|  BnaC05g46960D                                          404   3e-127   
ref|XP_008813012.1|  PREDICTED: probable serine/threonine-protein...    407   3e-127   
ref|XP_008462723.1|  PREDICTED: probable serine/threonine-protein...    402   4e-127   
gb|EMS52048.1|  putative serine/threonine-protein kinase WNK1           404   6e-127   
ref|XP_009135806.1|  PREDICTED: serine/threonine-protein kinase W...    400   6e-127   
ref|XP_008804212.1|  PREDICTED: probable serine/threonine-protein...    402   7e-127   
ref|XP_004494679.1|  PREDICTED: serine/threonine-protein kinase W...    408   7e-127   
ref|XP_010694157.1|  PREDICTED: probable serine/threonine-protein...    406   9e-127   
ref|XP_009364542.1|  PREDICTED: probable serine/threonine-protein...    404   1e-126   
gb|KCW60761.1|  hypothetical protein EUGRSUZ_H03484                     404   2e-126   
ref|XP_009111922.1|  PREDICTED: probable serine/threonine-protein...    396   2e-126   
ref|XP_010532538.1|  PREDICTED: serine/threonine-protein kinase W...    402   2e-126   
ref|XP_010694160.1|  PREDICTED: probable serine/threonine-protein...    404   2e-126   
ref|XP_009364543.1|  PREDICTED: probable serine/threonine-protein...    403   3e-126   
ref|XP_008804213.1|  PREDICTED: probable serine/threonine-protein...    399   4e-126   
gb|KHN30959.1|  Putative serine/threonine-protein kinase WNK2           399   4e-126   
ref|NP_001031960.1|  putative serine/threonine-protein kinase WNK9      395   6e-126   
ref|XP_009135807.1|  PREDICTED: serine/threonine-protein kinase W...    397   6e-126   
ref|XP_010027207.1|  PREDICTED: probable serine/threonine-protein...    400   7e-126   
gb|KFK39534.1|  hypothetical protein AALP_AA3G256700                    399   1e-125   
ref|XP_010912955.1|  PREDICTED: probable serine/threonine-protein...    400   1e-125   
ref|XP_006577753.1|  PREDICTED: with no lysine kinase isoform X1        398   1e-125   
ref|XP_011026437.1|  PREDICTED: probable serine/threonine-protein...    401   2e-125   
ref|XP_009418807.1|  PREDICTED: probable serine/threonine-protein...    395   3e-125   
ref|XP_006580911.1|  PREDICTED: with no lysine kinase 7 isoform X2      396   3e-125   
ref|XP_010090912.1|  Serine/threonine-protein kinase WNK1               401   4e-125   
ref|XP_008811742.1|  PREDICTED: probable serine/threonine-protein...    399   4e-125   
ref|XP_002311620.2|  hypothetical protein POPTR_0008s15170g             400   5e-125   
ref|XP_008239340.1|  PREDICTED: probable serine/threonine-protein...    397   5e-125   
ref|XP_011026421.1|  PREDICTED: probable serine/threonine-protein...    401   6e-125   
ref|XP_008239339.1|  PREDICTED: probable serine/threonine-protein...    397   7e-125   
ref|XP_007209096.1|  hypothetical protein PRUPE_ppa003632mg             394   1e-124   
ref|XP_006580910.1|  PREDICTED: with no lysine kinase 7 isoform X1      395   2e-124   
ref|XP_010694158.1|  PREDICTED: probable serine/threonine-protein...    399   2e-124   
ref|XP_008366861.1|  PREDICTED: probable serine/threonine-protein...    398   2e-124   
ref|XP_009406528.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    392   3e-124   
gb|EMT05226.1|  Putative serine/threonine-protein kinase WNK1           401   3e-124   
ref|XP_007138006.1|  hypothetical protein PHAVU_009G173100g             394   7e-124   
gb|KDP31021.1|  hypothetical protein JCGZ_11397                         394   8e-124   
ref|XP_008438978.1|  PREDICTED: probable serine/threonine-protein...    392   1e-123   
ref|XP_011040496.1|  PREDICTED: probable serine/threonine-protein...    392   2e-123   
ref|XP_010694159.1|  PREDICTED: probable serine/threonine-protein...    397   2e-123   
ref|XP_008438898.1|  PREDICTED: probable serine/threonine-protein...    392   3e-123   
ref|XP_006852379.1|  hypothetical protein AMTR_s00049p00228060          395   4e-123   
ref|XP_008366862.1|  PREDICTED: probable serine/threonine-protein...    394   4e-123   
ref|XP_002883363.1|  predicted protein                                  391   5e-123   
ref|XP_002318673.2|  kinase family protein                              391   6e-123   
ref|XP_004152570.1|  PREDICTED: probable serine/threonine-protein...    390   1e-122   
emb|CBI14941.3|  unnamed protein product                                387   1e-122   
ref|XP_009362930.1|  PREDICTED: probable serine/threonine-protein...    391   2e-122   
ref|XP_002321638.1|  hypothetical protein POPTR_0015s09610g             389   2e-122   
ref|XP_009362933.1|  PREDICTED: probable serine/threonine-protein...    389   2e-122   
ref|XP_004955684.1|  PREDICTED: probable serine/threonine-protein...    389   2e-122   
ref|XP_009362931.1|  PREDICTED: probable serine/threonine-protein...    390   2e-122   
ref|XP_004301014.1|  PREDICTED: probable serine/threonine-protein...    389   2e-122   
ref|XP_010550704.1|  PREDICTED: probable serine/threonine-protein...    387   4e-122   
gb|KCW52445.1|  hypothetical protein EUGRSUZ_J01843                     387   5e-122   
ref|XP_004241502.1|  PREDICTED: probable serine/threonine-protein...    390   5e-122   
ref|XP_008380523.1|  PREDICTED: probable serine/threonine-protein...    390   5e-122   
ref|XP_011046241.1|  PREDICTED: probable serine/threonine-protein...    388   7e-122   
gb|AGA37256.1|  mitogen activated kinase kinase kinase ZIK3.2           388   7e-122   
ref|XP_002511310.1|  kinase, putative                                   389   7e-122   
ref|XP_010319025.1|  PREDICTED: probable serine/threonine-protein...    391   2e-121   
ref|XP_003601159.1|  Serine/threonine protein kinase WNK2               387   2e-121   
ref|XP_008356716.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    384   2e-121   
ref|XP_009362929.1|  PREDICTED: probable serine/threonine-protein...    388   2e-121   
ref|XP_009358673.1|  PREDICTED: serine/threonine-protein kinase W...    387   2e-121   
ref|XP_006404281.1|  hypothetical protein EUTSA_v10010293mg             384   3e-121   
ref|XP_008380522.1|  PREDICTED: probable serine/threonine-protein...    388   3e-121   
ref|XP_007039430.1|  No lysine kinase 10 isoform 1                      387   4e-121   
gb|EYU17738.1|  hypothetical protein MIMGU_mgv1a003221mg                386   5e-121   
emb|CDY21817.1|  BnaA06g20860D                                          384   5e-121   
ref|XP_006344481.1|  PREDICTED: probable serine/threonine-protein...    390   5e-121   
ref|XP_009333940.1|  PREDICTED: probable serine/threonine-protein...    387   5e-121   
ref|XP_010426313.1|  PREDICTED: probable serine/threonine-protein...    383   6e-121   
ref|XP_010503456.1|  PREDICTED: probable serine/threonine-protein...    383   6e-121   
ref|XP_006290923.1|  hypothetical protein CARUB_v10017035mg             383   6e-121   
ref|NP_680105.1|  putative serine/threonine-protein kinase WNK3         383   6e-121   
ref|XP_009150200.1|  PREDICTED: probable serine/threonine-protein...    383   8e-121   
emb|CAC84087.1|  ZIK1 protein                                           385   8e-121   
ref|XP_004955683.1|  PREDICTED: probable serine/threonine-protein...    384   8e-121   
ref|XP_002277287.1|  PREDICTED: probable serine/threonine-protein...    388   9e-121   
ref|XP_008239216.1|  PREDICTED: serine/threonine-protein kinase WNK8    385   1e-120   
ref|XP_009375426.1|  PREDICTED: probable serine/threonine-protein...    386   2e-120   
ref|XP_004501868.1|  PREDICTED: probable serine/threonine-protein...    384   2e-120   
ref|XP_006476896.1|  PREDICTED: probable serine/threonine-protein...    384   2e-120   
emb|CDP12714.1|  unnamed protein product                                387   3e-120   
ref|XP_011026430.1|  PREDICTED: probable serine/threonine-protein...    389   3e-120   
ref|XP_009404238.1|  PREDICTED: probable serine/threonine-protein...    386   3e-120   
ref|XP_009772721.1|  PREDICTED: probable serine/threonine-protein...    385   4e-120   
ref|XP_009334386.1|  PREDICTED: serine/threonine-protein kinase W...    384   4e-120   
ref|XP_006476895.1|  PREDICTED: probable serine/threonine-protein...    384   4e-120   
ref|XP_009333939.1|  PREDICTED: probable serine/threonine-protein...    385   4e-120   
ref|XP_010515141.1|  PREDICTED: probable serine/threonine-protein...    381   5e-120   
ref|XP_006439255.1|  hypothetical protein CICLE_v10019287mg             384   5e-120   
ref|XP_009628331.1|  PREDICTED: probable serine/threonine-protein...    387   5e-120   
ref|XP_006439256.1|  hypothetical protein CICLE_v10019287mg             384   8e-120   
gb|EMT11060.1|  Putative serine/threonine-protein kinase WNK2           382   9e-120   
ref|XP_006439931.1|  hypothetical protein CICLE_v10019340mg             383   9e-120   
ref|XP_006476897.1|  PREDICTED: probable serine/threonine-protein...    382   1e-119   
gb|KDO76676.1|  hypothetical protein CISIN_1g006781mg                   381   1e-119   
gb|EYU22189.1|  hypothetical protein MIMGU_mgv1a004122mg                380   1e-119   
ref|XP_009779090.1|  PREDICTED: probable serine/threonine-protein...    386   1e-119   
gb|KHG27767.1|  Serine/threonine-protein kinase WNK8                    382   2e-119   
ref|XP_008390301.1|  PREDICTED: serine/threonine-protein kinase W...    382   2e-119   
ref|XP_009358674.1|  PREDICTED: serine/threonine-protein kinase W...    382   2e-119   
ref|XP_008392885.1|  PREDICTED: probable serine/threonine-protein...    382   3e-119   
ref|XP_008392887.1|  PREDICTED: probable serine/threonine-protein...    380   3e-119   
ref|XP_008392886.1|  PREDICTED: probable serine/threonine-protein...    382   3e-119   
ref|XP_007037762.1|  No lysine kinase 3 isoform 1                       382   4e-119   
ref|XP_004502064.1|  PREDICTED: serine/threonine-protein kinase W...    381   6e-119   
gb|KDO76674.1|  hypothetical protein CISIN_1g006781mg                   382   7e-119   
emb|CDX77897.1|  BnaC03g53220D                                          378   8e-119   
ref|XP_006476316.1|  PREDICTED: serine/threonine-protein kinase W...    382   8e-119   
ref|XP_011040497.1|  PREDICTED: probable serine/threonine-protein...    380   8e-119   
ref|XP_002877606.1|  predicted protein                                  377   9e-119   
ref|XP_008233107.1|  PREDICTED: probable serine/threonine-protein...    382   1e-118   
ref|XP_008811741.1|  PREDICTED: probable serine/threonine-protein...    383   1e-118   
gb|KDO76678.1|  hypothetical protein CISIN_1g006781mg                   381   1e-118   
ref|XP_004955682.1|  PREDICTED: probable serine/threonine-protein...    379   1e-118   
ref|XP_008392884.1|  PREDICTED: probable serine/threonine-protein...    381   1e-118   
ref|NP_001236039.1|  with no lysine kinase                              379   2e-118   
ref|XP_006439257.1|  hypothetical protein CICLE_v10019287mg             380   2e-118   
ref|XP_004955681.1|  PREDICTED: probable serine/threonine-protein...    379   2e-118   
ref|XP_002452766.1|  hypothetical protein SORBIDRAFT_04g032080          379   3e-118   
ref|XP_010533446.1|  PREDICTED: probable serine/threonine-protein...    378   4e-118   
ref|XP_006347423.1|  PREDICTED: probable serine/threonine-protein...    380   4e-118   
gb|KDP28454.1|  hypothetical protein JCGZ_14225                         380   7e-118   
ref|NP_001236111.1|  with no lysine kinase 4                            373   9e-118   
ref|XP_003601461.1|  Serine/threonine protein kinase WNK8               378   1e-117   
ref|XP_010100703.1|  putative serine/threonine-protein kinase WNK4      377   1e-117   
gb|AFW63351.1|  putative protein kinase superfamily protein             376   2e-117   
gb|AAK73135.1|AC079022_8  putative protein kinase                       375   2e-117   
ref|XP_004496735.1|  PREDICTED: serine/threonine-protein kinase W...    381   2e-117   
gb|EEC78375.1|  hypothetical protein OsI_18146                          377   2e-117   
emb|CBI40585.3|  unnamed protein product                                376   3e-117   
ref|XP_008374149.1|  PREDICTED: serine/threonine-protein kinase W...    378   3e-117   
emb|CBI34567.3|  unnamed protein product                                376   3e-117   
gb|KDO76679.1|  hypothetical protein CISIN_1g006781mg                   377   3e-117   
ref|XP_002303683.1|  kinase family protein                              376   3e-117   
ref|XP_008678931.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    376   3e-117   
gb|KFK34126.1|  hypothetical protein AALP_AA5G104700                    374   3e-117   
ref|NP_001054430.1|  Os05g0108300                                       377   4e-117   
ref|NP_974354.1|  serine/threonine-protein kinase WNK2                  377   5e-117   
ref|XP_004496733.1|  PREDICTED: serine/threonine-protein kinase W...    381   6e-117   
ref|XP_010251035.1|  PREDICTED: probable serine/threonine-protein...    378   6e-117   
ref|XP_010231854.1|  PREDICTED: probable serine/threonine-protein...    377   7e-117   
ref|XP_010485878.1|  PREDICTED: serine/threonine-protein kinase W...    378   7e-117   
gb|KDO76675.1|  hypothetical protein CISIN_1g006781mg                   376   7e-117   
ref|XP_007220210.1|  hypothetical protein PRUPE_ppa002647mg             377   9e-117   
ref|XP_004953424.1|  PREDICTED: probable serine/threonine-protein...    375   1e-116   
ref|XP_010919301.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    377   1e-116   
ref|XP_010106142.1|  Serine/threonine-protein kinase WNK8               377   1e-116   
ref|XP_007210290.1|  hypothetical protein PRUPE_ppa002664mg             376   2e-116   



>ref|XP_009597550.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Nicotiana 
tomentosiformis]
Length=592

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/556 (69%), Positives = 443/556 (80%), Gaps = 35/556 (6%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VY+AFDE+LG+EVAWNQ+KLN+VFRSPEELQRLYSEV LLK+LDH SIM+FHASWI+ + 
Sbjct  39    VYKAFDELLGIEVAWNQVKLNDVFRSPEELQRLYSEVHLLKELDHESIMKFHASWINVEG  98

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             RTFNFITE+FTSGTLREYRQ+Y  VNIRAIKNW RQIL+GLAYLH H+PPVIHRDLKCDN
Sbjct  99    RTFNFITEMFTSGTLREYRQKYKRVNIRAIKNWARQILKGLAYLHGHNPPVIHRDLKCDN  158

Query  365   IFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             IFVNGHLGQVKIGDLGLA +L GS HAHSVIGTPEFMAPELYEE+YDELVD+YSFGMCVL
Sbjct  159   IFVNGHLGQVKIGDLGLAIILCGSHHAHSVIGTPEFMAPELYEEDYDELVDVYSFGMCVL  218

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY I +AEAQ FVGRCL PAS+RPSA ELL
Sbjct  219   EMLTSEYPYSECSNPAQIYKKVTSGKLPKAFYEISDAEAQIFVGRCLNPASERPSASELL  278

Query  722   LDPFLAADEEEDESA--KLPSQKLIPNGKLLEVEPCFVDQQA-KSSDMTITGTLNPEDDT  892
              DPFLA DE+E  S    LP QKL P G+  E  PC  D      +DMTITGT+NPEDDT
Sbjct  279   RDPFLAVDEDEQSSPVINLPGQKLTPIGEQNEA-PCQSDDSVLGGTDMTITGTMNPEDDT  337

Query  893   IFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISAL  1072
             IFL+VQIS K+GKARNIFFPFDI++DTA+EVA EMVKEL+ITDW PL IA+MIDEEI AL
Sbjct  338   IFLKVQISQKNGKARNIFFPFDISNDTALEVAVEMVKELDITDWDPLQIADMIDEEIFAL  397

Query  1073  VPTWRSTQ-----YQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE-  1234
             +P W+++Q     Y++QHSFNY++DDD+++       R+PFY +SS SSSQ SLP L   
Sbjct  398   IPQWKNSQDSVQNYEEQHSFNYVEDDDENH-------RNPFYYISSHSSSQLSLPGLFPS  450

Query  1235  ----KINHDWLQN-----DDTSSRSSMNSYDCS---NLCWATESEGDLSSIGGRESLLI-  1375
                 K++HDWLQ+     DD+SS+ SMNSY      N C   E + DL+           
Sbjct  451   YHQGKLDHDWLQDELKLYDDSSSQCSMNSYGSYNNLNFCSLQEDDADLNYKKAESQYCTD  510

Query  1376  QKTNT-GTRLCPETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRL  1552
             QKTN   TR CPET+ S  +       +Q PK+++V+S+VD+RSQLLHR+LVEE+NKRRL
Sbjct  511   QKTNKCTTRFCPETNMSKNQSVLM---NQHPKLTKVKSLVDIRSQLLHRSLVEEINKRRL  567

Query  1553  FKTVGAVENIGYHEPA  1600
             FKTVGAVENIGYH+PA
Sbjct  568   FKTVGAVENIGYHDPA  583



>ref|XP_006346683.1| PREDICTED: probable serine/threonine-protein kinase WNK5-like 
[Solanum tuberosum]
Length=612

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/554 (68%), Positives = 440/554 (79%), Gaps = 25/554 (5%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VYRAFDE+LGMEVAWNQ+KLN++FRSPEELQRLYSEV LLK+LDH SIM+FHASWI+ + 
Sbjct  53    VYRAFDELLGMEVAWNQVKLNDMFRSPEELQRLYSEVHLLKELDHESIMKFHASWINVEG  112

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             RTFNFITE+FTSGTLREYR +Y  VNI AIKNW  QIL+GLAYLH HDPPVIHRDLKCDN
Sbjct  113   RTFNFITEMFTSGTLREYRHKYRRVNIHAIKNWGCQILKGLAYLHCHDPPVIHRDLKCDN  172

Query  365   IFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             IFVNGHLGQVKIGDLGLA +L GS HAHSVIGTPEFMAPELYEE+YDELVD+YSFGMCVL
Sbjct  173   IFVNGHLGQVKIGDLGLATILCGSHHAHSVIGTPEFMAPELYEEDYDELVDVYSFGMCVL  232

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY+I++AEAQRFVGRCL P S+RPSA ELL
Sbjct  233   EMLTSEYPYSECSNPAQIYKKVTSGKLPKAFYKINDAEAQRFVGRCLSPVSERPSASELL  292

Query  722   LDPFLAADEEED--ESAKLPSQKLIPNGKLLEVEPCFVDQQA-KSSDMTITGTLNPEDDT  892
              DPFLA DE ED      L  +KL PNGK  E+ P   D      ++MTITGT+NPEDDT
Sbjct  293   RDPFLAVDEHEDLPPVINLSCEKLTPNGKQNEIIPSQPDDTVLDGTNMTITGTMNPEDDT  352

Query  893   IFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISAL  1072
             IFL+VQI  K+G+ARNIFFPFDI+SDTAMEVA EMVKEL+ITDW PL IA+MID EIS L
Sbjct  353   IFLKVQIFQKNGQARNIFFPFDISSDTAMEVAAEMVKELDITDWDPLQIADMIDTEISDL  412

Query  1073  VPTWRST----QYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE--  1234
             +P W+ +     Y++QHSFNY++DDD+D++     T HPFY  SS SSSQ SLP LL   
Sbjct  413   IPEWKKSPSLQNYEQQHSFNYVEDDDNDDDD-DENTPHPFYYNSSHSSSQLSLPGLLPSY  471

Query  1235  -------KINHDWLQN-----DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQ  1378
                    K++HDWLQ+     DD+SS+ SM SY+  N     E + D   +G +++   Q
Sbjct  472   KSTFHQGKLDHDWLQDELKLYDDSSSQCSMTSYESFNNVNFHEDDAD--CMGSKKAESQQ  529

Query  1379  KTNTGTRLCPETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFK  1558
              +   TR CPETS  +K +     N+QRPK+++VRS+VD+RSQLLHR+LVEE+NKRRLFK
Sbjct  530   TSKCSTRFCPETSMLSKNQNTMQMNNQRPKLTKVRSLVDIRSQLLHRSLVEEINKRRLFK  589

Query  1559  TVGAVENIGYHEPA  1600
             TVGAVENIGYHEP 
Sbjct  590   TVGAVENIGYHEPG  603



>ref|XP_009758213.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Nicotiana 
sylvestris]
Length=593

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/557 (68%), Positives = 443/557 (80%), Gaps = 36/557 (6%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VY+AFDE+LG+EVAWNQ+KLN+VFRSPEELQRLYSEV LLK+LDH SIM+FHASWI+ + 
Sbjct  39    VYKAFDELLGIEVAWNQVKLNDVFRSPEELQRLYSEVHLLKELDHESIMKFHASWINVEG  98

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             RTFNFITE+FTSGTLREYR +Y  VNIRAIKNW RQIL+GLAYLH H+PPVIHRDLKCDN
Sbjct  99    RTFNFITEMFTSGTLREYRHKYKRVNIRAIKNWARQILKGLAYLHGHNPPVIHRDLKCDN  158

Query  365   IFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             IFVNGHLGQVKIGDLGLA +L GS HAHSVIGTPEFMAPELYEE+YDELVD+YSFGMCVL
Sbjct  159   IFVNGHLGQVKIGDLGLATILCGSHHAHSVIGTPEFMAPELYEEDYDELVDVYSFGMCVL  218

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY+I +AEAQ FVGRCL  AS+RPSA ELL
Sbjct  219   EMLTSEYPYSECSNPAQIYKKVTSGKLPKAFYKISDAEAQIFVGRCLNTASERPSASELL  278

Query  722   LDPFLAADEEEDESA--KLP-SQKLIPNGKLLEVEPCFVDQQA-KSSDMTITGTLNPEDD  889
              DPFLA DE+E  S    LP  QK  PNG+  EV PC  D      +DM ITGT+NP DD
Sbjct  279   RDPFLAVDEDEQLSPVINLPFHQKFTPNGEQNEV-PCQSDDSVLGGTDMIITGTMNPADD  337

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
             TIFL+VQIS K+GKARNIFFPFDI++DTAMEVA EMVKEL+ITDW PL IA+MID+EISA
Sbjct  338   TIFLKVQISQKNGKARNIFFPFDISNDTAMEVAVEMVKELDITDWDPLQIADMIDQEISA  397

Query  1070  LVPTWRSTQ-----YQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLL-  1231
             L+PTW+++Q     Y++QHSFNY++DDD+++       R+ FY +SS SSSQ SLP LL 
Sbjct  398   LIPTWKNSQNSVQNYEQQHSFNYVEDDDENH-------RNLFYYISSHSSSQLSLPGLLP  450

Query  1232  ----EKINHDWLQN-----DDTSSRSSMNSYDCS---NLCWATESEGDLSSIGGRESLLI  1375
                 EK++HDWLQ+     DD+SS+ SMNSY      N C   E + DL+          
Sbjct  451   SYHQEKLDHDWLQDELKPYDDSSSQCSMNSYGSYNNLNFCSLQEDDADLNYKKAESQYCT  510

Query  1376  -QKTNT-GTRLCPETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRR  1549
              QKTN   TR CPET+ S  +       +Q PK+++V+S+VD+RSQL+HR+LVEE+NKRR
Sbjct  511   DQKTNKCTTRFCPETNMSKNQSALM---NQHPKLTKVKSLVDIRSQLMHRSLVEEINKRR  567

Query  1550  LFKTVGAVENIGYHEPA  1600
             LF TVGAVENIGYH+PA
Sbjct  568   LFNTVGAVENIGYHDPA  584



>ref|XP_004246271.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Solanum 
lycopersicum]
Length=606

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/555 (68%), Positives = 440/555 (79%), Gaps = 25/555 (5%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VYRAFDE+LGMEVAWNQ+KLN++FRSPEELQRLYSEV LLK+LDH +IM+FHASWI+ + 
Sbjct  45    VYRAFDELLGMEVAWNQVKLNDMFRSPEELQRLYSEVHLLKELDHEAIMKFHASWINVEG  104

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             RTFNFITE+FTSGTLREYR +Y  +NI AIKNW  QIL GLAYLH HDPPVIHRDLKCDN
Sbjct  105   RTFNFITEMFTSGTLREYRHKYKRLNIHAIKNWGCQILNGLAYLHCHDPPVIHRDLKCDN  164

Query  365   IFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             IFVNGHLGQVKIGDLGLA +L GS HAHSVIGTPEFMAPELYEE+YDELVD+YSFGMCVL
Sbjct  165   IFVNGHLGQVKIGDLGLATILCGSHHAHSVIGTPEFMAPELYEEDYDELVDVYSFGMCVL  224

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY+I++ EAQRFVGRCL P S+RPSA ELL
Sbjct  225   EMLTSEYPYSECSNPAQIYKKVTSGKLPKAFYKINDPEAQRFVGRCLSPVSERPSASELL  284

Query  722   LDPFLAADEEED--ESAKLPSQKLIPNGKLLEVEPCFVDQQA-KSSDMTITGTLNPEDDT  892
              DPFLA DE ED   +  L  QK +PN K  E+ P   D      ++MTITGT+NPED T
Sbjct  285   RDPFLAVDEHEDLPPAINLSCQKYMPNEKQNEIIPFQPDDSVLDGTNMTITGTMNPEDYT  344

Query  893   IFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISAL  1072
             IFL+VQI  K+G+ARNIFFPFDI+SDTAMEVA EMVKEL+ITDW PL IA+MID EIS L
Sbjct  345   IFLKVQIFQKNGQARNIFFPFDISSDTAMEVAAEMVKELDITDWDPLQIADMIDTEISDL  404

Query  1073  VPTWRSTQ----YQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE--  1234
             +P W++++    Y++QHSFNY+++DD+D++     T HPFY  SS SSSQ SLP LL   
Sbjct  405   IPEWKNSRSLQNYEQQHSFNYVENDDNDDDD--ENTPHPFYYNSSHSSSQLSLPGLLPSY  462

Query  1235  -------KINHDWLQN-----DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQ  1378
                    K++HDWLQ+     DD+SS+ SMNSY+  N     E++ D  S    ES   Q
Sbjct  463   KSTFHQGKLDHDWLQDELKLYDDSSSQCSMNSYESYNNVNFHENDADCMSSKKAESQCTQ  522

Query  1379  K-TNTGTRLCPETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLF  1555
             + +   TR CPETS  +K +     N+QRPK+++VRS+VD+RSQLLHR+LVEE+NKRRLF
Sbjct  523   QISKCSTRFCPETSLLSKNQNTMQMNNQRPKLTKVRSLVDIRSQLLHRSLVEEINKRRLF  582

Query  1556  KTVGAVENIGYHEPA  1600
             KTVGAVENIGYHEP 
Sbjct  583   KTVGAVENIGYHEPG  597



>ref|XP_006429556.1| hypothetical protein CICLE_v10011307mg [Citrus clementina]
 gb|ESR42796.1| hypothetical protein CICLE_v10011307mg [Citrus clementina]
Length=615

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/567 (66%), Positives = 444/567 (78%), Gaps = 31/567 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVL +EVAWNQ+KLN VFRSPEELQRLY EV LLK+L+H SI+RF+ASWID D
Sbjct  45    TVYKAFDEVLAIEVAWNQVKLNEVFRSPEELQRLYCEVHLLKNLNHDSIIRFYASWIDVD  104

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYR++YT V+IRA+KNW RQIL G+AYLH HDPPVIHRDLKCD
Sbjct  105   RRTFNFITEMFTSGTLREYRKKYTRVDIRAVKNWARQILRGIAYLHGHDPPVIHRDLKCD  164

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQ+KIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCV
Sbjct  165   NIFVNGHLGQIKIGDLGLAAILRGSQQAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCV  224

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AF+RI +AEA+RFVG+CLE  SKR  A EL
Sbjct  225   LEMLTSEYPYSECSNPAQIYKKVTSGKLPGAFHRIQDAEARRFVGKCLENVSKRLPAKEL  284

Query  719   LLDPFLAADEEED-ESAKLPS-QKLIPNGKLLEVEPCFV--DQQAKSSDMTITGTLNPED  886
             LLDPFLA+D  E     ++PS Q L PNG ++E+ P F     + KS+DMTITGT+NPED
Sbjct  285   LLDPFLASDAGEPLLIPQVPSFQNLNPNGAVMELVPKFAVDSDRRKSTDMTITGTMNPED  344

Query  887   DTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEIS  1066
             DTIFL+VQI+DKDG+ARNI+FPFDI +DTA EVA EMVKELEITDW PL+IAEMI++EIS
Sbjct  345   DTIFLKVQITDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEIS  404

Query  1067  ALVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK  1237
             +LVP W+   S Q+  QHSF+Y D+DDD+++ GI    HPFYS SS SSS ASLP     
Sbjct  405   SLVPNWKECGSPQFCHQHSFSYEDEDDDNDDDGIY---HPFYSNSSHSSSHASLPAFFTN  461

Query  1238  INH---DWLQ------NDDTSSRSSMNSYDCSNLCWATESEGD--LSSIGGRESLLIQKT  1384
               +    WLQ      NDD SS  S++S+  S+  + + +E D   S   G    + + T
Sbjct  462   NANSPPSWLQQEDLLGNDDASSNGSVSSFKYSSWDYHSGNEDDSEFSHRAGEPLCIARAT  521

Query  1385  NTGTRLCPETSRS---------NKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEV  1537
                TR CPE + +         N +K C  +++   K+SR+RS+VD+RSQLLHR+LVEE+
Sbjct  522   QKSTRFCPEAAMNNDRCNSEDVNSRKACRSNSNNHRKLSRIRSLVDVRSQLLHRSLVEEI  581

Query  1538  NKRRLFKTVGAVENIGYHEPAEYSCKG  1618
             +KRRLFKTVGAVENIG+HEPA  +  G
Sbjct  582   HKRRLFKTVGAVENIGFHEPANCAAYG  608



>ref|XP_011095120.1| PREDICTED: probable serine/threonine-protein kinase WNK5 isoform 
X2 [Sesamum indicum]
Length=582

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/561 (68%), Positives = 438/561 (78%), Gaps = 30/561 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE+LG+EVAWNQ+KLN+VF SP+ELQRLYSEV LLK L+H SIMR  ASWID +
Sbjct  3     TVYRAFDELLGVEVAWNQVKLNDVFGSPQELQRLYSEVHLLKSLNHDSIMRSRASWIDVE  62

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYR++Y  VNIRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  63    RRTFNFITEMFTSGTLREYRKKYKRVNIRAIKDWARQILEGLDYLHRHDPPVIHRDLKCD  122

Query  362   NIFVNGHLGQVKIGDLGLAAMLRG-SHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVK+GDLGLAA+LRG SHAHSVIGTPEFMAPELYEEEYDELVDIYSFGMCV
Sbjct  123   NIFVNGHLGQVKLGDLGLAAILRGTSHAHSVIGTPEFMAPELYEEEYDELVDIYSFGMCV  182

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFYRI++ EA+RFVGRCLE A+ RPSA EL
Sbjct  183   LEMLTSEYPYSECSNPAQIYKKVTSGKLPEAFYRIEDVEARRFVGRCLEKAANRPSAREL  242

Query  719   LLDPFLAADEEED---ESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDD  889
             L+DPFL+ +E E+     AK+PSQK   +GK  E+ P  V  QA+S+DM+ITGTLN EDD
Sbjct  243   LMDPFLSVEEVEELLANVAKIPSQKAALSGKSEELLPLSV-VQARSTDMSITGTLNQEDD  301

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
             TIFL+V ISDKDG ARNI+FPFDI SDT+++VATEMVKELEITDW PL+IA+MI EEIS 
Sbjct  302   TIFLKVHISDKDGSARNIYFPFDIMSDTSLDVATEMVKELEITDWDPLEIADMIGEEIST  361

Query  1070  LVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE--  1234
             LVP+W+   S+   +QHSFNY D++DD+++ G     HPFYS SS SSS ASLP L    
Sbjct  362   LVPSWKDSCSSLINQQHSFNYADEEDDNDDNG---PHHPFYSTSSFSSSHASLPGLFSLS  418

Query  1235  -------KINHDWLQNDDT-----SSRSSMNSYDCSNLCWATESEGDLSSIGGRESL-LI  1375
                    K  HDW Q D T     SS SS  S   SNL + + +E     I  +E +  I
Sbjct  419   DAEFYQAKALHDWHQEDTTSIDDASSISSSCSDKYSNLKYYSANEDSFLPISDKEEIHCI  478

Query  1376  QKTNTGTRLCPETSRS---NKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKR  1546
              KT   TR  PE S +   N     C S  Q+ KM R RSMVD+RSQLLHRTLVEE+NKR
Sbjct  479   AKTPKCTRFGPEGSTTRNCNFNVVGCSSKRQQ-KMVRTRSMVDIRSQLLHRTLVEEINKR  537

Query  1547  RLFKTVGAVENIGYHEPAEYS  1609
             RLFKTVGAVE++GYHE  ++S
Sbjct  538   RLFKTVGAVEHVGYHEVGDFS  558



>ref|XP_011095119.1| PREDICTED: probable serine/threonine-protein kinase WNK5 isoform 
X1 [Sesamum indicum]
Length=620

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/561 (68%), Positives = 438/561 (78%), Gaps = 30/561 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE+LG+EVAWNQ+KLN+VF SP+ELQRLYSEV LLK L+H SIMR  ASWID +
Sbjct  41    TVYRAFDELLGVEVAWNQVKLNDVFGSPQELQRLYSEVHLLKSLNHDSIMRSRASWIDVE  100

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYR++Y  VNIRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  101   RRTFNFITEMFTSGTLREYRKKYKRVNIRAIKDWARQILEGLDYLHRHDPPVIHRDLKCD  160

Query  362   NIFVNGHLGQVKIGDLGLAAMLRG-SHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVK+GDLGLAA+LRG SHAHSVIGTPEFMAPELYEEEYDELVDIYSFGMCV
Sbjct  161   NIFVNGHLGQVKLGDLGLAAILRGTSHAHSVIGTPEFMAPELYEEEYDELVDIYSFGMCV  220

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFYRI++ EA+RFVGRCLE A+ RPSA EL
Sbjct  221   LEMLTSEYPYSECSNPAQIYKKVTSGKLPEAFYRIEDVEARRFVGRCLEKAANRPSAREL  280

Query  719   LLDPFLAADEEED---ESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDD  889
             L+DPFL+ +E E+     AK+PSQK   +GK  E+ P  V  QA+S+DM+ITGTLN EDD
Sbjct  281   LMDPFLSVEEVEELLANVAKIPSQKAALSGKSEELLPLSV-VQARSTDMSITGTLNQEDD  339

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
             TIFL+V ISDKDG ARNI+FPFDI SDT+++VATEMVKELEITDW PL+IA+MI EEIS 
Sbjct  340   TIFLKVHISDKDGSARNIYFPFDIMSDTSLDVATEMVKELEITDWDPLEIADMIGEEIST  399

Query  1070  LVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE--  1234
             LVP+W+   S+   +QHSFNY D++DD+++ G     HPFYS SS SSS ASLP L    
Sbjct  400   LVPSWKDSCSSLINQQHSFNYADEEDDNDDNG---PHHPFYSTSSFSSSHASLPGLFSLS  456

Query  1235  -------KINHDWLQNDDT-----SSRSSMNSYDCSNLCWATESEGDLSSIGGRESL-LI  1375
                    K  HDW Q D T     SS SS  S   SNL + + +E     I  +E +  I
Sbjct  457   DAEFYQAKALHDWHQEDTTSIDDASSISSSCSDKYSNLKYYSANEDSFLPISDKEEIHCI  516

Query  1376  QKTNTGTRLCPETSRS---NKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKR  1546
              KT   TR  PE S +   N     C S  Q+ KM R RSMVD+RSQLLHRTLVEE+NKR
Sbjct  517   AKTPKCTRFGPEGSTTRNCNFNVVGCSSKRQQ-KMVRTRSMVDIRSQLLHRTLVEEINKR  575

Query  1547  RLFKTVGAVENIGYHEPAEYS  1609
             RLFKTVGAVE++GYHE  ++S
Sbjct  576   RLFKTVGAVEHVGYHEVGDFS  596



>ref|XP_006481173.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase WNK5-like [Citrus sinensis]
Length=645

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/597 (62%), Positives = 444/597 (74%), Gaps = 61/597 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVL +EVAWNQ+KLN VFRSPEELQRLY EV LLK+L+H SI+RF+ASWID D
Sbjct  45    TVYKAFDEVLAIEVAWNQVKLNEVFRSPEELQRLYCEVHLLKNLNHDSIIRFYASWIDVD  104

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYR++YT V+IRA+KNW RQIL G+AYLH HDPPVIHRDLKCD
Sbjct  105   RRTFNFITEMFTSGTLREYRKKYTRVDIRAVKNWARQILRGIAYLHGHDPPVIHRDLKCD  164

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIG---------------------------  457
             NIFVNGHLGQ+KIGDLGLAA+LRGS  AHSVIG                           
Sbjct  165   NIFVNGHLGQIKIGDLGLAAILRGSQQAHSVIGNSQYALSKLSNFDLITLTICLTXCLVR  224

Query  458   ---TPEFMAPelyeeeydelvdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPA  628
                TPEFMAPELYEE+Y+ELVDIYSFGMCVLEMLTSEYPYSEC+NPAQIYKKVTSGKLP 
Sbjct  225   TLGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPG  284

Query  629   AFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPFLAADEEED-ESAKLPS-QKLIPNGK  802
             AF+RI +AEA+RFVG+CLE  SKR  A ELLLDPFLA+D  E     ++PS Q L PNG 
Sbjct  285   AFHRIQDAEARRFVGKCLENVSKRLPAKELLLDPFLASDAGEPLLIPQVPSFQNLNPNGA  344

Query  803   LLEVEPCFV--DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTA  976
             ++E+ P F     + KS+DMTITGT+NPEDDTIFL+VQI+DKDG+ARNI+FPFDI +DTA
Sbjct  345   VMELVPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQITDKDGQARNIYFPFDIFNDTA  404

Query  977   MEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR---STQYQKQHSFNYIddddddN  1147
              EVA EMVKELEITDW PL+IAEMI++EIS+LVP W+   S Q+  QHSF+Y D+DDD++
Sbjct  405   TEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKECGSPQFCHQHSFSYEDEDDDND  464

Query  1148  NVGISTTRHPFYslssqsssqaslPDLLEKINH---DWLQ------NDDTSSRSSMNSYD  1300
             + GI    HPFYS SS SSS ASLP       +    WLQ      NDD SS  S++S+ 
Sbjct  465   DDGI---YHPFYSNSSHSSSHASLPAFFTNNANSPPSWLQQEDLLGNDDASSNGSVSSFK  521

Query  1301  CSNLCWATESEGD--LSSIGGRESLLIQKTNTGTRLCPETSRS---------NKKKGCCG  1447
              S+  + + +E D   S   G    + + T   TR CPE + +         N +K C  
Sbjct  522   YSSWDYHSGNEDDSEFSHRAGEPLCIARATQKSTRFCPEAAMNNDRCNSEDVNSRKACRS  581

Query  1448  SNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSCKG  1618
             +++   K+SR+RS+VD+RSQLLHR+LVEE++KRRLFKTVGAVENIG+HEPA  +  G
Sbjct  582   NSNNHRKLSRIRSLVDVRSQLLHRSLVEEIHKRRLFKTVGAVENIGFHEPANCAAYG  638



>emb|CDP06398.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/573 (65%), Positives = 444/573 (77%), Gaps = 48/573 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE LGMEVAWNQ+KLN+VFRSP+ELQRLYSEV LLK+LDH SIMRFHASWID  
Sbjct  45    TVYRAFDEALGMEVAWNQVKLNDVFRSPQELQRLYSEVHLLKNLDHPSIMRFHASWIDVH  104

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSG+LREYR ++  VN++A+KNW RQILEGLAYLH HDPPVIHRDLKCD
Sbjct  105   HRTFNFITEMFTSGSLREYRHKHKRVNMQAVKNWGRQILEGLAYLHGHDPPVIHRDLKCD  164

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIG-----------TPEFMAPelyeeeyde  505
             NIFVNGHLGQVKIGDLGLAA+LRGS HAHSVIG           TPEFMAPELYEE+YDE
Sbjct  165   NIFVNGHLGQVKIGDLGLAAILRGSHHAHSVIGKLFFNLLFDNSTPEFMAPELYEEDYDE  224

Query  506   lvdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLE  685
             LVD+YSFGMC+LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFYRI + EA+RF+G+CLE
Sbjct  225   LVDVYSFGMCMLEMLTSEYPYSECSNPAQIYKKVTSGKLPGAFYRIHDPEARRFIGKCLE  284

Query  686   PASKRPSAHELLLDPFLAADEEED--ESAKLPSQKLIP-----NGKLLEVEPCFVDQQAK  844
              ASKRPSA ELL DPFLA D+E++  E   +P   L+P       ++L++   F DQ+ +
Sbjct  285   TASKRPSALELLRDPFLAYDQEDELLEITGIPC--LMPCSPRRREEVLQMPSTFCDQK-R  341

Query  845   SSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDW  1024
             S++MTITGTLNP+DD+IFL+VQISDKDG+ARNI+FPFDI+SDTAM+VA EMVKELEITDW
Sbjct  342   STNMTITGTLNPKDDSIFLKVQISDKDGQARNIYFPFDISSDTAMDVAGEMVKELEITDW  401

Query  1025  MPLDIAEMIDEEISALVPTWRST----QYQKQHSFNYIddddddNNVGISTTRHPFY-sl  1189
              P++IAEMIDEEISALVP+W+        Q+QHSF Y  +DDDD++    +T  PFY   
Sbjct  402   KPIEIAEMIDEEISALVPSWKGCPQGFHQQRQHSFRYDQEDDDDHH----STLPPFYSLS  457

Query  1190  ssqsssqaslPDLLEKINHDWLQ------NDDTSSRSSMNSYDCSNLCWATESEGD---L  1342
             S  SSSQASLP L      DW+Q      +D +SS+SS NS   SNL + ++ E +    
Sbjct  458   SQHSSSQASLPGLFPSGLPDWIQEDLSNYDDASSSQSSFNSNKLSNLSYFSDREMNGSTF  517

Query  1343  SSIGGRESLLIQKTNTG-----TRLCPETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQ  1507
             SS  G   + ++ T TG     TR CP+ +  +K   CC  + +   M RVRS+VD+RSQ
Sbjct  518   SSKVGEPQIFMRTTTTGSSKWTTRFCPDQNNMSK---CCTDDDRNLGMPRVRSLVDIRSQ  574

Query  1508  LLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEY  1606
             LLHR+LVEE+N+RRLFKTVGAVENIGYHEP  Y
Sbjct  575   LLHRSLVEEINRRRLFKTVGAVENIGYHEPGGY  607



>gb|KHF97547.1| putative serine/threonine-protein kinase WNK5 [Gossypium arboreum]
Length=593

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/558 (63%), Positives = 423/558 (76%), Gaps = 28/558 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE LGMEVAWNQ+KLN+VFRSPEELQRLYSEV LLK+L H SI+RF+ SW+D +
Sbjct  42    TVYRAFDEALGMEVAWNQVKLNDVFRSPEELQRLYSEVHLLKNLKHDSIIRFYTSWVDIN  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQ+Y  +++RA+K+W  QIL+GLAYLH HDPPVIHRDLKCD
Sbjct  102   RRTFNFITEMFTSGTLREYRQKYPRIDMRAVKSWACQILQGLAYLHGHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCV
Sbjct  162   NIFVNGHLGQVKIGDLGLAAILRGSQHAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVT+GKLP AFYRI + EA+RF+G+CLE  SKR  AHEL
Sbjct  222   LEMLTSEYPYSECSNPAQIYKKVTTGKLPEAFYRIQDEEARRFIGKCLENVSKRLPAHEL  281

Query  719   LLDPFLAADEEEDESA-KLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA++E    S  ++ SQKL  NG + E+ P       +S+DM+ITGT++PEDDTI
Sbjct  282   LLDPFLASNEGNLLSVPRVLSQKLTQNGPVAELAPSLQADPTRSTDMSITGTMDPEDDTI  341

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+DK+G+ARNI+FPFDI +DTA++VA EMVKEL+I DW PL+IA+MI+EEIS+LV
Sbjct  342   FLKVQITDKEGQARNIYFPFDIVNDTAIDVALEMVKELDINDWEPLEIADMIEEEISSLV  401

Query  1076  PTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYsl---ssqsssqaslPDLLEK  1237
             PTW+   S+Q   QHSF Y D+D+DD    I    HPFY+    SS  +  +    +  K
Sbjct  402   PTWKDWGSSQVYHQHSFKYEDEDEDDAQNEIC---HPFYATFSHSSYEAQFSHGKSVTSK  458

Query  1238  IN--HDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPE  1411
              N   D   NDD SS  SMNS+  S + +    E   SS+   E   I K    TR CP 
Sbjct  459   CNWPQDLFSNDDASSSCSMNSFQYSTMNY----EDFDSSLHQGEHPCIPKGLKSTRFCPS  514

Query  1412  TSRSNKKKGCCGS----------NHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKT  1561
              S +      C +          N  R K+++VRS+VD+RS+LLH+ ++ E+NKRRLFKT
Sbjct  515   ESMTAHSYEQCDAQLDSWRSSHLNGHR-KLTKVRSLVDIRSKLLHQMVMAEINKRRLFKT  573

Query  1562  VGAVENIGYHEPAEYSCK  1615
             VGAVENIGY E  E S K
Sbjct  574   VGAVENIGYQELGEVSGK  591



>ref|XP_011008755.1| PREDICTED: probable serine/threonine-protein kinase WNK5 isoform 
X2 [Populus euphratica]
Length=611

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/570 (62%), Positives = 431/570 (76%), Gaps = 42/570 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ+KL++VF SPEELQRLYSEV LLK+L+H SI++F+ SWID D
Sbjct  35    TVYKAFDEVLGMEVAWNQVKLHDVFHSPEELQRLYSEVHLLKNLNHDSIIKFYTSWIDID  94

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RR FNFITE+FTSGTLR YR++Y  V+IRAIKNW RQIL GLA+LH HDPPVIHRDLKCD
Sbjct  95    RRAFNFITEMFTSGTLRAYRKKYQRVDIRAIKNWSRQILRGLAFLHGHDPPVIHRDLKCD  154

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF+NGHLG VKIGDLGLAA+L+GS HAHSVIGTPEFMAPELYEE+YDELVDIYSFGMCV
Sbjct  155   NIFINGHLGHVKIGDLGLAAILQGSQHAHSVIGTPEFMAPELYEEDYDELVDIYSFGMCV  214

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT +YPYSEC+NPAQIYKKVTSGKLP AFYRI++ EAQ+F+G+CL  ASKR  A EL
Sbjct  215   LEMLTFKYPYSECSNPAQIYKKVTSGKLPEAFYRIEDVEAQQFIGKCLATASKRLPAREL  274

Query  719   LLDPFLAADEEEDES-AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA+DE E  +  K+PS    P     ++ P  +    K+++MTITGT+NP+DDTI
Sbjct  275   LLDPFLASDEAELGTIPKVPSPWSSPKVAEEKIMPSLLADPTKATEMTITGTMNPQDDTI  334

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+V+IS+KDG+ RNI+FPFDI +DTA++VA EMVKELEITDW P +IA+MI+E+IS+L+
Sbjct  335   FLKVKISEKDGQTRNIYFPFDIMNDTAIDVAMEMVKELEITDWEPFEIADMIEEQISSLI  394

Query  1076  PTWR----STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKIN  1243
             P W+    S  +  QH F+Y DDDDDD++      R+PF++ SS  SSQAS    L   N
Sbjct  395   PGWKQCSSSQIHHPQHCFSYQDDDDDDDDDHNDGPRYPFFASSSHCSSQAS----LLAFN  450

Query  1244  ----------------HDWLQ-----NDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGR  1360
                             HDW +     NDD +S+SS+NS+  S L +++ +E D  +    
Sbjct  451   CSFQTKPCQGRNMTSAHDWFEDKLFINDDATSQSSLNSFKDSTLNYSSGNEDDYDASLRE  510

Query  1361  ESLLIQKTNTGTRLCPETSRSNKK----------KGCCGSNHQRPKMSRVRSMVDLRSQL  1510
               L   K +  TR CP  S + K+           GCC SN QR K+SR+RS VD+RSQL
Sbjct  511   VPLGFGKIHKYTRFCPADSLNAKQYKHRNVRLDSGGCCSSNPQR-KLSRIRSQVDVRSQL  569

Query  1511  LHRTLVEEVNKRRLFKTVGAVENIGYHEPA  1600
             LHR+L+EE+NKRRLFKTVGAVENIGYHEP 
Sbjct  570   LHRSLLEEINKRRLFKTVGAVENIGYHEPG  599



>ref|XP_011008754.1| PREDICTED: probable serine/threonine-protein kinase WNK5 isoform 
X1 [Populus euphratica]
Length=618

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/566 (62%), Positives = 429/566 (76%), Gaps = 34/566 (6%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ+KL++VF SPEELQRLYSEV LLK+L+H SI++F+ SWID D
Sbjct  42    TVYKAFDEVLGMEVAWNQVKLHDVFHSPEELQRLYSEVHLLKNLNHDSIIKFYTSWIDID  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RR FNFITE+FTSGTLR YR++Y  V+IRAIKNW RQIL GLA+LH HDPPVIHRDLKCD
Sbjct  102   RRAFNFITEMFTSGTLRAYRKKYQRVDIRAIKNWSRQILRGLAFLHGHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF+NGHLG VKIGDLGLAA+L+GS HAHSVIGTPEFMAPELYEE+YDELVDIYSFGMCV
Sbjct  162   NIFINGHLGHVKIGDLGLAAILQGSQHAHSVIGTPEFMAPELYEEDYDELVDIYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT +YPYSEC+NPAQIYKKVTSGKLP AFYRI++ EAQ+F+G+CL  ASKR  A EL
Sbjct  222   LEMLTFKYPYSECSNPAQIYKKVTSGKLPEAFYRIEDVEAQQFIGKCLATASKRLPAREL  281

Query  719   LLDPFLAADEEEDES-AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA+DE E  +  K+PS    P     ++ P  +    K+++MTITGT+NP+DDTI
Sbjct  282   LLDPFLASDEAELGTIPKVPSPWSSPKVAEEKIMPSLLADPTKATEMTITGTMNPQDDTI  341

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+V+IS+KDG+ RNI+FPFDI +DTA++VA EMVKELEITDW P +IA+MI+E+IS+L+
Sbjct  342   FLKVKISEKDGQTRNIYFPFDIMNDTAIDVAMEMVKELEITDWEPFEIADMIEEQISSLI  401

Query  1076  PTWR----STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqss----------sqa  1213
             P W+    S  +  QH F+Y DDDDDD++      R+PF++ SS  S          S  
Sbjct  402   PGWKQCSSSQIHHPQHCFSYQDDDDDDDDDHNDGPRYPFFASSSHCSSQASLLAFNCSFQ  461

Query  1214  slPDLLEKIN--HDWLQ-----NDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLL  1372
             + P     +   HDW +     NDD +S+SS+NS+  S L +++ +E D  +      L 
Sbjct  462   TKPCQGRNMTSAHDWFEDKLFINDDATSQSSLNSFKDSTLNYSSGNEDDYDASLREVPLG  521

Query  1373  IQKTNTGTRLCPETSRSNKK----------KGCCGSNHQRPKMSRVRSMVDLRSQLLHRT  1522
               K +  TR CP  S + K+           GCC SN QR K+SR+RS VD+RSQLLHR+
Sbjct  522   FGKIHKYTRFCPADSLNAKQYKHRNVRLDSGGCCSSNPQR-KLSRIRSQVDVRSQLLHRS  580

Query  1523  LVEEVNKRRLFKTVGAVENIGYHEPA  1600
             L+EE+NKRRLFKTVGAVENIGYHEP 
Sbjct  581   LLEEINKRRLFKTVGAVENIGYHEPG  606



>ref|XP_007033559.1| Kinase, putative isoform 1 [Theobroma cacao]
 gb|EOY04485.1| Kinase, putative isoform 1 [Theobroma cacao]
Length=617

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/565 (65%), Positives = 435/565 (77%), Gaps = 37/565 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFD+VLGMEVAWNQ+KLN+VFRSPEELQRLYSEV LLK+L+H SIMRF+ SWID D
Sbjct  42    TVYRAFDKVLGMEVAWNQVKLNDVFRSPEELQRLYSEVHLLKNLNHDSIMRFYTSWIDID  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQRY  V++RAIKNW RQIL+GLAYLH HDPPVIHRDLKCD
Sbjct  102   RRTFNFITEMFTSGTLREYRQRYQLVDMRAIKNWARQILQGLAYLHGHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  162   NIFVNGHLGQVKIGDLGLAAILRGSQHAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFYRI + EA+RFVG+CLE  SKR  AHEL
Sbjct  222   LEMLTSEYPYSECSNPAQIYKKVTSGKLPEAFYRIQDEEARRFVGKCLENVSKRLPAHEL  281

Query  719   LLDPFLAADEEED-ESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA++E       ++ S+KL P+G + E+ P       +S+DM+ITGT NP DDTI
Sbjct  282   LLDPFLASEEASPLPIPRVSSRKLTPDGPVRELAPSVEVDPTRSTDMSITGTTNPGDDTI  341

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+DKDG ARNI+FPFD+ +DTA++VA EMVKELEI DW PL+IAEMI+EEIS+LV
Sbjct  342   FLKVQITDKDGHARNIYFPFDVVNDTAIDVALEMVKELEINDWEPLEIAEMIEEEISSLV  401

Query  1076  PTWR---STQYQKQHSFNYIddddddNNVGIST-TRHPFYslssqsssqaslPDLLEKI-  1240
             PTW+   S+Q   QHSF Y D+++DD++    T  RHPFY+ SS+SSSQ S+P  L    
Sbjct  402   PTWKDLGSSQVHHQHSFKYEDEEEDDDDDDDQTGIRHPFYATSSRSSSQVSIPTFLSSYE  461

Query  1241  ----------------NHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLL  1372
                               D   NDD SS  SMNS   S+L +  E + + S+  G E   
Sbjct  462   TQFCHGKNVTSSCNWPQEDVFSNDDASSSCSMNSLRYSSLNY--EDDFEWSAQQG-EHPC  518

Query  1373  IQKTNTGTRLCPETSR---SNKKKGC-------CGSNHQRPKMSRVRSMVDLRSQLLHRT  1522
             I KT   TR CP  S    S+KK+           SN QR K++++RS+VD+RSQLLHR+
Sbjct  519   IPKTLKATRFCPSESTSVYSHKKRNAQLNSWRFSHSNDQR-KLTKIRSLVDIRSQLLHRS  577

Query  1523  LVEEVNKRRLFKTVGAVENIGYHEP  1597
             ++ E+ KRRLFKT+GA+ENIG+ EP
Sbjct  578   VMAELTKRRLFKTIGAMENIGFQEP  602



>emb|CBI18051.3| unnamed protein product [Vitis vinifera]
Length=626

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/564 (61%), Positives = 420/564 (74%), Gaps = 33/564 (6%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDE LGMEVAWNQ+KLN+VF SP++LQRLYSEV LLK+LDH SIMRFH SWID D
Sbjct  42    TVYKAFDEFLGMEVAWNQVKLNDVFNSPDDLQRLYSEVHLLKNLDHDSIMRFHTSWIDLD  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               TFNFI+E+FTSGTLREYRQ+Y  V+I A+KNW RQIL GLAYLH HDPPVIHRDLKCD
Sbjct  102   GGTFNFISEMFTSGTLREYRQKYKRVDIGAVKNWARQILHGLAYLHGHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEEEYDELVD+YSFGMCV
Sbjct  162   NIFVNGHLGQVKIGDLGLAAILRGSQHAHSVIGTPEFMAPELYEEEYDELVDVYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPY EC+NPAQIYKKVTSGKLP AFYRI++ EA+ FVGRCLE  +KR  A EL
Sbjct  222   LEMLTSEYPYCECSNPAQIYKKVTSGKLPEAFYRIEDVEAREFVGRCLEHVAKRLPAKEL  281

Query  719   LLDPFLAADEEED--ESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDT  892
             L+DPFLA D  E      K+ SQK  PNG + ++     + + +S+DMTITGT+NP+D T
Sbjct  282   LMDPFLAVDHGEQMLPMLKISSQKPSPNGTVEKIPSFQTNPRKRSTDMTITGTINPDDYT  341

Query  893   IFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISAL  1072
             IFL+V ISDKDG +RNI+FPFDI SDT ++VA EMV+ELEITDW P +IA+MI+EEI AL
Sbjct  342   IFLKVAISDKDGLSRNIYFPFDIGSDTPIDVAAEMVRELEITDWEPFEIAKMIEEEIFAL  401

Query  1073  VPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDL-------L  1231
             VP+W+     + H  ++  +++++       T HPFY  +S+SS  A   DL        
Sbjct  402   VPSWKQCTSPENHQHSFEYEEEEEEEDDDDETYHPFYCYASESSRVALQ-DLSISCEIQS  460

Query  1232  EKINH-----DWLQ-----NDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGR--ESLLI  1375
             +  NH     DW Q     NDD SS+SS+NS   S L + + +E D+  +  +  E +  
Sbjct  461   QHRNHMISGEDWFQEGLLINDDASSQSSLNSDKYSTLVYCSVTENDIDHLAPKRVEPIFT  520

Query  1376  QKTNTGTRLCPETSRSNKKKGCCGSNHQRP-------KMSRVRSMVDLRSQLLHRTLVEE  1534
               T+  TR CPE   S+  + C GS  +RP       K+SR++S VD+RSQLL R+L+E 
Sbjct  521   ASTHKSTRFCPEEGTSSWNQ-CNGS--RRPYDSNCHRKLSRIKSFVDVRSQLLRRSLMEM  577

Query  1535  VNKRRLFKTVGAVENIGYHEPAEY  1606
             +NKRRLFKT+GAVENIGY EP ++
Sbjct  578   INKRRLFKTIGAVENIGYQEPGKF  601



>ref|XP_002532861.1| kinase, putative [Ricinus communis]
 gb|EEF29515.1| kinase, putative [Ricinus communis]
Length=617

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/568 (62%), Positives = 423/568 (74%), Gaps = 41/568 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ+KLN+V  S +EL RLYSEV LLK+L H SI++F++SWID D
Sbjct  44    TVYKAFDEVLGMEVAWNQVKLNDVLSSADELHRLYSEVHLLKNLKHESIIKFYSSWIDID  103

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYR++Y  V+IRA+KNW RQIL+GLAYLH HDPPVIHRDLKCD
Sbjct  104   RRTFNFITEMFTSGTLREYRKKYQHVDIRAVKNWARQILQGLAYLHGHDPPVIHRDLKCD  163

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF+NGHLGQVKIGDLGLAA+LRGS HA SVIGTPEFMAPELYEEEY+ELVDIYSFGMCV
Sbjct  164   NIFINGHLGQVKIGDLGLAAILRGSQHARSVIGTPEFMAPELYEEEYNELVDIYSFGMCV  223

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM TSEYPYSEC+NPAQIYKKVTSGKLP AFY+I + EAQ+FVG+CLE ASKR  A EL
Sbjct  224   LEMFTSEYPYSECSNPAQIYKKVTSGKLPEAFYKIKDTEAQKFVGKCLESASKRLPAREL  283

Query  719   LLDPFLAADEEE-DESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFL++DE +     K+P Q+   N    E+ P  +    K ++MTITGT+NP+DDT+
Sbjct  284   LLDPFLSSDEGKLLPVTKIPIQRSSSNAS-EEIIPSLLADPTKDTEMTITGTMNPDDDTV  342

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQISDKDG  RNI+FP+D  +DTA++VA EMVKELEITDW  LDIAEMI+E+I++L+
Sbjct  343   FLKVQISDKDGHTRNIYFPYDTMNDTAIDVAVEMVKELEITDWESLDIAEMIEEQIASLI  402

Query  1076  PTWRS-TQYQKQHSFNYIddddddNNVGISTTRHPFYslss---------qsssqaslPD  1225
             P+ +    +Q+QHSFN     DDD+        HPF+S SS           SS    P 
Sbjct  403   PSSKEWGLFQQQHSFN----YDDDDEYDNDGNHHPFHSFSSRSSSQASLLALSSPYENPH  458

Query  1226  LLEKINH------DWLQ-----NDDTSSRSSMNSYDCSNL--CWATESEGDLSSIGGRES  1366
             L    N       DWLQ     NDDTSS+SS NS   SNL  C   E   + S+ GG E 
Sbjct  459   LHGGSNTNVTCSLDWLQGELFTNDDTSSQSSFNSIKYSNLNYCSGNEDSCETSTRGG-EH  517

Query  1367  LLIQKTNTGTRLCPE----TSRSNKKKGC------CGSNHQRPKMSRVRSMVDLRSQLLH  1516
             L   K +  TR CP      S+ +K++        C S+  +PK+SR RS+VD+RSQLLH
Sbjct  518   LSFAKAHKSTRFCPADSNLCSKQHKQRNAQLGSWECSSSSSQPKLSRHRSLVDVRSQLLH  577

Query  1517  RTLVEEVNKRRLFKTVGAVENIGYHEPA  1600
             ++L+E+++KRRLFKTVGAVENIG+HEP 
Sbjct  578   KSLLEQIHKRRLFKTVGAVENIGFHEPG  605



>gb|KDP22777.1| hypothetical protein JCGZ_00364 [Jatropha curcas]
Length=598

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/549 (64%), Positives = 426/549 (78%), Gaps = 21/549 (4%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDEVLGMEVAWNQ+KLN+V  SPEELQRLYSEV LLK+L+H SI++F+ SWID +
Sbjct  42    TVYRAFDEVLGMEVAWNQVKLNDVLNSPEELQRLYSEVHLLKNLNHDSIIKFYTSWIDVN  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RR+FNFITE+ TSGTLREYR++Y  ++IRA+KNW RQIL GLAYLH HDPPVIHRDLKCD
Sbjct  102   RRSFNFITEMLTSGTLREYRKKYQQIDIRAVKNWARQILHGLAYLHGHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF+NGHLGQVKIGDLGLAA+LR S HAHSVIGTPEFMAPELYEEEY+ELVDIYSFGMCV
Sbjct  162   NIFINGHLGQVKIGDLGLAAILRESQHAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY+I + EAQ+FVG+CLE ASKR  A EL
Sbjct  222   LEMLTSEYPYSECSNPAQIYKKVTSGKLPEAFYKIKDIEAQQFVGKCLETASKRLPAWEL  281

Query  719   LLDPFLAADEEEDESA-KLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA+DE +   A K P Q   PNG   E+ P  +    K+++MTITG++N EDDTI
Sbjct  282   LLDPFLASDESKWLPAIKPPFQSSSPNGT-EEIIPSLLTDPTKATEMTITGSMNAEDDTI  340

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQISDKDG  RNI+FPFD TSDTA+EVA EMVKELEITDW PL+IAEMI+E++++L+
Sbjct  341   FLKVQISDKDGHTRNIYFPFDTTSDTAIEVAVEMVKELEITDWEPLEIAEMIEEQVTSLI  400

Query  1076  PTWRS---TQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH  1246
             P+W+    +Q Q+QHSFNY    DDD++ G   T     S SS   S  +L    +K +H
Sbjct  401   PSWKQWGFSQVQQQHSFNY----DDDDDDGTQPTFCSISSRSSSQPSLLALSSSCKKHHH  456

Query  1247  -----DWLQ-----NDDTSSRSSMNSYDCSNLCWATESEGDL-SSIGGRESLLIQKTNTG  1393
                  DWLQ     NDD SS+SS NS++ SN+ +   +E +  +S  G E L   K    
Sbjct  457   PGSNQDWLQGEPFMNDDASSQSSFNSFNYSNINYCLGNEDNCGTSFRGGEVLSSTKFCPD  516

Query  1394  TRLCPETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAV  1573
               LC +  R     G C +++ + K+SR+RS+VD+RSQ+LHR+L+EE++KRRLFKTVGAV
Sbjct  517   DSLCAKQYRKCTNSGECNNSNPQRKLSRIRSLVDIRSQMLHRSLLEELHKRRLFKTVGAV  576

Query  1574  ENIGYHEPA  1600
             ENIG+ +P 
Sbjct  577   ENIGFLDPG  585



>ref|XP_010653350.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase WNK5 [Vitis vinifera]
Length=660

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/598 (58%), Positives = 420/598 (70%), Gaps = 67/598 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDE LGMEVAWNQ+KLN+VF SP++LQRLYSEV LLK+LDH SIMRFH SWID D
Sbjct  42    TVYKAFDEFLGMEVAWNQVKLNDVFNSPDDLQRLYSEVHLLKNLDHDSIMRFHTSWIDLD  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               TFNFI+E+FTSGTLREYRQ+Y  V+I A+KNW RQIL GLAYLH HDPPVIHRDLKCD
Sbjct  102   GGTFNFISEMFTSGTLREYRQKYKRVDIGAVKNWARQILHGLAYLHGHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVI----------------------------  454
             NIFVNGHLGQVKIGDLGLAA+LRGS HAHSVI                            
Sbjct  162   NIFVNGHLGQVKIGDLGLAAILRGSQHAHSVIGNSLNFSLSRSLKHTPSFNYLXLFIYFL  221

Query  455   ------GTPEFMAPelyeeeydelvdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSG  616
                   GTPEFMAPELYEEEYDELVD+YSFGMCVLEMLTSEYPY EC+NPAQIYKKVTSG
Sbjct  222   FLDELAGTPEFMAPELYEEEYDELVDVYSFGMCVLEMLTSEYPYCECSNPAQIYKKVTSG  281

Query  617   KLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPFLAADEEED--ESAKLPSQKLI  790
             KLP AFYRI++ EA+ FVGRCLE  +KR  A ELL+DPFLA D  E      K+ SQK  
Sbjct  282   KLPEAFYRIEDVEAREFVGRCLEHVAKRLPAKELLMDPFLAVDHGEQMLPMLKISSQKPS  341

Query  791   PNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSD  970
             PNG + ++     + + +S+DMTITGT+NP+D TIFL+V ISDKDG +RNI+FPFDI SD
Sbjct  342   PNGTVEKIPSFQTNPRKRSTDMTITGTINPDDYTIFLKVAISDKDGLSRNIYFPFDIGSD  401

Query  971   TAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRSTQYQKQHSFNYIddddddNN  1150
             T ++VA EMV+ELEITDW P +IA+MI+EEI ALVP+W+     + H  ++  +++++  
Sbjct  402   TPIDVAAEMVRELEITDWEPFEIAKMIEEEIFALVPSWKQCTSPENHQHSFEYEEEEEEE  461

Query  1151  VGISTTRHPFYslssqsssqaslPDL-------LEKINH-----DWLQ-----NDDTSSR  1279
                  T HPFY  +S+SS  A   DL        +  NH     DW Q     NDD SS+
Sbjct  462   DDDDETYHPFYCYASESSRVALQ-DLSISCEIQSQHRNHMISGEDWFQEGLLINDDASSQ  520

Query  1280  SSMNSYDCSNLCWATESEGDLSSIGGR--ESLLIQKTNTGTRLCPETSRSNKKKGCCGSN  1453
             SS+NS   S L + + +E D+  +  +  E +    T+  TR CPE   S+  + C GS 
Sbjct  521   SSLNSDKYSTLVYCSVTENDIDHLAPKRVEPIFTASTHKSTRFCPEEGTSSWNQ-CNGS-  578

Query  1454  HQRP-------KMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEY  1606
              +RP       K+SR++S VD+RSQLL R+L+E +NKRRLFKT+GAVENIGY EP ++
Sbjct  579   -RRPYDSNCHRKLSRIKSFVDVRSQLLRRSLMEMINKRRLFKTIGAVENIGYQEPGKF  635



>ref|XP_008359945.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Malus 
domestica]
Length=576

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/567 (62%), Positives = 426/567 (75%), Gaps = 43/567 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ+KLN+VF SP+ELQRLYSEV LLK+L+H SI++++ASWID +
Sbjct  18    TVYKAFDEVLGMEVAWNQVKLNDVFTSPDELQRLYSEVHLLKNLNHDSIIQYYASWIDVN  77

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQ+Y  VNI A+KNW RQIL GLAYLH  DPPVIHRDLKCD
Sbjct  78    RRTFNFITEMFTSGTLREYRQKYQQVNIGAVKNWSRQILRGLAYLHKLDPPVIHRDLKCD  137

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRG+ HAHSVIGTPEFMAPELY+EEY+ELVDIY+FGMCV
Sbjct  138   NIFVNGHLGQVKIGDLGLAAILRGTQHAHSVIGTPEFMAPELYDEEYNELVDIYAFGMCV  197

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY I++ EAQRFVG+CLE  SKR  AHEL
Sbjct  198   LEMLTSEYPYSECSNPAQIYKKVTSGKLPNAFYNIEDLEAQRFVGKCLENVSKRLPAHEL  257

Query  719   LLDPFLAADEEE-DESAKLPSQKLIPNGKLLEVE---------PCFVDQQAKSSDMTITG  868
             LLDPFLA+D+ E   S ++P  KLIP+   +               VD + +S++M ITG
Sbjct  258   LLDPFLASDDGELASSPRIPFLKLIPDNDPVVEAEDEEDELHFAAEVDLE-RSTNMIITG  316

Query  869   TLNPEDDTIFLRVQISDKDGK-ARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAE  1045
              +N EDDTI L+V+ISD DGK  RNI+FPFDI +DTA+EVATEMVKELEI DW P +IA 
Sbjct  317   KMNLEDDTITLKVRISDLDGKNVRNIYFPFDILNDTAIEVATEMVKELEINDWEPPEIAG  376

Query  1046  MIDEEISALVP---TWRSTQ--YQKQHSFNYIddddddNNVGISTTRHPFYslssqsssq  1210
             MI+ EIS+L+     W S +  +  QHSFNY +++DD+NN GI  T HPFY+ SS SSSQ
Sbjct  377   MIENEISSLIAGSKKWGSPRDYHPHQHSFNY-EEEDDNNNGGI--THHPFYAFSSCSSSQ  433

Query  1211  aslPDL-LEKINHDWLQ-----NDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLL  1372
              SL  L     NHD LQ     NDD SS+SS +S + SN+ + + +E DL  +       
Sbjct  434   NSLHALSFHCKNHDSLQGDLFMNDDVSSQSSFDSCNYSNISYYSGNEDDLLDMS-----F  488

Query  1373  IQKTNTGTRLCPETSR-SNKKKGCCG----------SNHQRPKMSRVRSMVDLRSQLLHR  1519
              + T+  TR CP  SR +N  K C            ++H   K+ +++S++D+ SQLLHR
Sbjct  489   GKTTHKSTRFCPSKSRVANTYKHCNSQLDNHRPQKLNHHHERKLPKIQSLIDVHSQLLHR  548

Query  1520  TLVEEVNKRRLFKTVGAVENIGYHEPA  1600
             +LVEEVNKR LFKTVG +EN+G+  P 
Sbjct  549   SLVEEVNKRWLFKTVGTIENVGFQTPG  575



>ref|XP_010043077.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Eucalyptus 
grandis]
 gb|KCW88325.1| hypothetical protein EUGRSUZ_A00714 [Eucalyptus grandis]
Length=627

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/583 (60%), Positives = 425/583 (73%), Gaps = 48/583 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDEVLGMEVAW+Q+KL++VFRSPE+LQRLYSEV LLK+L+H SIM+F+ SW+D D
Sbjct  44    TVYRAFDEVLGMEVAWSQVKLHDVFRSPEDLQRLYSEVHLLKNLNHESIMKFYTSWVDPD  103

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELFTSGTLREYR+RY  V++ AIKNW RQIL+GLAYLHSHDPPVIHRDLKCD
Sbjct  104   RRTFNFITELFTSGTLREYRRRYQGVHMLAIKNWARQILKGLAYLHSHDPPVIHRDLKCD  163

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA +LRGS HAHSVIGTPEFMAPELYEEEYDELVDIYSFGMC+
Sbjct  164   NIFVNGHLGQVKIGDLGLATILRGSQHAHSVIGTPEFMAPELYEEEYDELVDIYSFGMCL  223

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM TSEYPYSEC+NPAQIYKKVTSGKLP AFYRI + EA+ F+G+CL+ A  R  A EL
Sbjct  224   LEMFTSEYPYSECSNPAQIYKKVTSGKLPEAFYRIQDDEAREFIGKCLKKACDRLPAREL  283

Query  719   LLDPFLAADE------EEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             LLDPFLA+D+          S+   + K       L V P  V    +++DMTITG++N 
Sbjct  284   LLDPFLASDDGGQLLLAPKASSGSSTPKSTAAATDLTVPPIIVADPLRNTDMTITGSMNS  343

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             EDD I+LRVQI++KDG ARNI+FPFDI +DTA++VA EMV+ELEI+D  P++IA+MI+EE
Sbjct  344   EDDAIYLRVQITEKDGHARNIYFPFDIVNDTALDVALEMVRELEISDREPIEIAKMIEEE  403

Query  1061  ISALVPTW-RSTQYQKQH--SFNYIddddddNNVGISTTRHPFYslssqsssqaslPDL-  1228
             IS LVPTW RS+   K H  SF+Y DDDDD        TR PF++ SS SSS ASLP   
Sbjct  404   ISTLVPTWKRSSLPLKNHHNSFSYEDDDDD------EETRPPFHTSSSCSSSHASLPSFN  457

Query  1229  --------------LEKINHDWLQN------DDTSSRSSMNSYDCSNLCWATESEGDLSS  1348
                           +  I  +WLQ+      D+ +S SS++S   SN  + + +E D  +
Sbjct  458   SAFPDANLKDVCNNMMNIGLNWLQDRDVCAHDEATSPSSVSSPKYSNFSYCSSNEDDYDT  517

Query  1349  IGGRESLLIQKTNTGTRLCPETS---RSNKKKGCCGSNHQR--------PKMSRVRSMVD  1495
                 +     KT+  TR CPE       N ++     + QR         K++R++S+VD
Sbjct  518   SARGDPHCFAKTHQSTRFCPEERNRVNDNYQRNNVQFDAQRGQQFMKGKQKLTRIQSLVD  577

Query  1496  LRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSCKGNR  1624
             +RSQLLHR+LVEE+NKRR+FKTVGAVENIGY EP +++    R
Sbjct  578   IRSQLLHRSLVEEINKRRMFKTVGAVENIGYQEPCDFAGTSRR  620



>ref|XP_008388335.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Malus 
domestica]
Length=604

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/567 (62%), Positives = 426/567 (75%), Gaps = 43/567 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ+KLN+VF SP+ELQRLYSEV LLK+L+H SI++++ASWID +
Sbjct  46    TVYKAFDEVLGMEVAWNQVKLNDVFXSPDELQRLYSEVHLLKNLNHDSIIQYYASWIDVN  105

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQ+Y  VNI A+KNW RQIL GLAYLH  DPPVIHRDLKCD
Sbjct  106   RRTFNFITEMFTSGTLREYRQKYQQVNIGAVKNWSRQILRGLAYLHKLDPPVIHRDLKCD  165

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRG+ HAHSVIGTPEFMAPELY+EEY+ELVDIY+FGMCV
Sbjct  166   NIFVNGHLGQVKIGDLGLAAILRGTQHAHSVIGTPEFMAPELYDEEYNELVDIYAFGMCV  225

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY I++ EAQRFVG+CLE  SKR  AHEL
Sbjct  226   LEMLTSEYPYSECSNPAQIYKKVTSGKLPNAFYNIEDLEAQRFVGKCLENVSKRLPAHEL  285

Query  719   LLDPFLAADEEE-DESAKLPSQKLIPNGKLLEVE---------PCFVDQQAKSSDMTITG  868
             LLDPFLA+D+ E   S ++P  KLIP+   +               VD + +S++M ITG
Sbjct  286   LLDPFLASDDGELASSPRIPFLKLIPDNDPVVEAEDEEDELHFAAEVDLE-RSTNMIITG  344

Query  869   TLNPEDDTIFLRVQISDKDGK-ARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAE  1045
              +N EDDTI L+V+ISD DGK  RNI+FPFDI +DTA+EVATEMVKELEI DW P +IA 
Sbjct  345   KMNLEDDTITLKVRISDLDGKNVRNIYFPFDILNDTAIEVATEMVKELEINDWEPPEIAG  404

Query  1046  MIDEEISALVP---TWRSTQ--YQKQHSFNYIddddddNNVGISTTRHPFYslssqsssq  1210
             MI+ EIS+L+     W S +  +  QHSFNY +++DD+NN GI  T HPFY+ SS SSSQ
Sbjct  405   MIENEISSLIAGSKKWGSPRDYHPHQHSFNY-EEEDDNNNGGI--THHPFYAFSSCSSSQ  461

Query  1211  aslPDL-LEKINHDWLQ-----NDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLL  1372
              SL  L     NHD LQ     NDD SS+SS +S + SN+ + + +E DL  +       
Sbjct  462   NSLHALSFHCKNHDSLQGDLFMNDDVSSQSSFDSCNYSNISYYSGNEDDLLDMS-----F  516

Query  1373  IQKTNTGTRLCPETSR-SNKKKGCCG----------SNHQRPKMSRVRSMVDLRSQLLHR  1519
              + T+  TR CP  SR +N  K C            ++H   K+ +++S++D+ SQLLHR
Sbjct  517   GKTTHKSTRFCPSKSRVANTYKHCNSQLDNHRPQKLNHHHERKLPKIQSLIDVHSQLLHR  576

Query  1520  TLVEEVNKRRLFKTVGAVENIGYHEPA  1600
             +LVEEVNKR LFKTVG +EN+G+  P 
Sbjct  577   SLVEEVNKRWLFKTVGTIENVGFQTPG  603



>ref|XP_009372002.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Pyrus 
x bretschneideri]
Length=603

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/567 (62%), Positives = 422/567 (74%), Gaps = 44/567 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ+KLN+VF SP+ELQRLYSEV LLK+L+H SI++++ SWID +
Sbjct  46    TVYKAFDEVLGMEVAWNQVKLNDVFSSPDELQRLYSEVNLLKNLNHDSIIQYYTSWIDVN  105

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             R+TFNFITE+FTSGTLREYRQ Y  VNI A+KNW RQIL GLAYLH  DPPVIHRDLKCD
Sbjct  106   RQTFNFITEMFTSGTLREYRQNYQRVNIGAVKNWSRQILRGLAYLHKLDPPVIHRDLKCD  165

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRG+ HAHSVIGTPEFMAPELY+EEY+ELVDIY+FGMCV
Sbjct  166   NIFVNGHLGQVKIGDLGLAAILRGTQHAHSVIGTPEFMAPELYDEEYNELVDIYAFGMCV  225

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY I+  EAQRFVG+CLE  SKR  AHEL
Sbjct  226   LEMLTSEYPYSECSNPAQIYKKVTSGKLPNAFYNIEALEAQRFVGKCLENVSKRLPAHEL  285

Query  719   LLDPFLAADEEE-DESAKLPSQKLIPNGKLLEVE---------PCFVDQQAKSSDMTITG  868
             LLDPFLA+D+ E   S ++P  KL+P+   +               VD + +S++M ITG
Sbjct  286   LLDPFLASDDRELASSPRIPILKLMPDNDPVAEAEDEEDELHFAAEVDLE-RSTNMIITG  344

Query  869   TLNPEDDTIFLRVQISDKDGK-ARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAE  1045
               N EDDTI L+V+ISD DGK ARNI+FPFDI +DTA++VATEMVKELEI DW P +IA 
Sbjct  345   KTNLEDDTITLKVRISDLDGKDARNIYFPFDILNDTAIDVATEMVKELEINDWEPPEIAG  404

Query  1046  MIDEEISALVPTWRST-----QYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssq  1210
             MI+ EIS+L+   +        +  QHSFNY  +++DDNN GI  T HPFY+ SS SSSQ
Sbjct  405   MIENEISSLIAGGKKCGSPRDYHPHQHSFNY--EEEDDNNGGI--THHPFYAFSSCSSSQ  460

Query  1211  aslPDLLEKI-NHDWLQ-----NDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLL  1372
              SL  L     NHD LQ     NDD SS+SS +S D SN+ + + +E DL  +       
Sbjct  461   NSLHALSSHCKNHDSLQGDLFMNDDVSSQSSFDSCDYSNISYYSGNEDDLLDMS-----F  515

Query  1373  IQKTNTGTRLCPETSR-SNKKKGCCG----------SNHQRPKMSRVRSMVDLRSQLLHR  1519
              + T+  TR CP  SR +N  K C            ++H   K+ +++S++D+RSQLLHR
Sbjct  516   GKTTHKSTRFCPSKSRVANTYKHCNSQLDNHRPQILNHHHERKLPKIQSLIDVRSQLLHR  575

Query  1520  TLVEEVNKRRLFKTVGAVENIGYHEPA  1600
             +LVEEVNKRRLFKTVG +EN+G+  P 
Sbjct  576   SLVEEVNKRRLFKTVGTIENVGFQTPG  602



>ref|XP_010252091.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Nelumbo 
nucifera]
 ref|XP_010252092.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Nelumbo 
nucifera]
Length=631

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/584 (60%), Positives = 420/584 (72%), Gaps = 51/584 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ KLN+VFRSPEEL+RLYSEV LL  L+H SI+RF++SWID D
Sbjct  42    TVYKAFDEVLGMEVAWNQAKLNDVFRSPEELERLYSEVHLLSTLNHDSIIRFYSSWIDID  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQRY  V+IRA+KNW RQIL GL YLH HDPPVIHRDLKCD
Sbjct  102   RRTFNFITEMFTSGTLREYRQRYKRVDIRAVKNWARQILHGLVYLHGHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEEEY+ELVDIYSFGMCV
Sbjct  162   NIFVNGHLGQVKIGDLGLAAILRGSQAAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT+EYPYSEC+NPAQIYKKVTSGKLPAAFYRI ++EAQRF+G+CL+ A KR  A EL
Sbjct  222   LEMLTAEYPYSECSNPAQIYKKVTSGKLPAAFYRIRDSEAQRFIGKCLDTAVKRLPAKEL  281

Query  719   LLDPFLAADEEEDESAKLP---SQKLIPNGKLLEVEPCFVDQQ-----AKSSDMTITGTL  874
             LLDPFLA+D EE      P   ++ ++P  +  +V   +V Q      + ++DMTITG +
Sbjct  282   LLDPFLASDTEEMLPTPNPPTVAKDVVPPPESSQV---YVPQPVAPAISTTTDMTITGKM  338

Query  875   NPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMID  1054
             NPEDDTIFL+VQI+DKDG  RNI+FPFDI SDT ++VATEMVKELEITD  P +IAE+I+
Sbjct  339   NPEDDTIFLKVQIADKDGCVRNIYFPFDILSDTPIDVATEMVKELEITDREPFEIAEVIE  398

Query  1055  EEISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLL-  1231
             +EISALVP W+ +Q+   H    ++  DDD++V      HP  S SS SS  +     L 
Sbjct  399   DEISALVPHWKESQHH-DHPHQILNYQDDDDDV----PYHPSCSFSSCSSQASLSVSGLI  453

Query  1232  -EKINHDWLQ-----NDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRES----LLIQK  1381
                  +DWLQ     +DD SS+SS+ S   SN  + + SE D +    R           
Sbjct  454   TSSYGYDWLQGDLFGDDDASSQSSVCSGKYSNFNYNSGSEHDFNQSPRRRRDQYYCPAAM  513

Query  1382  TNTGTRLCPE----------------TSRSNKKKGCCGSNH-------QRPKMSRVRSMV  1492
             T+  TR CPE                 S   + +  CG N           +++R RS+V
Sbjct  514   THQSTRFCPEEKPRTGHFIGMNRQRQPSVLAESRRACGKNEPAGNTLMDNRRLTRNRSLV  573

Query  1493  DLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSCKGNR  1624
             D+RSQLLHR+LVEEVNKRRLF+TVGAVE+IGY  P E+S K  R
Sbjct  574   DVRSQLLHRSLVEEVNKRRLFRTVGAVESIGYQAPHEFSDKDYR  617



>ref|XP_002268300.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Vitis 
vinifera]
 emb|CBI15829.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/582 (61%), Positives = 419/582 (72%), Gaps = 47/582 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLGMEVAWNQ+KLN V RSP+ELQRLYSEV LL  L+H SI++F+ SWID +
Sbjct  42    TVYKAIDEVLGMEVAWNQVKLNEVLRSPDELQRLYSEVHLLSALNHDSIIQFYTSWIDVE  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             R+TFNFITE FTSGTLREYR++Y  V+IRAIK W RQIL GL YLH HDPPVIHRDLKCD
Sbjct  102   RKTFNFITEFFTSGTLREYRKKYKRVDIRAIKCWARQILRGLVYLHGHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLG+VKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMCV
Sbjct  162   NIFVNGHLGEVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYEENYNELVDVYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFYRI + EAQRF+G+CL  ASKR  A EL
Sbjct  222   LEMLTSEYPYSECSNPAQIYKKVTSGKLPGAFYRIQDLEAQRFIGKCLVTASKRLPAKEL  281

Query  719   LLDPFLAADEEED-ESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA+DE +     KL SQK   N   + +E   +      ++MTITGTLNP+DDTI
Sbjct  282   LLDPFLASDEAKRLPKPKLGSQKPFLND--IRIEKLRLSDDRVRTNMTITGTLNPDDDTI  339

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQ +DKDG ARNI+FPFDI +DT ++VA EMVKELEITDW P +IA+MID EISALV
Sbjct  340   FLKVQTADKDGSARNIYFPFDIVTDTPIDVAMEMVKELEITDWEPFEIADMIDGEISALV  399

Query  1076  PTWRSTQYQKQH--SFNYIddddddNNVGISTTRHPFYslssqsssqaslPDL-----LE  1234
             P W+     +QH  +F+Y ++D+  N        HPF S SS SSSQAS P L     L+
Sbjct  400   PQWKKWDMPQQHHYAFDYQEEDEGHN--------HPFRSFSSCSSSQASFPCLSTSHRLD  451

Query  1235  KINH--DWLQN---DDTSSRSSMNSYDCSNLCWATESEG-DLSSIGGRESLLIQKTNTGT  1396
              +    DWL++   DDTSS SS +S   SNL + + +E    +S   RE     KT   T
Sbjct  452   TMAQGGDWLKDDLFDDTSSESSAHSGKYSNLNYFSGNEHCSETSTLRREQHPGAKTQKST  511

Query  1397  RLCPETSRSNK--------KKGCCGSNHQRP------------KMSRVRSMVDLRSQLLH  1516
             R CPE + S +        K+G      QR             +++R RS+VD+RSQLLH
Sbjct  512   RFCPEENSSTRKALPGKSYKQGKVLQESQRAPGSKDKFAMETIRLTRNRSLVDVRSQLLH  571

Query  1517  RTLVEEVNKRRLFKTVGAVENIGYHEPAEYSCKGNRSFQPFG  1642
             RTLVEEV+KRRL KTVGAVENIG+  P   S  G  S +P G
Sbjct  572   RTLVEEVHKRRLSKTVGAVENIGFQAPCNVS--GKVSQKPTG  611



>ref|XP_009346923.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Pyrus 
x bretschneideri]
Length=603

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/567 (61%), Positives = 419/567 (74%), Gaps = 44/567 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ+KLN+ F SP+ELQRLYSEV LLK+L H SI++++ SWID +
Sbjct  46    TVYKAFDEVLGMEVAWNQVKLNDAFSSPDELQRLYSEVHLLKNLHHDSIIQYYKSWIDVN  105

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYR +Y  VNI A+KNW RQIL GLAYLH  DPPVIHRDLKCD
Sbjct  106   RRTFNFITEMFTSGTLREYRHKYQRVNIGAVKNWSRQILRGLAYLHKRDPPVIHRDLKCD  165

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRG+ HAHSVIGTPEFMAPELY+EEY+ELVDIY+FGMCV
Sbjct  166   NIFVNGHLGQVKIGDLGLAAILRGTQHAHSVIGTPEFMAPELYDEEYNELVDIYAFGMCV  225

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY+I++ EAQRFVG+CLE  SKR  AHEL
Sbjct  226   LEMLTSEYPYSECSNPAQIYKKVTSGKLPNAFYKIEDLEAQRFVGKCLENVSKRLPAHEL  285

Query  719   LLDPFLAADEEEDES-AKLPSQKLIPNGKLL------EVEPCF---VDQQAKSSDMTITG  868
             LLDPFLA D+ E  S  ++   +LIPN   +      E E  F   VD + +S++M ITG
Sbjct  286   LLDPFLAFDDGELASPPRISIPELIPNNDPVAEAGDGEDELHFSAEVDLE-RSTNMIITG  344

Query  869   TLNPEDDTIFLRVQISDKDGK-ARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAE  1045
              +NPEDDTI L+V+ISD DGK ARNI+FPFDI +DTA++VATEMVKELEI++W P +IA 
Sbjct  345   KMNPEDDTISLKVRISDLDGKNARNIYFPFDIMNDTAIDVATEMVKELEISEWEPPEIAG  404

Query  1046  MIDEEISALVP---TWRSTQ--YQKQHSFNYIddddddNNVGISTTRHPFYslssqsssq  1210
             MI++EI +L+P    W S    +  QHSFNY ++DDDD  V      HPFYS S  SSSQ
Sbjct  405   MIEKEIFSLIPGRTKWGSPHGYHPHQHSFNYEEEDDDDGGV----NHHPFYSFSLCSSSQ  460

Query  1211  aslPDLLEKI-NH-----DWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLL  1372
              SL        NH     D   NDD SS+SS +S + SN+ + + +E DL  +       
Sbjct  461   NSLHSFRSHCKNHHLLHGDLFMNDDVSSQSSFDSCNYSNINYYSGNEDDLHDVS-----F  515

Query  1373  IQKTNTGTRLCPETSRSNKKKGCCGS-----------NHQRPKMSRVRSMVDLRSQLLHR  1519
              + T+  TR CP  SR       C S           +HQ  K+ +++S++D+RSQLLHR
Sbjct  516   GKATHKSTRFCPSESRGANSYKQCNSQLDNQRPHKLNHHQERKLPKIQSLIDVRSQLLHR  575

Query  1520  TLVEEVNKRRLFKTVGAVENIGYHEPA  1600
             +LVEEVNKRRLFKTVG +EN+G+  P 
Sbjct  576   SLVEEVNKRRLFKTVGTIENVGFQTPG  602



>ref|XP_010683526.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Beta 
vulgaris subsp. vulgaris]
Length=589

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/557 (61%), Positives = 419/557 (75%), Gaps = 33/557 (6%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDEVLG+EVAW+Q+ LN+V  SP+ELQRLYSEV LLK L H SI+RFH+SWID D
Sbjct  42    TVYRAFDEVLGLEVAWSQVMLNDVLGSPDELQRLYSEVHLLKSLQHESIIRFHSSWIDID  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQ+Y  V++RAIKNW RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  102   RRTFNFITEMFTSGTLREYRQKYHQVDLRAIKNWARQILRGLVYLHSHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS +AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  162   NIFVNGHLGQVKIGDLGLAAILRGSQYAHSVIGTPEFMAPELYEEKYNELVDVYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVT+GK P AFYRI + EAQ+FVG+CLE  SKR  +HEL
Sbjct  222   LEMLTSEYPYSECSNPAQIYKKVTAGKKPEAFYRIQDMEAQQFVGKCLETVSKRLPSHEL  281

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LLDPFLA D+      + P +   P G L+++ P  +D   +++DMTITGTLNPED+T+F
Sbjct  282   LLDPFLATDDNLLPLPERPLRIYSPKGVLVDM-PFLLDNPIRNTDMTITGTLNPEDNTLF  340

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQISDKDG  RN+ FPFDI  DTAMEVATEMV+EL+ITDW P +IA+MI+EEIS LVP
Sbjct  341   LKVQISDKDGCVRNVHFPFDIIYDTAMEVATEMVRELDITDWDPHEIADMIEEEISTLVP  400

Query  1079  TW---RSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE---KI  1240
              W   +S + Q+ +SFN+  DDD++   G+S+   P +  +  SS    +P   +     
Sbjct  401   RWKDLKSPKCQQHYSFNFNKDDDENGPPGLSSCS-PSHDSARGSSKSCEVPCSHKNPLNA  459

Query  1241  NHDWLQN-----DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLC  1405
             N DWLQ      +DT S SS  S  CS+  ++      L+S   R+++   KT   TR C
Sbjct  460   NQDWLQGCIDYIEDTYSESSCTSSTCSDFAYSL-----LNSSEARDAISNTKTEEYTRFC  514

Query  1406  PE---TSRSNKK---------KGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRR  1549
             P+    S+ ++K         KG   S H+  K+S++RS +D+RSQLL+R L++ +NKRR
Sbjct  515   PQENTVSKCDEKSNGFVGTRFKGMNTSGHK--KLSKLRSFMDIRSQLLNRGLMQAMNKRR  572

Query  1550  LFKTVGAVENIGYHEPA  1600
               KTVGAVENIG+H+P+
Sbjct  573   GAKTVGAVENIGFHDPS  589



>ref|XP_004302543.1| PREDICTED: probable serine/threonine-protein kinase WNK5-like 
[Fragaria vesca subsp. vesca]
Length=616

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/585 (60%), Positives = 429/585 (73%), Gaps = 60/585 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ+KLNNVF SPEELQRLYSEV LLK+L+H SI+ ++ SWID D
Sbjct  43    TVYKAFDEVLGMEVAWNQVKLNNVFGSPEELQRLYSEVHLLKNLNHDSIIHYYTSWIDID  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQ+Y  V+I A+KNW RQIL GLAYLH+ DPPVIHRDLKCD
Sbjct  103   RRTFNFITEMFTSGTLREYRQKYQRVSIGAVKNWARQILRGLAYLHTLDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             N+FVNGHLGQVKIGDLGLAA+L GS HAHSVIGTPEFMAPELY+EEY+ELVDIY+FGMCV
Sbjct  163   NVFVNGHLGQVKIGDLGLAAILSGSKHAHSVIGTPEFMAPELYDEEYNELVDIYAFGMCV  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP A+Y+I++ EAQRFVG+CL   S+R  AHEL
Sbjct  223   LEMLTSEYPYSECSNPAQIYKKVTSGKLPKAYYKIEDLEAQRFVGKCLVDVSERLPAHEL  282

Query  719   LLDPFLAADEEEDE----SAKLPSQKLIPNGKLLEV-EPCFV--DQQAKSSDMTITGTLN  877
             LLDPFLA+D+EE +    S  +P QK++P+     V EP         +++ M ITG+ N
Sbjct  283   LLDPFLASDDEEPKPMPISRSIPLQKIVPDESAEVVKEPILALGSNTKRTTKMIITGSRN  342

Query  878   PEDDTIFLRVQISD-KDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMID  1054
             PEDD I+L+V+ISD +DG ARNI+FPFDI +DTAM VA EMVKELEI DW P +IA MI+
Sbjct  343   PEDDAIYLKVRISDNQDGHARNIYFPFDIVNDTAMAVAVEMVKELEINDWEPSEIAVMIE  402

Query  1055  EEISALVPT---WRSTQ--YQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqasl  1219
             +EIS+LVP+   W S Q  +  QH ++Y DDDD D +V     RHPF+S SS SSSQ+SL
Sbjct  403   KEISSLVPSYDNWSSPQDYHSDQHCYSYEDDDDCDGDV----VRHPFHSFSSCSSSQSSL  458

Query  1220  -----PDLLE-------KINHDWLQ-----NDDTSSRSSMNSYDCSNLCWATESEGDLSS  1348
                  P L++         + DW       NDD SS+SS+NS + SN+ + + +E + SS
Sbjct  459   PVFGFPSLVQCHSAKNMTKDQDWFHGDLFTNDDASSQSSLNSCNYSNMNYYSGNEDEPSS  518

Query  1349  IGGRESLLIQKTNTGTRLCP-ETSRSNKKKGC-----------------CGSNHQRPKMS  1474
               G       KT+  TR CP +++ +N  K C                    +H + K+ 
Sbjct  519   CFG-------KTHKSTRFCPSDSTTTNHYKRCDPQVDNGRAYHELNHHPHKHHHNQGKLP  571

Query  1475  RVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYS  1609
             R+RS+VD+RSQLLHR+LVEE+ KRRL  TVGAVENIG+  P   S
Sbjct  572   RIRSLVDVRSQLLHRSLVEEITKRRLCNTVGAVENIGFQAPGNIS  616



>ref|XP_007017066.1| No lysine kinase 4 isoform 1 [Theobroma cacao]
 gb|EOY34685.1| No lysine kinase 4 isoform 1 [Theobroma cacao]
Length=652

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/562 (61%), Positives = 421/562 (75%), Gaps = 32/562 (6%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLGMEVAWNQ+KLN V RSPE+LQRLYSEV LL  L+H SI+RF+ SWID D
Sbjct  86    TVYKAIDEVLGMEVAWNQVKLNEVLRSPEDLQRLYSEVHLLSTLNHDSIIRFYTSWIDVD  145

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             R+TFNFITE+FTSG+LREYR++Y  V+IRAIKNW RQIL+GL YLH HDPPVIHRDLKCD
Sbjct  146   RKTFNFITEMFTSGSLREYRKKYKRVDIRAIKNWARQILQGLVYLHGHDPPVIHRDLKCD  205

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  206   NIFVNGHLGQVKIGDLGLAAILRGSKSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  265

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY+I + +AQRF+G+CL  ASKR SA EL
Sbjct  266   LEMLTSEYPYSECSNPAQIYKKVTSGKLPGAFYQIQDLDAQRFIGKCLVNASKRLSAEEL  325

Query  719   LLDPFLAADEEE-DESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA DE +   + +L S K   N +  E+E   ++     +DMTITG LNPEDDTI
Sbjct  326   LLDPFLATDEAKLSPTTRLGSPKPFLNER--EMEKLHLNDDPPRTDMTITGKLNPEDDTI  383

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+D +G ARNI+FPFDI +DT  +VA EMVKELEITDW P +IAEMID EISALV
Sbjct  384   FLKVQIADTEGSARNIYFPFDIVNDTPSDVALEMVKELEITDWEPYEIAEMIDGEISALV  443

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWL  1255
             P W+ + + +  +++  +  +DD+      + HPFYS SS SSSQ SL  L+ +   DWL
Sbjct  444   PLWKKSDFPRNEAYSTFNFQEDDDG-----SHHPFYSFSSCSSSQVSLSGLMTR-GGDWL  497

Query  1256  QN---DDTSSRSSMNSYDCSNLCW-ATESEGDLSSIGGRESLLIQKTNTGTRLC-PETSR  1420
             Q+   D+TSS+SS +S   +N+ + + +     +S+  +   L  + +  TR C  E+SR
Sbjct  498   QDDLPDETSSQSSSHSGTYNNMSYFSGDDHKPDTSLTTKSKHLSPRIHNSTRFCNEESSR  557

Query  1421  SNKK--KGCCG------SNHQRP---------KMSRVRSMVDLRSQLLHRTLVEEVNKRR  1549
             S +   + C        S+   P         K++R RS+VD+RSQLLHR+LVEEV+KRR
Sbjct  558   SGQSIARNCYNQYKALESHASSPKHRGVMDHRKLTRNRSLVDIRSQLLHRSLVEEVSKRR  617

Query  1550  LFKTVGAVENIGYHEPAEYSCK  1615
             LFKTVGAVE+IG+  P E   K
Sbjct  618   LFKTVGAVEDIGFQAPCEVPTK  639



>ref|XP_007017067.1| No lysine kinase 4 isoform 2 [Theobroma cacao]
 gb|EOY34686.1| No lysine kinase 4 isoform 2 [Theobroma cacao]
Length=590

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/558 (61%), Positives = 411/558 (74%), Gaps = 39/558 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLGMEVAWNQ+KLN V RSPE+LQRLYSEV LL  L+H SI+RF+ SWID D
Sbjct  39    TVYKAIDEVLGMEVAWNQVKLNEVLRSPEDLQRLYSEVHLLSTLNHDSIIRFYTSWIDVD  98

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             R+TFNFITE+FTSG+LREYR++Y  V+IRAIKNW RQIL+GL YLH HDPPVIHRDLKCD
Sbjct  99    RKTFNFITEMFTSGSLREYRKKYKRVDIRAIKNWARQILQGLVYLHGHDPPVIHRDLKCD  158

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  159   NIFVNGHLGQVKIGDLGLAAILRGSKSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  218

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY+I + +AQRF+G+CL  ASKR SA EL
Sbjct  219   LEMLTSEYPYSECSNPAQIYKKVTSGKLPGAFYQIQDLDAQRFIGKCLVNASKRLSAEEL  278

Query  719   LLDPFLAADEEE-DESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA DE +   + +L S K   N +  E+E   ++     +DMTITG LNPEDDTI
Sbjct  279   LLDPFLATDEAKLSPTTRLGSPKPFLNER--EMEKLHLNDDPPRTDMTITGKLNPEDDTI  336

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+D +G ARNI+FPFDI +DT  +VA EMVKELEITDW P +IAEMID EISALV
Sbjct  337   FLKVQIADTEGSARNIYFPFDIVNDTPSDVALEMVKELEITDWEPYEIAEMIDGEISALV  396

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWL  1255
             P W+ + + +  +++  +  +DD+      + HPFYS SS SSSQ SL  L+ +   DWL
Sbjct  397   PLWKKSDFPRNEAYSTFNFQEDDDG-----SHHPFYSFSSCSSSQVSLSGLMTR-GGDWL  450

Query  1256  QNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLC-PETSRSNKK  1432
             Q           +Y+  +     + + D +S+  +   L  + +  TR C  E+SRS + 
Sbjct  451   Q----------GTYNNMSYFSGDDHKPD-TSLTTKSKHLSPRIHNSTRFCNEESSRSGQS  499

Query  1433  --KGCCG------SNHQRP---------KMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKT  1561
               + C        S+   P         K++R RS+VD+RSQLLHR+LVEEV+KRRLFKT
Sbjct  500   IARNCYNQYKALESHASSPKHRGVMDHRKLTRNRSLVDIRSQLLHRSLVEEVSKRRLFKT  559

Query  1562  VGAVENIGYHEPAEYSCK  1615
             VGAVE+IG+  P E   K
Sbjct  560   VGAVEDIGFQAPCEVPTK  577



>ref|XP_003517007.1| PREDICTED: probable serine/threonine-protein kinase WNK5-like 
isoform X1 [Glycine max]
Length=609

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/577 (60%), Positives = 413/577 (72%), Gaps = 47/577 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VYRAFDEVLG+EVAWNQ+KL +VF SP+ L RLYSEV LLK+L+H SIM FH SWID +
Sbjct  37    VVYRAFDEVLGIEVAWNQVKLGDVFHSPDLLPRLYSEVHLLKNLEHDSIMTFHDSWIDVN  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITELFTSGTLREYR++Y  V+IRA+KNW RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    CRTFNFITELFTSGTLREYRKKYQRVDIRAVKNWARQILSGLEYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF+NGHLGQVKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEEEY+ELVDIYSFGMC+
Sbjct  157   NIFINGHLGQVKIGDLGLAAILRGSQHAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCM  216

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +E+ TSE+PYSEC+NPAQIYKKVTSGKLP A+YRI + EAQRFVG+CL   S+R SA EL
Sbjct  217   IEIFTSEFPYSECSNPAQIYKKVTSGKLPEAYYRIHDLEAQRFVGKCLANVSERLSAKEL  276

Query  719   LLDPFLAADEEED--ESAKLPSQK---LIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPE  883
             LLDPFLA ++ +    S  LP ++   L     L +        Q K S MTITG++N E
Sbjct  277   LLDPFLAKEQLDSPLPSPTLPKKQAPTLNFTASLAKELSQPKSNQTKDSHMTITGSINEE  336

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             DDT+FL+VQIS+KDG+ RNIFFPFD   DTA++VA EMVKELEI+D  PL+IA+MI+EEI
Sbjct  337   DDTVFLKVQISNKDGQKRNIFFPFDTIYDTAIDVAMEMVKELEISDLEPLEIAKMIEEEI  396

Query  1064  SALVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE  1234
             SALVP WR   S +YQKQHSF+Y ++ D  N+       HPF+S SS+SSS ASLP    
Sbjct  397   SALVPKWRDWGSAEYQKQHSFSYEEEYDMSNH-------HPFFSTSSRSSSHASLPVFGS  449

Query  1235  --------KINH-----DWLQ-----NDDTSSRSSMNSYDCSNL-CW--ATESEGDLSSI  1351
                     + NH     DW Q     NDD SS+SSMNS+ C N  C     E E D + +
Sbjct  450   SYKNNSHYRGNHYPFAQDWPQDELFMNDDASSQSSMNSFKCFNFNCCDPGNEDEHDPTLV  509

Query  1352  GGRESLLI--QKTNTGTRLCP--ETSRSNKKKGCCGSN------HQRPKMSRVRSMVDLR  1501
              G E L    +      R CP  E   ++  K  C         H   +++R+RS VDLR
Sbjct  510   LGAEHLYYTPKGNEKCIRFCPREEVMDADFTKQLCNMRMDSHRCHGMHRLTRIRSFVDLR  569

Query  1502  SQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSC  1612
              Q L R+L+EE++KRR+FKTVGAVENIG+  P    C
Sbjct  570   RQQLQRSLMEEIHKRRMFKTVGAVENIGFQNPEGGGC  606



>gb|KDO40186.1| hypothetical protein CISIN_1g007495mg [Citrus sinensis]
Length=601

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/553 (61%), Positives = 408/553 (74%), Gaps = 30/553 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++LN + RSP++LQRLYSEV LL  L H SI+RF+ SWID D
Sbjct  43    TVYKAIDEVLGVEVAWNQVRLNELMRSPDDLQRLYSEVHLLSTLKHDSIIRFYTSWIDVD  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             ++TFNFITE+FTSGTLREYR++Y  V+IRAIK+W RQIL+GL YLHS DPPVIHRDLKCD
Sbjct  103   QKTFNFITEMFTSGTLREYRKKYRRVDIRAIKSWARQILQGLVYLHSRDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  163   NIFVNGHLGQVKIGDLGLAAILRGSKSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM T EYPYSEC NPAQIYKKVTSGKLP AFY I + EAQRF+GRCL  ASKR SA EL
Sbjct  223   LEMFTCEYPYSECANPAQIYKKVTSGKLPGAFYSIQDLEAQRFIGRCLVNASKRLSAKEL  282

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LLDPFLA+DE +  S    +QK   N    E+E   +      +DMTITG LNPEDDTIF
Sbjct  283   LLDPFLASDEVKLLSKTKLNQKPFLNET--ELEKLQLSDDPPRTDMTITGKLNPEDDTIF  340

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQI+DKDG  RNI+FPFDI +DT ++VA EMVKELEITDW P +IA+MIDEEIS LVP
Sbjct  341   LKVQIADKDGPGRNIYFPFDILNDTPLDVAREMVKELEITDWEPFEIAKMIDEEISVLVP  400

Query  1079  TWRSTQY---QKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD  1249
              W+  ++   +  H+FNY +D+D  +        HP YS  S SSSQASLP L+   +HD
Sbjct  401   HWKKREWPHPEAYHTFNYEEDEDGYH--------HPLYSFPSCSSSQASLPGLV-TYDHD  451

Query  1250  WLQN---DDTSSRSSMNSYDCSNLCW--ATESEGDLSSIGGRESLLIQKTNTGTRLCPET  1414
             WL++   DD SS+SS +S   S+L +    E + + S +   +  +  + +  TR CPE 
Sbjct  452   WLKDDFFDDASSQSSSHSGAYSSLNYFSGDEHKSETSPVRRDKHPISTRAHNSTRFCPEE  511

Query  1415  SRSNKKKGCCGSNHQRP----------KMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTV  1564
             +   + K    S               +++R RS+VD+RSQLLHR LVEEV+KRRLF TV
Sbjct  512   NSYRQCKVMLESQRASSSKTKRVMDCRRLTRNRSLVDVRSQLLHRQLVEEVHKRRLFNTV  571

Query  1565  GAVENIGYHEPAE  1603
             GAVENIG+  P E
Sbjct  572   GAVENIGFQAPCE  584



>ref|XP_010108487.1| putative serine/threonine-protein kinase WNK4 [Morus notabilis]
 gb|EXC19549.1| putative serine/threonine-protein kinase WNK4 [Morus notabilis]
Length=631

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/576 (60%), Positives = 406/576 (70%), Gaps = 49/576 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLGMEVAWNQ+KLN V RSP++LQRLYSEV LL  L+H SIMRFH SWI+ D
Sbjct  46    TVYKAIDEVLGMEVAWNQVKLNEVLRSPDDLQRLYSEVHLLSTLNHDSIMRFHTSWINVD  105

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYR++Y  V+IRAIKNW RQIL+GL YLH HDPPVIHRDLKCD
Sbjct  106   RRTFNFITEMFTSGTLREYRKKYKQVDIRAIKNWARQILKGLVYLHGHDPPVIHRDLKCD  165

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  166   NIFVNGHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  225

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM TSEYPYSECTNPAQIYKKVTSGKLPAAFYRI + EAQRF+G+CL  ASKR  A EL
Sbjct  226   LEMFTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIRDLEAQRFIGKCLVNASKRLPAREL  285

Query  719   LLDPFLAADEEEDESAK-LPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA DE+E+ + + + SQK   N K  E+    +      +DM ITG LNPEDDTI
Sbjct  286   LLDPFLACDEDENSALRGVGSQKPFLNDK--EMGKLRLRDDVPRTDMKITGKLNPEDDTI  343

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQ +DKDG  RNI+FPFD  +DTA++VATEMVKELEI+DW P +IAEMI  EISAL+
Sbjct  344   FLKVQFADKDGSLRNIYFPFDTVTDTAIDVATEMVKELEISDWEPFEIAEMIQGEISALI  403

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWL  1255
             P + +  YQ     N               T HP YS SS SSSQAS+  L+     D +
Sbjct  404   PHYDTFNYQDDDDEN-------------DGTHHPLYSFSSSSSSQASISGLITSHGVDNI  450

Query  1256  QN----------DDTSSRSSMNSYDCSNLCWAT---ESEGDLSSIGGRESLLIQ---KTN  1387
              N          DD SS SS +S   SNL + +   ++E ++S   G ++  I    K +
Sbjct  451   ANPCDWLQDDLLDDISSVSSSHSGTYSNLNYISGDDQNESNISPAIGDKNPNINYNTKIH  510

Query  1388  TGTRLCPETSRSNKKKGCC-----------GSNHQRPKMSRVR-----SMVDLRSQLLHR  1519
               TR CPE    N   G             GS  +R  M  +R     S+VD+RSQLLHR
Sbjct  511   NVTRFCPEERYRNINSGQSNEQCKAFMSSRGSKDKRVVMDSLRLNRNTSLVDIRSQLLHR  570

Query  1520  TLVEEVNKRRLFKTVGAVENIGYHEPAEYSCKGNRS  1627
             +LVEEV KRRLF T+GAVENIG+  P +   K N S
Sbjct  571   SLVEEVYKRRLFNTIGAVENIGFQSPYDQVSKQNAS  606



>gb|KDP45717.1| hypothetical protein JCGZ_17324 [Jatropha curcas]
Length=602

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/562 (61%), Positives = 411/562 (73%), Gaps = 44/562 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLGMEVAWNQ+KLN V RSP++LQRLYSEV LL  L+H SI++FH SWID  
Sbjct  39    TVYKAIDEVLGMEVAWNQVKLNEVLRSPDDLQRLYSEVHLLSTLNHDSIIQFHTSWIDVH  98

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNFITE+FTSGTLR YR++Y  VNIRAIKNW RQIL+GL YLH HDPPVIHRDLKCD
Sbjct  99    HKTFNFITEMFTSGTLRGYRKKYKRVNIRAIKNWARQILQGLVYLHGHDPPVIHRDLKCD  158

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  159   NIFVNGHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  218

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC NPAQIYKKVTSGKLPAAFYRI + EAQRF+G+C+  ASKR SA EL
Sbjct  219   LEMLTSEYPYSECVNPAQIYKKVTSGKLPAAFYRIQDLEAQRFIGKCIVTASKRVSAKEL  278

Query  719   LLDPFLAADEEEDES-AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA+D+ E    +++ + K   N   +E      D   + ++MTITG LNPEDDTI
Sbjct  279   LLDPFLASDKAEPSPVSRIGNPKPFLNCTEMEKLQLSEDDSTR-TNMTITGKLNPEDDTI  337

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+DKDG  RNI+FPFDI  DT ++VA EMVKEL+I DW P++IAEMID EIS+LV
Sbjct  338   FLKVQIADKDGILRNIYFPFDILHDTPIDVAMEMVKELDIDDWEPIEIAEMIDGEISSLV  397

Query  1076  PTWRS---TQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH  1246
             P W+     Q    H FNY +D           T +PF+  SS SSSQAS+      I  
Sbjct  398   PNWKKWDLPQTGAYHIFNYQED---------DRTNNPFHPSSSCSSSQASI----SGIKT  444

Query  1247  DWLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIG-GRESLLIQKTNTGTRLCPE-  1411
             +WLQ+   DDTSS SS +S   SNL + +  +    +   GR+  LI +++  TR CPE 
Sbjct  445   NWLQDDLFDDTSSESSSHSGSYSNLNYISGDDHKFDTTKTGRDKHLITRSHNSTRFCPED  504

Query  1412  TSRS--------NKKKGC--------CGSNHQRP----KMSRVRSMVDLRSQLLHRTLVE  1531
              S+S        +  K C         G+  +R     +++R RS+VD+RSQLLHR+LVE
Sbjct  505   NSKSFVGQAIARDAYKHCKNLLESQNGGALTKRVIESRRLTRNRSLVDVRSQLLHRSLVE  564

Query  1532  EVNKRRLFKTVGAVENIGYHEP  1597
             EVNKRRLFKTVGAVEN+G+  P
Sbjct  565   EVNKRRLFKTVGAVENVGFVPP  586



>ref|XP_006432001.1| hypothetical protein CICLE_v10000645mg [Citrus clementina]
 ref|XP_006494377.1| PREDICTED: probable serine/threonine-protein kinase WNK4-like 
[Citrus sinensis]
 gb|ESR45241.1| hypothetical protein CICLE_v10000645mg [Citrus clementina]
Length=601

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/553 (61%), Positives = 407/553 (74%), Gaps = 30/553 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++LN + RSP++LQRLYSEV LL  L H SI+RF+ SWID D
Sbjct  43    TVYKAIDEVLGVEVAWNQVRLNELMRSPDDLQRLYSEVHLLSTLKHDSIIRFYTSWIDVD  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             ++TFNFITE+FTSGTLREYR++Y  V+IRAIK+W RQIL+GL YLHS DPPVIHRDLKCD
Sbjct  103   QKTFNFITEMFTSGTLREYRKKYRRVDIRAIKSWARQILQGLVYLHSRDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  163   NIFVNGHLGQVKIGDLGLAAILRGSKSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM T EYPYSEC NPAQIYKKVTSGKLP AFY I + EAQRF+GRCL  ASKR SA EL
Sbjct  223   LEMFTCEYPYSECANPAQIYKKVTSGKLPGAFYSIQDLEAQRFIGRCLVNASKRLSAKEL  282

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LLDPFLA+DE +  S    +QK   N    E+    +      +DMTITG LNPEDDTIF
Sbjct  283   LLDPFLASDEVKLLSKTKLNQKPFLNET--ELGKLQLSDDPPRTDMTITGKLNPEDDTIF  340

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQI+DKDG  RNI+FPFDI +DT ++VA EMVKELEITDW P +IA+MIDEEIS LVP
Sbjct  341   LKVQIADKDGPGRNIYFPFDILNDTPLDVAREMVKELEITDWEPFEIAKMIDEEISVLVP  400

Query  1079  TWRSTQY---QKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD  1249
              W+  ++   +  H+FNY +D+D  +        HP YS  S SSSQASLP L+   +HD
Sbjct  401   HWKKREWPHPEAYHTFNYEEDEDGYH--------HPLYSFPSCSSSQASLPGLV-TYDHD  451

Query  1250  WLQN---DDTSSRSSMNSYDCSNLCW--ATESEGDLSSIGGRESLLIQKTNTGTRLCPET  1414
             WL++   DD SS+SS +S   S+L +    E + + S +   +  +  + +  TR CPE 
Sbjct  452   WLKDDFFDDASSQSSSHSGAYSSLNYFSGDEHKSETSPVRRDKHPISTRAHNSTRFCPEE  511

Query  1415  SRSNKKKGCCGSNHQRP----------KMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTV  1564
             +   + K    S               +++R RS+VD+RSQLLHR LVEEV+KRRLF TV
Sbjct  512   NSYRQCKVMLESQRDSSSKTKRVMDCRRLTRNRSLVDVRSQLLHRQLVEEVHKRRLFNTV  571

Query  1565  GAVENIGYHEPAE  1603
             GAVENIG+  P E
Sbjct  572   GAVENIGFQAPCE  584



>ref|XP_007142049.1| hypothetical protein PHAVU_008G248200g [Phaseolus vulgaris]
 gb|ESW14043.1| hypothetical protein PHAVU_008G248200g [Phaseolus vulgaris]
Length=608

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/565 (60%), Positives = 413/565 (73%), Gaps = 36/565 (6%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++LN   R+PE+LQRLYSEV LL  L H SI+RF+ SWID D
Sbjct  29    TVYKAIDEVLGIEVAWNQVRLNEALRTPEDLQRLYSEVHLLSTLKHQSIIRFYTSWIDVD  88

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R FNFITELFTSG+LREYR++Y  V+I+ IKNW RQIL+GL YLH HDPPVIHRDLKCD
Sbjct  89    NRAFNFITELFTSGSLREYRKKYERVSIQGIKNWARQILQGLVYLHGHDPPVIHRDLKCD  148

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEEEY+EL D+YSFGMCV
Sbjct  149   NIFVNGHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYEEEYNELADVYSFGMCV  208

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AF+RI++ EAQRF+G+CL PA KRPSA +L
Sbjct  209   LEMLTSEYPYSECSNPAQIYKKVTSGKLPMAFFRIEDMEAQRFIGKCLLPAEKRPSAKDL  268

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LLDPFLA+D+    + K   QK   N    E+E   ++     + M + G LNPEDDTIF
Sbjct  269   LLDPFLASDDPS-SATKYAIQKPFLNAT--EMEKLQLNDDLPRTGMKVIGKLNPEDDTIF  325

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQISDK+G ARN+FFPFDI +DT ++VATEMVKELEI DW P +IA MID EISAL+P
Sbjct  326   LKVQISDKNGSARNVFFPFDIFNDTPIDVATEMVKELEIADWEPFEIANMIDREISALLP  385

Query  1079  TWR-STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKI-----  1240
               R S+     H+F+YIDDD DDN+      R    S SS SS Q S+PD + K      
Sbjct  386   QRRQSSCLDAFHTFSYIDDDCDDNDAPHHHFR----SFSSSSSFQESMPDFVSKAEEMSS  441

Query  1241  NHDWLQN---DDTSSR-SSMNSYDCSNLCWAT----ESEGDLSSIGGRESLLIQKTNTGT  1396
              + WL +   DDTSSR SS  +Y  SNL +++    + + +L S+   +  +I+  + G 
Sbjct  442   GYYWLHDDSHDDTSSRCSSQGTY--SNLNYSSVDDHQDQYNLPSLRKDKLPIIKSHSKGK  499

Query  1397  RLCP--ETSRSNKKKGCCGSN---HQRPKM-------SRVRSMVDLRSQLLHRTLVEEVN  1540
             ++ P  + S  N+ K   GS      R KM       +R RS++D+RSQLLHR+LVEEVN
Sbjct  500   KVSPGEDLSNFNQYKLMAGSQVPFTSRSKMMMNNHRLTRNRSLIDIRSQLLHRSLVEEVN  559

Query  1541  KRRLFKTVGAVENIGYHEPAEYSCK  1615
             KRRLF TVGAVENIG+  P + + K
Sbjct  560   KRRLFNTVGAVENIGFQAPCDVTTK  584



>ref|XP_008242759.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Prunus 
mume]
Length=586

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/567 (61%), Positives = 408/567 (72%), Gaps = 42/567 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LGMEVAWNQ+KLN V RSPE+LQRLYSEV LL  L+H SI+RF+ SWID D
Sbjct  32    TVYKAIDELLGMEVAWNQVKLNEVLRSPEDLQRLYSEVHLLSTLNHDSIIRFYTSWIDVD  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNFITE+FTSGTLREYR++Y  V+IRAIKNW RQIL GL YLH +DPPVIHRDLKCD
Sbjct  92    HKTFNFITEMFTSGTLREYRKKYKHVDIRAIKNWARQILRGLVYLHGNDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELY+E Y+ELVD+YSFGMCV
Sbjct  152   NIFVNGHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYDENYNELVDVYSFGMCV  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC NPAQIYKKVTSGKLP AFYRI + EAQRFVG+CL  ASKR  A EL
Sbjct  212   LEMLTSEYPYSECVNPAQIYKKVTSGKLPGAFYRIQDLEAQRFVGKCLVNASKRLPAKEL  271

Query  719   LLDPFLAADEEED-ESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFL   ++E     KL   K   N K  E+E   +      +DMTITG LNPEDDTI
Sbjct  272   LLDPFLERGKDEPLPLGKLGRPKPFLNDK--EMEKLQLSDDQTRTDMTITGKLNPEDDTI  329

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+DKDG  RNI+FPFDI +DT  +VATEMVKELEITDW P +IA MI+ EISALV
Sbjct  330   FLKVQIADKDGSFRNIYFPFDILNDTPFDVATEMVKELEITDWEPFEIANMIEGEISALV  389

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK--INH-  1246
             P W++  Y   H+ NY      D++ G    + P +S SS SSS  SL  L+    IN  
Sbjct  390   PNWKTEAY---HTINY-----QDDDDG---PQRPSHSHSSCSSSHTSLSGLISSHGINGM  438

Query  1247  ----DWLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSI-GGRESLLIQKTNTGTRL  1402
                 DWLQ+   D+TSS+SS +S   SNL +   +E   ++I  G +   I K +  TR 
Sbjct  439   TNGCDWLQDDFLDETSSQSSSHSGTYSNLNFICGNEHGTNTIPTGGDKHPISKCHKSTRF  498

Query  1403  CPETSRSN------------KKKGCCGSNHQR----PKMSRVRSMVDLRSQLLHRTLVEE  1534
             CPE +R+             K     GS  +R     ++ R +S+VD+RS LLHR+LVEE
Sbjct  499   CPEENRNTGQSMAKKYYERCKAFLASGSKDKRIMDSRRLMRNKSLVDVRSHLLHRSLVEE  558

Query  1535  VNKRRLFKTVGAVENIGYHEPAEYSCK  1615
             VN+RRLFKTVGAVENIG+  P E S K
Sbjct  559   VNRRRLFKTVGAVENIGFQAPCEVSKK  585



>gb|KHN14259.1| Putative serine/threonine-protein kinase WNK5 [Glycine soja]
Length=616

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/584 (59%), Positives = 413/584 (71%), Gaps = 54/584 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VYRAFDEVLG+EVAWNQ+KL +VF SP+ L RLYSEV LLK+L+H SIM FH SWID +
Sbjct  37    VVYRAFDEVLGIEVAWNQVKLGDVFHSPDLLPRLYSEVHLLKNLEHDSIMTFHDSWIDVN  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITELFTSGTLREYR++Y  V+IRA+KNW RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    CRTFNFITELFTSGTLREYRKKYQRVDIRAVKNWARQILSGLEYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIG-------TPEFMAPelyeeeydelvdI  517
             NIF+NGHLGQVKIGDLGLAA+LRGS HAHSVIG       TPEFMAPELYEEEY+ELVDI
Sbjct  157   NIFINGHLGQVKIGDLGLAAILRGSQHAHSVIGNFSCSFSTPEFMAPELYEEEYNELVDI  216

Query  518   YSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASK  697
             YSFGMC++E+ TSE+PYSEC+NPAQIYKKVTSGKLP A+YRI + EAQRFVG+CL   S+
Sbjct  217   YSFGMCMIEIFTSEFPYSECSNPAQIYKKVTSGKLPEAYYRIHDLEAQRFVGKCLANVSE  276

Query  698   RPSAHELLLDPFLAADEEED--ESAKLPSQK---LIPNGKLLEVEPCFVDQQAKSSDMTI  862
             R SA ELLLDPFLA ++ +    S  LP ++   L     L +        Q K S MTI
Sbjct  277   RLSAKELLLDPFLAKEQLDSPLPSPTLPKKQAPTLNFTASLAKELSQPKSNQTKDSHMTI  336

Query  863   TGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIA  1042
             TG++N EDDT+FL+VQIS+KDG+ RNIFFPFD   DTA++VA EMVKELEI+D  PL+IA
Sbjct  337   TGSINEEDDTVFLKVQISNKDGQKRNIFFPFDTIYDTAIDVAMEMVKELEISDLEPLEIA  396

Query  1043  EMIDEEISALVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqa  1213
             +MI+EEISALVP WR   S +YQKQHSF+Y ++ D  N+       HPF+S SS+SSS A
Sbjct  397   KMIEEEISALVPKWRDWGSAEYQKQHSFSYEEEYDMSNH-------HPFFSTSSRSSSHA  449

Query  1214  slPDLLE--------KINH-----DWLQ-----NDDTSSRSSMNSYDCSNL-CW--ATES  1330
             SLP            + NH     DW Q     NDD SS+SSMNS+ C N  C     E 
Sbjct  450   SLPVFGSSYKNNSHYRGNHYPFAQDWPQDELFMNDDASSQSSMNSFKCFNFNCCDPGNED  509

Query  1331  EGDLSSIGGRESLLI--QKTNTGTRLCP--ETSRSNKKKGCCGSN------HQRPKMSRV  1480
             E D + + G E L    +      R CP  E   ++  K  C         H   +++R+
Sbjct  510   EHDPTLVLGAEHLYYTPKGNEKCIRFCPREEVMDADFTKQLCNMRMDSHRCHGMHRLTRI  569

Query  1481  RSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSC  1612
             RS VDLR Q L R+L+EE++KRR+FKTVGAVENIG+  P    C
Sbjct  570   RSFVDLRRQQLQRSLMEEIHKRRMFKTVGAVENIGFQNPEGGGC  613



>ref|XP_002323664.2| hypothetical protein POPTR_0016s14210g, partial [Populus trichocarpa]
 gb|EEF05425.2| hypothetical protein POPTR_0016s14210g, partial [Populus trichocarpa]
Length=551

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/565 (59%), Positives = 401/565 (71%), Gaps = 78/565 (14%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ+KL++VFRSPEELQRLYSEV LLK+L+H SI++F+ SWID D
Sbjct  21    TVYKAFDEVLGMEVAWNQVKLHDVFRSPEELQRLYSEVHLLKNLNHDSIIKFYTSWIDID  80

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RR FNFITE+FTSGTLR YR++Y  V+IRAIKNW RQIL GLA+LH HDPPVIHRDLKCD
Sbjct  81    RRAFNFITEMFTSGTLRAYRKKYQRVDIRAIKNWSRQILRGLAFLHGHDPPVIHRDLKCD  140

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF+NGHLG VKIGDLGLAA+L+GS HAHSVIGTPEFMAPELYEE+YDELVDIYSFGMCV
Sbjct  141   NIFINGHLGHVKIGDLGLAAVLQGSQHAHSVIGTPEFMAPELYEEDYDELVDIYSFGMCV  200

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC+NPAQIYKKVTSGKLP AFYRI++ EAQ F+G+CL  ASKR  A EL
Sbjct  201   LEMLTFEYPYSECSNPAQIYKKVTSGKLPEAFYRIEDVEAQEFIGKCLATASKRLPAREL  260

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LLDPFLA+DE     A+L S+ +I    +  V                            
Sbjct  261   LLDPFLASDE-----AELSSKSMIYINLMFLV----------------------------  287

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
                      G+ RNI+FPFDI +DTA++VA EMVKELEITDW P +IA+MI+E+IS+L+P
Sbjct  288   ---------GQTRNIYFPFDIMNDTAIDVAMEMVKELEITDWEPFEIADMIEEQISSLIP  338

Query  1079  TWR----STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqss----------sqas  1216
              W+    S  +  QH F+Y DDDDDD+N G    RHPF++ SS SS          S  +
Sbjct  339   GWKQCSSSQIHHPQHCFSYEDDDDDDHNDG---PRHPFFASSSHSSSQASLLAFNCSFQT  395

Query  1217  lPDLLEKIN--HDWLQ-----NDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLI  1375
              P     +   HDW +     +DD SS+SS+NS+  S L +++ +E D  +      L  
Sbjct  396   KPCQGRNMTSAHDWFEGELFIDDDASSQSSLNSFKYSTLNYSSGNEDDYDASLREVPLGF  455

Query  1376  QKTNTGTRLCPETSRSNKK----------KGCCGSNHQRPKMSRVRSMVDLRSQLLHRTL  1525
              K +  TR CP  S S K+           GCC SN QR K+SR+RS VD+R+QLLHR+L
Sbjct  456   GKIHKSTRFCPADSLSAKQYKHRNARLDSGGCCSSNPQR-KLSRIRSQVDVRNQLLHRSL  514

Query  1526  VEEVNKRRLFKTVGAVENIGYHEPA  1600
             +EE+NKRRLFKTVGAVENIGYHEP 
Sbjct  515   LEEINKRRLFKTVGAVENIGYHEPG  539



>ref|XP_008370246.1| PREDICTED: probable serine/threonine-protein kinase WNK5 isoform 
X2 [Malus domestica]
Length=603

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/567 (60%), Positives = 411/567 (72%), Gaps = 44/567 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ+KLN+ F SP+ELQRLYSEV LLK+L H SI++++ SWID +
Sbjct  46    TVYKAFDEVLGMEVAWNQVKLNDXFSSPDELQRLYSEVHLLKNLKHDSIIQYYKSWIDVN  105

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLREYR  Y  VNI A+KNW RQIL GLAYLH   PPVIHRDLKCD
Sbjct  106   HRTFNFITEMFTSGTLREYRHXYQRVNIGAVKNWSRQILRGLAYLHXLXPPVIHRDLKCD  165

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRG+ HAHSVIGTPEFMAPELY+EEY+ELVDIY+FGMCV
Sbjct  166   NIFVNGHLGQVKIGDLGLAAILRGTQHAHSVIGTPEFMAPELYDEEYNELVDIYAFGMCV  225

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY+I++ EAQRFVG+CL   S R  AH L
Sbjct  226   LEMLTSEYPYSECSNPAQIYKKVTSGKLPNAFYKIEDLEAQRFVGKCLXNVSXRLPAHXL  285

Query  719   LLDPFLAADEEEDES-AKLPSQKLIPNGKLL------EVEPCF---VDQQAKSSDMTITG  868
             LLDPFLA+D+ E  S  ++   KLI N   +      E E  F   VD + +S++M ITG
Sbjct  286   LLDPFLASDDVELASPPRISIPKLIXNBDPVAEAGDEEDELHFSAEVDLE-RSTNMIITG  344

Query  869   TLNPEDDTIFLRVQISDKDGK-ARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAE  1045
              +NPEDDTI L V+ISD DGK ARNI+FPFDI +DTA++VATEMVKELEI+DW P +IA 
Sbjct  345   KMNPEDDTISLTVRISDLDGKNARNIYFPFDIMNDTAIDVATEMVKELEISDWEPPEIAG  404

Query  1046  MIDEEISALVP---TWRSTQ--YQKQHSFNYIddddddNNVGISTTRHPFYslssqsssq  1210
             MI++EI +L+P    W S    +  QHSFNY ++DDDD         HPFYS SS SSSQ
Sbjct  405   MIEKEIFSLIPGXKKWGSPXDYHPHQHSFNYEEEDDDDXGF----NHHPFYSFSSCSSSQ  460

Query  1211  aslPDLLEKI-NH-----DWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLL  1372
              SL        NH     D   NDD SS+SS +S + SN+ + + +E DL  +       
Sbjct  461   NSLHSFRSHCKNHNLLHGDLFMNDDVSSQSSFDSCNYSNINYYSGNEDDLHDVS-----F  515

Query  1373  IQKTNTGTRLCPETSRSNKKKGCCGS-----------NHQRPKMSRVRSMVDLRSQLLHR  1519
              + T+  TR CP  SR       C S           +HQ  K+ +++S++D+RSQLLHR
Sbjct  516   GKATHKSTRFCPSESRGANSYKQCNSQLDNQRPHKLNHHQERKLPKIQSLIDVRSQLLHR  575

Query  1520  TLVEEVNKRRLFKTVGAVENIGYHEPA  1600
             +L EEVNKRRLFKTVG +EN+G+  P 
Sbjct  576   SLEEEVNKRRLFKTVGTIENVGFQTPG  602



>ref|NP_001236036.1| with no lysine kinase 12 [Glycine max]
 gb|ACN87288.1| with no lysine kinase [Glycine max]
Length=595

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/568 (60%), Positives = 406/568 (71%), Gaps = 42/568 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++LN   R+P++LQRLYSEV LL  L H SI+RF+ SWID D
Sbjct  29    TVYKAIDEVLGIEVAWNQVRLNEALRTPDDLQRLYSEVHLLSTLKHQSIIRFYTSWIDID  88

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R FNFITELFTSG+LREYR+ Y  VNI+AIKNW  QIL+GL YLH HDPPVIHRDLKCD
Sbjct  89    NRAFNFITELFTSGSLREYRKNYKRVNIQAIKNWACQILQGLVYLHCHDPPVIHRDLKCD  148

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEEEY+EL D+YSFGMCV
Sbjct  149   NIFVNGHLGQVKIGDLGLAAILRGSQLAHSVIGTPEFMAPELYEEEYNELADVYSFGMCV  208

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AF+RI++ EAQRF+GRCL PA KRPSA EL
Sbjct  209   LEMLTSEYPYSECSNPAQIYKKVTSGKLPMAFFRIEDMEAQRFIGRCLVPAEKRPSAKEL  268

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LLDPFL +D+    + K   QK  P   + E+E   +      + M + G LNPEDDTIF
Sbjct  269   LLDPFLVSDDPS-STKKFAIQK--PFLNVNEMEKLQLSDDLPRTGMKVIGKLNPEDDTIF  325

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQISDKDG ARN+FFPFDI SDT ++VATEMVKELEI DW P +IA MID EISAL+P
Sbjct  326   LKVQISDKDGSARNVFFPFDILSDTPIDVATEMVKELEIADWEPFEIANMIDREISALLP  385

Query  1079  TWRSTQYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKI-----  1240
               R +      H+FNY+DDD DD+            S SS SS Q S+ DL+ K      
Sbjct  386   HRRQSSCSDAFHTFNYLDDDCDDDEPHHHFR-----SFSSSSSFQESMSDLVSKAEEISS  440

Query  1241  NHDWLQN---DDTSSR-SSMNSYDCSNLCWAT----ESEGDLSSIGGRESLLIQKTNTGT  1396
              + WL +   DDTSSR SS  +Y  SNL + +      E ++ S+   +  + +  N G 
Sbjct  441   GYYWLHDDLHDDTSSRCSSQGTY--SNLNYYSLDDHHQEYNVPSLRKDKLPITKSHNKGK  498

Query  1397  RLCP--ETSRSNKKKGCCGS-------------NHQRPKMSRVRSMVDLRSQLLHRTLVE  1531
             ++    + S  N+ K   GS             NH R  ++R RS++D+RSQLLHR+LVE
Sbjct  499   KVSSGEDLSNFNQYKLMVGSQVPLTSKSKMMMNNHHR--LTRNRSLIDIRSQLLHRSLVE  556

Query  1532  EVNKRRLFKTVGAVENIGYHEPAEYSCK  1615
             EVNKRRLFKTVGAVENIG+  P + S K
Sbjct  557   EVNKRRLFKTVGAVENIGFQAPCDVSTK  584



>ref|XP_006574320.1| PREDICTED: with no lysine kinase 12 isoform X1 [Glycine max]
 gb|KHN40985.1| Putative serine/threonine-protein kinase WNK4 [Glycine soja]
Length=608

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/568 (60%), Positives = 406/568 (71%), Gaps = 42/568 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++LN   R+P++LQRLYSEV LL  L H SI+RF+ SWID D
Sbjct  29    TVYKAIDEVLGIEVAWNQVRLNEALRTPDDLQRLYSEVHLLSTLKHQSIIRFYTSWIDID  88

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R FNFITELFTSG+LREYR+ Y  VNI+AIKNW  QIL+GL YLH HDPPVIHRDLKCD
Sbjct  89    NRAFNFITELFTSGSLREYRKNYKRVNIQAIKNWACQILQGLVYLHCHDPPVIHRDLKCD  148

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEEEY+EL D+YSFGMCV
Sbjct  149   NIFVNGHLGQVKIGDLGLAAILRGSQLAHSVIGTPEFMAPELYEEEYNELADVYSFGMCV  208

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AF+RI++ EAQRF+GRCL PA KRPSA EL
Sbjct  209   LEMLTSEYPYSECSNPAQIYKKVTSGKLPMAFFRIEDMEAQRFIGRCLVPAEKRPSAKEL  268

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LLDPFL +D+    + K   QK  P   + E+E   +      + M + G LNPEDDTIF
Sbjct  269   LLDPFLVSDDPS-STKKFAIQK--PFLNVNEMEKLQLSDDLPRTGMKVIGKLNPEDDTIF  325

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQISDKDG ARN+FFPFDI SDT ++VATEMVKELEI DW P +IA MID EISAL+P
Sbjct  326   LKVQISDKDGSARNVFFPFDILSDTPIDVATEMVKELEIADWEPFEIANMIDREISALLP  385

Query  1079  TWRSTQYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKI-----  1240
               R +      H+FNY+DDD DD+            S SS SS Q S+ DL+ K      
Sbjct  386   HRRQSSCSDAFHTFNYLDDDCDDDEPHHHFR-----SFSSSSSFQESMSDLVSKAEEISS  440

Query  1241  NHDWLQN---DDTSSR-SSMNSYDCSNLCWAT----ESEGDLSSIGGRESLLIQKTNTGT  1396
              + WL +   DDTSSR SS  +Y  SNL + +      E ++ S+   +  + +  N G 
Sbjct  441   GYYWLHDDLHDDTSSRCSSQGTY--SNLNYYSLDDHHQEYNVPSLRKDKLPITKSHNKGK  498

Query  1397  RLCP--ETSRSNKKKGCCGS-------------NHQRPKMSRVRSMVDLRSQLLHRTLVE  1531
             ++    + S  N+ K   GS             NH R  ++R RS++D+RSQLLHR+LVE
Sbjct  499   KVSSGEDLSNFNQYKLMVGSQVPLTSKSKMMMNNHHR--LTRNRSLIDIRSQLLHRSLVE  556

Query  1532  EVNKRRLFKTVGAVENIGYHEPAEYSCK  1615
             EVNKRRLFKTVGAVENIG+  P + S K
Sbjct  557   EVNKRRLFKTVGAVENIGFQAPCDVSTK  584



>ref|XP_002518280.1| kinase, putative [Ricinus communis]
 gb|EEF44040.1| kinase, putative [Ricinus communis]
Length=606

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/573 (59%), Positives = 413/573 (72%), Gaps = 49/573 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLGMEVAWNQ+KLN V RSPE+LQRLYSEV LL  L+H SI++F+ SWID  
Sbjct  42    TVYKAIDEVLGMEVAWNQVKLNEVLRSPEDLQRLYSEVHLLSTLNHDSIIQFYTSWIDVH  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             R+TFNFITE+FTSGTLREYR++Y  VNI+AIKNW RQIL+GL YLH HDPPVIHRDLKCD
Sbjct  102   RKTFNFITEMFTSGTLREYRRKYKRVNIQAIKNWARQILQGLVYLHGHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEEEY+ELVD+YSFGMCV
Sbjct  162   NIFVNGHLGQVKIGDLGLAAILRGSQLAHSVIGTPEFMAPELYEEEYNELVDVYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC NPAQIYKKVTSGKLPAAFYR+ + EAQ+F+G+CL  ASKR SA EL
Sbjct  222   LEMLTSEYPYSECVNPAQIYKKVTSGKLPAAFYRVQDLEAQKFIGKCLVAASKRLSAKEL  281

Query  719   LLDPFLAADEEEDES-AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA+DE E    ++  +QK   N    E++   ++   + +DMTITG L  EDDTI
Sbjct  282   LLDPFLASDEAESPPLSRSENQKPFLNDS--EMKKLHLNDPPR-TDMTITGKLKSEDDTI  338

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI++KDG  RNI+FPFDI +DT+M+VA EMVK+L+I DW P +IAEMID EI +LV
Sbjct  339   FLKVQIANKDGSLRNIYFPFDILNDTSMDVAMEMVKDLDIDDWEPFEIAEMIDGEICSLV  398

Query  1076  PTWRS---TQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH  1246
             P W+     Q +  H+FNY        + G+    HPF+S SS SSSQASL  L+ +   
Sbjct  399   PNWKKWDLPQIEAYHTFNY------QEDDGLD---HPFHSSSSCSSSQASLSGLMAQ---  446

Query  1247  DWLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGR--ESLLIQKTNTGTRLCPE  1411
              W+ +   DDTSS SS +S   SNL + +  +   ++   R  +   + +    TR CP 
Sbjct  447   -WVPDDLIDDTSSESSSHSGSYSNLNYVSSDDHKFNTSTTRRPDKHPMTRNQNSTRFCPR  505

Query  1412  TSRSN-------------------KKKGCCGSNHQRP----KMSRVRSMVDLRSQLLHRT  1522
              + S+                    + G   S  +R     +++R RS+VD+RSQLLHR+
Sbjct  506   DNSSSYIGQAIARDAYKYCKVLLESQSGASSSKQKRVMDGRRLTRNRSLVDIRSQLLHRS  565

Query  1523  LVEEVNKRRLFKTVGAVENIGYHEPAEYSCKGN  1621
             LVEEVNKRRLFKTVG VEN+G+  P   S KG+
Sbjct  566   LVEEVNKRRLFKTVGDVENVGFQAPLVDSKKGS  598



>ref|XP_004294736.1| PREDICTED: probable serine/threonine-protein kinase WNK4-like 
[Fragaria vesca subsp. vesca]
Length=602

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/563 (61%), Positives = 402/563 (71%), Gaps = 38/563 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VY+AFDE+LG+EVAWNQ+K + V RSPE+LQRLYSEV LL  L+H SI+RF+ SWID D
Sbjct  32    AVYKAFDELLGLEVAWNQVKFSEVLRSPEDLQRLYSEVHLLSTLNHDSIIRFYTSWIDVD  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNFITE+FTSGTLREYR++Y  V IRAIKNW RQIL+GL YLH +DPPVIHRDLKCD
Sbjct  92    HKTFNFITEMFTSGTLREYRKKYPRVEIRAIKNWARQILQGLVYLHGNDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LR SH AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  152   NIFVNGHLGQVKIGDLGLAAILRASHSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPY EC NPAQIYKKVTSGKLP+AFYRI + EAQRFVG+CL  ASKR SA EL
Sbjct  212   LEMLTSEYPYGECVNPAQIYKKVTSGKLPSAFYRIQDFEAQRFVGKCLVNASKRLSAKEL  271

Query  719   LLDPFLAADEEED-ESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFL  DE E     KL   K   N K  E+E   +      + MTITG LNPEDDTI
Sbjct  272   LLDPFLECDEGEPLLLGKLRHPKPFLNAK--EIEKLQLRDDPARTHMTITGKLNPEDDTI  329

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQ +DKDG  RNI+FPFDI +DT ++VATEMVKELEI+DW P +IA+MI+ EISALV
Sbjct  330   FLKVQSADKDGSHRNIYFPFDILNDTPIDVATEMVKELEISDWEPCEIAKMIEGEISALV  389

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLL--EKINH-  1246
             P W++  Y   H++NY        +       +PF+S SS SSSQ+S   L+    IN  
Sbjct  390   PDWKTEAY---HTYNY-------QDDDDDGPHYPFHSFSSCSSSQSSFSGLMRSHSINGR  439

Query  1247  ----DWLQND-----DTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTR  1399
                 D LQ+D      + S S    Y   +     E E ++S   G ++  I K +  TR
Sbjct  440   TNGCDQLQDDLFDEISSQSSSQSGMYSNVHYICGHEHENNMSP-AGSDNHHISKCHKSTR  498

Query  1400  LCPETSRSNKK-----KG--CCGSNHQRPKMSRV----RSMVDLRSQLLHRTLVEEVNKR  1546
              CPE +R   K     KG    GS  +R   SR     RS+VD+RSQLLHR+LVEEVN+R
Sbjct  499   FCPEENRYAGKSLAKCKGLLASGSADKRTMDSRTLMRNRSLVDVRSQLLHRSLVEEVNRR  558

Query  1547  RLFKTVGAVENIGYHEPAEYSCK  1615
             RLFKTVGAVENIG+  P E S K
Sbjct  559   RLFKTVGAVENIGFQAPCEVSTK  581



>ref|XP_007206781.1| hypothetical protein PRUPE_ppa025482mg, partial [Prunus persica]
 gb|EMJ07980.1| hypothetical protein PRUPE_ppa025482mg, partial [Prunus persica]
Length=554

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/558 (63%), Positives = 419/558 (75%), Gaps = 41/558 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ+KL +VF SP+ELQRLYSEV LLK+L+H SI++++ SWID +
Sbjct  12    TVYKAFDEVLGMEVAWNQVKLKDVFGSPDELQRLYSEVHLLKNLNHDSIIQYYMSWIDAN  71

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQ+Y  VNI A+KNW RQIL GLAYLH  DPPVIHRDLKCD
Sbjct  72    RRTFNFITEMFTSGTLREYRQKYQRVNIGAVKNWARQILRGLAYLHKLDPPVIHRDLKCD  131

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEEEY+ELVDIY+FGMCV
Sbjct  132   NIFVNGHLGQVKIGDLGLAAVLRGSHHAHSVIGTPEFMAPELYEEEYNELVDIYAFGMCV  191

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY+I++ EAQRFVG+CLE ASKR  AHEL
Sbjct  192   LEMLTSEYPYSECSNPAQIYKKVTSGKLPNAFYKIEDLEAQRFVGKCLENASKRLPAHEL  251

Query  719   LLDPFLAADEEEDESA-KLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA+D+ E  S  ++P Q L+PN     VE    +++ +  +      L+  DDTI
Sbjct  252   LLDPFLASDDRELLSTPRIPFQNLMPNDDSAVVEVEEEEEEEEEEEEEEL-PLDLGDDTI  310

Query  896   FLRVQISDKDGK-ARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISAL  1072
             FL+VQISD+DG+ ARNI+FPFDI +DTA+ VATEMVKELEI+DW P +IAEMI++EIS+L
Sbjct  311   FLKVQISDRDGQNARNIYFPFDIVNDTAIAVATEMVKELEISDWEPSEIAEMIEKEISSL  370

Query  1073  VP---TWRSTQ--YQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK  1237
             +P    W + Q  +  +HSFNY D+DDD          HPFYS SS SSSQ SL      
Sbjct  371   IPGHKKWGTPQDYHAHRHSFNYEDEDDDH-----DHGHHPFYSFSSCSSSQNSLHAFSSH  425

Query  1238  INHDWLQNDDTSSRSSMNSYDCSNLCWATESEG---DLSSIGGRESLLIQKTNTGTRLCP  1408
                D   NDD SS+SS +S + SN+ + + +E    DL S  G+        +  +R CP
Sbjct  426   C--DLFINDDASSQSSFSSCNHSNINYFSGTEDDHHDLISCFGK--------SHKSRFCP  475

Query  1409  ETSRSNKKKGCCGS--NHQRP------------KMSRVRSMVDLRSQLLHRTLVEEVNKR  1546
               SR+      C S  +HQRP            K+ R++S++D+RSQLLHR+LVEE+NKR
Sbjct  476   SESRAANCYKHCNSQLHHQRPHELNHPLCHHQRKLPRIQSLIDVRSQLLHRSLVEEINKR  535

Query  1547  RLFKTVGAVENIGYHEPA  1600
             RLFKTVGAVENIG+  P 
Sbjct  536   RLFKTVGAVENIGFQTPG  553



>ref|XP_002319412.2| hypothetical protein POPTR_0013s15110g [Populus trichocarpa]
 gb|EEE95335.2| hypothetical protein POPTR_0013s15110g [Populus trichocarpa]
Length=608

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/567 (60%), Positives = 406/567 (72%), Gaps = 42/567 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE LG+EVAWN++KLN V  SP++LQRLYSEV LL  L+H SI++F+ SWID  
Sbjct  44    TVYKAIDEFLGIEVAWNRVKLNQVLCSPDDLQRLYSEVHLLSTLNHDSIIKFYTSWIDVR  103

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             R+TFNFITE+FTSGTLREYR++YT VNIRAIK W RQILEG+ YLH HDPPVIHRDLKCD
Sbjct  104   RKTFNFITEMFTSGTLREYRKKYTRVNIRAIKKWARQILEGIVYLHGHDPPVIHRDLKCD  163

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMCV
Sbjct  164   NIFVNGHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYEENYNELVDVYSFGMCV  223

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSECTNPAQIYKKVTSGKLPA F+RI + EAQRF+G+CL  A+KR SA EL
Sbjct  224   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAVFHRIPDLEAQRFIGKCLVTAAKRLSAKEL  283

Query  719   LLDPFLAADEEE-DESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA+DE E     +   QK   N +  E+E   ++     +DMTITG LNPEDDTI
Sbjct  284   LLDPFLASDEAELPHVPRFRKQKPFLNDR--EMEKLQLNDHPPRTDMTITGKLNPEDDTI  341

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+++DG  RNIFFPFDI  DT ++VA EMVKELEI DW P +IA+MID  ISALV
Sbjct  342   FLKVQIANEDGTLRNIFFPFDILHDTPIDVAMEMVKELEIDDWEPFEIADMIDGAISALV  401

Query  1076  PTWRS---TQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH  1246
             P W+       +  H+F+Y +DD  D         HPF+S SS SSS ASL  L+  +  
Sbjct  402   PNWKKWDLPHIESHHTFDYQEDDGHD---------HPFHSSSSCSSSPASLSGLMPHLLQ  452

Query  1247  DWLQND-DTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCP-ETSR  1420
             D L +D  + S S   SY C N     E + DLSS   R+  LI +T   TR CP E S 
Sbjct  453   DDLFDDTSSQSSSHSGSYSCLNYISGDEHKFDLSST-RRDKHLITRTQNSTRFCPQENSN  511

Query  1421  SNKKKGCCGS--NHQRP--------------------KMSRVRSMVDLRSQLLHRTLVEE  1534
             SN  +    +  NH +                     +++R RS+VD+RSQLLHR+LVEE
Sbjct  512   SNIGQALATNAYNHCKVLLESQTRASSSKSKRMMDSRRLTRNRSLVDIRSQLLHRSLVEE  571

Query  1535  VNKRRLFKTVGAVENIGYHEPAEYSCK  1615
             V+KRRL KTVG VE++G+ +P E  CK
Sbjct  572   VHKRRLSKTVGDVEDVGFQKPTEV-CK  597



>ref|XP_011021023.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Populus euphratica]
Length=608

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/567 (60%), Positives = 401/567 (71%), Gaps = 42/567 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE LG+EVAWN++KLN V  SP++LQRLYSEV LL  L+H SI++F+ SWID  
Sbjct  44    TVYKAIDEFLGIEVAWNRVKLNQVLCSPDDLQRLYSEVHLLSTLNHDSIIKFYTSWIDVR  103

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             R+TFNFITE+FTSGTLREYR++Y  VNIRAIK W RQILEG+ YLH HDPPVIHRDLKCD
Sbjct  104   RKTFNFITEMFTSGTLREYRKKYNRVNIRAIKKWARQILEGIVYLHGHDPPVIHRDLKCD  163

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMCV
Sbjct  164   NIFVNGHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYEENYNELVDVYSFGMCV  223

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSECTNPAQIYKKVTSGKLPA F+RI + EAQRF+ +CL  ASKR SA EL
Sbjct  224   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAVFHRIQDLEAQRFIAKCLVTASKRLSAKEL  283

Query  719   LLDPFLAADEEE-DESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFL +DE E     +   QK   N +  E+E   ++     +DMTITG LNPEDDTI
Sbjct  284   LLDPFLGSDEAELSHVPRFRKQKPFLNDR--EMEKLQLNDHPPRTDMTITGKLNPEDDTI  341

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+++DG  RNIFFPFDI  DT ++VA EMVKELEI DW P +IA+MID EISALV
Sbjct  342   FLKVQIANEDGTLRNIFFPFDILHDTPIDVAMEMVKELEIDDWEPFEIADMIDGEISALV  401

Query  1076  PTWRS---TQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH  1246
             P W+       +  H+F+Y +D             HPF+S SS SSS ASL  L+  +  
Sbjct  402   PNWKKWDLPHIESHHTFDYQED---------DGHNHPFHSSSSCSSSPASLSGLMPHLLQ  452

Query  1247  DWLQND-DTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPE----  1411
             D L +D  + S S   SY C N     E + DLSS   R+  LI KT   TR CP+    
Sbjct  453   DDLFDDTSSQSSSHSGSYSCLNYVSGDEHKFDLSST-RRDKHLITKTQNSTRFCPQENSN  511

Query  1412  --------TSRSNKKKGCCGSNHQRP-----------KMSRVRSMVDLRSQLLHRTLVEE  1534
                     T+  N  KG   S  +             +++R RS+VD+RSQLLHR+LVEE
Sbjct  512   SNIGQVLATNAYNHCKGLLESQTRASSSKSKRMMDSRRLTRNRSLVDIRSQLLHRSLVEE  571

Query  1535  VNKRRLFKTVGAVENIGYHEPAEYSCK  1615
             V+KRRL KTVG VE++G+ +P E  CK
Sbjct  572   VHKRRLSKTVGDVEDVGFQKPTEV-CK  597



>ref|XP_008245055.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase WNK5 [Prunus mume]
Length=652

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/623 (58%), Positives = 434/623 (70%), Gaps = 105/623 (17%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ+KL +VF SP+ELQRLYSEV LLK+L+H SI+++H SWID +
Sbjct  44    TVYKAFDEVLGMEVAWNQVKLKDVFGSPDELQRLYSEVNLLKNLNHDSIIQYHMSWIDVN  103

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQ+Y  VNI A+KNW RQIL GLAYLH  DPPVIHRDLKCD
Sbjct  104   RRTFNFITEMFTSGTLREYRQKYQLVNIGAVKNWARQILRGLAYLHKLDPPVIHRDLKCD  163

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIG---------------------------  457
             NIFVNGHLGQVKIGDLGLAA+LRGSH AHSVIG                           
Sbjct  164   NIFVNGHLGQVKIGDLGLAAVLRGSHHAHSVIGNDLXLSFCLXKLSESDLPFSILICFFF  223

Query  458   ---TPEFMAPelyeeeydelvdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPA  628
                TPEFMAPELYEEEY+ELVDIY+FGMCVLEMLTSEYPYSEC+NPAQIYKKVT GKLP 
Sbjct  224   SSGTPEFMAPELYEEEYNELVDIYAFGMCVLEMLTSEYPYSECSNPAQIYKKVTLGKLPN  283

Query  629   AFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPFLAADEEEDESA-KLPSQKLIPNG--  799
             AFY+I++ EAQRFVG+CLE ASKR  AHELLLDPFLA+D+ E  S  ++P Q L+PN   
Sbjct  284   AFYKIEDLEAQRFVGKCLENASKRLPAHELLLDPFLASDDRELLSTPRIPFQNLMPNDDS  343

Query  800   ----------------KLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGK  931
                             + L ++   VD + +S++M ITG +NPEDDTIFL+V+ISD DG+
Sbjct  344   AVEEEEEEEEEEEEEEEELPLD-LGVDLK-RSTNMIITGKMNPEDDTIFLKVRISDLDGQ  401

Query  932   -ARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP---TWRSTQ-  1096
              ARNI+FPFDI +DTA+ VATEMVKELEI+DW P +IAEMI++EIS+L+P    W + Q 
Sbjct  402   NARNIYFPFDIVNDTAIAVATEMVKELEISDWEPSEIAEMIEKEISSLIPGHKKWGTPQD  461

Query  1097  -YQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKI-----------  1240
              +  QHSFNY D+D+DD++       HPFYS SS SSSQ SL                  
Sbjct  462   YHPHQHSFNYEDEDEDDDH-----GHHPFYSFSSCSSSQNSLHAFSSHCKTQFHCGENIS  516

Query  1241  -NHDWLQ-----NDDTSSRSSMNSYDCSNLCWATESEG---DLSSIGGRESLLIQKTNTG  1393
              + DWLQ     NDD SS+SS +S + SN+ + + +E    DL S  G+        N  
Sbjct  517   NDQDWLQGDLFINDDASSQSSFSSCNYSNINYFSGTEDDHHDLISCFGK--------NHK  568

Query  1394  TRLCPETSRSNKKKGCCGS--NHQRP------------KMSRVRSMVDLRSQLLHRTLVE  1531
             +R CP  SR+      C S  +HQRP            K+ R++S++D+RSQLLHR+LVE
Sbjct  569   SRFCPSESRAANCYKHCNSQLHHQRPHELNHPLCHHQRKLPRIQSLIDVRSQLLHRSLVE  628

Query  1532  EVNKRRLFKTVGAVENIGYHEPA  1600
             E+NKRRLFKTVGAVENIG+  P 
Sbjct  629   EINKRRLFKTVGAVENIGFQTPG  651



>ref|XP_008370245.1| PREDICTED: probable serine/threonine-protein kinase WNK5 isoform 
X1 [Malus domestica]
Length=604

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/568 (60%), Positives = 409/568 (72%), Gaps = 45/568 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEVLGMEVAWNQ+KLN+ F SP+ELQRLYSEV LLK+L H SI++++ SWID +
Sbjct  46    TVYKAFDEVLGMEVAWNQVKLNDXFSSPDELQRLYSEVHLLKNLKHDSIIQYYKSWIDVN  105

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLREYR  Y  VNI A+KNW RQIL GLAYLH   PPVIHRDLKCD
Sbjct  106   HRTFNFITEMFTSGTLREYRHXYQRVNIGAVKNWSRQILRGLAYLHXLXPPVIHRDLKCD  165

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRG+ HAHSVIGTPEFMAPELY+EEY+ELVDIY+FGMCV
Sbjct  166   NIFVNGHLGQVKIGDLGLAAILRGTQHAHSVIGTPEFMAPELYDEEYNELVDIYAFGMCV  225

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFY+I++ EAQRFVG+CL   S R  AH L
Sbjct  226   LEMLTSEYPYSECSNPAQIYKKVTSGKLPNAFYKIEDLEAQRFVGKCLXNVSXRLPAHXL  285

Query  719   LLDPFLAADEEEDES-AKLPSQKLIPNGKLL------EVEPCF---VDQQAKSSDMTITG  868
             LLDPFLA+D+ E  S  ++   KLI N   +      E E  F   VD + +S++M ITG
Sbjct  286   LLDPFLASDDVELASPPRISIPKLIXNBDPVAEAGDEEDELHFSAEVDLE-RSTNMIITG  344

Query  869   TLNPEDDTIFLRVQISDKDG--KARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIA  1042
              +NPEDDTI L V+ISD D    ARNI+FPFDI +DTA++VATEMVKELEI+DW P +IA
Sbjct  345   KMNPEDDTISLTVRISDLDAGKNARNIYFPFDIMNDTAIDVATEMVKELEISDWEPPEIA  404

Query  1043  EMIDEEISALVP---TWRSTQ--YQKQHSFNYIddddddNNVGISTTRHPFYslssqsss  1207
              MI++EI +L+P    W S    +  QHSFNY ++DDDD         HPFYS SS SSS
Sbjct  405   GMIEKEIFSLIPGXKKWGSPXDYHPHQHSFNYEEEDDDDXGF----NHHPFYSFSSCSSS  460

Query  1208  qaslPDLLEKI-NH-----DWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESL  1369
             Q SL        NH     D   NDD SS+SS +S + SN+ + + +E DL  +      
Sbjct  461   QNSLHSFRSHCKNHNLLHGDLFMNDDVSSQSSFDSCNYSNINYYSGNEDDLHDVS-----  515

Query  1370  LIQKTNTGTRLCPETSRSNKKKGCCGS-----------NHQRPKMSRVRSMVDLRSQLLH  1516
               + T+  TR CP  SR       C S           +HQ  K+ +++S++D+RSQLLH
Sbjct  516   FGKATHKSTRFCPSESRGANSYKQCNSQLDNQRPHKLNHHQERKLPKIQSLIDVRSQLLH  575

Query  1517  RTLVEEVNKRRLFKTVGAVENIGYHEPA  1600
             R+L EEVNKRRLFKTVG +EN+G+  P 
Sbjct  576   RSLEEEVNKRRLFKTVGTIENVGFQTPG  603



>ref|XP_009374365.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Pyrus x bretschneideri]
Length=586

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/564 (60%), Positives = 398/564 (71%), Gaps = 36/564 (6%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LGMEVAWNQ+KLN V RSPE+LQRLYSEV LL  L+H SI+RF+ SWID +
Sbjct  32    TVYKAIDELLGMEVAWNQVKLNQVLRSPEDLQRLYSEVHLLSTLNHDSIIRFYTSWIDIE  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLREYR++Y  V+IRAIKNW RQIL GL YLH HDPPV+HRDLKCD
Sbjct  92    HRTFNFITEMFTSGTLREYRKKYNQVDIRAIKNWARQILRGLLYLHGHDPPVVHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELY+E Y+ELVD+YSFGMCV
Sbjct  152   NIFVNGHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYDENYNELVDVYSFGMCV  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC NPAQIYKKVT+GKLP AFYRI++ EAQRFVG+CL  ASKR SA EL
Sbjct  212   LEMLTSEYPYSECVNPAQIYKKVTAGKLPGAFYRIEDLEAQRFVGKCLVNASKRLSAKEL  271

Query  719   LLDPFLAADEEEDES---AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDD  889
             LLDPFL  D  +DES    KL   K   N K  E+E   +      +DMTITG LN EDD
Sbjct  272   LLDPFL--DCGKDESLPLGKLGRPKPFLNDK--EMEKLQLSDHPTRTDMTITGKLNSEDD  327

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
             TIFL+VQI+DKDG  RNI+FPFD+ +DT  +VATEMVKELEITDW P +IA MI+ EISA
Sbjct  328   TIFLKVQIADKDGSLRNIYFPFDVLNDTPFDVATEMVKELEITDWEPFEIANMIEGEISA  387

Query  1070  LVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH-  1246
             LVP W+   Y   H+F Y   DDD N     +  H + S  S  S   +   +    +  
Sbjct  388   LVPDWKPEAY---HTFKY--QDDDKNGPHRPSDSHCYSSSRSSLSGLINSHGINGMTSGC  442

Query  1247  DWLQN---DDTSSRSSMNSYDCSNL--CWATESEGDLSSIGGRESLLIQKTNTGTRLCPE  1411
             D LQ+   D+TSS+SS +     N+    A E    +   GG +   I K +  TR CPE
Sbjct  443   DSLQDDLPDETSSQSSSHLVTSPNVSSISANEHRTKMFPTGG-DKHPISKCHKSTRFCPE  501

Query  1412  TSRSNKK-------KGC-----CGSNHQR----PKMSRVRSMVDLRSQLLHRTLVEEVNK  1543
              +R+  K       + C      GS  +R     K+ R RS+ D RSQL HR++VEEVN+
Sbjct  502   ETRNAGKSIAKKYFERCKAFLASGSKDKRIMDSQKLMRNRSLGDTRSQLPHRSVVEEVNR  561

Query  1544  RRLFKTVGAVENIGYHEPAEYSCK  1615
             +RLFKTVGAVE IG+  P E S K
Sbjct  562   KRLFKTVGAVETIGFQAPCEISKK  585



>ref|XP_011080727.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Sesamum indicum]
 ref|XP_011080728.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Sesamum indicum]
Length=628

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/568 (58%), Positives = 395/568 (70%), Gaps = 33/568 (6%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++L ++ +SP++LQRLYSEV LL  L+H+SI+RF+ SWID +
Sbjct  43    TVYKAIDEVLGLEVAWNQVRLVDLLQSPDDLQRLYSEVHLLSTLNHNSIIRFYTSWIDVE  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+F+SGTLREYR +Y  VNIRAIK W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  103   NRTFNFITEMFSSGTLREYRAKYKRVNIRAIKIWARQILEGLVYLHGHDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH GQVKIGDLGLAA+LRGSH AHSVIGTPEFMAPELYEE YDELVD+YSFGMCV
Sbjct  163   NIFVNGHHGQVKIGDLGLAAILRGSHRAHSVIGTPEFMAPELYEENYDELVDVYSFGMCV  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSEYPYSECTNPAQIYKKVTSGK P AFY++ + +AQRF+G+CLE ASKR SA EL
Sbjct  223   LEMITSEYPYSECTNPAQIYKKVTSGKKPRAFYKVQDLDAQRFIGKCLESASKRLSAKEL  282

Query  719   LLDPFLAADEEEDE-SAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             + DPFLA D  +D   + + +QK + N   +E+E    +     ++MTITGTLNPED TI
Sbjct  283   MHDPFLAIDHSDDHPDSYIENQKPLLN-DCIELERLQFNDDVPRTNMTITGTLNPEDGTI  341

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+DK G  RN+FFPFDI SDT ++VA EMVKELEITDW P +IA MID EIS LV
Sbjct  342   FLKVQIADKQGAVRNVFFPFDIVSDTPIDVANEMVKELEITDWRPSEIANMIDGEISGLV  401

Query  1076  PTWRSTQYQKQ--HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD  1249
             P W+    Q    H  NY +DDD  N    S++       S  S    + P     +  D
Sbjct  402   PDWKPDNPQSSHFHVLNYQEDDDHHNLFSPSSSSQVSVLGSITSHRINTRPHTSHWVQGD  461

Query  1250  WLQNDDTSSRSSMNSYDCSNLCWATESEGDLSS------------------IGGRESLLI  1375
                 DDTSS+SS+ S   SN  + +  E D  S                    G  S+  
Sbjct  462   LF--DDTSSQSSLYSEKYSNWTYYSADEHDPLSPKRHGQAANEDILSPSRFYPGENSVTA  519

Query  1376  QKTNTGTRLCPETSRS--NKKKGCCGSNHQR---PKMSRVRSMVDLRSQLLHRTLVEEVN  1540
             Q      +LC   S+     ++G    N  +   P+++R RS+VD RSQLLHR+LVEEVN
Sbjct  520   QHL---AKLCHHQSKDMIEPREGSTSRNRSKIEIPRLTRNRSLVDTRSQLLHRSLVEEVN  576

Query  1541  KRRLFKTVGAVENIGYHEPAEYSCKGNR  1624
             +RRLF TVGAVENIG+  P E S K  R
Sbjct  577   RRRLFNTVGAVENIGFQSPYEVSSKTTR  604



>ref|XP_009374364.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Pyrus x bretschneideri]
Length=588

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/566 (60%), Positives = 397/566 (70%), Gaps = 38/566 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LGMEVAWNQ+KLN V RSPE+LQRLYSEV LL  L+H SI+RF+ SWID +
Sbjct  32    TVYKAIDELLGMEVAWNQVKLNQVLRSPEDLQRLYSEVHLLSTLNHDSIIRFYTSWIDIE  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLREYR++Y  V+IRAIKNW RQIL GL YLH HDPPV+HRDLKCD
Sbjct  92    HRTFNFITEMFTSGTLREYRKKYNQVDIRAIKNWARQILRGLLYLHGHDPPVVHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELY+E Y+ELVD+YSFGMCV
Sbjct  152   NIFVNGHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYDENYNELVDVYSFGMCV  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC NPAQIYKKVT+GKLP AFYRI++ EAQRFVG+CL  ASKR SA EL
Sbjct  212   LEMLTSEYPYSECVNPAQIYKKVTAGKLPGAFYRIEDLEAQRFVGKCLVNASKRLSAKEL  271

Query  719   LLDPFLAADEEEDES---AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDD  889
             LLDPFL  D  +DES    KL   K   N K  E+E   +      +DMTITG LN EDD
Sbjct  272   LLDPFL--DCGKDESLPLGKLGRPKPFLNDK--EMEKLQLSDHPTRTDMTITGKLNSEDD  327

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
             TIFL+VQI+DKDG  RNI+FPFD+ +DT  +VATEMVKELEITDW P +IA MI+ EISA
Sbjct  328   TIFLKVQIADKDGSLRNIYFPFDVLNDTPFDVATEMVKELEITDWEPFEIANMIEGEISA  387

Query  1070  LVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH-  1246
             LVP W+   Y   H+F Y   DDD N     +  H + S  S  S   +   +    +  
Sbjct  388   LVPDWKPEAY---HTFKY--QDDDKNGPHRPSDSHCYSSSRSSLSGLINSHGINGMTSGC  442

Query  1247  DWLQ-----NDDTSSRSSMNSYDCSNL--CWATESEGDLSSIGGRESLLIQKTNTGTRLC  1405
             D LQ      D+TSS+SS +     N+    A E    +   GG +   I K +  TR C
Sbjct  443   DSLQVADDLPDETSSQSSSHLVTSPNVSSISANEHRTKMFPTGG-DKHPISKCHKSTRFC  501

Query  1406  PETSRSNKK-------KGC-----CGSNHQR----PKMSRVRSMVDLRSQLLHRTLVEEV  1537
             PE +R+  K       + C      GS  +R     K+ R RS+ D RSQL HR++VEEV
Sbjct  502   PEETRNAGKSIAKKYFERCKAFLASGSKDKRIMDSQKLMRNRSLGDTRSQLPHRSVVEEV  561

Query  1538  NKRRLFKTVGAVENIGYHEPAEYSCK  1615
             N++RLFKTVGAVE IG+  P E S K
Sbjct  562   NRKRLFKTVGAVETIGFQAPCEISKK  587



>ref|XP_006576137.1| PREDICTED: with no lysine kinase 5 isoform X1 [Glycine max]
Length=610

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/578 (60%), Positives = 415/578 (72%), Gaps = 48/578 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VYRAFDEVLG EVAWNQ+KL +VF SP+ L RLYSEV LLK+L+H SIM FH SWID  
Sbjct  37    VVYRAFDEVLGREVAWNQVKLGDVFHSPDLLPRLYSEVHLLKNLEHDSIMTFHDSWIDVH  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITELFTSGTLREYR++Y  V+IRA+KNW RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    CRTFNFITELFTSGTLREYRKKYQRVDIRAVKNWARQILSGLEYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF+NGHLGQVKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEEEY+ELVDIYSFGMC+
Sbjct  157   NIFINGHLGQVKIGDLGLAAILRGSQHAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCM  216

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +E+ TSE+PYSEC+NPAQIYKKVTSGKLP A+YRI + EAQ+FVG+CL   S+R SA EL
Sbjct  217   IEIFTSEFPYSECSNPAQIYKKVTSGKLPEAYYRIHDLEAQKFVGKCLANVSERLSAKEL  276

Query  719   LLDPFLAADEEED--ESAKLPSQK---LIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPE  883
             LLDPFLA ++ +    S  LP ++   L     L +  P     Q K + MTITG++N E
Sbjct  277   LLDPFLATEQLDSPLPSPTLPKKQTPTLNFTALLAKELPPPKSNQTKDTHMTITGSMNEE  336

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             +DT+FL+VQIS+K+G+ RNIFFPFD  +DTA++VA EMVKELEI+D  PL+IAEMI+EEI
Sbjct  337   NDTVFLKVQISNKNGQKRNIFFPFDTINDTAIDVAMEMVKELEISDLEPLEIAEMIEEEI  396

Query  1064  SALVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDL--  1228
             SALVPTWR   S +YQKQHSF+Y ++ D  N+       HPF+S +S+SSS ASLP    
Sbjct  397   SALVPTWRDWGSAKYQKQHSFSYEEEYDMSNH-------HPFFSPTSRSSSHASLPVFGS  449

Query  1229  -------LEKINH-----DWLQ-----NDDTSSRSSMNSYDCSNL-CW--ATESEGDLSS  1348
                      + NH     DW Q     NDD SS+SSMNS+ C NL C     E E D + 
Sbjct  450   SSYKNSSHHRENHYPFAQDWPQDELFMNDDASSQSSMNSFKCFNLNCCDPGNEDEHDPTL  509

Query  1349  IGGRESLLI--QKTNTGTRLCP--ETSRSNKKKGCCGSN------HQRPKMSRVRSMVDL  1498
               G E L    +     TR CP  E   S+  K  C         H   +++R+RS VDL
Sbjct  510   ALGAEHLFYTPKGNEKYTRFCPREEVMESDFTKQFCNMRMDSHRCHGMHRLTRIRSFVDL  569

Query  1499  RSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSC  1612
             R Q   R+LVEE++KRR+FKTVGA+ENIG+ +P    C
Sbjct  570   RRQQQQRSLVEEIHKRRMFKTVGAIENIGFQDPEGDGC  607



>ref|XP_010922722.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Elaeis 
guineensis]
 ref|XP_010922723.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Elaeis 
guineensis]
Length=633

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/576 (59%), Positives = 398/576 (69%), Gaps = 53/576 (9%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VYRAFDE+ GMEVAWNQ K+ +V RSP+ LQR+YSEV LL  L H SI+RFHASWID ++
Sbjct  43    VYRAFDELNGMEVAWNQAKICDVLRSPDALQRMYSEVHLLSTLHHESIIRFHASWIDVEK  102

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             RTFNFITE+FTSGTLREYRQRY  V+IRA+KNW RQIL GL YLH HDPPVIHRDLKCDN
Sbjct  103   RTFNFITEMFTSGTLREYRQRYRRVDIRAVKNWARQILHGLVYLHGHDPPVIHRDLKCDN  162

Query  365   IFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             IFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+EL D+YSFGMC+L
Sbjct  163   IFVNGHLGQVKIGDLGLAAVLRGSQSAHSVIGTPEFMAPELYEEDYNELADVYSFGMCML  222

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EMLTSEYPYSEC NPAQIYKKVTSGKLP AFYRI + EA+RF+GRCLE ASKR SA +LL
Sbjct  223   EMLTSEYPYSECRNPAQIYKKVTSGKLPDAFYRIQDPEARRFIGRCLETASKRSSAKKLL  282

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKLLE------VEPCFVDQQAKSSDMTITGTLNPE  883
             LDPFLA+D   D ++ LP          LE       E    +   + +DMTITG +NPE
Sbjct  283   LDPFLASD---DRNSLLPQNAPTIQAIGLEGQAHHAAESHNPEHTKRRTDMTITGKMNPE  339

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             DDTIFL+VQI+DK+G  RNI+FPFDI +DT ++VA EMVKELEITD  P +IAEMI +EI
Sbjct  340   DDTIFLKVQIADKEGHMRNIYFPFDIVTDTPIDVANEMVKELEITDREPSEIAEMIAQEI  399

Query  1064  SALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLL----  1231
             S LVP W+     +   + Y   DDD++        HPFY LSS +SS  S   +     
Sbjct  400   SILVPGWKEGDLHEGSHYAYSYGDDDEDGCN-----HPFYYLSSPTSSHGSFFGMAPSPG  454

Query  1232  ----EKINH--DWL---QNDDTSSRSSMNS--YDCSNLCWATESEGDLSSIGGRESLLIQ  1378
                 ++ +H  DW       D   +SSM+S  Y   N     E EGD  S   RE+  IQ
Sbjct  455   SFHRQRQSHQEDWFGDDPYFDDDDKSSMHSSKYSAVNYISGNEHEGD-GSCHQRETQPIQ  513

Query  1379  KTNTGTRLCP------ETSRSNKKKGCCG-----------SNHQRPK----MSRVRSMVD  1495
              ++  TR C       +TS + K    C               +RP     M R RSMVD
Sbjct  514   NSHKSTRFCSGEGPPVDTSLATKFHQQCNVLLESSRASSSRAGKRPVDGRCMMRNRSMVD  573

Query  1496  LRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAE  1603
             +RSQLLHRTLVEEVNK RLFKTVGAVENIG+ +P E
Sbjct  574   IRSQLLHRTLVEEVNK-RLFKTVGAVENIGFQDPTE  608



>ref|XP_010253119.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Nelumbo 
nucifera]
Length=628

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/582 (60%), Positives = 408/582 (70%), Gaps = 49/582 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDEV+GMEVAWNQ+KLN+VFRSPEELQRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  43    TVYKAFDEVVGMEVAWNQVKLNDVFRSPEELQRLYSEVHLLSTLNHDSIIRFYTSWIDVA  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQRY  VNIRA+KNW RQIL GL YLH H+PPVIHRDLKCD
Sbjct  103   RRTFNFITEMFTSGTLREYRQRYKQVNIRAVKNWARQILRGLVYLHGHNPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEEEY+ELVDIYSFGMCV
Sbjct  163   NIFVNGHLGQVKIGDLGLAAILRGSQPAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCV  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFYRI + EAQ+F+G+CLE ASKR SA +L
Sbjct  223   LEMLTSEYPYSECSNPAQIYKKVTSGKLPDAFYRIHDLEAQQFIGKCLETASKRMSAKQL  282

Query  719   LLDPFLAADEEEDESA-KLPSQKLIPNGKLLEVEPCFVDQ-----QAKSSDMTITGTLNP  880
             LLDPFLA+ EEE   A ++   K I      E    ++       +  ++DM ITG +NP
Sbjct  283   LLDPFLASHEEEMLPAPRITDHKSITKNPAPEYSHVYLPTPLATPRKTTTDMKITGKMNP  342

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             EDDTIFL+VQI+DK+G  RNI+FPFDI SDT ++VATEMVKELEITD  P +IAE+I+ E
Sbjct  343   EDDTIFLKVQIADKEGCVRNIYFPFDILSDTPVDVATEMVKELEITDREPFEIAEVIENE  402

Query  1061  ISALVPTWRSTQYQ--KQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE  1234
             ISALVP W+  + +     +F+Y       ++       H F S SS SSS ASL  L+ 
Sbjct  403   ISALVPHWKEPEPEPHPHQTFSY------QDDDDDDGPHHAFCSFSSCSSSHASLSGLIS  456

Query  1235  KIN----------HDWLQ-----NDDTSSRSSMNSYDC---SNLCWATESEGDLSSIGGR  1360
               +           DWLQ     +DD SS+SS +S      SN+ + + SE D +    R
Sbjct  457   STHISRGEGTFNGCDWLQGDLFADDDASSQSSAHSQSSGMYSNINYNSGSEHDFNPSPRR  516

Query  1361  ESLL--IQKTNTGTRLCPE-------------TSRSNKKKGCCGSNHQRPKMSRVRSMVD  1495
                       +  TR CPE              SR        G    R +++R RS+VD
Sbjct  517   RDYCSAAMSHHQSTRFCPEEKARAGHSIGMNRQSRRASSSNESGRVDNR-QLTRNRSLVD  575

Query  1496  LRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSCKGN  1621
             +RSQLLHRTLVEEVNKRRLFKTVG VE+IG+  P     KG+
Sbjct  576   VRSQLLHRTLVEEVNKRRLFKTVGDVESIGFQSPKGLCEKGS  617



>ref|XP_008354540.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Malus 
domestica]
Length=585

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/568 (59%), Positives = 401/568 (71%), Gaps = 45/568 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LGMEVAWNQ+KLN V RSPE+LQRLYSEV LL  L+H SI+RF+ SWID +
Sbjct  32    TVYKAIDELLGMEVAWNQVKLNEVLRSPEDLQRLYSEVHLLSTLNHDSIIRFYTSWIDIE  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              + FNFITE+FTSGTLR+YR++Y  V+IRAIKNW  QIL GL +LH HDPPVIHRDLKCD
Sbjct  92    HKAFNFITEMFTSGTLRQYRKKYNQVDIRAIKNWAXQILRGLVHLHGHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  152   NIFVNGHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC NPAQIYKKVT+GKLP AFYRI++ EAQRFVG+CL  ASKR SA EL
Sbjct  212   LEMLTSEYPYSECVNPAQIYKKVTAGKLPGAFYRIEDLEAQRFVGKCLVNASKRLSAKEL  271

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKS---------SDMTITGT  871
             LLDPFL   ++E           +P GKL   +P   D++ +          +DMTITG 
Sbjct  272   LLDPFLECGKDES----------LPLGKLGHPKPFLNDKEMEKLRLSDXRTRTDMTITGK  321

Query  872   LNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMI  1051
             LN EDDTIFL+VQI+DKDG  RNI+FPFDI +DT  +VATEMVKELEITDW P +IA MI
Sbjct  322   LNSEDDTIFLKVQIADKDGSLRNIYFPFDILNDTPFDVATEMVKELEITDWEPFEIANMI  381

Query  1052  DEEISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLL  1231
             + EISAL P W+   Y   H+FNY DDDDD  +    +     +S  S   S   +  + 
Sbjct  382   EGEISALAPDWKPEAY---HTFNYQDDDDDGPHHPSHSYSSSSHSSLSGLISSHGINGM-  437

Query  1232  EKINHDWLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSI-GGRESLLIQKTNTGTR  1399
              K   DW Q+   D+TSS+SS +S   SNL + + +E     I  G +   I K +  TR
Sbjct  438   -KNACDWFQDDLLDETSSQSSSHSGTYSNLSFISGNEHGTKMIPTGGDKHPISKCHKSTR  496

Query  1400  LCP-ETSRSN-----------KKKGCCGSNHQR----PKMSRVRSMVDLRSQLLHRTLVE  1531
              CP ETS +            K     GS  +R     K+ R RS+VD+RSQLLHR++VE
Sbjct  497   FCPEETSHAGQYIAKKYFERCKALLASGSKDKRIMDSRKLMRNRSLVDIRSQLLHRSVVE  556

Query  1532  EVNKRRLFKTVGAVENIGYHEPAEYSCK  1615
             EVN+RRLFKTVG VE IG+  P + S K
Sbjct  557   EVNRRRLFKTVGDVETIGFQAPCDVSKK  584



>ref|XP_006595486.1| PREDICTED: with no lysine kinase 13 isoform X2 [Glycine max]
Length=595

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/556 (58%), Positives = 395/556 (71%), Gaps = 31/556 (6%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++LN V R+P++LQRLYSEV LL  L H SI+RF+ SWID D
Sbjct  29    TVYKAIDEVLGIEVAWNQVRLNEVLRTPDDLQRLYSEVHLLSTLKHQSILRFYTSWIDID  88

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R FNFITE FTSG+LREYR+ Y  V+I+AIKNW RQIL+GL YLH HDPPVIHRDLKCD
Sbjct  89    SRAFNFITEFFTSGSLREYRKNYKRVSIQAIKNWARQILQGLVYLHCHDPPVIHRDLKCD  148

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+L GS  AHSVIGTPEFMAPELYEEEY+EL D+YSFGMCV
Sbjct  149   NIFVNGHLGQVKIGDLGLAAILHGSQLAHSVIGTPEFMAPELYEEEYNELADVYSFGMCV  208

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AF+RI++ EAQRF+G+CL PA KRPSA EL
Sbjct  209   LEMLTSEYPYSECSNPAQIYKKVTSGKLPMAFFRIEDMEAQRFIGKCLVPAEKRPSAKEL  268

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LLDPFL +D+    + K   QK  P   + E+E   +      + M + G LNPE+DTIF
Sbjct  269   LLDPFLVSDDPS-STMKFAIQK--PFLNVNEMEKLQLSDDLPRTGMKVIGKLNPENDTIF  325

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQISDKDG  RN+FFPFDI SDT ++VATEMVKELEI D  P +IA MID EISAL+P
Sbjct  326   LKVQISDKDGSVRNVFFPFDILSDTPIDVATEMVKELEIEDGEPYEIANMIDREISALLP  385

Query  1079  TWRSTQYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWL  1255
               R +      H+FNY+DDD DD+         P +   S SSS +    + + ++ D L
Sbjct  386   HRRQSSCSDAFHTFNYLDDDCDDDG--------PHHHFRSFSSSSSFQESMSDLVSKDDL  437

Query  1256  QNDDTSSRSSMNSYDCSNLCWAT---ESEGDLSSIGGRESLLIQKTNTGTRLCPETSRSN  1426
              +D +S  SS  +Y  SNL + +     E ++ S+   +  +    N G ++      SN
Sbjct  438   HDDTSSRCSSQGTY--SNLNYYSVDDHQEYNVPSLRKDKLPITTSHNKGKKISTGEDLSN  495

Query  1427  KKKGCCGSNHQRP-------------KMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVG  1567
               +G      Q P             +++R RS++D+RSQLLHR+LVEEVNKRRLFKTVG
Sbjct  496   FNQGKLMVGSQVPLTSKSKMMINNHHRLTRNRSLIDIRSQLLHRSLVEEVNKRRLFKTVG  555

Query  1568  AVENIGYHEPAEYSCK  1615
             AVENIG+  P + + K
Sbjct  556   AVENIGFQAPCDVTTK  571



>gb|ABQ65855.1| WNK1 [Glycine max]
Length=610

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/578 (60%), Positives = 412/578 (71%), Gaps = 48/578 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VYRAFDEVLG EVAWNQ+KL +VF SP+ L RLYSEV LLK+L+H SIM FH SWID  
Sbjct  37    VVYRAFDEVLGREVAWNQVKLGDVFHSPDLLPRLYSEVHLLKNLEHDSIMTFHDSWIDVH  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITELFTSGTLREYR++Y  V+IRA+KNW RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    CRTFNFITELFTSGTLREYRKKYQRVDIRAVKNWARQILSGLEYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF+NGHLGQVKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEEEY+ELVDIYSFGMC+
Sbjct  157   NIFINGHLGQVKIGDLGLAAILRGSQHAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCM  216

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +E+ TSE+PYSEC+NPAQIYKKVTSGKLP A+YRI + EAQ+FVG+C    S+R SA EL
Sbjct  217   IEIFTSEFPYSECSNPAQIYKKVTSGKLPEAYYRIHDLEAQKFVGKCSANVSERLSAKEL  276

Query  719   LLDPFLAADEEED--ESAKLPSQK---LIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPE  883
             LLDPFLA ++ +    S  LP ++   L     L +  P     Q K + MTITG+ N E
Sbjct  277   LLDPFLATEQLDSPLPSPTLPKKQTPTLNFTALLAKELPPPKSNQTKDTHMTITGSTNEE  336

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             +DT+FL+VQIS+K+G+ RNIFFPFD  +DTA++VA EMVKELEI+D  PL+IAEMI+EEI
Sbjct  337   NDTVFLKVQISNKNGQKRNIFFPFDTINDTAIDVAMEMVKELEISDLEPLEIAEMIEEEI  396

Query  1064  SALVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDL--  1228
             SALVPTWR   S +YQKQHSF+Y +  D  N+       HPF+S +S+SSS ASLP    
Sbjct  397   SALVPTWRDWGSAKYQKQHSFSYEEAYDMSNH-------HPFFSPTSRSSSHASLPVFGS  449

Query  1229  -------LEKINH-----DWLQ-----NDDTSSRSSMNSYDCSNL-CW--ATESEGDLSS  1348
                      + NH     DW Q     NDD SS+SSMNS+ C NL C     E E D + 
Sbjct  450   SSYKNSSHHRENHYPFAQDWPQDELFMNDDASSQSSMNSFKCFNLNCCDPGNEDEHDPTL  509

Query  1349  IGGRESLLI--QKTNTGTRLCP--ETSRSNKKKGCCGSN------HQRPKMSRVRSMVDL  1498
               G E L    +     TR CP  E   S+  K  C         H   +++R+RS VDL
Sbjct  510   ALGAEHLFYTPKGNEKYTRFCPREEVMESDFTKQFCNMRMDSHRCHGMHRLTRIRSFVDL  569

Query  1499  RSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSC  1612
             R Q   R+LVEE++KRR+FKTVGA+ENIG+ +P    C
Sbjct  570   RRQQQQRSLVEEIHKRRMFKTVGAIENIGFQDPEGDGC  607



>ref|XP_009354752.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Pyrus x bretschneideri]
Length=585

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/570 (59%), Positives = 403/570 (71%), Gaps = 49/570 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LGMEVAWNQ+KLN V RSPE+LQRLYSEV LL  L+H SI+RF+ SWID +
Sbjct  32    TVYKAIDELLGMEVAWNQVKLNEVLRSPEDLQRLYSEVHLLGTLNHDSIIRFYTSWIDIE  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNFITE+FTSGTLR+YR++Y  V+IRAIKNW  QIL GL +LH HDPPVIHRDLKCD
Sbjct  92    HKTFNFITEMFTSGTLRQYRKKYNQVDIRAIKNWACQILRGLVHLHGHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  152   NIFVNGHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC NPAQIYKKVT+GKLP AFYRI++ EAQRFVG+CL  ASKR SA EL
Sbjct  212   LEMLTSEYPYSECVNPAQIYKKVTAGKLPGAFYRIEDLEAQRFVGKCLVNASKRSSAKEL  271

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKS---------SDMTITGT  871
             +LDPFL   ++E           +P GKL   +P   D++ +          +DMTITG 
Sbjct  272   MLDPFLECGKDES----------LPLGKLGLPKPFLNDKEMEKLQLSDYPTRTDMTITGK  321

Query  872   LNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMI  1051
             LN EDDTIFL+VQI+DKDG  RNI+FPFD  +DT  +VATEMVKELEITDW P +IA MI
Sbjct  322   LNSEDDTIFLKVQIADKDGSLRNIYFPFDRLNDTPFDVATEMVKELEITDWEPFEIANMI  381

Query  1052  DEEISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLL  1231
             + EISAL P W+   Y   H+FNY     DD++ G     H + S S  S S       +
Sbjct  382   EGEISALAPDWKPEAY---HTFNY----QDDDDDGPHHPSHSYSSSSHSSLSGLISSHGI  434

Query  1232  EKINH--DWLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSI-GGRESLLIQKTNTG  1393
              ++ +  DW Q+   D+TSS+SS +S   SNL + + +E     I  G +   I K +  
Sbjct  435   NRMKNACDWFQDDLLDETSSQSSSHSGTYSNLSFISGNEHGTKMIPTGGDKHPISKCHKS  494

Query  1394  TRLCPE------TSRSNKKKGCC------GSNHQR----PKMSRVRSMVDLRSQLLHRTL  1525
             TR CPE       S + K  G C      GS  +R     K+ R RS+VD+RSQLLHR++
Sbjct  495   TRFCPEETSNAGQSIAKKYVGRCKALLASGSKDERIMDSRKLMRNRSLVDIRSQLLHRSV  554

Query  1526  VEEVNKRRLFKTVGAVENIGYHEPAEYSCK  1615
             VEEVN+RRLFKTVG V+ IG+  P + S K
Sbjct  555   VEEVNRRRLFKTVGDVKTIGFQAPCDVSKK  584



>ref|XP_008384673.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Malus 
domestica]
Length=575

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/559 (60%), Positives = 392/559 (70%), Gaps = 37/559 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LGMEVAWNQ+KLN V RSPE+LQRLYSEV LL  L+H SI+RF+ SWID +
Sbjct  32    TVYKAIDELLGMEVAWNQVKLNQVLRSPEDLQRLYSEVHLLSTLNHDSIIRFYTSWIDIE  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLREYR++Y  V+IRAIKNW RQIL GL YLH HDPPVIHRDLKCD
Sbjct  92    HRTFNFITEMFTSGTLREYRKKYNQVDIRAIKNWARQILRGLVYLHGHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF NGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELY+E+Y+ELVD+YSFGMCV
Sbjct  152   NIFXNGHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYDEDYNELVDVYSFGMCV  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC N AQIYKKVT+GKLP AFYRI++ EAQRFVG+CL  ASKR SA EL
Sbjct  212   LEMLTSEYPYSECVNAAQIYKKVTAGKLPGAFYRIEDLEAQRFVGKCLVNASKRLSAKEL  271

Query  719   LLDPFLAADEEEDES---AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDD  889
             LLDPFL  D  +DES    KL   K   N K  E+E   +      +DMTITG LN EDD
Sbjct  272   LLDPFL--DCGKDESLPLGKLGRPKPFLNDK--EMEKLQLSDHPTRTDMTITGKLNSEDD  327

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
             TIFL+VQI+DKDG  RNI+FPFD+ +DT  +VATEMVKELEITDW P +IA MI+ EISA
Sbjct  328   TIFLKVQIADKDGSLRNIYFPFDVLNDTPFDVATEMVKELEITDWEPFEIANMIEGEISA  387

Query  1070  LVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD  1249
             LVP W+   Y   H F Y        +        P  S S  SS  +    +  ++  D
Sbjct  388   LVPDWKPEAY---HXFKY-------QDDDKDGPHRPSNSHSYSSSRSSLSGLINSRVADD  437

Query  1250  WLQNDDTSSRSSMNSYDCSNLCWATESE-GDLSSIGGRESLLIQKTNTGTRLCPETSRSN  1426
              L  D+TSS+SS +S    N+ + + +E G      G +   I K +  TR CPE +R+ 
Sbjct  438   LL--DETSSQSSSHSVTSPNVSFISANEHGTKMFPAGGDKHPISKCHKSTRFCPEETRNA  495

Query  1427  KK-------KGC-----CGSNHQR----PKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFK  1558
              K       + C      GS  +R     K+ R RS+ D R QLLHR++VEEVN+ RLFK
Sbjct  496   GKSIAKKYFERCKAFLASGSKDKRIMDSRKLMRNRSLGDTRXQLLHRSVVEEVNRXRLFK  555

Query  1559  TVGAVENIGYHEPAEYSCK  1615
             TVGAVE IG+  P E S K
Sbjct  556   TVGAVETIGFQAPCEVSKK  574



>ref|XP_008463254.1| PREDICTED: probable serine/threonine-protein kinase WNK5 isoform 
X2 [Cucumis melo]
Length=597

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/579 (56%), Positives = 408/579 (70%), Gaps = 59/579 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+ FDEVLG+EVAWNQ+ L +VF SPEEL+RLYSEV LLK+L+H+SI+RF+ SWIDT 
Sbjct  31    TVYKGFDEVLGIEVAWNQVHLKDVFHSPEELERLYSEVHLLKNLNHNSIIRFYTSWIDTH  90

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQ+Y  ++I AIKNW RQIL GL YLH HDPPVIHRDLKCD
Sbjct  91    RRTFNFITEMFTSGTLREYRQKYQNIDIEAIKNWARQILHGLVYLHGHDPPVIHRDLKCD  150

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             N+F+NGHLGQVKIGDLGLA +L GS +AHSVIGTPEFMAPELY+EEY+ELVD+YSFGMC+
Sbjct  151   NVFINGHLGQVKIGDLGLATILHGSQNAHSVIGTPEFMAPELYDEEYNELVDVYSFGMCM  210

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +EMLT EYPY+EC+NPAQIYKKVTSGKLP AFY I + EAQRFV +CLE  SKR SA EL
Sbjct  211   IEMLTLEYPYNECSNPAQIYKKVTSGKLPNAFYEIKDLEAQRFVRKCLENVSKRVSAREL  270

Query  719   LLDPFLAADEEEDES--AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDT  892
             LL+PFLA     + S   +L S  L P   ++          A+ +D+ I+G++NP+DD+
Sbjct  271   LLEPFLAPSNSNNVSHNEELVSSSLSPEKSIM----------ARRTDLAISGSINPKDDS  320

Query  893   IFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELE-ITDWMPLDIAEMIDEEISA  1069
             IFL+VQI  K+GK++N++F FDI +DTA++VATEMVKELE I+DW PL+IA MI++EIS+
Sbjct  321   IFLKVQIKVKNGKSKNVYFAFDILNDTAIDVATEMVKELEIISDWDPLEIAVMIEKEISS  380

Query  1070  LVPTWRSTQYQKQH---SFNY------IddddddNNVGISTTRHPFYslssqsssqaslP  1222
             L+P W   ++ + H   SFNY       DD+DDD++     T HPFY   S   S +   
Sbjct  381   LIPDWEEWKFPEIHHQDSFNYEQDHNGNDDNDDDDDDENYATPHPFYYCGSSHGSSSDSL  440

Query  1223  D----LLEKINH-----------DWLQNDDTSSRSSMNSYDCSNLCWATESEGDL---SS  1348
                    E  NH           +W + DDTSS  S+NS+D S+L + +  E +    S+
Sbjct  441   HDFYPFRENPNHHFGGMDTSITTEWFREDDTSSCCSLNSFDYSDLSFYSNDEDEYEYDSN  500

Query  1349  IGGRESLLIQKTNTGTRLCPET----------------SRSNKKKGCCGSNHQRPKMSRV  1480
             I GRES  I  T   TR CP                  +R   + G   +N   P+++RV
Sbjct  501   IKGRESRYISTTKQPTRFCPTMKIDSHHLRHKDTRIIPNRETFENGSLSNN--SPRITRV  558

Query  1481  RSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             +SMV+LRS+ LHR LVE + K+RLF TVGA+ENIG+ +P
Sbjct  559   KSMVNLRSETLHRYLVETLLKKRLFNTVGAMENIGFQKP  597



>ref|XP_009603875.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Nicotiana tomentosiformis]
Length=634

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/581 (57%), Positives = 408/581 (70%), Gaps = 48/581 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRA DE+LGMEVAWNQIKLN++  SPE+++RLYSEV LL  L+H SIMRF+ SWID +
Sbjct  42    TVYRAIDELLGMEVAWNQIKLNDLLHSPEDMERLYSEVHLLSTLNHHSIMRFYTSWIDVE  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLR YR++Y  V+IRAIKNW RQILEGL YLH HDPPVIHRDLKCD
Sbjct  102   HRTFNFITEMFTSGTLRGYRKKYQRVDIRAIKNWARQILEGLVYLHEHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMC+
Sbjct  162   NIFVNGHLGQVKIGDLGLAAILRGSQRAHSVIGTPEFMAPELYEENYNELVDVYSFGMCM  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC NPAQIYKKVTSGK P AFY++ + +AQRF+ +CLEPASKR SA EL
Sbjct  222   LEMLTGEYPYSECVNPAQIYKKVTSGKRPRAFYKVQDLDAQRFIRKCLEPASKRLSAKEL  281

Query  719   LLDPFLAADEEEDESAKLPS-QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             ++DPFL  D  + +S  +   QK   N K + +E   +++ A  ++MTITG LNPEDDTI
Sbjct  282   MVDPFLVFDNVDGKSVTMMQLQKPFLNDK-IAIEDLHLNEDAPRTNMTITGKLNPEDDTI  340

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
              ++VQI+DK+G  RN++FPFDI +DT  EVA EMVKELEITDW P +IA MID EIS LV
Sbjct  341   LIKVQIADKEGDVRNVYFPFDIVTDTPTEVANEMVKELEITDWKPYEIANMIDGEISGLV  400

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD--  1249
             P W+     +   ++ +   DDDN+       +PF   SS SSSQ SL  LL     D  
Sbjct  401   PQWKKWNQFESADYHVLSYKDDDND-----HHNPFRGFSSCSSSQVSLSGLLSSQVIDTN  455

Query  1250  -----WLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGT-RL  1402
                  WL     DDTSS+SS +S + SN  + ++ E D  +   ++S      N  T R 
Sbjct  456   TNGPHWLHGDMFDDTSSQSSSHSANYSNFNYFSDDENDPVTTSTKQSQPATAINHHTSRF  515

Query  1403  CP-------------------------ETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQ  1507
             CP                          TS ++K+KG   +     +++R +S+VD+RSQ
Sbjct  516   CPGENSSTGQSLARMCYKQCKDMLELKRTSSTSKEKGKVDTR----RLTRNKSLVDMRSQ  571

Query  1508  LLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSCKGNRSF  1630
             LLH+TLVEEV+KRRLFKTVGAVENIG+ +P E S +  +S 
Sbjct  572   LLHKTLVEEVHKRRLFKTVGAVENIGFQQPYEDSRRSPQSM  612



>ref|XP_006595485.1| PREDICTED: with no lysine kinase 13 isoform X1 [Glycine max]
Length=607

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/565 (59%), Positives = 400/565 (71%), Gaps = 37/565 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++LN V R+P++LQRLYSEV LL  L H SI+RF+ SWID D
Sbjct  29    TVYKAIDEVLGIEVAWNQVRLNEVLRTPDDLQRLYSEVHLLSTLKHQSILRFYTSWIDID  88

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R FNFITE FTSG+LREYR+ Y  V+I+AIKNW RQIL+GL YLH HDPPVIHRDLKCD
Sbjct  89    SRAFNFITEFFTSGSLREYRKNYKRVSIQAIKNWARQILQGLVYLHCHDPPVIHRDLKCD  148

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+L GS  AHSVIGTPEFMAPELYEEEY+EL D+YSFGMCV
Sbjct  149   NIFVNGHLGQVKIGDLGLAAILHGSQLAHSVIGTPEFMAPELYEEEYNELADVYSFGMCV  208

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AF+RI++ EAQRF+G+CL PA KRPSA EL
Sbjct  209   LEMLTSEYPYSECSNPAQIYKKVTSGKLPMAFFRIEDMEAQRFIGKCLVPAEKRPSAKEL  268

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LLDPFL +D+    + K   QK  P   + E+E   +      + M + G LNPE+DTIF
Sbjct  269   LLDPFLVSDDPS-STMKFAIQK--PFLNVNEMEKLQLSDDLPRTGMKVIGKLNPENDTIF  325

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQISDKDG  RN+FFPFDI SDT ++VATEMVKELEI D  P +IA MID EISAL+P
Sbjct  326   LKVQISDKDGSVRNVFFPFDILSDTPIDVATEMVKELEIEDGEPYEIANMIDREISALLP  385

Query  1079  TWRSTQYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK-----I  1240
               R +      H+FNY+DDD DD+            S SS SS Q S+ DL+ K      
Sbjct  386   HRRQSSCSDAFHTFNYLDDDCDDDGPHHHFR-----SFSSSSSFQESMSDLVSKGEEISS  440

Query  1241  NHDWLQN---DDTSSR-SSMNSYDCSNLCWAT---ESEGDLSSIGGRESLLIQKTNTGTR  1399
              + WL +   DDTSSR SS  +Y  SNL + +     E ++ S+   +  +    N G +
Sbjct  441   GYYWLHDDLHDDTSSRCSSQGTY--SNLNYYSVDDHQEYNVPSLRKDKLPITTSHNKGKK  498

Query  1400  LCPETSRSNKKKGCCGSNHQRP-------------KMSRVRSMVDLRSQLLHRTLVEEVN  1540
             +      SN  +G      Q P             +++R RS++D+RSQLLHR+LVEEVN
Sbjct  499   ISTGEDLSNFNQGKLMVGSQVPLTSKSKMMINNHHRLTRNRSLIDIRSQLLHRSLVEEVN  558

Query  1541  KRRLFKTVGAVENIGYHEPAEYSCK  1615
             KRRLFKTVGAVENIG+  P + + K
Sbjct  559   KRRLFKTVGAVENIGFQAPCDVTTK  583



>ref|XP_008465303.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Cucumis 
melo]
Length=645

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/567 (57%), Positives = 392/567 (69%), Gaps = 38/567 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE LG+EVAW+Q+KLN V RSPE+L+RLYSEV LL  L H SIMRF+ SWID D
Sbjct  46    TVYKAIDEFLGIEVAWSQVKLNEVLRSPEDLERLYSEVHLLSTLKHESIMRFYTSWIDVD  105

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNFITELFTSGTLREY ++Y  V+IRAIK+W RQIL+GL YLH HDPP+IHRDLKCD
Sbjct  106   HKTFNFITELFTSGTLREYGKKYRRVDIRAIKSWARQILQGLIYLHEHDPPIIHRDLKCD  165

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+L GS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMCV
Sbjct  166   NIFVNGHLGQVKIGDLGLAAILHGSRSAHSVIGTPEFMAPELYEENYNELVDVYSFGMCV  225

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLPAA Y+I + +AQRF+ +CL P S R SA EL
Sbjct  226   LEMLTSEYPYSECSNPAQIYKKVTSGKLPAALYKIQDVDAQRFIKKCLVPVSMRASAKEL  285

Query  719   LLDPFLAADEEEDES-AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             L DPFL  D     S  +  +QK   N K  E+E   + +    ++MTITG LNPEDDT+
Sbjct  286   LADPFLKVDGNRPSSVGRTQNQKPFLNAK--EMENFHLGEGLSRTNMTITGKLNPEDDTL  343

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FLRVQ +DKDG  RNI+FPFDI +DTA++VA EMVKELEI+DW P +IA+MI+ EISALV
Sbjct  344   FLRVQTADKDGSLRNIYFPFDIVNDTALDVAMEMVKELEISDWEPFEIADMIEGEISALV  403

Query  1076  PTW-RSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH--  1246
             P W RS       SF+Y    ++D+NV   T R    S  + +    S P   + I++  
Sbjct  404   PNWNRSELTNHSLSFSY---AEEDDNVSHHTFRSVSSSSQATTLGLISSPRTNQNISNGF  460

Query  1247  -----DWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPE  1411
                  D L +  +   S    Y   N   + E E  +SS+   +   I K +  +R CP 
Sbjct  461   SWFPDDTLDDSSSQCSSVSGKYSNLNYISSEEYETSMSSVLIDQHNNINKIHNSSRFCPI  520

Query  1412  TSRSNK--------KKGCC---GSNHQRP------------KMSRVRSMVDLRSQLLHRT  1522
              +R NK        K+  C   GS+                K++R RS+VD+ SQLLHR+
Sbjct  521   ENRKNKDFLAQLLYKQSQCAIAGSSQGVASCRKDKRGTDGRKLTRNRSLVDVHSQLLHRS  580

Query  1523  LVEEVNKRRLFKTVGAVENIGYHEPAE  1603
             LVEEVN+RRLFKTVGAVE+IG+  P E
Sbjct  581   LVEEVNRRRLFKTVGAVESIGFQAPCE  607



>gb|KHN43739.1| Putative serine/threonine-protein kinase WNK5 [Glycine soja]
Length=617

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/585 (59%), Positives = 415/585 (71%), Gaps = 55/585 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VYRAFDEVLG EVAWNQ+KL +VF SP+ L RLYSEV LLK+L+H SIM FH SWID  
Sbjct  37    VVYRAFDEVLGREVAWNQVKLGDVFHSPDLLPRLYSEVHLLKNLEHDSIMTFHDSWIDVH  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITELFTSGTLREYR++Y  V+IRA+KNW RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    CRTFNFITELFTSGTLREYRKKYQRVDIRAVKNWARQILSGLEYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIG-------TPEFMAPelyeeeydelvdI  517
             NIF+NGHLGQVKIGDLGLAA+LRGS HAHSVIG       TPEFMAPELYEEEY+ELVDI
Sbjct  157   NIFINGHLGQVKIGDLGLAAILRGSQHAHSVIGNSSCSFSTPEFMAPELYEEEYNELVDI  216

Query  518   YSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASK  697
             YSFGMC++E+ TSE+PYSEC+NPAQIYKKVTSGKLP A+YRI + EAQ+FVG+CL   S+
Sbjct  217   YSFGMCMIEIFTSEFPYSECSNPAQIYKKVTSGKLPEAYYRIHDLEAQKFVGKCLANVSE  276

Query  698   RPSAHELLLDPFLAADEEED--ESAKLPSQK---LIPNGKLLEVEPCFVDQQAKSSDMTI  862
             R SA ELLLDPFLA ++ +    S  LP ++   L     L +  P     Q K + MTI
Sbjct  277   RLSAKELLLDPFLATEQLDSPLPSPTLPKKQTPTLNFTALLAKELPPPKSNQTKDTHMTI  336

Query  863   TGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIA  1042
             TG++N E+DT+FL+VQIS+K+G+ RNIFFPFD  +DTA++VA EMVKELEI+D  PL+IA
Sbjct  337   TGSMNEENDTVFLKVQISNKNGQKRNIFFPFDTINDTAIDVAMEMVKELEISDLEPLEIA  396

Query  1043  EMIDEEISALVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqa  1213
             EMI+EEISALVPTWR   S +YQKQHSF+Y ++ D  N+       HPF+S +S+SSS A
Sbjct  397   EMIEEEISALVPTWRDWGSAKYQKQHSFSYEEEYDMSNH-------HPFFSPTSRSSSHA  449

Query  1214  slPDL---------LEKINH-----DWLQ-----NDDTSSRSSMNSYDCSNL-CW--ATE  1327
             SLP             + NH     DW Q     NDD SS+SSMNS+ C NL C     E
Sbjct  450   SLPVFGSSSYKNSSHHRENHYPFAQDWPQDELFMNDDASSQSSMNSFKCFNLNCCDPGNE  509

Query  1328  SEGDLSSIGGRESLLI--QKTNTGTRLCP--ETSRSNKKKGCCGSN------HQRPKMSR  1477
              E D +   G E L    +     TR CP  E   S+  K  C         H   +++R
Sbjct  510   DEHDPTLALGAEHLFYTPKGNEKYTRFCPREEVMESDFTKQFCNMRMDSHRCHGMHRLTR  569

Query  1478  VRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSC  1612
             +RS VDLR Q   R+LVEE++KRR+FKTVGA+ENIG+ +P    C
Sbjct  570   IRSFVDLRRQQQQRSLVEEIHKRRMFKTVGAIENIGFQDPEGDGC  614



>gb|ABY52426.1| NN mitogen-activated protein kinase [Nicotiana tabacum]
Length=634

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/581 (57%), Positives = 407/581 (70%), Gaps = 48/581 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRA DE+LGMEVAWNQIKLN++  SPE+++RLYSEV LL  L+H SIMRF+ SWID +
Sbjct  42    TVYRAIDELLGMEVAWNQIKLNDLLHSPEDMERLYSEVHLLSTLNHHSIMRFYTSWIDVE  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLR YR++Y  V+IRAIKNW RQILEGL YLH HDPPVIHRDLKCD
Sbjct  102   HRTFNFITEMFTSGTLRGYRKKYQRVDIRAIKNWARQILEGLVYLHEHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMC+
Sbjct  162   NIFVNGHLGQVKIGDLGLAAILRGSQRAHSVIGTPEFMAPELYEENYNELVDVYSFGMCM  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC NPAQIYKKVTSGK P AFY++ + +AQRF+ +CLEPASKR SA EL
Sbjct  222   LEMLTGEYPYSECVNPAQIYKKVTSGKRPRAFYKVQDLDAQRFIRKCLEPASKRLSAKEL  281

Query  719   LLDPFLAADEEEDESAKLPS-QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             ++DPFL  +  + +S  +   QK   N K + +E   +++ A  ++MTITG LNPEDDTI
Sbjct  282   MVDPFLVFNNVDGKSVTMMQLQKPFLNDK-IAIEDLHLNEDAPRTNMTITGKLNPEDDTI  340

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
              ++VQI+DK G  RN++FPFDI +DT  EVA EMVKELEITDW P +IA MID EIS LV
Sbjct  341   LIKVQIADKKGDVRNVYFPFDIVTDTPTEVANEMVKELEITDWKPYEIANMIDGEISGLV  400

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD--  1249
             P W+     +   ++ +   DDDN+       +PF   SS SSSQ SL  LL     D  
Sbjct  401   PQWKKWNQFESADYHVLSYKDDDND-----HHNPFRGFSSCSSSQVSLSGLLSSQVIDTN  455

Query  1250  -----WLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGT-RL  1402
                  WL     DDTSS+SS +S + SN  + ++ E D  +   ++S      N  T R 
Sbjct  456   TNGPHWLHGDMFDDTSSQSSSHSANYSNFNYFSDDENDPVTTSTKQSQPATAINHHTSRF  515

Query  1403  CP-------------------------ETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQ  1507
             CP                          TS ++K+KG   +     +++R +S+VD+RSQ
Sbjct  516   CPGENSSTGQSLARMCYKQCKDMLELKRTSSTSKEKGKVDTR----RLTRNKSLVDMRSQ  571

Query  1508  LLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSCKGNRSF  1630
             LLH+TLVEEV+KRRLFKTVGAVENIG+ +P E S +  +S 
Sbjct  572   LLHKTLVEEVHKRRLFKTVGAVENIGFQQPYEDSRRSPQSM  612



>ref|XP_004172723.1| PREDICTED: probable serine/threonine-protein kinase WNK5-like, 
partial [Cucumis sativus]
Length=579

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/578 (55%), Positives = 403/578 (70%), Gaps = 56/578 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+ FDEVLG+EVAWNQ+ L +VF SPEELQRLYSEV LLK+L+H SI+RF+  WIDT 
Sbjct  12    TVYKGFDEVLGIEVAWNQVHLKDVFHSPEELQRLYSEVHLLKNLNHDSIIRFYTYWIDTH  71

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQ+Y  ++I AIKNW RQIL GL YLH HDPP+IHRDLKCD
Sbjct  72    RRTFNFITEMFTSGTLREYRQKYRNIDIEAIKNWARQILHGLVYLHGHDPPIIHRDLKCD  131

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             N+F+NGHLGQVKIGDLGLAA+L  S HAHSVIGTPEFMAPELY+EEY+ELVD+YSFGMC+
Sbjct  132   NVFINGHLGQVKIGDLGLAAILHDSQHAHSVIGTPEFMAPELYDEEYNELVDVYSFGMCM  191

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +EMLT EYPYSEC+NPAQIYKKVTSGKLP AFY I + EAQRFV +CLE  SKR SA EL
Sbjct  192   IEMLTLEYPYSECSNPAQIYKKVTSGKLPNAFYEIKDLEAQRFVRKCLENVSKRVSAREL  251

Query  719   LLDPFLAADEEEDES--AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDT  892
             LLDPFLA       S   +L S  L P   ++          A+ +D+ I+G++NP+DD+
Sbjct  252   LLDPFLAPSNANHASHNEELLSSSLSPEKSIM----------ARRTDLAISGSINPKDDS  301

Query  893   IFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELE-ITDWMPLDIAEMIDEEISA  1069
             IFL+VQI  K+GK++N++F FDI +DT ++VATEMVKELE I+DW PL+IA MI++EIS+
Sbjct  302   IFLKVQIKVKNGKSKNVYFAFDILNDTTIDVATEMVKELEIISDWDPLEIAVMIEKEISS  361

Query  1070  LVP---TWRSTQYQKQHSFNY------IddddddNNVGISTTRHPFYslssqsssqaslP  1222
             L+P    W+  + Q Q SFNY       +D+D+D++     T HPFY   S   S +   
Sbjct  362   LIPDWEEWKLPKIQHQDSFNYEQDHDGDNDNDNDDDDENYATPHPFYYCGSSHGSSSDSL  421

Query  1223  DLL----EKINH------------DWLQNDDTSSRSSMNSYDCSNLCWATESEGDL---S  1345
                    E  NH            +W + DDTSS  S+NS++ S+L + + +E +    S
Sbjct  422   HAFYSSRENPNHYFGGMKDTSNTTEWFREDDTSSCCSLNSFNYSDLSFYSNNEDEYEYDS  481

Query  1346  SIGGRESLLIQKTNTGTRLCP----ETSRSNKKKGCCGSNHQ----------RPKMSRVR  1483
             +I GRE   +  T   TR CP    ++     K      N +           P+++RV+
Sbjct  482   NIKGREPQYVSTTKQPTRFCPTMKIDSHHLRHKDNKIIPNREVFESRSRSNNSPRLTRVK  541

Query  1484  SMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             SMV+LRS+ LHR LVE + K+RLF TVGA+ENIGY +P
Sbjct  542   SMVNLRSETLHRYLVEMLLKKRLFNTVGAMENIGYQKP  579



>gb|KGN54444.1| hypothetical protein Csa_4G332110 [Cucumis sativus]
Length=598

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/578 (55%), Positives = 403/578 (70%), Gaps = 56/578 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+ FDEVLG+EVAWNQ+ L +VF SPEELQRLYSEV LLK+L+H SI+RF+  WIDT 
Sbjct  31    TVYKGFDEVLGIEVAWNQVHLKDVFHSPEELQRLYSEVHLLKNLNHDSIIRFYTYWIDTH  90

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQ+Y  ++I AIKNW RQIL GL YLH HDPP+IHRDLKCD
Sbjct  91    RRTFNFITEMFTSGTLREYRQKYRNIDIEAIKNWARQILHGLVYLHGHDPPIIHRDLKCD  150

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             N+F+NGHLGQVKIGDLGLAA+L  S HAHSVIGTPEFMAPELY+EEY+ELVD+YSFGMC+
Sbjct  151   NVFINGHLGQVKIGDLGLAAILHDSQHAHSVIGTPEFMAPELYDEEYNELVDVYSFGMCM  210

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +EMLT EYPYSEC NPAQIYKKVTSGKLP AFY I + EAQRFV +CLE  SKR SA EL
Sbjct  211   IEMLTLEYPYSECFNPAQIYKKVTSGKLPNAFYEIKDLEAQRFVRKCLENVSKRVSAREL  270

Query  719   LLDPFLAADEEEDES--AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDT  892
             LLDPFLA     + S   +L S  L P   ++          A+ +D+ I+G++NP+DD+
Sbjct  271   LLDPFLAPSNANNASHNEELLSSSLSPEKSIM----------ARRTDLAISGSINPKDDS  320

Query  893   IFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELE-ITDWMPLDIAEMIDEEISA  1069
             IFL+VQI  K+GK++N++F FDI +DT ++VATEMVKELE I+DW PL+IA MI++EIS+
Sbjct  321   IFLKVQIKVKNGKSKNVYFAFDILNDTTIDVATEMVKELEIISDWDPLEIAVMIEKEISS  380

Query  1070  LVP---TWRSTQYQKQHSFNY------IddddddNNVGISTTRHPFYslssqsssqaslP  1222
             L+P    W+  + Q Q SFNY       +D+D+D++     T HPFY   S   S +   
Sbjct  381   LIPDWEEWKLPKIQHQDSFNYEQDHDGDNDNDNDDDDENYATPHPFYYCGSSHGSSSDSL  440

Query  1223  DLL----EKINH------------DWLQNDDTSSRSSMNSYDCSNLCWATESEGDL---S  1345
                    E  NH            +W + DDTSS  S+NS++ S+L + + +E +    S
Sbjct  441   HAFYSSRENPNHYFGGMKDTSNTTEWFREDDTSSCCSLNSFNYSDLSFYSNNEDEYEYDS  500

Query  1346  SIGGRESLLIQKTNTGTRLCP----ETSRSNKKKGCCGSNHQ----------RPKMSRVR  1483
             +I GRE   +  T   TR CP    ++     K      N +           P+++RV+
Sbjct  501   NIKGREPQYVSTTKQPTRFCPTMKIDSHHLRHKDNKIIPNREVFESRSRSNNSPRLTRVK  560

Query  1484  SMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             SMV+LRS+ LHR LVE + K+RLF TVGA+ENIGY +P
Sbjct  561   SMVNLRSETLHRYLVEMLLKKRLFNTVGAMENIGYQKP  598



>ref|XP_009603876.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Nicotiana tomentosiformis]
Length=615

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/572 (57%), Positives = 401/572 (70%), Gaps = 49/572 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRA DE+LGMEVAWNQIKLN++  SPE+++RLYSEV LL  L+H SIMRF+ SWID +
Sbjct  42    TVYRAIDELLGMEVAWNQIKLNDLLHSPEDMERLYSEVHLLSTLNHHSIMRFYTSWIDVE  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLR YR++Y  V+IRAIKNW RQILEGL YLH HDPPVIHRDLKCD
Sbjct  102   HRTFNFITEMFTSGTLRGYRKKYQRVDIRAIKNWARQILEGLVYLHEHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMC+
Sbjct  162   NIFVNGHLGQVKIGDLGLAAILRGSQRAHSVIGTPEFMAPELYEENYNELVDVYSFGMCM  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC NPAQIYKKVTSGK P AFY++ + +AQRF+ +CLEPASKR SA EL
Sbjct  222   LEMLTGEYPYSECVNPAQIYKKVTSGKRPRAFYKVQDLDAQRFIRKCLEPASKRLSAKEL  281

Query  719   LLDPFLAADEEEDESAKLPS-QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             ++DPFL  D  + +S  +   QK   N K + +E   +++ A  ++MTITG LNPEDDTI
Sbjct  282   MVDPFLVFDNVDGKSVTMMQLQKPFLNDK-IAIEDLHLNEDAPRTNMTITGKLNPEDDTI  340

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
              ++VQI+DK+G  RN++FPFDI +DT  EVA EMVKELEITDW P +IA MID EIS LV
Sbjct  341   LIKVQIADKEGDVRNVYFPFDIVTDTPTEVANEMVKELEITDWKPYEIANMIDGEISGLV  400

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYs-lssqsssqaslPDLLEKINHDW  1252
             P W+     +   ++ +   DDDN+       +PF    S  SS  +   D+        
Sbjct  401   PQWKKWNQFESADYHVLSYKDDDND-----HHNPFRGFSSCSSSQVSLSGDMF-------  448

Query  1253  LQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGT-RLCP-------  1408
                DDTSS+SS +S + SN  + ++ E D  +   ++S      N  T R CP       
Sbjct  449   ---DDTSSQSSSHSANYSNFNYFSDDENDPVTTSTKQSQPATAINHHTSRFCPGENSSTG  505

Query  1409  ------------------ETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEE  1534
                                TS ++K+KG   +     +++R +S+VD+RSQLLH+TLVEE
Sbjct  506   QSLARMCYKQCKDMLELKRTSSTSKEKGKVDTR----RLTRNKSLVDMRSQLLHKTLVEE  561

Query  1535  VNKRRLFKTVGAVENIGYHEPAEYSCKGNRSF  1630
             V+KRRLFKTVGAVENIG+ +P E S +  +S 
Sbjct  562   VHKRRLFKTVGAVENIGFQQPYEDSRRSPQSM  593



>ref|XP_006350878.1| PREDICTED: probable serine/threonine-protein kinase WNK4-like 
[Solanum tuberosum]
Length=635

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/576 (56%), Positives = 399/576 (69%), Gaps = 38/576 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRA DE+LGMEVAW+QI+LN++ +SPE+++RLYSEV LL  L+H SIM+F+ SWID +
Sbjct  43    TVYRAIDELLGMEVAWSQIRLNDLLQSPEDIERLYSEVHLLSTLNHPSIMKFYTSWIDIE  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +RTFNFITELFTSGTLR YR +Y  VNIRA+K W  QILEGL YLH HDPPVIHRDLKCD
Sbjct  103   KRTFNFITELFTSGTLRGYRNKYHRVNIRAVKIWAHQILEGLVYLHEHDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELY+E YDELVD+YSFGMC+
Sbjct  163   NIFVNGHLGQVKIGDLGLAAILRGSQRAHSVIGTPEFMAPELYDENYDELVDVYSFGMCM  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC NPAQIYKKV SGK P AFY++ + +AQRF+ +CLEPAS R SA EL
Sbjct  223   LEMLTGEYPYSECVNPAQIYKKVISGKRPRAFYKVQDLDAQRFIRKCLEPASNRSSAKEL  282

Query  719   LLDPFLAADEEEDESAKLPS-QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             +LDPFL  D+ + ES  +   QK I N K+  +E   +++    ++MTITG LNPEDDTI
Sbjct  283   MLDPFLVIDDADSESVTMMRLQKPILNDKIA-IEDLHLNEDVPRTNMTITGKLNPEDDTI  341

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+DK+G  R+++FPFD  +DT  EVA EMVKELEITDW P +IA MID EIS LV
Sbjct  342   FLKVQIADKEGGVRHVYFPFDTVTDTPTEVANEMVKELEITDWKPCEIANMIDGEISGLV  401

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD--  1249
             P W+     +   ++ +   DDDN+           S S  S S      +++   +D  
Sbjct  402   PQWKKWNQFESSDYHVLSYKDDDNDRHNPFQGFSSSSSSQVSLSGLLSSQVIDTNTNDRR  461

Query  1250  WLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGT-RLCPE--  1411
             WL     DDTSS+ S +S + SN  + ++ E D  +   R+S      +  T R CPE  
Sbjct  462   WLHGDMFDDTSSQCSSHSANYSNFNYFSDDENDPVTTSTRQSQPATAISHHTSRFCPEEN  521

Query  1412  -----------------------TSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRT  1522
                                    TS ++K KG    N    +++R +S+VD+RSQLLH++
Sbjct  522   SSTGQSLARTCYKQCKAMLESKGTSSTSKGKG----NDDTRRLTRNKSLVDMRSQLLHKS  577

Query  1523  LVEEVNKRRLFKTVGAVENIGYHEPAEYSCKGNRSF  1630
             LVEEV+KRRLFKTVGAVENIG+ +P E   +  RS 
Sbjct  578   LVEEVHKRRLFKTVGAVENIGFQQPYEDLKRSPRSM  613



>ref|XP_004142734.1| PREDICTED: probable serine/threonine-protein kinase WNK5-like 
[Cucumis sativus]
Length=598

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/578 (55%), Positives = 403/578 (70%), Gaps = 56/578 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+ FDEVLG+EVAWNQ+ L +VF SPEELQRLYSEV LLK+L+H SI+RF+  WIDT 
Sbjct  31    TVYKGFDEVLGIEVAWNQVHLKDVFHSPEELQRLYSEVHLLKNLNHDSIIRFYTYWIDTH  90

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQ+Y  ++I AIKNW RQIL GL YLH HDPP+IHRDLKCD
Sbjct  91    RRTFNFITEMFTSGTLREYRQKYRNIDIEAIKNWARQILHGLVYLHGHDPPIIHRDLKCD  150

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             N+F+NGHLGQVKIGDLGLAA+L  S HAHSVIGTPEFMAPELY+EEY+ELVD+YSFGMC+
Sbjct  151   NVFINGHLGQVKIGDLGLAAILHDSQHAHSVIGTPEFMAPELYDEEYNELVDVYSFGMCM  210

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +EMLT EYPYSEC NPAQIYKKVTSGKLP AFY I + EAQRFV +CLE  SKR SA EL
Sbjct  211   IEMLTLEYPYSECFNPAQIYKKVTSGKLPNAFYEIKDLEAQRFVRKCLENVSKRVSAREL  270

Query  719   LLDPFLAADEEEDES--AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDT  892
             LLDPFLA     + S   +L S  L P   ++          A+ +D+ I+G++NP+DD+
Sbjct  271   LLDPFLAPSNANNASHNEELLSSSLSPEKSIM----------ARRTDLAISGSINPKDDS  320

Query  893   IFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELE-ITDWMPLDIAEMIDEEISA  1069
             IFL+VQI  K+GK++N++F FDI +DT ++VATEMVKELE I+DW PL+IA MI++EIS+
Sbjct  321   IFLKVQIKVKNGKSKNVYFAFDILNDTTIDVATEMVKELEIISDWDPLEIAVMIEKEISS  380

Query  1070  LVP---TWRSTQYQKQHSFNY------IddddddNNVGISTTRHPFYslssqsssqaslP  1222
             L+P    W+  + Q Q SFNY       +D+D+D++     T HPFY   S   S +   
Sbjct  381   LIPDWEEWKLPKIQHQDSFNYEQDHDGDNDNDNDDDDENYATPHPFYYCGSSHGSSSDSL  440

Query  1223  DLL----EKINH------------DWLQNDDTSSRSSMNSYDCSNLCWATESEGDL---S  1345
                    E  NH            +W + DDTSS  S+NS++ S+L + + +E +    S
Sbjct  441   HAFYSSRENPNHYFGGMKDTSNTTEWFREDDTSSCCSLNSFNYSDLSFYSNNEDEYEYDS  500

Query  1346  SIGGRESLLIQKTNTGTRLCP----ETSRSNKKKGCCGSNHQ----------RPKMSRVR  1483
             +I GRE   +  T   TR CP    ++     K      N +           P+++RV+
Sbjct  501   NIKGREPQYVSTTKQPTRFCPTMKIDSHHLRHKDNKIIPNREVFESRSRSNNSPRLTRVK  560

Query  1484  SMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             SMV+LRS+ LHR LVE + K+RLF TVGA+ENIGY +P
Sbjct  561   SMVNLRSETLHRYLVEMLLKKRLFNTVGAMENIGYKKP  598



>ref|XP_004149364.1| PREDICTED: probable serine/threonine-protein kinase WNK4-like 
[Cucumis sativus]
 gb|KGN47215.1| hypothetical protein Csa_6G212860 [Cucumis sativus]
Length=645

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/566 (57%), Positives = 392/566 (69%), Gaps = 36/566 (6%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE LG+EVAW+Q+KLN V RSPE+LQRLYSEV LL  L H SIMRF+ SWID D
Sbjct  46    TVYKAIDEFLGIEVAWSQVKLNEVLRSPEDLQRLYSEVHLLSTLKHESIMRFYTSWIDVD  105

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             ++TFNFITELFTSGTLREY ++Y  V+IRAIK+W RQIL+GL YLH HDPP+IHRDLKCD
Sbjct  106   KKTFNFITELFTSGTLREYGKKYRRVDIRAIKSWARQILQGLIYLHEHDPPIIHRDLKCD  165

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+L GS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMCV
Sbjct  166   NIFVNGHLGQVKIGDLGLAAILHGSRSAHSVIGTPEFMAPELYEENYNELVDVYSFGMCV  225

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLPAA Y+I + +AQRF+ +CL P S R SA EL
Sbjct  226   LEMLTSEYPYSECSNPAQIYKKVTSGKLPAALYKIQDVDAQRFIKKCLVPVSMRASAKEL  285

Query  719   LLDPFLAADEEEDES-AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             L D FL  D     S  +  +QK   N K  E+E   + +    ++MTITG LNPEDDT+
Sbjct  286   LADSFLKVDGNRPSSVGRTQNQKPFLNAK--EMENFHLSEGLSRTNMTITGKLNPEDDTL  343

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FLRVQ +DKDG  RNI+FPFDI +DTA++VA EMVKELEI+DW P +IA+MI+ EISALV
Sbjct  344   FLRVQTADKDGSLRNIYFPFDIVNDTALDVAMEMVKELEISDWEPFEIADMIEGEISALV  403

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH---  1246
             P W  ++    HS  +    ++D+NV   T R    S  + +    S P   + I++   
Sbjct  404   PNWNRSEL-TNHSLGF-SCAEEDDNVSHHTFRSISSSSQATTLGLISSPRTNQNISNGFS  461

Query  1247  ----DWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPET  1414
                 D L +  +   S+   Y   N   + E E  +SS+   +   I K +  +R CP  
Sbjct  462   WFPDDTLDDSSSQCSSASGKYSNLNYISSDEYETSMSSVQTDQHNNINKIHNSSRFCPIE  521

Query  1415  SRSNK--------KKGCC---GSNHQRP------------KMSRVRSMVDLRSQLLHRTL  1525
             +R +K        K+  C   GS+                K++R RS+VD+ SQLLHR+L
Sbjct  522   NRKSKDFLAQLLYKQSQCAIAGSSQGVASGRKDKKGTDGRKLTRNRSLVDVHSQLLHRSL  581

Query  1526  VEEVNKRRLFKTVGAVENIGYHEPAE  1603
             VEEVN+RRLFKTVGAVE+IG+  P E
Sbjct  582   VEEVNRRRLFKTVGAVESIGFQAPCE  607



>ref|XP_009757969.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Nicotiana sylvestris]
Length=634

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/577 (57%), Positives = 406/577 (70%), Gaps = 40/577 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRA DE+LGME+AWNQIKLN++  SPE+++RLYSEV LL  L+H SIMRF+ SWID +
Sbjct  42    TVYRAIDELLGMEMAWNQIKLNDLLHSPEDMERLYSEVHLLSTLNHHSIMRFYTSWIDVE  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLR YR++Y  V+IRAIKNW RQILEGL YLH HDPPVIHRDLKCD
Sbjct  102   HRTFNFITEMFTSGTLRGYRKKYQRVDIRAIKNWARQILEGLVYLHEHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVK+GDLGLAA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMC+
Sbjct  162   NIFVNGHLGQVKVGDLGLAAILRGSQRAHSVIGTPEFMAPELYEENYNELVDVYSFGMCM  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC NPAQIYKKVTSGK P AFY++ + +AQRF+ +CLEPASKR SA EL
Sbjct  222   LEMLTGEYPYSECVNPAQIYKKVTSGKRPRAFYKVQDLDAQRFIRKCLEPASKRLSAKEL  281

Query  719   LLDPFLAADEEEDESAKLPS-QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             ++DPFLA D  + +S  +   QK   N K + +E   ++  A  ++MTITG LNPEDDTI
Sbjct  282   MVDPFLALDNIDGKSVTMMQLQKPFLNDK-IAIEDLHLNDDAPRTNMTITGKLNPEDDTI  340

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
              ++VQI+D +G  RN++FPFDI +DT  EVA EMVKEL+ITDW P +IA MID EIS LV
Sbjct  341   LIKVQIADNEGDVRNVYFPFDIVTDTPTEVANEMVKELDITDWKPHEIANMIDGEISGLV  400

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD--  1249
             P W+     +   +  +   DDDN+       +PF   SS SSSQ SL  LL     D  
Sbjct  401   PQWKKWNQFESADYQVLSYKDDDND-----HHNPFQGFSSCSSSQVSLSGLLSSQVIDTN  455

Query  1250  -----WLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGT-RL  1402
                  WL     DDTSS+SS +S + SN  + ++ E D  +   ++S      +  T R 
Sbjct  456   TNDPHWLHGDMFDDTSSQSSSHSANYSNFNYFSDDENDPVTTSTKQSQPATAISHHTSRF  515

Query  1403  CPETSRSN----------------KKKGCCGSNHQRPK-----MSRVRSMVDLRSQLLHR  1519
             CP  + S                 K KG   ++ ++ K     ++R +S+VD+RSQLLH+
Sbjct  516   CPGENSSTGQSLAKMCYKQCKDMLKLKGTSSTSKEKDKVDARRLTRNKSLVDMRSQLLHK  575

Query  1520  TLVEEVNKRRLFKTVGAVENIGYHEPAEYSCKGNRSF  1630
             TLVEEV+KRRLFKTVGAVENIG+ +P E S +  +S 
Sbjct  576   TLVEEVHKRRLFKTVGAVENIGFQQPYEDSRRSPQSM  612



>ref|XP_008463253.1| PREDICTED: probable serine/threonine-protein kinase WNK5 isoform 
X1 [Cucumis melo]
Length=600

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/582 (55%), Positives = 408/582 (70%), Gaps = 62/582 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+ FDEVLG+EVAWNQ+ L +VF SPEEL+RLYSEV LLK+L+H+SI+RF+ SWIDT 
Sbjct  31    TVYKGFDEVLGIEVAWNQVHLKDVFHSPEELERLYSEVHLLKNLNHNSIIRFYTSWIDTH  90

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQ+Y  ++I AIKNW RQIL GL YLH HDPPVIHRDLKCD
Sbjct  91    RRTFNFITEMFTSGTLREYRQKYQNIDIEAIKNWARQILHGLVYLHGHDPPVIHRDLKCD  150

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             N+F+NGHLGQVKIGDLGLA +L GS +AHSVIGTPEFMAPELY+EEY+ELVD+YSFGMC+
Sbjct  151   NVFINGHLGQVKIGDLGLATILHGSQNAHSVIGTPEFMAPELYDEEYNELVDVYSFGMCM  210

Query  539   LEMLTSEYPYSECTNPAQIYKKVTS---GKLPAAFYRIDNAEAQRFVGRCLEPASKRPSA  709
             +EMLT EYPY+EC+NPAQIYKKVTS   GKLP AFY I + EAQRFV +CLE  SKR SA
Sbjct  211   IEMLTLEYPYNECSNPAQIYKKVTSKLQGKLPNAFYEIKDLEAQRFVRKCLENVSKRVSA  270

Query  710   HELLLDPFLAADEEEDES--AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPE  883
              ELLL+PFLA     + S   +L S  L P   ++          A+ +D+ I+G++NP+
Sbjct  271   RELLLEPFLAPSNSNNVSHNEELVSSSLSPEKSIM----------ARRTDLAISGSINPK  320

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELE-ITDWMPLDIAEMIDEE  1060
             DD+IFL+VQI  K+GK++N++F FDI +DTA++VATEMVKELE I+DW PL+IA MI++E
Sbjct  321   DDSIFLKVQIKVKNGKSKNVYFAFDILNDTAIDVATEMVKELEIISDWDPLEIAVMIEKE  380

Query  1061  ISALVPTWRSTQYQKQH---SFNY------IddddddNNVGISTTRHPFYslssqsssqa  1213
             IS+L+P W   ++ + H   SFNY       DD+DDD++     T HPFY   S   S +
Sbjct  381   ISSLIPDWEEWKFPEIHHQDSFNYEQDHNGNDDNDDDDDDENYATPHPFYYCGSSHGSSS  440

Query  1214  slPD----LLEKINH-----------DWLQNDDTSSRSSMNSYDCSNLCWATESEGDL--  1342
                       E  NH           +W + DDTSS  S+NS+D S+L + +  E +   
Sbjct  441   DSLHDFYPFRENPNHHFGGMDTSITTEWFREDDTSSCCSLNSFDYSDLSFYSNDEDEYEY  500

Query  1343  -SSIGGRESLLIQKTNTGTRLCPET----------------SRSNKKKGCCGSNHQRPKM  1471
              S+I GRES  I  T   TR CP                  +R   + G   +N   P++
Sbjct  501   DSNIKGRESRYISTTKQPTRFCPTMKIDSHHLRHKDTRIIPNRETFENGSLSNN--SPRI  558

Query  1472  SRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             +RV+SMV+LRS+ LHR LVE + K+RLF TVGA+ENIG+ +P
Sbjct  559   TRVKSMVNLRSETLHRYLVETLLKKRLFNTVGAMENIGFQKP  600



>ref|XP_004169120.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase WNK4-like [Cucumis sativus]
Length=645

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/566 (57%), Positives = 391/566 (69%), Gaps = 36/566 (6%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE LG+EVAW+Q+KLN V RSPE+LQRLYSEV LL  L H SIMRF+ SWID D
Sbjct  46    TVYKAIDEFLGIEVAWSQVKLNEVLRSPEDLQRLYSEVHLLSTLKHESIMRFYTSWIDVD  105

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNFITELFTSGTLREY ++Y  V+IRAIK+W RQIL+GL YLH HDPP+IHRDLKCD
Sbjct  106   XKTFNFITELFTSGTLREYGKKYRRVDIRAIKSWARQILQGLIYLHEHDPPIIHRDLKCD  165

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+L GS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMCV
Sbjct  166   NIFVNGHLGQVKIGDLGLAAILHGSRSAHSVIGTPEFMAPELYEENYNELVDVYSFGMCV  225

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLPAA Y+I + +AQRF+ +CL P S R SA EL
Sbjct  226   LEMLTSEYPYSECSNPAQIYKKVTSGKLPAALYKIQDVDAQRFIKKCLVPVSMRASAKEL  285

Query  719   LLDPFLAADEEEDES-AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             L D FL  D     S  +  +QK   N K  E+E   + +    ++MTITG LNPEDDT+
Sbjct  286   LADSFLKVDGNRPSSVGRTQNQKPFLNAK--EMENFHLSEGLSRTNMTITGKLNPEDDTL  343

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FLRVQ +DKDG  RNI+FPFDI +DTA++VA EMVKELEI+DW P +IA+MI+ EISALV
Sbjct  344   FLRVQTADKDGSLRNIYFPFDIVNDTALDVAMEMVKELEISDWEPFEIADMIEGEISALV  403

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH---  1246
             P W  ++    HS  +    ++D+NV   T R    S  + +    S P   + I++   
Sbjct  404   PNWNRSEL-TNHSLGF-SCAEEDDNVSHHTFRSVSSSSQATTLGLISSPRTNQNISNGFS  461

Query  1247  ----DWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPET  1414
                 D L +  +   S+   Y   N   + E E  +SS+   +   I K +  +R CP  
Sbjct  462   WFPDDTLDDSSSQCSSASGKYSNLNYISSDEYETSMSSVQTDQHNNINKIHNSSRFCPIE  521

Query  1415  SRSNK--------KKGCC---GSNHQRP------------KMSRVRSMVDLRSQLLHRTL  1525
             +R +K        K+  C   GS+                K++R RS+VD+ SQLLHR+L
Sbjct  522   NRKSKDXLAQLLYKQSQCAIAGSSQGVASGRKDKKGTDGRKLTRNRSLVDVHSQLLHRSL  581

Query  1526  VEEVNKRRLFKTVGAVENIGYHEPAE  1603
             VEEVN+RRLFKTVGAVE+IG+  P E
Sbjct  582   VEEVNRRRLFKTVGAVESIGFQAPCE  607



>ref|XP_004490711.1| PREDICTED: probable serine/threonine-protein kinase WNK4-like 
[Cicer arietinum]
Length=586

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/555 (56%), Positives = 400/555 (72%), Gaps = 27/555 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWN+I+L+ V  + ++LQRLYSEV LL  L H SI+RF  SWID D
Sbjct  40    TVYKAIDEVLGIEVAWNKIRLSEVLNTQDDLQRLYSEVHLLSTLKHHSIIRFFTSWIDID  99

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              + FNF+TE+FTSG+LREYR++Y  V+++AIKNW RQIL+GL YLH HDPPVIHRDLKCD
Sbjct  100   NKAFNFVTEMFTSGSLREYRKKYKRVSVQAIKNWARQILQGLVYLHGHDPPVIHRDLKCD  159

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+L+GS  AHSVIGTPEFMAPELYEEEY+EL D+YSFGMCV
Sbjct  160   NIFVNGHLGQVKIGDLGLAAILQGSQSAHSVIGTPEFMAPELYEEEYNELADVYSFGMCV  219

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTS+YPYSEC+NPAQIYKKVTSG+LP AF+R+++AEA++F+G+CLEPA+KRPSA +L
Sbjct  220   LEMLTSDYPYSECSNPAQIYKKVTSGRLPMAFFRVEDAEARKFIGKCLEPAAKRPSAKDL  279

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LL+PFL+AD+    + KL  QK   N    E+E   +  +   + M + G LNPEDDTIF
Sbjct  280   LLEPFLSADDSL-SAMKLAIQKPFLNDS--EMEKLKLSDEFPRTKMKVIGKLNPEDDTIF  336

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQISD++   RN++FPFDI +DT ++VA EMVKELEI+DW P DIA MI+ EISAL+P
Sbjct  337   LKVQISDQNCSVRNVYFPFDILTDTPIDVAMEMVKELEISDWDPFDIANMINREISALLP  396

Query  1079  -TWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKIN----  1243
               W++      ++F+Y       ++ G         S SS SS Q S+PDL+ K+     
Sbjct  397   YRWQNNYSDSYNTFSY------QDDDGEDEPHFRLRSFSSCSSLQESIPDLVSKVEEISR  450

Query  1244  -----HDWLQNDDTSSRSSMNSYDCSNLCWATESE--GDLSSIGGRESLLIQKTNTGTRL  1402
                  HD L +D++S  SS  +Y   N     + E   +++SI  ++ L + K   GTR 
Sbjct  451   GYYSLHDDLHDDNSSRCSSQGTYSNWNYYSMDDQEHNNNVASI-RKDKLPMIKNQQGTRF  509

Query  1403  CPETSRSNKKKGCCGSNH----QRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGA  1570
              P    SN  K    SN     +  K++R RS++D RSQLLHR+LVEE+ KRR FKT+GA
Sbjct  510   SPGEDLSNCNKNPSPSNSKMMMENRKLTRNRSLIDTRSQLLHRSLVEELYKRRQFKTIGA  569

Query  1571  VENIGYHEPAEYSCK  1615
             VENIG+  P + S K
Sbjct  570   VENIGFQSPYDVSTK  584



>ref|XP_011080729.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Sesamum indicum]
Length=602

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/561 (58%), Positives = 384/561 (68%), Gaps = 43/561 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++L ++ +SP++LQRLYSEV LL  L+H+SI+RF+ SWID +
Sbjct  43    TVYKAIDEVLGLEVAWNQVRLVDLLQSPDDLQRLYSEVHLLSTLNHNSIIRFYTSWIDVE  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+F+SGTLREYR +Y  VNIRAIK W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  103   NRTFNFITEMFSSGTLREYRAKYKRVNIRAIKIWARQILEGLVYLHGHDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH GQVKIGDLGLAA+LRGSH AHSVIGTPEFMAPELYEE YDELVD+YSFGMCV
Sbjct  163   NIFVNGHHGQVKIGDLGLAAILRGSHRAHSVIGTPEFMAPELYEENYDELVDVYSFGMCV  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSEYPYSECTNPAQIYKKVTSGK P AFY++ + +AQRF+G+CLE ASKR SA EL
Sbjct  223   LEMITSEYPYSECTNPAQIYKKVTSGKKPRAFYKVQDLDAQRFIGKCLESASKRLSAKEL  282

Query  719   LLDPFLAADEEEDE-SAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             + DPFLA D  +D   + + +QK + N   +E+E    +     ++MTITGTLNPED TI
Sbjct  283   MHDPFLAIDHSDDHPDSYIENQKPLLN-DCIELERLQFNDDVPRTNMTITGTLNPEDGTI  341

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+DK G  RN+FFPFDI SDT ++VA EMVKELEITDW P +IA MID EIS LV
Sbjct  342   FLKVQIADKQGAVRNVFFPFDIVSDTPIDVANEMVKELEITDWRPSEIANMIDGEISGLV  401

Query  1076  PTWRSTQYQKQ--HSFNYIddddddN----------NVGISTTRHPFYslssqsssqasl  1219
             P W+    Q    H  NY +DDD  N          +V  S T H   +    S      
Sbjct  402   PDWKPDNPQSSHFHVLNYQEDDDHHNLFSPSSSSQVSVLGSITSHRINTRPHTSHWVQDE  461

Query  1220  PDLLEKINHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTR  1399
              D L    H    N+D  S S                        G  S+  Q      +
Sbjct  462   HDPLSPKRHGQAANEDILSPSRF--------------------YPGENSVTAQHL---AK  498

Query  1400  LCPETSRS--NKKKGCCGSNHQR---PKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTV  1564
             LC   S+     ++G    N  +   P+++R RS+VD RSQLLHR+LVEEVN+RRLF TV
Sbjct  499   LCHHQSKDMIEPREGSTSRNRSKIEIPRLTRNRSLVDTRSQLLHRSLVEEVNRRRLFNTV  558

Query  1565  GAVENIGYHEPAEYSCKGNRS  1627
             GAVENIG+  P E S K  R 
Sbjct  559   GAVENIGFQSPYEVSSKTTRG  579



>ref|XP_008798574.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase WNK5 [Phoenix dactylifera]
Length=627

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/577 (59%), Positives = 397/577 (69%), Gaps = 53/577 (9%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VYRAFDE+ GMEVAWNQ K+ +V RSP+ LQR+YSEV LL  L H SI+ FHASWID  R
Sbjct  40    VYRAFDELNGMEVAWNQAKICDVLRSPDALQRMYSEVHLLSTLHHESIITFHASWIDVGR  99

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             RTFNFITE+FTSGTLREYRQRY  V+IRA+KNW RQIL GL YLH HDPPVIHRDLKCDN
Sbjct  100   RTFNFITEMFTSGTLREYRQRYRRVDIRAVKNWARQILHGLVYLHGHDPPVIHRDLKCDN  159

Query  365   IFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             IFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCVL
Sbjct  160   IFVNGHLGQVKIGDLGLAAVLRGSQSAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCVL  219

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EMLTSEYPYSEC+NPAQIYKKVTSGKLP AFYRI + EA+RF+GRCLE ASKR SA +LL
Sbjct  220   EMLTSEYPYSECSNPAQIYKKVTSGKLPDAFYRIQDPEARRFIGRCLETASKRSSAKKLL  279

Query  722   LDPFLAADEEED-----ESAKLPSQKLIPNGKLLEVEPCFVDQQAK-SSDMTITGTLNPE  883
             LDPFLA+D+  +      +  +  +   P G           ++ K  +DMTITG +NPE
Sbjct  280   LDPFLASDDHRNTLLPQNAPPIQVKATGPQGHGHHAPEIHNPERTKRRTDMTITGKMNPE  339

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             DD IFL+VQI+DK+G  RNI+FPFDI +DT ++VA EMVKELEITD  P +IAEMI +EI
Sbjct  340   DDAIFLKVQIADKEGHMRNIYFPFDIVTDTPIDVANEMVKELEITDREPSEIAEMIAQEI  399

Query  1064  SALVPTWRSTQYQKQH-SFNYIddddddNNVGISTTRHPFYslssqsssqas------lP  1222
             S LVP W+     + H +++Y DDD+D  N       HPF+ LSS +SSQ S       P
Sbjct  400   STLVPGWKEGDMPESHYAYSYGDDDEDGCN-------HPFFCLSSPTSSQGSLFGMGPSP  452

Query  1223  DLLEKINH----DW---LQNDDTSSRSSMNS--YDCSNLCWATESEGDLSSIGGRESLLI  1375
                 +       DW       D    SSM+S  Y   N     E EG+  S   RE+  I
Sbjct  453   GWSHQQRQFHQEDWFGDDPYFDDDDGSSMHSGKYSAVNYVSGNEHEGE-GSCHQRETQPI  511

Query  1376  QKTNTGTRLCP------ETSRSNKKKGCCGSNHQRPK---------------MSRVRSMV  1492
               ++  TR CP      + S + K    C    + P+               M R RSMV
Sbjct  512   HNSHKSTRFCPGEGHPVDASLATKFHQQCSILLESPRASSSRAGKRPVDGRCMMRNRSMV  571

Query  1493  DLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAE  1603
             D+RSQLLHRTLVEEVNK RLFKTVGAVENIG+ +P E
Sbjct  572   DIRSQLLHRTLVEEVNK-RLFKTVGAVENIGFQDPTE  607



>gb|AAQ83971.2| mitogen-activated protein kinase [Nicotiana tabacum]
 gb|ABC68393.1| serine/thronine protein kinase [Nicotiana tabacum]
Length=615

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/572 (56%), Positives = 400/572 (70%), Gaps = 49/572 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRA DE+LGMEVAWNQIKLN++  SPE+++RLYSEV LL  L+H SIMRF+ SWID +
Sbjct  42    TVYRAIDELLGMEVAWNQIKLNDLLHSPEDMERLYSEVHLLSTLNHHSIMRFYTSWIDVE  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLR YR++Y  V+IRAIKNW RQILEGL YLH HDPPVIHRDLKCD
Sbjct  102   HRTFNFITEMFTSGTLRGYRKKYQRVDIRAIKNWARQILEGLVYLHEHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMC+
Sbjct  162   NIFVNGHLGQVKIGDLGLAAILRGSQRAHSVIGTPEFMAPELYEENYNELVDVYSFGMCM  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC NPAQIYKKVTSGK P AFY++ + +AQRF+ +CLEPASKR SA EL
Sbjct  222   LEMLTGEYPYSECVNPAQIYKKVTSGKRPRAFYKVQDLDAQRFIRKCLEPASKRLSAKEL  281

Query  719   LLDPFLAADEEEDESAKLPS-QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             ++DPFL  +  + +S  +   QK   N K + +E   +++ A  ++MTITG LNPEDDTI
Sbjct  282   MVDPFLVFNNVDGKSVTMMQLQKPFLNDK-IAIEDLHLNEDAPRTNMTITGKLNPEDDTI  340

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
              ++VQI+DK G  RN++FPFDI +DT  EVA EMVKELEITDW P +IA MID EIS LV
Sbjct  341   LIKVQIADKKGDVRNVYFPFDIVTDTPTEVANEMVKELEITDWKPYEIANMIDGEISGLV  400

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYs-lssqsssqaslPDLLEKINHDW  1252
             P W+     +   ++ +   DDDN+       +PF    S  SS  +   D+        
Sbjct  401   PQWKKWNQFESADYHVLSYKDDDND-----HHNPFRGFSSCSSSQVSLSGDMF-------  448

Query  1253  LQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGT-RLCP-------  1408
                DDTSS+SS +S + SN  + ++ E D  +   ++S      N  T R CP       
Sbjct  449   ---DDTSSQSSSHSANYSNFNYFSDDENDPVTTSTKQSQPATAINHHTSRFCPGENSSTG  505

Query  1409  ------------------ETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEE  1534
                                TS ++K+KG   +     +++R +S+VD+RSQLLH+TLVEE
Sbjct  506   QSLARMCYKQCKDMLELKRTSSTSKEKGKVDTR----RLTRNKSLVDMRSQLLHKTLVEE  561

Query  1535  VNKRRLFKTVGAVENIGYHEPAEYSCKGNRSF  1630
             V+KRRLFKTVGAVENIG+ +P E S +  +S 
Sbjct  562   VHKRRLFKTVGAVENIGFQQPYEDSRRSPQSM  593



>gb|EYU36911.1| hypothetical protein MIMGU_mgv1a003239mg [Erythranthe guttata]
Length=597

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/558 (59%), Positives = 395/558 (71%), Gaps = 34/558 (6%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LG+EVAWNQ++L ++ RSP++LQR+YSEV LL  LDH SI+RFH SW+D  
Sbjct  42    TVYKALDELLGIEVAWNQVRLVDLLRSPDDLQRVYSEVHLLSTLDHDSIIRFHTSWVDVG  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLREYR +Y  VNIRAIK W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  102   NRTFNFITEMFTSGTLREYRAKYKRVNIRAIKIWARQILEGLVYLHGHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+L+GS  AHSVIGTPEFMAPELYEE Y+ELVD+YS+GMCV
Sbjct  162   NIFVNGHLGQVKIGDLGLAAILQGSCRAHSVIGTPEFMAPELYEENYNELVDVYSYGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSEYPYSECTNPAQIYKKVTSG+ P AFY++ + EAQRF+ +CLE ASKR SA EL
Sbjct  222   LEMITSEYPYSECTNPAQIYKKVTSGRKPRAFYKVQDLEAQRFIRKCLETASKRLSAKEL  281

Query  719   LLDPFLAADEEED--ESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDT  892
             +LDPFLA D  +D    + + +QK   N K +E E   +D     ++MTITG LNP+D T
Sbjct  282   MLDPFLAVDHFDDLISESTIKNQKPFLNDK-IEFEHLQLDDNVPRTNMTITGKLNPDDGT  340

Query  893   IFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISAL  1072
             IFL+VQI+DK+G  RN+FFPFDI +DTA+EVA EMVKELEI DW P +IA MID EIS L
Sbjct  341   IFLKVQIADKEGDVRNVFFPFDIVNDTALEVANEMVKELEINDWRPSEIANMIDGEISGL  400

Query  1073  VPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK-INHD  1249
             VP WR+   Q  H F+ +      NN       H +   S  SSSQ S   +  +  N +
Sbjct  401   VPDWRAHHPQPAH-FHVM------NNYQEDDYDHQYTLFSHSSSSQLSSHRMETRPQNSN  453

Query  1250  WLQN---DDTSSRSSMNSYDCSNLCWATESEGDLS-------SIGGRESLLI---QKTNT  1390
             WLQ    DDTSS+SS +S   S   WA E     S       S+ G+    +   Q  N 
Sbjct  454   WLQGEYFDDTSSQSSSHSEKYSG--WAYEDMLSPSRFYPGENSVNGQNLAKVCYRQSKNI  511

Query  1391  GTRLCPETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGA  1570
                     SRSN       S  + P+++R RS+VD RSQLLHR+LVEEVN+RRLFKTV A
Sbjct  512   VEPREASASRSN-------SEIEMPRLTRNRSLVDTRSQLLHRSLVEEVNRRRLFKTVDA  564

Query  1571  VENIGYHEPAEYSCKGNR  1624
             VE+IG+  P + S K  +
Sbjct  565   VEDIGFRSPFDVSVKNTQ  582



>ref|NP_001237474.1| with no lysine kinase 5 [Glycine max]
 gb|ACN87281.1| with no lysine kinase [Glycine max]
Length=607

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/578 (60%), Positives = 412/578 (71%), Gaps = 51/578 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VYRAFDEVLG EVAWNQ+KL +VF SP+ L RLYSEV LLK+L+H SIM FH SWID  
Sbjct  37    VVYRAFDEVLGREVAWNQVKLGDVFHSPDLLPRLYSEVHLLKNLEHDSIMTFHDSWIDVH  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITELFTSGTLREYR++Y  V+IRA+KNW RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    CRTFNFITELFTSGTLREYRKKYQRVDIRAVKNWARQILSGLEYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF+NGHLGQVKIGDLGLAA+LRGS HAHS   TPEFMAPELYEEEY+ELVDIYSFGMC+
Sbjct  157   NIFINGHLGQVKIGDLGLAAILRGSQHAHS---TPEFMAPELYEEEYNELVDIYSFGMCM  213

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +E+ TSE+PYSEC+NPAQIYKKVTSGKLP A+YRI + EAQ+FVG+CL   S+R SA EL
Sbjct  214   IEIFTSEFPYSECSNPAQIYKKVTSGKLPEAYYRIHDLEAQKFVGKCLANVSERLSAKEL  273

Query  719   LLDPFLAADEEED--ESAKLPSQK---LIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPE  883
             LLDPFLA ++ +    S  LP ++   L     L +  P     Q K + MTITG++N E
Sbjct  274   LLDPFLATEQLDSPLPSPTLPKKQTPTLNFTALLAKELPPPKSNQTKDTHMTITGSMNEE  333

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             +DT+FL+VQIS+K+G+ RNIFFPFD  +DTA++VA EMVKELEI+D  PL+IAEMI+EEI
Sbjct  334   NDTVFLKVQISNKNGQKRNIFFPFDTINDTAIDVAMEMVKELEISDLEPLEIAEMIEEEI  393

Query  1064  SALVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDL--  1228
             SALVPTWR   S +YQKQHSF+Y ++ D  N+       HPF+S +S+SSS ASLP    
Sbjct  394   SALVPTWRDWGSAKYQKQHSFSYEEEYDMSNH-------HPFFSPTSRSSSHASLPVFGS  446

Query  1229  -------LEKINH-----DWLQ-----NDDTSSRSSMNSYDCSNL-CW--ATESEGDLSS  1348
                      + NH     DW Q     NDD SS+SSMNS+ C NL C     E E D + 
Sbjct  447   SSYKNSSHHRENHYPFAQDWPQDELFMNDDASSQSSMNSFKCFNLNCCDPGNEDEHDPTL  506

Query  1349  IGGRESLLI--QKTNTGTRLCP--ETSRSNKKKGCCGSN------HQRPKMSRVRSMVDL  1498
               G E L    +     TR CP  E   S+  K  C         H   +++R+RS VDL
Sbjct  507   ALGAEHLFYTPKGNEKYTRFCPREEVMESDFTKQFCNMRMDSHRCHGMHRLTRIRSFVDL  566

Query  1499  RSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSC  1612
             R Q   R+LVEE++KRR+FKTVGA+ENIG+ +P    C
Sbjct  567   RRQQQQRSLVEEIHKRRMFKTVGAIENIGFQDPEGDGC  604



>ref|XP_003616019.1| With no lysine kinase [Medicago truncatula]
 gb|AES98977.1| WNK kinase [Medicago truncatula]
Length=575

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/547 (56%), Positives = 395/547 (72%), Gaps = 30/547 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++LN V  +P++LQRLYSEV LL  L H SIMRF+ SWID D
Sbjct  40    TVYKAIDEVLGIEVAWNQVRLNEVLNTPDDLQRLYSEVHLLSTLKHRSIMRFYTSWIDID  99

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              + FNF+TE+FTSG+LREYR++Y  V+++AIK+W RQIL+GL YLH HDPPVIHRDLKCD
Sbjct  100   NKNFNFVTEMFTSGSLREYRRKYKRVSLQAIKSWARQILQGLVYLHGHDPPVIHRDLKCD  159

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+L+GS  AHSVIGTPEFMAPE+YEEEY+EL D+YSFGMCV
Sbjct  160   NIFVNGHLGQVKIGDLGLAAILQGSQSAHSVIGTPEFMAPEMYEEEYNELADVYSFGMCV  219

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTS+YPYSECTNPAQIYKKVTSGKLP +F+RI++ EA+RF+G+CLEPA+ RPSA +L
Sbjct  220   LEMLTSDYPYSECTNPAQIYKKVTSGKLPMSFFRIEDGEARRFIGKCLEPAANRPSAKDL  279

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LL+PFL+ D+    + KL  QK   N    E+E   +  + + ++M + G LNPEDDTIF
Sbjct  280   LLEPFLSTDDTS-SAMKLKIQKPFLNEN--EMEKLQLSDEFQRTEMKVIGKLNPEDDTIF  336

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQISDK    RN++FPFDI +DT ++VA EMVKELEI+DW P DIA MI+ EISAL+P
Sbjct  337   LKVQISDKKCSVRNVYFPFDILTDTPIDVAMEMVKELEISDWDPFDIANMINREISALLP  396

Query  1079  -TWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK------  1237
               W++      H+F+Y        +  +  +R  F S+SS SS   S+PD + K      
Sbjct  397   HRWKNDYSDSFHTFSY-------QDDDVDESRLHFRSISSSSSLHESIPDFVSKSEEISH  449

Query  1238  ---INHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCP  1408
                + HD L +D++S  SS  +Y   N     + E +++SI  ++ L I K++     C 
Sbjct  450   GYYLLHDDLHDDNSSRCSSQGTYSNWNYYSMDDHEHNIASI-RKDKLPIMKSHN----CN  504

Query  1409  ETSRSNKKKGCCGSNH----QRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVE  1576
                     + C  S      +  K++R RS++D RSQLLHR+LV+E+NKRR  KTVGAVE
Sbjct  505   HCKIIGGSQNCSSSKSKMVMENRKLTRNRSLIDTRSQLLHRSLVDELNKRRQVKTVGAVE  564

Query  1577  NIGYHEP  1597
             NIG+  P
Sbjct  565   NIGFQSP  571



>ref|XP_007134689.1| hypothetical protein PHAVU_010G067900g [Phaseolus vulgaris]
 gb|ESW06683.1| hypothetical protein PHAVU_010G067900g [Phaseolus vulgaris]
Length=602

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/566 (60%), Positives = 408/566 (72%), Gaps = 42/566 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VYRAFDEVLG+EVAWNQ+KL +VF SP+ LQRLYSEV LLK L+H SIM FH SWID +
Sbjct  37    VVYRAFDEVLGIEVAWNQVKLGDVFHSPDLLQRLYSEVHLLKTLEHDSIMTFHDSWIDVN  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITELFTSGTLREYR++Y  V+IRA+KNW RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    YRTFNFITELFTSGTLREYRKKYQRVDIRAVKNWARQILSGLEYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF+NGHLGQVKIGDLGLAA+L GS HAHSVIGTPEFMAPELYEEEY+ELVDIYSFGMC+
Sbjct  157   NIFINGHLGQVKIGDLGLAAILHGSQHAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCM  216

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +E+ TSE+PYSEC+NPAQIYKKVTSGKLP AFYRI + EAQRFVG+CL   S+R SA EL
Sbjct  217   IEIFTSEFPYSECSNPAQIYKKVTSGKLPEAFYRIHDLEAQRFVGKCLVDVSERLSAKEL  276

Query  719   LLDPFLAADEEED--ESAKLPSQK---LIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPE  883
             LLD FLA D+ +    S  LP ++   L     + +  P   D Q K + MTITG++N E
Sbjct  277   LLDSFLAKDQLDSPLSSPTLPRKQTPTLNFTASVAKELPPMSD-QTKDTHMTITGSINEE  335

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             DDTIFL+VQIS+K G+ RNIFFPFD  +DTA++VA EMVKELEI+D  PL+IAEMI+EEI
Sbjct  336   DDTIFLKVQISNKKGEKRNIFFPFDTINDTAIDVAVEMVKELEISDLEPLEIAEMIEEEI  395

Query  1064  SALVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE  1234
             S LVPTWR   ++ YQ+QHSF Y ++ D  N+        P++S SS+SSS  S      
Sbjct  396   STLVPTWRDWDTSNYQRQHSFTYEEEYDMSNH-------QPYFSSSSRSSSHGSFHKHNS  448

Query  1235  KI--NH-----DWLQ-----NDDTSSRSSMNSYDCSNLCWA---TESEGDLSSIGGRESL  1369
              +  NH     DW Q     NDD SS+SSMNS+ C NL ++    E   D + + G E+L
Sbjct  449   HLCGNHYPFAQDWPQDELSTNDDASSQSSMNSFKCFNLKYSDPGNEDGHDPTVVLGAEAL  508

Query  1370  LI--QKTNTGTRLCP--ETSRSNKKKGCCGSN------HQRPKMSRVRSMVDLRSQLLHR  1519
                 +     TR CP  E   ++  K  C         H   +++R+ S VDLR Q   R
Sbjct  509   GYSPKGNEKYTRFCPREEVMDADSTKQFCNMRMDSHRYHGVQRLTRISSFVDLRRQQPQR  568

Query  1520  TLVEEVNKRRLFKTVGAVENIGYHEP  1597
             +L+EE++KRR+FKTVGA+ENIG+  P
Sbjct  569   SLMEEIHKRRIFKTVGAIENIGFQNP  594



>ref|XP_007033560.1| Kinase, putative isoform 2, partial [Theobroma cacao]
 gb|EOY04486.1| Kinase, putative isoform 2, partial [Theobroma cacao]
Length=492

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/431 (71%), Positives = 360/431 (84%), Gaps = 6/431 (1%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFD+VLGMEVAWNQ+KLN+VFRSPEELQRLYSEV LLK+L+H SIMRF+ SWID D
Sbjct  42    TVYRAFDKVLGMEVAWNQVKLNDVFRSPEELQRLYSEVHLLKNLNHDSIMRFYTSWIDID  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQRY  V++RAIKNW RQIL+GLAYLH HDPPVIHRDLKCD
Sbjct  102   RRTFNFITEMFTSGTLREYRQRYQLVDMRAIKNWARQILQGLAYLHGHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  162   NIFVNGHLGQVKIGDLGLAAILRGSQHAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AFYRI + EA+RFVG+CLE  SKR  AHEL
Sbjct  222   LEMLTSEYPYSECSNPAQIYKKVTSGKLPEAFYRIQDEEARRFVGKCLENVSKRLPAHEL  281

Query  719   LLDPFLAADEEED-ESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA++E       ++ S+KL P+G + E+ P       +S+DM+ITGT NP DDTI
Sbjct  282   LLDPFLASEEASPLPIPRVSSRKLTPDGPVRELAPSVEVDPTRSTDMSITGTTNPGDDTI  341

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+DKDG ARNI+FPFD+ +DTA++VA EMVKELEI DW PL+IAEMI+EEIS+LV
Sbjct  342   FLKVQITDKDGHARNIYFPFDVVNDTAIDVALEMVKELEINDWEPLEIAEMIEEEISSLV  401

Query  1076  PTWR---STQYQKQHSFNYIddddddNNVGIST-TRHPFYslssqsssqaslPDLLEKIN  1243
             PTW+   S+Q   QHSF Y D+++DD++    T  RHPFY+ SS+SSSQ S+P  L    
Sbjct  402   PTWKDLGSSQVHHQHSFKYEDEEEDDDDDDDQTGIRHPFYATSSRSSSQVSIPTFLSSYE  461

Query  1244  HDWLQNDDTSS  1276
               +    + +S
Sbjct  462   TQFCHGKNVTS  472



>ref|XP_009757970.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Nicotiana sylvestris]
Length=615

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/568 (56%), Positives = 399/568 (70%), Gaps = 41/568 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRA DE+LGME+AWNQIKLN++  SPE+++RLYSEV LL  L+H SIMRF+ SWID +
Sbjct  42    TVYRAIDELLGMEMAWNQIKLNDLLHSPEDMERLYSEVHLLSTLNHHSIMRFYTSWIDVE  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLR YR++Y  V+IRAIKNW RQILEGL YLH HDPPVIHRDLKCD
Sbjct  102   HRTFNFITEMFTSGTLRGYRKKYQRVDIRAIKNWARQILEGLVYLHEHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVK+GDLGLAA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMC+
Sbjct  162   NIFVNGHLGQVKVGDLGLAAILRGSQRAHSVIGTPEFMAPELYEENYNELVDVYSFGMCM  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC NPAQIYKKVTSGK P AFY++ + +AQRF+ +CLEPASKR SA EL
Sbjct  222   LEMLTGEYPYSECVNPAQIYKKVTSGKRPRAFYKVQDLDAQRFIRKCLEPASKRLSAKEL  281

Query  719   LLDPFLAADEEEDESAKLPS-QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             ++DPFLA D  + +S  +   QK   N K + +E   ++  A  ++MTITG LNPEDDTI
Sbjct  282   MVDPFLALDNIDGKSVTMMQLQKPFLNDK-IAIEDLHLNDDAPRTNMTITGKLNPEDDTI  340

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
              ++VQI+D +G  RN++FPFDI +DT  EVA EMVKEL+ITDW P +IA MID EIS LV
Sbjct  341   LIKVQIADNEGDVRNVYFPFDIVTDTPTEVANEMVKELDITDWKPHEIANMIDGEISGLV  400

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYs-lssqsssqaslPDLLEKINHDW  1252
             P W+     +   +  +   DDDN+       +PF    S  SS  +   D+        
Sbjct  401   PQWKKWNQFESADYQVLSYKDDDND-----HHNPFQGFSSCSSSQVSLSGDMF-------  448

Query  1253  LQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGT-RLCPETSRSN-  1426
                DDTSS+SS +S + SN  + ++ E D  +   ++S      +  T R CP  + S  
Sbjct  449   ---DDTSSQSSSHSANYSNFNYFSDDENDPVTTSTKQSQPATAISHHTSRFCPGENSSTG  505

Query  1427  ---------------KKKGCCGSNHQRPK-----MSRVRSMVDLRSQLLHRTLVEEVNKR  1546
                            K KG   ++ ++ K     ++R +S+VD+RSQLLH+TLVEEV+KR
Sbjct  506   QSLAKMCYKQCKDMLKLKGTSSTSKEKDKVDARRLTRNKSLVDMRSQLLHKTLVEEVHKR  565

Query  1547  RLFKTVGAVENIGYHEPAEYSCKGNRSF  1630
             RLFKTVGAVENIG+ +P E S +  +S 
Sbjct  566   RLFKTVGAVENIGFQQPYEDSRRSPQSM  593



>emb|CDP04053.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/567 (57%), Positives = 404/567 (71%), Gaps = 48/567 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLGMEVAW Q+KL+++ RS E+L+RLYSEV LL  L H SIM+F+ SWID +
Sbjct  46    TVYKAIDEVLGMEVAWCQVKLSDLLRSAEDLERLYSEVHLLSALHHPSIMKFYTSWIDVE  105

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLR+Y+++Y  V+IRA+KNW RQILEGL YLH HDPPVIHRDLKCD
Sbjct  106   RRTFNFITEMFTSGTLRQYKKKYKRVDIRAVKNWARQILEGLVYLHGHDPPVIHRDLKCD  165

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LR S  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMC+
Sbjct  166   NIFVNGHLGQVKIGDLGLAAILRSSQRAHSVIGTPEFMAPELYEENYNELVDVYSFGMCI  225

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC NPAQIYKKVT GK P AFY++ + EAQRF+G+CLE ASKR SA EL
Sbjct  226   LEMLTSEYPYSECNNPAQIYKKVTLGKKPRAFYKVQDLEAQRFIGKCLETASKRLSAKEL  285

Query  719   LLDPFLAADEEEDESAK-LPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             +LDPFL  D+ +D   K + SQK   N   + +E   +++    ++MTITG LNPEDDTI
Sbjct  286   MLDPFLMVDDFQDGPLKRIGSQKAFLNDN-IGIEDLQLNEDIPETNMTITGKLNPEDDTI  344

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+DK+G  RN+FFPFD+ SDT + VA EMV+EL+ITDW P +IA+MID EIS L+
Sbjct  345   FLKVQITDKEGATRNVFFPFDMASDTPIGVAREMVRELDITDWTPSEIADMIDAEISGLL  404

Query  1076  P---TWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH  1246
             P    W  +Q  + H  +Y  ++D+D+N       HPF   SS SSSQ S+ D  E    
Sbjct  405   PYSKKWEQSQPPRYHILHY--EEDEDHN-------HPFVDFSSCSSSQVSILD--ETF--  451

Query  1247  DWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPE-----  1411
                  DD SS+SS++S   SNL + ++    L S   ++      T++ +R CP      
Sbjct  452   -----DDGSSQSSLHSEKHSNLNYCSDEYDSLRSPRQQKLPAASSTHSSSRFCPGGNCSM  506

Query  1412  -----------------TSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVN  1540
                              +  ++   G C  + +  K++R RS+VD+RSQLLHR+LVEEV+
Sbjct  507   AQSLARICPSLSKGMLVSQVTSTASGKCTVDLR--KLTRNRSLVDMRSQLLHRSLVEEVS  564

Query  1541  KRRLFKTVGAVENIGYHEPAEYSCKGN  1621
             KRRL KTVGAVE+IG+ +P   S K +
Sbjct  565   KRRLSKTVGAVEHIGFQDPCRVSKKAS  591



>gb|KDO36588.1| hypothetical protein CISIN_1g010768mg [Citrus sinensis]
Length=501

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/497 (64%), Positives = 380/497 (76%), Gaps = 30/497 (6%)
 Frame = +2

Query  209   LFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDNIFVNGHLG  388
             +FTSGTLREYR++YT V+IRA+KNW RQIL G+AYLH HDPPVIHRDLKCDNIFVNGHLG
Sbjct  1     MFTSGTLREYRKKYTRVDIRAVKNWARQILRGIAYLHGHDPPVIHRDLKCDNIFVNGHLG  60

Query  389   QVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLEMLTSEYP  565
             QVKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCVLEMLTSEYP
Sbjct  61    QVKIGDLGLAAILRGSQHAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYP  120

Query  566   YSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPFLAAD  745
             YSEC+NPAQIYKKVTSGKLP AF+RI +AEA+RFVG+CLE  SKR  A ELLLDPFLA+D
Sbjct  121   YSECSNPAQIYKKVTSGKLPGAFHRIQDAEARRFVGKCLENVSKRLPAKELLLDPFLASD  180

Query  746   EEED-ESAKLPS-QKLIPNGKLLEVEPCFV--DQQAKSSDMTITGTLNPEDDTIFLRVQI  913
               E     K+PS Q L PNG + E+ P F     + KS+DMTITGT+NPEDDTIFL+VQI
Sbjct  181   AGEPLLIPKVPSFQNLNPNGAVTELVPQFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQI  240

Query  914   SDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR--  1087
             +DKDG+ARNI+FP+DI +DTA EVA EMVKELEITDW PL+IAEMI++EIS+LVP W+  
Sbjct  241   TDKDGQARNIYFPYDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKEC  300

Query  1088  -STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK--------I  1240
              S Q+  QHSF+Y D+DDD+++ GI    HPFYS SS SSS ASLP             +
Sbjct  301   GSPQFCHQHSFSYEDEDDDNDDYGI---YHPFYSNSSHSSSHASLPAFFTNNANSPPSWL  357

Query  1241  NHDWLQNDDTSSRSSMNSYDCSNLCWATESEGD--LSSIGGRESLLIQKTNTGTRLCPET  1414
               D L NDD SS  S+NS+  S+  + + +E D   S   G    + + T   TR CPE 
Sbjct  358   QQDLLGNDDASSNGSVNSFKYSSWDYHSGNEDDYEFSHRAGEPLCIARATQKSTRFCPEA  417

Query  1415  SRSNKK---------KGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVG  1567
             + +N +         K C  +++   K+SR+RS+VD+RSQLLHR+LVEE++KRRLFKTVG
Sbjct  418   AMNNDRCNSEDVNSWKACSTNSNNHRKLSRIRSLVDVRSQLLHRSLVEEIHKRRLFKTVG  477

Query  1568  AVENIGYHEPAEYSCKG  1618
             A+ENIG+HEPA  +  G
Sbjct  478   AIENIGFHEPANCAAYG  494



>ref|XP_010931349.1| PREDICTED: probable serine/threonine-protein kinase WNK5 isoform 
X1 [Elaeis guineensis]
Length=633

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/575 (60%), Positives = 403/575 (70%), Gaps = 53/575 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE+ G+EVAWNQ KL ++ RSP+ LQR+YSEV LL  L H SI+R+HASWID  
Sbjct  42    TVYRAFDELNGIEVAWNQAKLCDMLRSPDALQRMYSEVHLLSTLHHESIIRYHASWIDLG  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +RTFNFITE+FTSGTLREYRQRY  V+IRAIKNW  QIL GL YLH HDPPVIHRDLKCD
Sbjct  102   KRTFNFITEMFTSGTLREYRQRYRRVDIRAIKNWACQILHGLTYLHGHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  162   NIFVNGHLGQVKIGDLGLAAVLRGSQSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEML+SEYPYSEC+NPAQIYKKVTSGKLP AFYRI + EAQRFVGRCLE AS+RPSA EL
Sbjct  222   LEMLSSEYPYSECSNPAQIYKKVTSGKLPDAFYRIQDPEAQRFVGRCLETASRRPSAKEL  281

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLL---EVEPCFVDQQA--KSSDMTITGTLNPE  883
             LLDPFLA+D   +    LP  K+I N  L       P   +Q+   K +DMTITG LNPE
Sbjct  282   LLDPFLASDNHHN-PVPLPRIKIIKNTGLEAHGHHAPQIYNQKPTEKMNDMTITGKLNPE  340

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             +DTIFL+VQI+DK+G  RN++FPFDI  DT M+VA EMVKELEITD  P +IAEMI +EI
Sbjct  341   NDTIFLKVQIADKEGHVRNVYFPFDIVIDTPMDVANEMVKELEITDREPSEIAEMIAQEI  400

Query  1064  SALVPTWRSTQYQK--QHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDL---  1228
             S LVP W+     +   H +NY D+++D  N       HPFY LSS +SSQ SL  +   
Sbjct  401   SLLVPGWKEGDVPEDSHHVYNYGDEEEDGCN-------HPFYYLSSPTSSQGSLFGMGPS  453

Query  1229  --------LEKINHDWL---QNDDTSSRSSMNS--YDCSNLCWATESEGDLSSIGGRESL  1369
                      +    DW       D    SSM+S  Y   N     E EG+ +S   RE+ 
Sbjct  454   QGVWSHQHCQSHQEDWFGDDLYFDDDDESSMHSDNYSAVNYTIDNEQEGE-ASCQQRETQ  512

Query  1370  LI--QKTNTGTRLCP--ETSRSNKKKGCCG--------SNHQRPK-------MSRVRSMV  1492
              I  ++T   TR  P  +TS ++K    C         S+ +  K       M R  SMV
Sbjct  513   PIHHKQTRCCTRESPPVDTSVASKFHKQCNILLESSRVSSSRAGKRAVDGYRMMRNHSMV  572

Query  1493  DLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             D+RSQLLHRTL++EVNK RLFKTVGA ENIG+ +P
Sbjct  573   DIRSQLLHRTLLQEVNK-RLFKTVGAFENIGFKDP  606



>ref|XP_011041800.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Populus euphratica]
Length=605

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/569 (57%), Positives = 394/569 (69%), Gaps = 41/569 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE LG+EVAWNQ KL+ V  SP++LQRLYSEV LL+ L+H SI++F+ASWID  
Sbjct  43    TVYKAIDEFLGIEVAWNQAKLSQVLCSPDDLQRLYSEVHLLRILNHDSIIKFYASWIDVR  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNFITE+FTSGTLR+YRQ+YT VNIRAIK W RQILEG+ YLH HDPPVIHRDLKCD
Sbjct  103   GKTFNFITEIFTSGTLRQYRQKYTRVNIRAIKKWARQILEGIVYLHGHDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMCV
Sbjct  163   NIFVNGHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYEENYNELVDVYSFGMCV  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT+EYPYSECTNPAQIYKKVTSGKLPA FYRI + EAQRF+G+CLE ASKR  A EL
Sbjct  223   LEMLTAEYPYSECTNPAQIYKKVTSGKLPAVFYRIKDLEAQRFIGKCLETASKRLPAKEL  282

Query  719   LLDPFLAADEEE-DESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA+DE E  +  ++ +QK   N +  E+E   ++     +DM ITG LN  DDTI
Sbjct  283   LLDPFLASDEAELSQVPRIRNQKSFLNDR--EMEKLQLNDHPPRTDMIITGKLN-RDDTI  339

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+++DG  RNIFFPFDI  DT ++VA EMVKELEI DW P +IA+MID  IS LV
Sbjct  340   FLKVQIANEDGTPRNIFFPFDILHDTPIDVAMEMVKELEIGDWEPFEIADMIDGAISDLV  399

Query  1076  PTWRS---TQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH  1246
             P W+       + +H F+Y        + G++   HPF+S S  SS  +    +   +  
Sbjct  400   PNWKKWDLPHAEPRHIFDY------QEDDGLN---HPFHSSSYSSSHSSLSGLMPHLLQD  450

Query  1247  DWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETSRSN  1426
             D   +  + S S   SY C N     E + DLS+   RE  L  +T   TR CP  + ++
Sbjct  451   DLFDDTSSQSSSHSGSYSCLNYISGDEHKLDLST-RRREKHLDTRTQNSTRFCPRENLNS  509

Query  1427  KKKGCCGSN-----------------------HQRPKMSRVRSMVDLRSQLLHRTLVEEV  1537
                    +N                           +++R RS+VD+RSQLLHR+LVEEV
Sbjct  510   NTGHVLATNAYDNCKVLLDSQSRVSSSKSKRMMDSRRLARNRSLVDIRSQLLHRSLVEEV  569

Query  1538  NKRRLFKTVGAVENIGYHEPAEYSCKGNR  1624
             +KRRL KTVG VE++G+  PAE   K ++
Sbjct  570   HKRRLSKTVGDVEDVGFQAPAEICKKASQ  598



>ref|XP_011041801.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Populus euphratica]
Length=590

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/572 (56%), Positives = 392/572 (69%), Gaps = 62/572 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE LG+EVAWNQ KL+ V  SP++LQRLYSEV LL+ L+H SI++F+ASWID  
Sbjct  43    TVYKAIDEFLGIEVAWNQAKLSQVLCSPDDLQRLYSEVHLLRILNHDSIIKFYASWIDVR  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNFITE+FTSGTLR+YRQ+YT VNIRAIK W RQILEG+ YLH HDPPVIHRDLKCD
Sbjct  103   GKTFNFITEIFTSGTLRQYRQKYTRVNIRAIKKWARQILEGIVYLHGHDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMCV
Sbjct  163   NIFVNGHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYEENYNELVDVYSFGMCV  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT+EYPYSECTNPAQIYKKVTSGKLPA FYRI + EAQRF+G+CLE ASKR  A EL
Sbjct  223   LEMLTAEYPYSECTNPAQIYKKVTSGKLPAVFYRIKDLEAQRFIGKCLETASKRLPAKEL  282

Query  719   LLDPFLAADEEE-DESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFLA+DE E  +  ++ +QK   N +  E+E   ++     +DM ITG LN  DDTI
Sbjct  283   LLDPFLASDEAELSQVPRIRNQKSFLNDR--EMEKLQLNDHPPRTDMIITGKLN-RDDTI  339

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+++DG  RNIFFPFDI  DT ++VA EMVKELEI DW P +IA+MID  IS LV
Sbjct  340   FLKVQIANEDGTPRNIFFPFDILHDTPIDVAMEMVKELEIGDWEPFEIADMIDGAISDLV  399

Query  1076  PTWRS---TQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqas---lPDLLEK  1237
             P W+       + +H F+Y        + G++   HPF+S S  SS  +    +P LL+ 
Sbjct  400   PNWKKWDLPHAEPRHIFDY------QEDDGLN---HPFHSSSYSSSHSSLSGLMPHLLQ-  449

Query  1238  INHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS  1417
                               SY C N     E + DLS+   RE  L  +T   TR CP  +
Sbjct  450   -----------------GSYSCLNYISGDEHKLDLST-RRREKHLDTRTQNSTRFCPREN  491

Query  1418  RSNKKKGCCGSN-----------------------HQRPKMSRVRSMVDLRSQLLHRTLV  1528
              ++       +N                           +++R RS+VD+RSQLLHR+LV
Sbjct  492   LNSNTGHVLATNAYDNCKVLLDSQSRVSSSKSKRMMDSRRLARNRSLVDIRSQLLHRSLV  551

Query  1529  EEVNKRRLFKTVGAVENIGYHEPAEYSCKGNR  1624
             EEV+KRRL KTVG VE++G+  PAE   K ++
Sbjct  552   EEVHKRRLSKTVGDVEDVGFQAPAEICKKASQ  583



>ref|XP_004242485.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Solanum lycopersicum]
Length=636

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/564 (56%), Positives = 397/564 (70%), Gaps = 31/564 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRA DE+LGMEVAW+Q++LN++ +SPE+++RLYSEV LL  L+H SIM+F+ SWID +
Sbjct  43    TVYRAIDELLGMEVAWSQVRLNDLLQSPEDIERLYSEVHLLSTLNHPSIMKFYTSWIDIE  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +RTFNFITELFTSGTLR YR +Y  VNIRA+K W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  103   KRTFNFITELFTSGTLRGYRNKYHRVNIRAVKIWARQILEGLIYLHEHDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF NGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELY+E YDELVD+YSFGMC+
Sbjct  163   NIFANGHLGQVKIGDLGLAAILRGSQRAHSVIGTPEFMAPELYDENYDELVDVYSFGMCM  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC NPAQIYKKV SGK P AFY++ + +AQRF+ +CLEPAS R SA EL
Sbjct  223   LEMLTGEYPYSECVNPAQIYKKVISGKRPRAFYKVQDLDAQRFIRKCLEPASNRSSAKEL  282

Query  719   LLDPFLAADEEEDESAKLPS-QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             +LDPFL  D+ + ES  +   QK I N K+  +E   +++    ++MTITG L+PEDDTI
Sbjct  283   MLDPFLVIDDADSESVTMMRLQKPIYNDKIA-IEDLHLNEDVPRTNMTITGKLHPEDDTI  341

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+DK+G  R+++FPFD  +DT  EVA EMVKELEITDW P +IA MID EIS LV
Sbjct  342   FLKVQIADKEGGVRHVYFPFDTVTDTPTEVANEMVKELEITDWKPCEIANMIDGEISGLV  401

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD--  1249
             P W+     +   ++ +   DDDN+           S S  S S      +++   +D  
Sbjct  402   PQWKKWNQFESSDYHVLSYKDDDNDRHNPFQGFSSSSSSQVSLSGLLSSQVIDTNTNDRR  461

Query  1250  WLQN---DDTSSRSSMNSYDCSNLCWATESEGD-LSSIGGRESLLIQKTNTGT-RLCPET  1414
             WL     DDTSS+ S +S + SN  + ++ E D  ++   R+S      +  T R CPE 
Sbjct  462   WLHGDMFDDTSSQCSSHSANYSNFNYFSDDENDPATTTSTRQSQPATAISHHTSRFCPEE  521

Query  1415  SRSN----------------KKKGCCGSNHQRPK-----MSRVRSMVDLRSQLLHRTLVE  1531
             + +                 + KG   ++  + K     ++R +S+VD+RSQLLH++LVE
Sbjct  522   NSNTGQSLARTCYKQCKAMLESKGTSSNSKGKGKDDARRLTRNKSLVDMRSQLLHKSLVE  581

Query  1532  EVNKRRLFKTVGAVENIGYHEPAE  1603
             EV+KRRLFKTVGAVENIG+ +P E
Sbjct  582   EVHKRRLFKTVGAVENIGFQQPYE  605



>ref|XP_004242486.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Solanum lycopersicum]
Length=617

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/561 (56%), Positives = 397/561 (71%), Gaps = 44/561 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRA DE+LGMEVAW+Q++LN++ +SPE+++RLYSEV LL  L+H SIM+F+ SWID +
Sbjct  43    TVYRAIDELLGMEVAWSQVRLNDLLQSPEDIERLYSEVHLLSTLNHPSIMKFYTSWIDIE  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +RTFNFITELFTSGTLR YR +Y  VNIRA+K W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  103   KRTFNFITELFTSGTLRGYRNKYHRVNIRAVKIWARQILEGLIYLHEHDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF NGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELY+E YDELVD+YSFGMC+
Sbjct  163   NIFANGHLGQVKIGDLGLAAILRGSQRAHSVIGTPEFMAPELYDENYDELVDVYSFGMCM  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC NPAQIYKKV SGK P AFY++ + +AQRF+ +CLEPAS R SA EL
Sbjct  223   LEMLTGEYPYSECVNPAQIYKKVISGKRPRAFYKVQDLDAQRFIRKCLEPASNRSSAKEL  282

Query  719   LLDPFLAADEEEDESAKLPS-QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             +LDPFL  D+ + ES  +   QK I N K+  +E   +++    ++MTITG L+PEDDTI
Sbjct  283   MLDPFLVIDDADSESVTMMRLQKPIYNDKIA-IEDLHLNEDVPRTNMTITGKLHPEDDTI  341

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+VQI+DK+G  R+++FPFD  +DT  EVA EMVKELEITDW P +IA MID EIS LV
Sbjct  342   FLKVQIADKEGGVRHVYFPFDTVTDTPTEVANEMVKELEITDWKPCEIANMIDGEISGLV  401

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRH-PFYs-lssqsssqaslPDLLEKINHD  1249
             P W+     +   ++ +   DDDN+      RH PF    SS SS  +   D+       
Sbjct  402   PQWKKWNQFESSDYHVLSYKDDDND------RHNPFQGFSSSSSSQVSLSGDMF------  449

Query  1250  WLQNDDTSSRSSMNSYDCSNLCWATESEGD-LSSIGGRESLLIQKTNTGT-RLCPETSRS  1423
                 DDTSS+ S +S + SN  + ++ E D  ++   R+S      +  T R CPE + +
Sbjct  450   ----DDTSSQCSSHSANYSNFNYFSDDENDPATTTSTRQSQPATAISHHTSRFCPEENSN  505

Query  1424  N----------------KKKGCCGSNHQRPK-----MSRVRSMVDLRSQLLHRTLVEEVN  1540
                              + KG   ++  + K     ++R +S+VD+RSQLLH++LVEEV+
Sbjct  506   TGQSLARTCYKQCKAMLESKGTSSNSKGKGKDDARRLTRNKSLVDMRSQLLHKSLVEEVH  565

Query  1541  KRRLFKTVGAVENIGYHEPAE  1603
             KRRLFKTVGAVENIG+ +P E
Sbjct  566   KRRLFKTVGAVENIGFQQPYE  586



>gb|KDO36589.1| hypothetical protein CISIN_1g010768mg [Citrus sinensis]
Length=502

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/498 (64%), Positives = 381/498 (77%), Gaps = 31/498 (6%)
 Frame = +2

Query  209   LFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDNIFVNGHLG  388
             +FTSGTLREYR++YT V+IRA+KNW RQIL G+AYLH HDPPVIHRDLKCDNIFVNGHLG
Sbjct  1     MFTSGTLREYRKKYTRVDIRAVKNWARQILRGIAYLHGHDPPVIHRDLKCDNIFVNGHLG  60

Query  389   QVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLEMLTSEYP  565
             QVKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCVLEMLTSEYP
Sbjct  61    QVKIGDLGLAAILRGSQHAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYP  120

Query  566   YSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPFLAAD  745
             YSEC+NPAQIYKKVTSGKLP AF+RI +AEA+RFVG+CLE  SKR  A ELLLDPFLA+D
Sbjct  121   YSECSNPAQIYKKVTSGKLPGAFHRIQDAEARRFVGKCLENVSKRLPAKELLLDPFLASD  180

Query  746   EEED-ESAKLPS-QKLIPNGKLLEVEPCFV--DQQAKSSDMTITGTLNPEDDTIFLRVQI  913
               E     K+PS Q L PNG + E+ P F     + KS+DMTITGT+NPEDDTIFL+VQI
Sbjct  181   AGEPLLIPKVPSFQNLNPNGAVTELVPQFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQI  240

Query  914   SDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR--  1087
             +DKDG+ARNI+FP+DI +DTA EVA EMVKELEITDW PL+IAEMI++EIS+LVP W+  
Sbjct  241   TDKDGQARNIYFPYDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKEC  300

Query  1088  -STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH---DWL  1255
              S Q+  QHSF+Y D+DDD+++ GI    HPFYS SS SSS ASLP       +    WL
Sbjct  301   GSPQFCHQHSFSYEDEDDDNDDYGI---YHPFYSNSSHSSSHASLPAFFTNNANSPPSWL  357

Query  1256  Q------NDDTSSRSSMNSYDCSNLCWATESEGD--LSSIGGRESLLIQKTNTGTRLCPE  1411
             Q      NDD SS  S+NS+  S+  + + +E D   S   G    + + T   TR CPE
Sbjct  358   QQEDLLGNDDASSNGSVNSFKYSSWDYHSGNEDDYEFSHRAGEPLCIARATQKSTRFCPE  417

Query  1412  TSRSNKK---------KGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTV  1564
              + +N +         K C  +++   K+SR+RS+VD+RSQLLHR+LVEE++KRRLFKTV
Sbjct  418   AAMNNDRCNSEDVNSWKACSTNSNNHRKLSRIRSLVDVRSQLLHRSLVEEIHKRRLFKTV  477

Query  1565  GAVENIGYHEPAEYSCKG  1618
             GA+ENIG+HEPA  +  G
Sbjct  478   GAIENIGFHEPANCAAYG  495



>ref|XP_010931350.1| PREDICTED: probable serine/threonine-protein kinase WNK5 isoform 
X2 [Elaeis guineensis]
Length=599

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/573 (60%), Positives = 400/573 (70%), Gaps = 53/573 (9%)
 Frame = +2

Query  8     YRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDRR  187
             YRAFDE+ G+EVAWNQ KL ++ RSP+ LQR+YSEV LL  L H SI+R+HASWID  +R
Sbjct  10    YRAFDELNGIEVAWNQAKLCDMLRSPDALQRMYSEVHLLSTLHHESIIRYHASWIDLGKR  69

Query  188   TFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDNI  367
             TFNFITE+FTSGTLREYRQRY  V+IRAIKNW  QIL GL YLH HDPPVIHRDLKCDNI
Sbjct  70    TFNFITEMFTSGTLREYRQRYRRVDIRAIKNWACQILHGLTYLHGHDPPVIHRDLKCDNI  129

Query  368   FVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLE  544
             FVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCVLE
Sbjct  130   FVNGHLGQVKIGDLGLAAVLRGSQSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCVLE  189

Query  545   MLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLL  724
             ML+SEYPYSEC+NPAQIYKKVTSGKLP AFYRI + EAQRFVGRCLE AS+RPSA ELLL
Sbjct  190   MLSSEYPYSECSNPAQIYKKVTSGKLPDAFYRIQDPEAQRFVGRCLETASRRPSAKELLL  249

Query  725   DPFLAADEEEDESAKLPSQKLIPNGKLL---EVEPCFVDQQA--KSSDMTITGTLNPEDD  889
             DPFLA+D   +    LP  K+I N  L       P   +Q+   K +DMTITG LNPE+D
Sbjct  250   DPFLASDNHHN-PVPLPRIKIIKNTGLEAHGHHAPQIYNQKPTEKMNDMTITGKLNPEND  308

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
             TIFL+VQI+DK+G  RN++FPFDI  DT M+VA EMVKELEITD  P +IAEMI +EIS 
Sbjct  309   TIFLKVQIADKEGHVRNVYFPFDIVIDTPMDVANEMVKELEITDREPSEIAEMIAQEISL  368

Query  1070  LVPTWRSTQY--QKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDL-----  1228
             LVP W+         H +NY D+++D  N       HPFY LSS +SSQ SL  +     
Sbjct  369   LVPGWKEGDVPEDSHHVYNYGDEEEDGCN-------HPFYYLSSPTSSQGSLFGMGPSQG  421

Query  1229  ------LEKINHDWL---QNDDTSSRSSMNS--YDCSNLCWATESEGDLSSIGGRESLLI  1375
                    +    DW       D    SSM+S  Y   N     E EG+ +S   RE+  I
Sbjct  422   VWSHQHCQSHQEDWFGDDLYFDDDDESSMHSDNYSAVNYTIDNEQEGE-ASCQQRETQPI  480

Query  1376  --QKTNTGTRLCP--ETSRSNKKKGCCG--------SNHQRPK-------MSRVRSMVDL  1498
               ++T   TR  P  +TS ++K    C         S+ +  K       M R  SMVD+
Sbjct  481   HHKQTRCCTRESPPVDTSVASKFHKQCNILLESSRVSSSRAGKRAVDGYRMMRNHSMVDI  540

Query  1499  RSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             RSQLLHRTL++EVNK RLFKTVGA ENIG+ +P
Sbjct  541   RSQLLHRTLLQEVNK-RLFKTVGAFENIGFKDP  572



>ref|XP_002325649.2| hypothetical protein POPTR_0019s14910g [Populus trichocarpa]
 gb|EEF00031.2| hypothetical protein POPTR_0019s14910g [Populus trichocarpa]
Length=606

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/570 (57%), Positives = 392/570 (69%), Gaps = 42/570 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE LG+EVAWNQ KL+ V  SPE+LQRLYSEV LL+ L+H SI++F+ASWID  
Sbjct  43    TVYKAIDEFLGIEVAWNQAKLSRVLCSPEDLQRLYSEVHLLRILNHDSIIKFYASWIDVR  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNFITE+FTSGTLR+YRQ+YT VNIRAIK W RQILEG+ YLH HDPPVIHRDLKCD
Sbjct  103   GKTFNFITEMFTSGTLRQYRQKYTRVNIRAIKKWARQILEGIEYLHGHDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIG-TPEFMAPelyeeeydelvdIYSFGMC  535
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIG TPEFMAPELYEE Y+ELVD+YSFGMC
Sbjct  163   NIFVNGHLGQVKIGDLGLAAILRGSQSAHSVIGSTPEFMAPELYEENYNELVDVYSFGMC  222

Query  536   VLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHE  715
             VLEMLT+EYPYSECTNPAQIYKKVTSGKLPA FYRI + EAQRF+G+CLE ASKR  A E
Sbjct  223   VLEMLTAEYPYSECTNPAQIYKKVTSGKLPAVFYRIQDLEAQRFIGKCLETASKRLPAKE  282

Query  716   LLLDPFLAADEEE-DESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDT  892
             LLLDPFLA+DE E     ++ +QK   N +  E+E   ++     +DM ITG LN  DDT
Sbjct  283   LLLDPFLASDEAELSRVPRIRNQKSFLNDR--EMEKLQLNDHPPRTDMIITGKLN-RDDT  339

Query  893   IFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISAL  1072
             IFL+VQI+++DG  RNIFFPFDI  DT ++VA EMVKELEI DW P +IA+MID  IS L
Sbjct  340   IFLKVQIANEDGTPRNIFFPFDILHDTPIDVAMEMVKELEIGDWEPFEIADMIDGAISDL  399

Query  1073  VPTWRS---TQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKIN  1243
             VP W+       + +H F+Y +D             HPF+S S  SS  +        + 
Sbjct  400   VPNWKKWDLPHTEPRHIFDYQED---------DGHNHPFHSSSYSSSHSSLSGSTPHLLQ  450

Query  1244  HDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCP-ETSR  1420
              D   +  + S S   SY C N     E + DLS+   RE  L  +T   TR CP E S 
Sbjct  451   DDLFDDTSSQSSSHSGSYSCLNYISGDEHKLDLSTT-RREKHLDTRTQNSTRFCPRENSN  509

Query  1421  SNKKKGCCGSNHQRPK----------------------MSRVRSMVDLRSQLLHRTLVEE  1534
             SN  +    + +   K                      ++R RS+VD+RSQLLHR+LVEE
Sbjct  510   SNIGQVLATNAYNNCKVLLESKSRVSSSKSKRMMDSRRLTRNRSLVDIRSQLLHRSLVEE  569

Query  1535  VNKRRLFKTVGAVENIGYHEPAEYSCKGNR  1624
             V+KRRL KTVG VE++G+  PAE   K ++
Sbjct  570   VHKRRLSKTVGDVEDVGFQAPAEVCKKASQ  599



>ref|XP_004506432.1| PREDICTED: probable serine/threonine-protein kinase WNK5-like 
[Cicer arietinum]
Length=609

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/584 (57%), Positives = 410/584 (70%), Gaps = 58/584 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VYRAFDEVLG+EVAWNQ+ L++VF SP++LQRLYSEV LLK+LDH SI+ FH +WID +
Sbjct  37    VVYRAFDEVLGIEVAWNQVMLDDVFHSPDQLQRLYSEVHLLKNLDHDSIITFHDTWIDVN  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITELFTSGTLREYR++Y  V+IRAIKNW RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    CRTFNFITELFTSGTLREYRKKYPRVDIRAIKNWGRQILSGLEYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH+G+VKIGDLGLAA+L GS HAHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMC+
Sbjct  157   NIFVNGHMGKVKIGDLGLAAILSGSQHAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCM  216

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +E+ TSE+PY+EC+NPAQIYKKVTSGKLP AFYRI + EAQ+FVG+CL   S+R SA EL
Sbjct  217   IELFTSEFPYNECSNPAQIYKKVTSGKLPEAFYRIQDLEAQKFVGKCLANVSERLSAKEL  276

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEP---CFVDQQAKSSDMTITGTLNPEDD  889
             LLDPFLA D+ +   + LP+   +         P     ++ Q KS+ MTITGT+N EDD
Sbjct  277   LLDPFLATDQLD---SLLPTPTSLSRLNFTTSNPKDKHSLNDQTKSTHMTITGTMNEEDD  333

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
             T+FL+V+I +K+G  RNI+FPFD   DTA+EVA EMVKELEI+D  PL+IAEMI+EEIS 
Sbjct  334   TVFLKVKIFNKNGNTRNIYFPFDTIKDTAIEVANEMVKELEISDLEPLEIAEMIEEEIST  393

Query  1070  LVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKI  1240
             +VPTWR   + +YQ+QHSF Y ++DD +N+       HPF+S S +SSS  SLP      
Sbjct  394   IVPTWRDCDTYKYQRQHSFQYEEEDDINNH-------HPFFSSSPRSSSHDSLPMFCPSY  446

Query  1241  NH-------------DWLQNDDTSSRSSMNSYDCSNL-----CWATESEGDLSSIGGRES  1366
             N+             D   NDD SS+SSMNSY+  N      C   E +G  S   G E 
Sbjct  447   NNSYFRGNQYPFAQDDLFMNDDASSQSSMNSYNYFNFHSNDSCNEDEQQGS-SFAKGEEP  505

Query  1367  LLI--QKTNTGTRLCP---ETSRSNKKKGC--------------CGSNHQRPKMSRVRSM  1489
             L    + +N  TR  P   E      K+ C               G  ++  K++++ S 
Sbjct  506   LCCNPKSSNKWTRFYPQEEEVEAGITKQFCNMRMDSHTHTHKHHHGPRNRCHKLTKINSY  565

Query  1490  VDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP---AEYSC  1612
             VD+R Q L RTL+EE+ KRR+ KTVGA+ENIG+  P     +SC
Sbjct  566   VDIRRQQLQRTLMEEMQKRRMAKTVGAIENIGFKNPEGDGSFSC  609



>gb|KDO49667.1| hypothetical protein CISIN_1g010730mg [Citrus sinensis]
Length=502

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/498 (63%), Positives = 381/498 (77%), Gaps = 31/498 (6%)
 Frame = +2

Query  209   LFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDNIFVNGHLG  388
             +FTSGTLREYR++YT V+IRA+KNW RQIL G+AYLH HDPPVIHRDLKCDNIFVNGHLG
Sbjct  1     MFTSGTLREYRKKYTRVDIRAVKNWARQILRGIAYLHGHDPPVIHRDLKCDNIFVNGHLG  60

Query  389   QVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLEMLTSEYP  565
             Q+KIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCVLEMLTSEYP
Sbjct  61    QIKIGDLGLAAILRGSQQAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTSEYP  120

Query  566   YSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPFLAAD  745
             YSEC+NPAQIYKKVTSGKLP AF+RI +AEA+RFVG+CLE  SKR  A ELLLDPFLA+D
Sbjct  121   YSECSNPAQIYKKVTSGKLPGAFHRIQDAEARRFVGKCLENVSKRLPAKELLLDPFLASD  180

Query  746   EEED-ESAKLPS-QKLIPNGKLLEVEPCFV--DQQAKSSDMTITGTLNPEDDTIFLRVQI  913
               E     ++PS Q L PNG ++E+ P F     + KS+DMTITGT+NPEDDTIFL+VQI
Sbjct  181   AGEPLLIPQVPSFQNLNPNGAVMELVPKFAVDSDRRKSTDMTITGTMNPEDDTIFLKVQI  240

Query  914   SDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR--  1087
             +DKDG+ARNI+FPFDI +DTA EVA EMVKELEITDW PL+IAEMI++EIS+LVP W+  
Sbjct  241   TDKDGQARNIYFPFDIFNDTATEVALEMVKELEITDWEPLEIAEMIEQEISSLVPNWKEC  300

Query  1088  -STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH---DWL  1255
              S Q+  QHSF+Y D+DDD+++ GI    HPFYS SS SSS ASLP       +    WL
Sbjct  301   GSPQFCHQHSFSYEDEDDDNDDDGI---YHPFYSNSSHSSSHASLPAFFTNNANSPPSWL  357

Query  1256  Q------NDDTSSRSSMNSYDCSNLCWATESEGD--LSSIGGRESLLIQKTNTGTRLCPE  1411
             Q      NDD SS  S++S+  S+  + + +E D   S   G    + + T   TR CPE
Sbjct  358   QQEDLLGNDDASSNGSVSSFKYSSWDYHSGNEDDSEFSHRAGEPLCIARATQKSTRFCPE  417

Query  1412  TSRS---------NKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTV  1564
              + +         N +K C  +++   K+SR+RS+VD+RSQLLHR+LVEE++KRRLFKTV
Sbjct  418   AAMNNDRCNSEDVNSRKACRSNSNNHRKLSRIRSLVDVRSQLLHRSLVEEIHKRRLFKTV  477

Query  1565  GAVENIGYHEPAEYSCKG  1618
             GAVENIG+HEPA  +  G
Sbjct  478   GAVENIGFHEPANCAAYG  495



>ref|XP_003553219.1| PREDICTED: probable serine/threonine-protein kinase WNK4-like 
[Glycine max]
 gb|KHN48406.1| Putative serine/threonine-protein kinase WNK4 [Glycine soja]
Length=610

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/560 (57%), Positives = 391/560 (70%), Gaps = 39/560 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAW+Q+KLN   R PE+L+RLY EV LL  L H SIMRF+ SWID D
Sbjct  40    TVYKAIDEVLGIEVAWSQVKLNEALRKPEDLERLYLEVHLLSTLKHQSIMRFYTSWIDVD  99

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNFITE+FTSGTLREYR++Y  + ++AIK+W R IL+GL YLH HDPPVIHRDLKCD
Sbjct  100   NKTFNFITEMFTSGTLREYRKKYKHIGLQAIKSWTRLILQGLVYLHEHDPPVIHRDLKCD  159

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+L GS  AHSVIGTPEFMAPELYEEEY+ELVD+YSFGMCV
Sbjct  160   NIFVNGHLGQVKIGDLGLAAILHGSQPAHSVIGTPEFMAPELYEEEYNELVDVYSFGMCV  219

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTS+YPYSEC NPAQIYKKVTSGKLPA+F+RI++ EAQRF+G+CL  A+KRPSA EL
Sbjct  220   LEMLTSDYPYSECANPAQIYKKVTSGKLPASFFRIEDTEAQRFIGKCLITAAKRPSAKEL  279

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             L DPFL +D+    + K+  QK   N    E+E   +D  +  ++M+ITG LNPE DTIF
Sbjct  280   LNDPFLLSDDASSMT-KIGIQKPFLNYN--EMEKLQLDDVSPRTEMSITGKLNPEHDTIF  336

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQISDKDG  RN++FPFDI +DT ++VA EMVKELEITD  P DIA MI+ EIS L+P
Sbjct  337   LKVQISDKDGSCRNVYFPFDIYTDTPIDVAMEMVKELEITDLKPSDIANMIEGEISVLLP  396

Query  1079  TWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK----INH  1246
               R++                      +TT H F+S SS+SSSQ S+     +    +N 
Sbjct  397   NKRNSNCSVI--------------TMTTTTNHHFHSASSRSSSQGSISGSDSRADDLLNG  442

Query  1247  D-WLQND---DTSSR-SSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPE  1411
             D WL  D   D SS  SS  +Y  SN C   E E +  +   ++  LI K++  TR  P 
Sbjct  443   DYWLHGDVLDDASSICSSHGTYSNSNFCSVDEQEENHKASTRKDKHLIIKSHMCTRFSPN  502

Query  1412  TSRSNKKKGCCGSNHQRP------------KMSRVRSMVDLRSQLLHRTLVEEVNKRRLF  1555
                    +    +  Q P            +++R +S++D RSQLLHR+LVEEVNKRRLF
Sbjct  503   EDPITLNQCKVLAGPQAPSTSKNKRMMDNRRLTRNKSLIDTRSQLLHRSLVEEVNKRRLF  562

Query  1556  KTVGAVENIGYHEPAEYSCK  1615
              TVGAVENIG+  P E + K
Sbjct  563   NTVGAVENIGFVTPYEVTNK  582



>ref|XP_010091078.1| putative serine/threonine-protein kinase WNK5 [Morus notabilis]
 gb|EXB42368.1| putative serine/threonine-protein kinase WNK5 [Morus notabilis]
Length=632

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/588 (57%), Positives = 410/588 (70%), Gaps = 71/588 (12%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VYRAFDEVLGMEVAWNQIKLN+VFRSPEELQRLYSEV LLK+L H SI+RFH SWID D
Sbjct  50    VVYRAFDEVLGMEVAWNQIKLNDVFRSPEELQRLYSEVHLLKNLHHDSIIRFHTSWIDVD  109

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RR FNFITE+FTSGTLREYRQ+Y  V++R++KNW RQIL GL +LH HDPPVIHRDLKCD
Sbjct  110   RRNFNFITEMFTSGTLREYRQKYPRVDLRSVKNWARQILLGLEHLHGHDPPVIHRDLKCD  169

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNGHLGQVK                  IGTPEFMAPELYEEEY+ELVDIYSFGMCVL
Sbjct  170   NIFVNGHLGQVK------------------IGTPEFMAPELYEEEYNELVDIYSFGMCVL  211

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EMLTSEYPY EC+N AQIYKKVTSGKLP AFYRI N+EAQ FVG+CLE  SKR  A ELL
Sbjct  212   EMLTSEYPYCECSNSAQIYKKVTSGKLPEAFYRIQNSEAQIFVGKCLENVSKRLPARELL  271

Query  722   LDPFLAADEEEDE-SAKLPSQKL----IPNGKLLEVEPCFVDQQAKSSDMTITGTLNPED  886
             LDPFLA D+EE + +  +P  ++    + NG + + E        ++++MTITGT++PED
Sbjct  272   LDPFLACDDEEQKLNMPIPRPQMNKSSLFNGTMHKEEDFVEPYLNRTTNMTITGTMSPED  331

Query  887   DTIFLRVQISDKDG-KARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             DTIFL+VQISDKDG  ARNI+FPFDI +DTA++VATEMVKELEI+DW P +IAEMI+E+I
Sbjct  332   DTIFLKVQISDKDGNNARNIYFPFDIVNDTAIDVATEMVKELEISDWEPPEIAEMIEEQI  391

Query  1064  SALVPTWR-------STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslP  1222
              +LVP+W+            +Q SF+Y +++DD++++       PFYS S  SS  + L 
Sbjct  392   YSLVPSWKEWGSPLSEQDLHEQISFSYGEEEDDNDDI----NNRPFYSSSCSSSPNSLLA  447

Query  1223  DL---------LEKINHDWLQ-----NDDTSSRSSMNSYDCSNLCWAT---ESEGDLSSI  1351
              +         +   + +W+Q     NDD SS SS NS++ SN+ + +   E + D +  
Sbjct  448   LISSHFLRGNNMTSCDRNWIQDDPFINDDASSVSSFNSFNYSNVNYYSGTYEDDYDANIK  507

Query  1352  GGRESLLIQKTNTGTRLCP----------ETSRSNKKKGCCG---------SNHQRPKMS  1474
             G  E   +   +  TR  P           + R + +  C             H+ PK++
Sbjct  508   GIGEPFPVTMAHKTTRFRPADIAITSNHCSSPRGSPRAYCLKHHHHQPQQQQQHRPPKLT  567

Query  1475  RVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSCKG  1618
             R+RS+VD+RSQLLHR+LVEE+NKRRLFKTVGAVENIGYHEP     +G
Sbjct  568   RIRSLVDVRSQLLHRSLVEEINKRRLFKTVGAVENIGYHEPGGQFSEG  615



>ref|XP_010535338.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Tarenaya hassleriana]
Length=565

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/561 (56%), Positives = 391/561 (70%), Gaps = 38/561 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE++G+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  3     TVYKAIDEMVGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVH  62

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             R TFNFITELFTSGTLREYR +Y  V+IRAIKNW RQILEGL YLH HDPPVIHRDLKCD
Sbjct  63    RHTFNFITELFTSGTLREYRAKYARVDIRAIKNWSRQILEGLVYLHGHDPPVIHRDLKCD  122

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA +L+ S  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  123   NIFVNGHLGQVKIGDLGLARILQDSRSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  182

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC NPAQIYKKVTSG+LP AFYR++  EAQRF+G+CL  ASKR SA EL
Sbjct  183   LEMITSEFPYSECNNPAQIYKKVTSGRLPEAFYRVEGIEAQRFIGKCLVSASKRVSAKEL  242

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LLDPFLA+DE      + P   L P    +E+E   +D   + + MTITG LNPED TIF
Sbjct  243   LLDPFLASDESWMVCTRNPGD-LKPFLNEIEMETLKLDDDFQRTHMTITGKLNPEDKTIF  301

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQI+D +G ARN++FP+D  +DT+++VA EMVKELEITDW P++IA MID EIS++VP
Sbjct  302   LKVQIADANGPARNVYFPYDTVNDTSIDVAMEMVKELEITDWEPVEIATMIDGEISSMVP  361

Query  1079  TWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWLQ  1258
              W+  +  + H         +           PF+S SS SSS  SL  L  +   DWL+
Sbjct  362   GWKHPEDDETHG--------EHTPDHHHHRHPPFHSSSSYSSSHVSLSGLTTQAVQDWLK  413

Query  1259  N---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS----  1417
             +   D+T S+ S NS    N+ + +  E      G   +  I +T+  TR CPE S    
Sbjct  414   DDFSDETLSQGSSNSGSYPNMNYISADEVIPEKRGSPPA--ITRTHNLTRFCPEESAYSQ  471

Query  1418  -----------------RSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKR  1546
                               S+ +     S+++R  ++R RS+VD++SQLLHR+LVEEV +R
Sbjct  472   SGNLSHRHCNILPNLHASSSSRTRRVASDNRR--LTRNRSLVDVQSQLLHRSLVEEVRRR  529

Query  1547  RLFKTVGAVENIGYHEPAEYS  1609
             RLFKTVG VE +G+  P E S
Sbjct  530   RLFKTVGDVETVGFRSPYEVS  550



>ref|XP_010529931.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Tarenaya 
hassleriana]
Length=595

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/540 (58%), Positives = 384/540 (71%), Gaps = 11/540 (2%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDEVLGMEVAWNQ+KLN VFRSPE LQRLYSEV LLK+L+H SI+R+ +SWID  
Sbjct  48    TVYRAFDEVLGMEVAWNQVKLNEVFRSPEALQRLYSEVHLLKNLNHESIIRYSSSWIDVT  107

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLREYR++Y  V+IRAIK W RQIL GLAYLH HDPPVIHRDLKCD
Sbjct  108   CRTFNFITEMFTSGTLREYRRKYQKVDIRAIKRWARQILNGLAYLHGHDPPVIHRDLKCD  167

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LR S HAHSVIGTPEFMAPELYEE Y+ELVDIYSFGMC+
Sbjct  168   NIFVNGHLGQVKIGDLGLAAILRESQHAHSVIGTPEFMAPELYEEFYNELVDIYSFGMCM  227

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC+NPAQIYKKVTSGKLP AFY I NAEAQRF+G+CL+  S R  A +L
Sbjct  228   LEMLTGEYPYSECSNPAQIYKKVTSGKLPEAFYGIKNAEAQRFIGKCLDTVSMRLPAEQL  287

Query  719   LLDPFLAADEEEDESA---KLPS---QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             LLDPFLA  E+ D       LP    Q L PNG ++E  P       +++DM+ITGT+N 
Sbjct  288   LLDPFLAVSEDIDSVPLYRVLPPPLVQNLAPNGTVVEQLPRSAVDPTRTTDMSITGTMNS  347

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             +D+TIFL+VQISD+DG  RNI FPFDI +DT++EVA EMVKELEITDW PL+IA MI+EE
Sbjct  348   DDNTIFLQVQISDEDGHMRNIHFPFDIVNDTSVEVALEMVKELEITDWEPLEIAGMIEEE  407

Query  1061  ISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKI  1240
             IS+LVP WR   +    S  +    +DD++     T H F ++SS SSS  S     ++ 
Sbjct  408   ISSLVPNWRRQCHAHGPSLAHHSYQNDDDDDDNGKT-HRFCAISSCSSSLDSPVASGKQP  466

Query  1241  NHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETSR  1420
             N +   NDD   R              +         G  E      T  G +   + SR
Sbjct  467   NKNMGFNDDDEHRDHHVRRSGDGSSSNSSFNSSTPQNGEEEEESRDNTGEGVKESRDKSR  526

Query  1421  SNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRL-FKTVGAVENIGYHEP  1597
             ++ +     S  ++P++ +++S+VD+R+Q+LHR+L++ +NKRR  F TV  + ++  H P
Sbjct  527   NSNRVCPENSGRRKPRLQKIKSLVDMRTQVLHRSLMDLINKRRRGFNTVQNINDL--HRP  584



>ref|XP_010535337.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Tarenaya hassleriana]
Length=600

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/561 (56%), Positives = 391/561 (70%), Gaps = 38/561 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE++G+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  38    TVYKAIDEMVGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVH  97

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             R TFNFITELFTSGTLREYR +Y  V+IRAIKNW RQILEGL YLH HDPPVIHRDLKCD
Sbjct  98    RHTFNFITELFTSGTLREYRAKYARVDIRAIKNWSRQILEGLVYLHGHDPPVIHRDLKCD  157

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA +L+ S  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  158   NIFVNGHLGQVKIGDLGLARILQDSRSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  217

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC NPAQIYKKVTSG+LP AFYR++  EAQRF+G+CL  ASKR SA EL
Sbjct  218   LEMITSEFPYSECNNPAQIYKKVTSGRLPEAFYRVEGIEAQRFIGKCLVSASKRVSAKEL  277

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LLDPFLA+DE      + P   L P    +E+E   +D   + + MTITG LNPED TIF
Sbjct  278   LLDPFLASDESWMVCTRNPGD-LKPFLNEIEMETLKLDDDFQRTHMTITGKLNPEDKTIF  336

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQI+D +G ARN++FP+D  +DT+++VA EMVKELEITDW P++IA MID EIS++VP
Sbjct  337   LKVQIADANGPARNVYFPYDTVNDTSIDVAMEMVKELEITDWEPVEIATMIDGEISSMVP  396

Query  1079  TWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWLQ  1258
              W+  +  + H         +           PF+S SS SSS  SL  L  +   DWL+
Sbjct  397   GWKHPEDDETHG--------EHTPDHHHHRHPPFHSSSSYSSSHVSLSGLTTQAVQDWLK  448

Query  1259  N---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS----  1417
             +   D+T S+ S NS    N+ + +  E      G   +  I +T+  TR CPE S    
Sbjct  449   DDFSDETLSQGSSNSGSYPNMNYISADEVIPEKRGSPPA--ITRTHNLTRFCPEESAYSQ  506

Query  1418  -----------------RSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKR  1546
                               S+ +     S+++R  ++R RS+VD++SQLLHR+LVEEV +R
Sbjct  507   SGNLSHRHCNILPNLHASSSSRTRRVASDNRR--LTRNRSLVDVQSQLLHRSLVEEVRRR  564

Query  1547  RLFKTVGAVENIGYHEPAEYS  1609
             RLFKTVG VE +G+  P E S
Sbjct  565   RLFKTVGDVETVGFRSPYEVS  585



>gb|KFK34409.1| hypothetical protein AALP_AA5G141100 [Arabis alpina]
Length=544

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/520 (61%), Positives = 373/520 (72%), Gaps = 42/520 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD+VLGMEVAWNQ+KLN VFRSPE LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  40    TVYKAFDQVLGMEVAWNQVKLNEVFRSPEPLQRLYSEVHLLKNLNHESIIRYFTSWIDVN  99

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             R TFNFITELFTSGTLREYR++Y  V+IRAIK+W RQIL GLAYLH HDPPVIHRDLKCD
Sbjct  100   RTTFNFITELFTSGTLREYRRKYQKVDIRAIKSWARQILNGLAYLHGHDPPVIHRDLKCD  159

Query  362   NIFVNGHLGQVKIGDLGLAAMLR-GSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LR  SHAHSVIGTPEFMAPELYEE+Y++LVDIYSFGMCV
Sbjct  160   NIFVNGHLGQVKIGDLGLAAILRESSHAHSVIGTPEFMAPELYEEDYNQLVDIYSFGMCV  219

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC+NPAQIYKKVTSGKLP +F+ I N EAQ FVG+CLE  SKR SA+EL
Sbjct  220   LEMLTGEYPYSECSNPAQIYKKVTSGKLPESFHLIQNLEAQCFVGKCLETVSKRLSANEL  279

Query  719   LLDPFLAADEEEDESA--KLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDT  892
             L DPFLA  +E D +   +LP Q L  NG + E  P   D   +++DM+ITG +N ED T
Sbjct  280   LEDPFLATADERDLAPIYRLPIQNLAANGTVTEQPPLTTD-PTRTTDMSITGRMNSEDHT  338

Query  893   IFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISAL  1072
             IFL+VQISD DG  RNI FPF+I SDT +EVA EMVKELEITDW PL+I  MI+ EIS L
Sbjct  339   IFLQVQISDGDGHVRNIHFPFNIVSDTPLEVALEMVKELEITDWDPLEITAMIENEISLL  398

Query  1073  VPTWRSTQYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD  1249
             VP WR+     Q HSF + +DDD+DN  G   TR PF S SS   +     D  E  N+D
Sbjct  399   VPNWRAHDSSLQHHSFGH-EDDDEDNGEGEGRTR-PFSSASSSPVAVR---DNKEGFNND  453

Query  1250  WLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETSRSNK  1429
              ++ +D  S SS +  + S   ++  ++ D  S   R  L +QK                
Sbjct  454   IVRGNDGGSGSSNSWLNISTYHYSPATDDDDQSQQHRRRLRLQK----------------  497

Query  1430  KKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRR  1549
                             +RS+VD R+Q+LHR+L+E +NKRR
Sbjct  498   ----------------MRSLVDTRTQVLHRSLMELINKRR  521



>ref|XP_009397082.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=636

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/577 (56%), Positives = 391/577 (68%), Gaps = 55/577 (10%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VYRAFDE+ G EVAWNQ KL+ V RSPE LQRLYSEV LL  L H SI++FHASWID   
Sbjct  45    VYRAFDELNGTEVAWNQAKLSEVIRSPEALQRLYSEVHLLSSLCHESIIKFHASWIDAAN  104

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             RTFNFITE+FTSGTLREYRQRY  V+IR +K W RQIL+G+ YLHSHDPPVIHRDLKCDN
Sbjct  105   RTFNFITEMFTSGTLREYRQRYPRVHIRTVKTWARQILQGILYLHSHDPPVIHRDLKCDN  164

Query  365   IFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             IFVNGHLGQ+KIGDLGLAAMLR +H AHSVIGTPEFMAPE+YEEEY+ELVDIYSFGMCVL
Sbjct  165   IFVNGHLGQLKIGDLGLAAMLREAHCAHSVIGTPEFMAPEVYEEEYNELVDIYSFGMCVL  224

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EMLTSEYPYSEC+NPAQIYKKVTSGKLP AF+RI + +A+RF+GRCLE  SKR SA ELL
Sbjct  225   EMLTSEYPYSECSNPAQIYKKVTSGKLPDAFHRIRDPQAKRFIGRCLETVSKRSSAKELL  284

Query  722   LDPFLAADEEEDESAKL--PSQKL--IPNGKLLEVE----PCFVDQQAKSSDMTITGTLN  877
              DPFLA ++    S  L  PS ++  I +G     +    P      AK +DMTITG +N
Sbjct  285   HDPFLAFEDRPTTSPSLKSPSHEVKNIVHGDYDPSQATDGPGATSPVAKRTDMTITGKMN  344

Query  878   PEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDE  1057
             PEDDTIFL+VQISD++GK  NI+FPFDI  DT+++VA EMVKEL++TD    +IAEMI +
Sbjct  345   PEDDTIFLKVQISDREGKMSNIYFPFDIVGDTSIDVANEMVKELDLTDREASEIAEMIAQ  404

Query  1058  EISALVPTWRSTQYQK-QHSFNYIddddddNNVGISTTRHPFY---------------sl  1189
             EIS LVP WR    +   H +NY++DD D +N       HPFY               S 
Sbjct  405   EISRLVPGWREGAPEDCHHVYNYVEDDQDGSN-------HPFYCLSSPSSSQGSEFGGSS  457

Query  1190  ssqsssqaslPDLLEKINHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESL  1369
             S     Q   P  ++ +     Q+DD  S    + Y   N     E E D  S   +E +
Sbjct  458   SQGIFCQQHNPRQVDWLGDSLFQDDDDKSSVHSSKYSAVNYTSGGELESD-GSFHRKEPM  516

Query  1370  LIQKTNTG---TRLCPETSR------SNKKKGCC---------GSNHQR---PKMSRVRS  1486
              +  +++    TR CPE S       S+K    C         G   +R    ++ R +S
Sbjct  517   PLVPSSSRCKWTRFCPEDSSAEDDYISHKLHEKCNILTEASHVGGGKRRVDSRRLMRNQS  576

Query  1487  MVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             M+D+RSQLLH+ LVEE+NK R+FKTVGAVENIG+  P
Sbjct  577   MMDVRSQLLHKALVEELNK-RMFKTVGAVENIGFQVP  612



>ref|XP_007146868.1| hypothetical protein PHAVU_006G077100g [Phaseolus vulgaris]
 gb|ESW18862.1| hypothetical protein PHAVU_006G077100g [Phaseolus vulgaris]
Length=613

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/552 (56%), Positives = 383/552 (69%), Gaps = 19/552 (3%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ+KLN  FR PE+L+RLY EV LL  L H SIMRF+ SWID +
Sbjct  40    TVYKAIDEVLGIEVAWNQVKLNEAFRKPEDLERLYLEVHLLSTLKHQSIMRFYTSWIDVN  99

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNFITE+FTSGTLREYR++Y  + ++AIK+W RQIL+GL YLH HDPPVIHRDLKCD
Sbjct  100   NKTFNFITEMFTSGTLREYRKKYKHIGLKAIKSWARQILQGLVYLHEHDPPVIHRDLKCD  159

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+L GS  AHSVIGTPEFMAPELYEEEY+ELVD+YSFGMCV
Sbjct  160   NIFVNGHLGQVKIGDLGLAAILHGSQPAHSVIGTPEFMAPELYEEEYNELVDVYSFGMCV  219

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTS+YPYSECTNPAQIYKKVTSGKLPAAF+RI++ EAQ+F+G+CL  A+ RPSA EL
Sbjct  220   LEMLTSDYPYSECTNPAQIYKKVTSGKLPAAFFRIEDTEAQKFIGKCLIAAANRPSAKEL  279

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             L D FL +++     AK+  QK  P     E+E   +      + M+ITG LNPEDDTIF
Sbjct  280   LNDQFLLSNDAS-AMAKIGIQK--PFLNYSEMETLQLSDDLPMTKMSITGKLNPEDDTIF  336

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+V+IS KDG  RN++FPFDI +DT ++VA EMVKELEITD  P DIA MI+ EIS L+P
Sbjct  337   LKVKISQKDGSCRNVYFPFDIYTDTPIDVAIEMVKELEITDLKPSDIASMIEGEISVLLP  396

Query  1079  TWRSTQYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWL  1255
              WR++      H+F+Y DD D+++      +     S    +       D L    H WL
Sbjct  397   NWRNSNCPDTWHAFSYNDDKDNEDPHHHFHSVSSCSSSQESTPGLVIRVDDLLNGCH-WL  455

Query  1256  QNDDTSSRSSM-NSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETSRSNKK  1432
               D     SS+ +S+  SN C   + E    +   ++   I K++  TR  P        
Sbjct  456   HGDGLDDASSICSSHGNSNFCSVDDQEEHNKASTKKDKHPIIKSHMCTRFSPNEDPITVS  515

Query  1433  KGCCGSNHQRP-----------KMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVEN  1579
                  +  Q P           ++SR +S++D RSQLLHR+LVEE+NKRR FKTVGAVEN
Sbjct  516   HCKILAGPQTPTGKSNRMIDNRRLSRNKSLIDTRSQLLHRSLVEEINKRR-FKTVGAVEN  574

Query  1580  IGYHEPAEYSCK  1615
             IG+  P E + K
Sbjct  575   IGFVTPYEVTNK  586



>ref|XP_008792207.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Phoenix 
dactylifera]
Length=627

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/582 (57%), Positives = 386/582 (66%), Gaps = 62/582 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  GMEVAWNQ KL +V RSP+ LQR+YSEV +L  L H SI+ +H SWID  
Sbjct  39    TVYRAFDEQNGMEVAWNQAKLCDVLRSPDALQRMYSEVHILSTLHHESIISYHTSWIDVG  98

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +RTFNFITE+FTSG LREYRQRY  V+IRAIKNW  QIL GL YLH HDPPVIHRDLKCD
Sbjct  99    KRTFNFITEMFTSGALREYRQRYRRVDIRAIKNWACQILHGLVYLHGHDPPVIHRDLKCD  158

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCV
Sbjct  159   NIFVNGHLGQVKIGDLGLAAVLRGSQSAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCV  218

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC+NPAQIYKKVTSGKLP AF+RI + EA+RF+GRCLE AS+RPSA EL
Sbjct  219   LEMLTSEYPYSECSNPAQIYKKVTSGKLPDAFHRIQDPEARRFLGRCLETASRRPSAKEL  278

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQ--AKSSDMTITGTLNPEDDT  892
             LLDPFLA+D   D    +P QK     K+++  P   + +   K +DMTITG LNPEDDT
Sbjct  279   LLDPFLASD---DHHNPVPLQKYASRIKVIKDAPEIYNLKPTKKRTDMTITGKLNPEDDT  335

Query  893   IFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISAL  1072
             IFL+VQI+DK+G  RNI+FPFDI  DT  +VA EMVKELEITD  P +IAEMI +EIS L
Sbjct  336   IFLKVQIADKEGHVRNIYFPFDIVIDTPSDVANEMVKELEITDREPSEIAEMIAQEISVL  395

Query  1073  VPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqas----------lP  1222
             +P W      +  + +++    DD   G +   HPFY LSS +SSQ S            
Sbjct  396   MPGWNEGDVPENSNSHHVYSFGDDEEDGCN---HPFYYLSSPTSSQGSLFGTRPSQGWSH  452

Query  1223  DLLEKINHDWL-----QNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTN  1387
                +    DW       +DD  S    + Y  +N     E EG+ +S   RE+  I   +
Sbjct  453   QQRQSHQEDWFGDDLYSDDDDKSSMHSDKYSAANYTSDNELEGE-ASCHRRETQPIHHKS  511

Query  1388  T--GTRLCPETSRSNKKK--------------------------GCCGSNHQRPKMSRVR  1483
             T   TR  P    S   K                          GCC        M R  
Sbjct  512   TRFCTRESPPVDASLASKFHRQCNEILSESSRASSSRAGKRAVDGCC--------MMRNY  563

Query  1484  SMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYS  1609
             SMVD+RSQLL RT VEEVNK RLFKTVGA +NIG+ +P E S
Sbjct  564   SMVDIRSQLLQRTFVEEVNK-RLFKTVGAFQNIGFKDPTEGS  604



>ref|XP_008463255.1| PREDICTED: probable serine/threonine-protein kinase WNK5 isoform 
X3 [Cucumis melo]
Length=575

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/566 (55%), Positives = 397/566 (70%), Gaps = 55/566 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+ FDEVLG+EVAWNQ+ L +VF SPEEL+RLYSEV LLK+L+H+SI+RF+ SWIDT 
Sbjct  31    TVYKGFDEVLGIEVAWNQVHLKDVFHSPEELERLYSEVHLLKNLNHNSIIRFYTSWIDTH  90

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYRQ+Y  ++I AIKNW RQIL GL YLH HDPPVIHRDLKCD
Sbjct  91    RRTFNFITEMFTSGTLREYRQKYQNIDIEAIKNWARQILHGLVYLHGHDPPVIHRDLKCD  150

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             N+F+NGHLGQVKIGDLGLA +L GS +AHSVIGTPEFMAPELY+EEY+ELVD+YSFGMC+
Sbjct  151   NVFINGHLGQVKIGDLGLATILHGSQNAHSVIGTPEFMAPELYDEEYNELVDVYSFGMCM  210

Query  539   LEMLTSEYPYSECTNPAQIYKKVTS---GKLPAAFYRIDNAEAQRFVGRCLEPASKRPSA  709
             +EMLT EYPY+EC+NPAQIYKKVTS   GKLP AFY I + EAQRFV +CLE  SKR SA
Sbjct  211   IEMLTLEYPYNECSNPAQIYKKVTSKLQGKLPNAFYEIKDLEAQRFVRKCLENVSKRVSA  270

Query  710   HELLLDPFLAADEEEDES--AKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPE  883
              ELLL+PFLA     + S   +L S  L P   ++          A+ +D+ I+G++NP+
Sbjct  271   RELLLEPFLAPSNSNNVSHNEELVSSSLSPEKSIM----------ARRTDLAISGSINPK  320

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELE-ITDWMPLDIAEMIDEE  1060
             DD+IFL+VQI  K+GK++N++F FDI +DTA++VATEMVKELE I+DW PL+IA MI++E
Sbjct  321   DDSIFLKVQIKVKNGKSKNVYFAFDILNDTAIDVATEMVKELEIISDWDPLEIAVMIEKE  380

Query  1061  ISALVPTWRSTQYQKQH---SFNY------IddddddNNVGISTTRHPFYslssqsssqa  1213
             IS+L+P W   ++ + H   SFNY       DD+DDD++     T HPFY   S   S +
Sbjct  381   ISSLIPDWEEWKFPEIHHQDSFNYEQDHNGNDDNDDDDDDENYATPHPFYYCGSSHGSSS  440

Query  1214  slPDLLEKINHDW--LQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTN  1387
                       HD+   + +       M++   +   +  E E D S+I GRES  I  T 
Sbjct  441   DSL-------HDFYPFRENPNHHFGGMDT-SITTEWFRDEYEYD-SNIKGRESRYISTTK  491

Query  1388  TGTRLCPET----------------SRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHR  1519
               TR CP                  +R   + G   +N   P+++RV+SMV+LRS+ LHR
Sbjct  492   QPTRFCPTMKIDSHHLRHKDTRIIPNRETFENGSLSNN--SPRITRVKSMVNLRSETLHR  549

Query  1520  TLVEEVNKRRLFKTVGAVENIGYHEP  1597
              LVE + K+RLF TVGA+ENIG+ +P
Sbjct  550   YLVETLLKKRLFNTVGAMENIGFQKP  575



>ref|XP_009397081.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=640

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/581 (56%), Positives = 391/581 (67%), Gaps = 59/581 (10%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VYRAFDE+ G EVAWNQ KL+ V RSPE LQRLYSEV LL  L H SI++FHASWID   
Sbjct  45    VYRAFDELNGTEVAWNQAKLSEVIRSPEALQRLYSEVHLLSSLCHESIIKFHASWIDAAN  104

Query  185   RTFNFITELFTSGTLRE----YRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDL  352
             RTFNFITE+FTSGTLRE    YRQRY  V+IR +K W RQIL+G+ YLHSHDPPVIHRDL
Sbjct  105   RTFNFITEMFTSGTLRENGFRYRQRYPRVHIRTVKTWARQILQGILYLHSHDPPVIHRDL  164

Query  353   KCDNIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFG  529
             KCDNIFVNGHLGQ+KIGDLGLAAMLR +H AHSVIGTPEFMAPE+YEEEY+ELVDIYSFG
Sbjct  165   KCDNIFVNGHLGQLKIGDLGLAAMLREAHCAHSVIGTPEFMAPEVYEEEYNELVDIYSFG  224

Query  530   MCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSA  709
             MCVLEMLTSEYPYSEC+NPAQIYKKVTSGKLP AF+RI + +A+RF+GRCLE  SKR SA
Sbjct  225   MCVLEMLTSEYPYSECSNPAQIYKKVTSGKLPDAFHRIRDPQAKRFIGRCLETVSKRSSA  284

Query  710   HELLLDPFLAADEEEDESAKL--PSQKL--IPNGKLLEVE----PCFVDQQAKSSDMTIT  865
              ELL DPFLA ++    S  L  PS ++  I +G     +    P      AK +DMTIT
Sbjct  285   KELLHDPFLAFEDRPTTSPSLKSPSHEVKNIVHGDYDPSQATDGPGATSPVAKRTDMTIT  344

Query  866   GTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAE  1045
             G +NPEDDTIFL+VQISD++GK  NI+FPFDI  DT+++VA EMVKEL++TD    +IAE
Sbjct  345   GKMNPEDDTIFLKVQISDREGKMSNIYFPFDIVGDTSIDVANEMVKELDLTDREASEIAE  404

Query  1046  MIDEEISALVPTWRSTQYQK-QHSFNYIddddddNNVGISTTRHPFY-------------  1183
             MI +EIS LVP WR    +   H +NY++DD D +N       HPFY             
Sbjct  405   MIAQEISRLVPGWREGAPEDCHHVYNYVEDDQDGSN-------HPFYCLSSPSSSQGSEF  457

Query  1184  --slssqsssqaslPDLLEKINHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGG  1357
               S S     Q   P  ++ +     Q+DD  S    + Y   N     E E D  S   
Sbjct  458   GGSSSQGIFCQQHNPRQVDWLGDSLFQDDDDKSSVHSSKYSAVNYTSGGELESD-GSFHR  516

Query  1358  RESLLIQKTNTG---TRLCPETSR------SNKKKGCC---------GSNHQR---PKMS  1474
             +E + +  +++    TR CPE S       S+K    C         G   +R    ++ 
Sbjct  517   KEPMPLVPSSSRCKWTRFCPEDSSAEDDYISHKLHEKCNILTEASHVGGGKRRVDSRRLM  576

Query  1475  RVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             R +SM+D+RSQLLH+ LVEE+NK R+FKTVGAVENIG+  P
Sbjct  577   RNQSMMDVRSQLLHKALVEELNK-RMFKTVGAVENIGFQVP  616



>ref|XP_007140097.1| hypothetical protein PHAVU_008G084000g [Phaseolus vulgaris]
 gb|ESW12091.1| hypothetical protein PHAVU_008G084000g [Phaseolus vulgaris]
Length=620

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/573 (56%), Positives = 388/573 (68%), Gaps = 54/573 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE+LG+EVAWNQ+KL +VF SPE+LQRLYSEV LLK L+H S+M F+ SWID +
Sbjct  51    TVYRAFDELLGIEVAWNQVKLGDVFHSPEQLQRLYSEVHLLKHLNHDSMMIFYGSWIDVN  110

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNF+TELFTSGTLREYRQ+Y  V+IRA+K W RQIL GL YLHSH+PPVIHRDLKCD
Sbjct  111   NRTFNFVTELFTSGTLREYRQKYKRVDIRAVKIWARQILGGLEYLHSHNPPVIHRDLKCD  170

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH G+VKIGDLGLAA+LR S HAHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMC+
Sbjct  171   NIFVNGHQGRVKIGDLGLAAILRSSQHAHSVIGTPEFMAPELYEEKYNELVDIYSFGMCM  230

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +E+LT E+PYSEC NPAQIYKKVTSGKLP AFYRI + EAQ+FVG+CL   S RPSA EL
Sbjct  231   IELLTFEFPYSECANPAQIYKKVTSGKLPNAFYRIPDLEAQKFVGKCLSNVSDRPSAKEL  290

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVD---QQAKSSDMTITGTLNPEDD  889
             LLDPFLA D+ E               KL  + P  +D    Q KS++MTITG++N ED+
Sbjct  291   LLDPFLAVDQLEIPLPPNIPLLPNHTLKLNSIPPLPIDLHRDQTKSAEMTITGSINEEDN  350

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
             T+FL+V+ISD  G  R++FFPFD   DTA++VA EMV+ELEI+   PL+IA MID E+SA
Sbjct  351   TVFLKVKISDITGHTRHVFFPFDTLKDTAIQVAMEMVQELEISHLEPLEIAAMIDYEVSA  410

Query  1070  LVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFY----------------sls  1192
             LVPTWR      +Q+QHSFNY +D+D +N+       HPF+                +  
Sbjct  411   LVPTWRDRVKCHHQRQHSFNYEEDEDVNNH-------HPFFLSSSPSSPRGSGHTASNSF  463

Query  1193  sqsssqaslPDLLEKINHD-WLQNDDTSSRSSMNSYDCSNLCW---ATESEGD-------  1339
                      P  LE    D ++ NDD SS++SMNS+  S   +     E E D       
Sbjct  464   KTHVCGNHYPFALEGPQDDMFMNNDDASSQASMNSFKYSTFQFCDPGHEDEHDGTERHKW  523

Query  1340  --LSSIGGRESLLIQKTNTGTRLCPETSRSNKKKGC-CGSNHQRPKMSRVRSMV-DLRSQ  1507
               LS  GG E    +       L P   R     GC  GS H  P+++R+RS   + RSQ
Sbjct  524   TTLSYRGGGE----EGEPANPVLNP--PRMECSCGCRLGSGHGCPRLTRIRSCPHERRSQ  577

Query  1508  LLHRTL-VEEVNK--RRLFKTVGAVENIGYHEP  1597
              L R++ +EE+ K  RR   TVG VENIG+  P
Sbjct  578   QLQRSMMLEEIYKYNRRFLNTVGTVENIGFRHP  610



>gb|KHN40619.1| Putative serine/threonine-protein kinase WNK5 [Glycine soja]
Length=616

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/572 (55%), Positives = 392/572 (69%), Gaps = 49/572 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE+LG+EVAWNQ+KL +VF SPE+LQRLYSEV LLK L+H S+M F+ SWID +
Sbjct  51    TVYRAFDELLGIEVAWNQVKLGDVFHSPEQLQRLYSEVHLLKHLNHDSMMIFYGSWIDVN  110

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNF+TELFTSGTLREYRQ+Y  V+I A+KNW RQIL GL YLHSH+PPVIHRDLKCD
Sbjct  111   NKTFNFVTELFTSGTLREYRQKYKRVDITAVKNWARQILSGLEYLHSHNPPVIHRDLKCD  170

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH G+VKIGDLGLAA+L+ S HAHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMC+
Sbjct  171   NIFVNGHQGRVKIGDLGLAAILKSSQHAHSVIGTPEFMAPELYEEKYNELVDIYSFGMCM  230

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +EMLT E+PYSEC NPAQIYKKVTSGK+P AFYRI+N EAQ+FVG+CL   S+RPSA EL
Sbjct  231   IEMLTFEFPYSECANPAQIYKKVTSGKIPEAFYRIENLEAQKFVGKCLANVSERPSAKEL  290

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVE-----PCFVDQQAKSSDMTITGTLNPE  883
             LLDPFLA ++ E +    PS   +   K  ++      P     Q KS+DMTITG++N E
Sbjct  291   LLDPFLAMEQLEIQLP--PSIPALFTNKSFKLSCPAPFPSEHRDQTKSADMTITGSINEE  348

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             D+T+FL+V+ISD  G  R++FFPFD   DTA++VA EMV+ELEI+   P +I  MID E+
Sbjct  349   DNTVFLKVRISDIMGHTRHVFFPFDTLKDTAIQVAMEMVQELEISHLEPFEIGAMIDHEV  408

Query  1064  SALVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqasl-----  1219
             SALVPTWR      +Q+Q+SFNY +D+D +N+       HPF+  SS SS + S      
Sbjct  409   SALVPTWRDRVKCHHQRQYSFNYEEDEDVNNH-------HPFFLSSSPSSPRGSGHMSAS  461

Query  1220  ------------PDLLEKINHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRE  1363
                         P   E    D   NDD SS++SMNS+ CS+     E E    + G   
Sbjct  462   NSFKTHFRGNHCPFTQEWPQDDPFMNDDASSQASMNSFKCSSFDPGHEDEHATPTDGPER  521

Query  1364  -------SLLIQ--KTNTGTRLCPETSRSNKKKGCC--GSNHQRPKMSRVRSMV-DLRSQ  1507
                    S  I+  + N          R N   GC   GS+H  P+++R+RS   + RSQ
Sbjct  522   KKCTPLLSYRIEEPEPNFTKPFNYYPPRMNSSCGCSRFGSSHACPRLTRIRSCPHERRSQ  581

Query  1508  LLHRTLVEEV--NKRRLFKTVGAVENIGYHEP  1597
                  ++EE+   KRR F TVGAVENIG+  P
Sbjct  582   QQRSMMLEEMYKYKRRFFNTVGAVENIGFQHP  613



>ref|XP_010503860.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Camelina 
sativa]
Length=548

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/526 (60%), Positives = 374/526 (71%), Gaps = 51/526 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD VLGMEVAWNQ+KLN VFRSPE LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  40    TVYKAFDHVLGMEVAWNQVKLNEVFRSPEPLQRLYSEVHLLKNLNHESIIRYCTSWIDVN  99

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELFTSGTLREYR++Y  V+IRAIK+W RQIL GLAYLH HDPPVIHRDLKCD
Sbjct  100   RRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWARQILNGLAYLHGHDPPVIHRDLKCD  159

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS +AHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCV
Sbjct  160   NIFVNGHLGQVKIGDLGLAAILRGSQNAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCV  219

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT +YPYSECTNPAQIYKKVT+GKLP +F+ I N EAQRFVG+CLE  S+R  A EL
Sbjct  220   LEMLTGDYPYSECTNPAQIYKKVTAGKLPESFHLIQNMEAQRFVGKCLETVSRRLPAKEL  279

Query  719   LLDPFLAADEEEDES--AKLPS----QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             L DPFLAA +E D +  ++LP     Q L  NG LLE  P   D   +++DM+ITG +N 
Sbjct  280   LEDPFLAATDERDLAHLSRLPPQLAIQNLAANGTLLEHPPSTSD-PTRTTDMSITGRMNS  338

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             ED  IFL+VQI D DG  RNI FPF+I SDT +EVA EMVKELEITDW PL+IA MI+ E
Sbjct  339   EDHNIFLQVQILDGDGHMRNIQFPFNILSDTPLEVALEMVKELEITDWDPLEIASMIENE  398

Query  1061  ISALVPTWRSTQYQKQH-SFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK  1237
             IS LVP WR+     +H SF + D++++++      TR  FYS SS   S  ++ D    
Sbjct  399   ISLLVPNWRANDSSIRHESFGHEDEEENEDAE--ERTR-LFYSASSSHDSPVAVED----  451

Query  1238  INHDWLQND--DTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPE  1411
              N+D   ND  D SSRSS N  + S   ++   + D S    R   L QK          
Sbjct  452   -NNDGSSNDVMDGSSRSSNNWLNASTYHYSPAIDDDQSQHQRRRVRLQQK----------  500

Query  1412  TSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRR  1549
                                   +RS+VD R+Q+LHR+L+E +NKRR
Sbjct  501   ----------------------MRSLVDTRTQVLHRSLMELINKRR  524



>ref|XP_009410523.1| PREDICTED: probable serine/threonine-protein kinase WNK5 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=572

 Score =   539 bits (1388),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 313/560 (56%), Positives = 375/560 (67%), Gaps = 49/560 (9%)
 Frame = +2

Query  8     YRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDRR  187
             Y+AFDE+ G EVAWNQ KL ++ RSPE LQR+YSEV LL  L H SI+RFHASWID + R
Sbjct  10    YKAFDELNGTEVAWNQAKLCSMLRSPEALQRMYSEVHLLSSLHHESIIRFHASWIDVENR  69

Query  188   TFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDNI  367
             TFNFITE+F SGTLREYR+RY  VNI AIK+W RQIL GLAYLH HDPPVIHRD+KCDNI
Sbjct  70    TFNFITEMFASGTLREYRRRYPHVNIGAIKSWARQILHGLAYLHRHDPPVIHRDIKCDNI  129

Query  368   FVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLEM  547
              +NGHLG VKI D GLAA+LRGS  H+VIGTPEFMAPE+YEEEY+ELVDIYSFGMCVLEM
Sbjct  130   LINGHLGHVKISDFGLAAILRGSQ-HTVIGTPEFMAPEIYEEEYNELVDIYSFGMCVLEM  188

Query  548   LTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLLD  727
             LTSEYPYSEC NPAQIYKKVTSG+LP AFYRI + EA+RFVGRCLE  SKRPSA ELLLD
Sbjct  189   LTSEYPYSECYNPAQIYKKVTSGRLPDAFYRIQDPEAKRFVGRCLEDVSKRPSAEELLLD  248

Query  728   PFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRV  907
             PFLA  +    +  +   +      L  +E    +     +DMTITG +NPEDDTIFLRV
Sbjct  249   PFLALGDHTVPADAVTGIRSQDQDGLHSMEFHDANSTVWRTDMTITGKMNPEDDTIFLRV  308

Query  908   QISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             QI+D +G  RNI FPFDI  DT ++VA EMVKELEITD  P +IAEMI +E +ALVP W+
Sbjct  309   QIADAEGHVRNIHFPFDIVCDTPIDVANEMVKELEITDREPSEIAEMIAQETTALVPDWK  368

Query  1088  STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsss------qaslPDLLEKINH-  1246
             +T      + N +    +  +       HPFY+LSS +SS            +L++  H 
Sbjct  369   ATS-----APNSVFRVYNYEDDAEDGCNHPFYNLSSSASSQGSVFGTGHRLGMLDQQQHP  423

Query  1247  ---DWLQNDDTSSR-----------SSMNSYDCSNLCWATESEGDLSSIG-------GRE  1363
                +W Q D  S             S+MN Y   +     E E  +S  G       G +
Sbjct  424   HQEEWFQGDPHSDEDAVSYTQSGRYSAMNYYSSRD-----EQESKVSFHGSHKSTKLGED  478

Query  1364  SLLIQKTNTGTRLCPETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNK  1543
             + L  +      + PE SR    K   G      +++R RSMVD+RSQLLHR LVE++ K
Sbjct  479   AALADEFCKQCNILPERSR----KPVGGQ-----RLTRNRSMVDMRSQLLHRNLVEQL-K  528

Query  1544  RRLFKTVGAVENIGYHEPAE  1603
             +RLFKTVGAVENIG+  P +
Sbjct  529   KRLFKTVGAVENIGFQTPCD  548



>ref|XP_010426735.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Camelina 
sativa]
Length=548

 Score =   537 bits (1383),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 312/526 (59%), Positives = 371/526 (71%), Gaps = 51/526 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD VLGMEVAWNQ+KLN VFRSPE LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  40    TVYKAFDHVLGMEVAWNQVKLNEVFRSPEPLQRLYSEVHLLKNLNHESIIRYCTSWIDVN  99

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELFTSGTLREYR++Y  V+IRAIK+W RQIL GLAYLH HDPPVIHRDLKCD
Sbjct  100   RRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWARQILNGLAYLHGHDPPVIHRDLKCD  159

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS +AHSVIGTPEFMAPELY E+Y ELV IYSFGMCV
Sbjct  160   NIFVNGHLGQVKIGDLGLAAILRGSQNAHSVIGTPEFMAPELYGEDYHELVGIYSFGMCV  219

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT +YPYSECTNPAQIYKKVT+GKLP +F+ I N EAQRFVG+CLE  S+R  A EL
Sbjct  220   LEMLTGDYPYSECTNPAQIYKKVTAGKLPESFHLIQNMEAQRFVGKCLETVSRRLPAKEL  279

Query  719   LLDPFLAADEEEDES--AKLPS----QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             L DPFLAA +E D +  ++LP     Q L  NG +LE  P   D   +++DM+ITG +N 
Sbjct  280   LEDPFLAATDERDLAPLSRLPPQLAIQNLAANGTVLEHLPSTSD-PTRTTDMSITGRMNS  338

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             ED  IFL+VQI D DG  RNI FPF+I SDT +EVA EMVKELEITDW PL+IA MI+ E
Sbjct  339   EDHNIFLQVQILDGDGHMRNIQFPFNILSDTPLEVALEMVKELEITDWDPLEIAAMIENE  398

Query  1061  ISALVPTWRSTQYQKQH-SFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK  1237
             IS LVP WR+     +H SF + D++++++     +TR  F S SS   S  ++ D    
Sbjct  399   ISLLVPNWRANDSSIRHESFGHEDEEENEDAE--ESTR-LFSSASSSHDSPVAVGD----  451

Query  1238  INHDWLQND--DTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPE  1411
              N+D   ND  D SSRSS N  + S   ++   + D S    R   L QK          
Sbjct  452   -NNDGSSNDVMDGSSRSSNNWLNASTYHYSPAIDDDQSQHQRRRVRLQQK----------  500

Query  1412  TSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRR  1549
                                   +RS+VD R+Q+LHR+L+E +NKRR
Sbjct  501   ----------------------MRSLVDTRTQVLHRSLMELINKRR  524



>gb|KEH29201.1| WNK kinase [Medicago truncatula]
Length=620

 Score =   539 bits (1389),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 329/588 (56%), Positives = 407/588 (69%), Gaps = 66/588 (11%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VYRAFDEVLG+EVAWNQIKL++VF SP++LQRLYSEV LLK+LDH SIM FH +WID + 
Sbjct  38    VYRAFDEVLGIEVAWNQIKLDDVFHSPDQLQRLYSEVHLLKNLDHDSIMTFHGTWIDANC  97

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             RTFNFITELFTSGTLREYR++Y  V+IRAIKNW RQIL GL YLHSHDPPVIHRDLKCDN
Sbjct  98    RTFNFITELFTSGTLREYRKKYPRVDIRAIKNWARQILSGLEYLHSHDPPVIHRDLKCDN  157

Query  365   IFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             IFVNGH+G+VKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEEEY+ELVDIYSFGMC++
Sbjct  158   IFVNGHMGKVKIGDLGLAAILRGSQHAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCMI  217

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             E+ TSE+PYSEC+NPAQIYKKVTSGKLP AF +I + E Q+F+G+CL   S+R SA ELL
Sbjct  218   ELFTSEFPYSECSNPAQIYKKVTSGKLPKAFDKIHDEETQKFIGKCLANVSERLSAKELL  277

Query  722   LDPFLAADEEEDESAKLPSQKLIP--------NGKLLEVEPCFVDQQAKSSDMTITGTLN  877
             +DPFLA    +   + LPS  L+         N  + + +P  +     S+ MTITGT+N
Sbjct  278   MDPFLATAHHD---SPLPSPTLVSKHTQQINFNATIAKEQPP-LKNATNSTHMTITGTIN  333

Query  878   PEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDE  1057
              ED T+FL+V+IS+K+G  RNI+FPFD   DTA+EVA EMVKELEI+D  P++IAEMI+E
Sbjct  334   EEDGTVFLKVKISNKNGHTRNIYFPFDTKKDTAIEVANEMVKELEISDLEPIEIAEMIEE  393

Query  1058  EISALVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDL  1228
             EIS +VPTWR   S++YQ+QHSF Y     ++++  IS   HPF+S  S+SSS  SLP  
Sbjct  394   EISTIVPTWRDCCSSKYQRQHSFIY----GEEDDHDIS-NHHPFFSPPSRSSSHGSLPMF  448

Query  1229  LEKINH-------------DWLQ------NDDTSSRSSMNS-----YDCSNLCWATESEG  1336
                 N+             DW Q      NDD SS+SS NS     Y C++ C   E + 
Sbjct  449   CASYNNNSNHCGNHYSFAQDWPQDDLQYMNDDASSQSSTNSFKSFNYHCNDSC--NEDDQ  506

Query  1337  DLSSIGGRESLLI--QKTNTGTRLCP--ETSRSNKKKGCC---------------GSNHQ  1459
               + + G E L    +  N  TR  P  E   +   K  C               G  H 
Sbjct  507   GTNQVVGEEPLCCNPKSHNKWTRFGPPEEMVEAGFTKQFCNKRMDSHTHTHRNHHGQRHG  566

Query  1460  RPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAE  1603
               +++R+ S VD+R Q L R+L+EE+ K R+F TVGA+EN+G+  P E
Sbjct  567   CQRLTRINSCVDVRKQQLQRSLMEEMQKIRMFNTVGAIENVGFQNPDE  614



>ref|XP_010515595.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Camelina 
sativa]
Length=548

 Score =   536 bits (1382),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 310/526 (59%), Positives = 370/526 (70%), Gaps = 51/526 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD VLGMEVAWNQ+KLN VFRSPE LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  40    TVYKAFDHVLGMEVAWNQVKLNEVFRSPEPLQRLYSEVHLLKNLNHESIIRYCTSWIDVN  99

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELFTSGTLREYR++Y  V+IRAIK+W RQIL GLAYLH HDPPVIHRDLKCD
Sbjct  100   RRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWARQILNGLAYLHGHDPPVIHRDLKCD  159

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS +AHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCV
Sbjct  160   NIFVNGHLGQVKIGDLGLAAILRGSQNAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCV  219

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT +YPYSECTNPAQIYKKVT+GKLP +F+ I N EAQRFVG+CLE  S+R  A EL
Sbjct  220   LEMLTGDYPYSECTNPAQIYKKVTAGKLPESFHLIQNMEAQRFVGKCLETVSRRLPAKEL  279

Query  719   LLDPFLAADEEEDES--AKLPS----QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             L DPFLA  +E D +  ++LP     Q L  NG LLE  P   D   +++DM+ITG +N 
Sbjct  280   LEDPFLATTDERDLAPLSRLPPQLAIQNLAANGTLLEHPPSTSD-PTRTTDMSITGRMNS  338

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             ED  IFL+VQI D DG  RNI FPF+I SDT +EVA EMVKELEITDW PL+IA MI+ E
Sbjct  339   EDHNIFLQVQILDGDGHMRNIQFPFNILSDTPLEVALEMVKELEITDWDPLEIAAMIENE  398

Query  1061  ISALVPTWRSTQYQKQH-SFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK  1237
             IS LVP WR+     +H SF + D+++++     +  R   +S +S S        + + 
Sbjct  399   ISLLVPNWRANDSSIRHESFGHEDEEENEA----AEERTRLFSSASSSHDSP----VADG  450

Query  1238  INHDWLQND--DTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPE  1411
              N+D   ND  D SSRSS N  + S   ++   + D S    R   L QK          
Sbjct  451   DNNDGSSNDVMDGSSRSSTNWLNASTYHYSPAIDDDQSQHQRRRVRLQQK----------  500

Query  1412  TSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRR  1549
                                   +RS+VD R+Q+LHR+L+E +NKRR
Sbjct  501   ----------------------MRSLVDTRTQVLHRSLMELINKRR  524



>gb|KDO40188.1| hypothetical protein CISIN_1g007495mg [Citrus sinensis]
Length=466

 Score =   531 bits (1367),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 288/429 (67%), Positives = 339/429 (79%), Gaps = 15/429 (3%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++LN + RSP++LQRLYSEV LL  L H SI+RF+ SWID D
Sbjct  43    TVYKAIDEVLGVEVAWNQVRLNELMRSPDDLQRLYSEVHLLSTLKHDSIIRFYTSWIDVD  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             ++TFNFITE+FTSGTLREYR++Y  V+IRAIK+W RQIL+GL YLHS DPPVIHRDLKCD
Sbjct  103   QKTFNFITEMFTSGTLREYRKKYRRVDIRAIKSWARQILQGLVYLHSRDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  163   NIFVNGHLGQVKIGDLGLAAILRGSKSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM T EYPYSEC NPAQIYKKVTSGKLP AFY I + EAQRF+GRCL  ASKR SA EL
Sbjct  223   LEMFTCEYPYSECANPAQIYKKVTSGKLPGAFYSIQDLEAQRFIGRCLVNASKRLSAKEL  282

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LLDPFLA+DE +  S    +QK   N    E+E   +      +DMTITG LNPEDDTIF
Sbjct  283   LLDPFLASDEVKLLSKTKLNQKPFLNET--ELEKLQLSDDPPRTDMTITGKLNPEDDTIF  340

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQI+DKDG  RNI+FPFDI +DT ++VA EMVKELEITDW P +IA+MIDEEIS LVP
Sbjct  341   LKVQIADKDGPGRNIYFPFDILNDTPLDVAREMVKELEITDWEPFEIAKMIDEEISVLVP  400

Query  1079  TWRSTQY---QKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD  1249
              W+  ++   +  H+FNY +D+D  +        HP YS  S SSSQASLP L+   +HD
Sbjct  401   HWKKREWPHPEAYHTFNYEEDEDGYH--------HPLYSFPSCSSSQASLPGLV-TYDHD  451

Query  1250  WLQNDDTSS  1276
             WL+   +++
Sbjct  452   WLKGQGSNN  460



>gb|KDO40187.1| hypothetical protein CISIN_1g007495mg [Citrus sinensis]
Length=467

 Score =   530 bits (1366),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 288/423 (68%), Positives = 336/423 (79%), Gaps = 15/423 (4%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++LN + RSP++LQRLYSEV LL  L H SI+RF+ SWID D
Sbjct  43    TVYKAIDEVLGVEVAWNQVRLNELMRSPDDLQRLYSEVHLLSTLKHDSIIRFYTSWIDVD  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             ++TFNFITE+FTSGTLREYR++Y  V+IRAIK+W RQIL+GL YLHS DPPVIHRDLKCD
Sbjct  103   QKTFNFITEMFTSGTLREYRKKYRRVDIRAIKSWARQILQGLVYLHSRDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCV
Sbjct  163   NIFVNGHLGQVKIGDLGLAAILRGSKSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCV  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM T EYPYSEC NPAQIYKKVTSGKLP AFY I + EAQRF+GRCL  ASKR SA EL
Sbjct  223   LEMFTCEYPYSECANPAQIYKKVTSGKLPGAFYSIQDLEAQRFIGRCLVNASKRLSAKEL  282

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             LLDPFLA+DE +  S    +QK   N    E+E   +      +DMTITG LNPEDDTIF
Sbjct  283   LLDPFLASDEVKLLSKTKLNQKPFLNET--ELEKLQLSDDPPRTDMTITGKLNPEDDTIF  340

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQI+DKDG  RNI+FPFDI +DT ++VA EMVKELEITDW P +IA+MIDEEIS LVP
Sbjct  341   LKVQIADKDGPGRNIYFPFDILNDTPLDVAREMVKELEITDWEPFEIAKMIDEEISVLVP  400

Query  1079  TWRSTQY---QKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD  1249
              W+  ++   +  H+FNY +D+D  +        HP YS  S SSSQASLP L+   +HD
Sbjct  401   HWKKREWPHPEAYHTFNYEEDEDGYH--------HPLYSFPSCSSSQASLPGLV-TYDHD  451

Query  1250  WLQ  1258
             WL+
Sbjct  452   WLK  454



>ref|XP_009384321.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Musa 
acuminata subsp. malaccensis]
Length=655

 Score =   535 bits (1379),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 321/581 (55%), Positives = 392/581 (67%), Gaps = 58/581 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDE+ G EVAWNQ K+ NV +SP+ LQR+YSEV LL  L H S++RFH SWID +
Sbjct  58    TVYKAFDELNGTEVAWNQAKICNVLQSPDVLQRMYSEVHLLSSLHHESLIRFHTSWIDVE  117

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+F+SGTLREYR++Y  V+IRAIK+W RQIL+GL YLH HDPPVIHRD+KCD
Sbjct  118   NRTFNFITEMFSSGTLREYRKKYPRVDIRAIKSWARQILKGLVYLHGHDPPVIHRDIKCD  177

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLG+VKIGDLGLAA+L+GS  AHSVIGTPEFMAPELYEEEY+ELVDIYSFGMCV
Sbjct  178   NIFVNGHLGEVKIGDLGLAAVLKGSQSAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCV  237

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLTSEYPYSEC NPAQIYKKVTSGKLP AF+RI + EA+RF+GRCLE  +KR SA EL
Sbjct  238   LEMLTSEYPYSECFNPAQIYKKVTSGKLPDAFHRIKDPEAKRFIGRCLENVAKRSSAKEL  297

Query  719   LLDPFLAADEEEDESAKLPSQKLIP-----------NGKLLEVEPCFVDQQAKSSDMTIT  865
             LLDPFLA D   D    +   K IP           +  L  +E   V   A+ +DMTIT
Sbjct  298   LLDPFLALD---DHHVPMLPLKNIPVHVVKDMRSRGHDHLHLLEAGDVTCTARRTDMTIT  354

Query  866   GTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAE  1045
             G +NPE DTIFL+VQI+D++G+ RNI+FPFD+ SDT M+VA EMVKELEITD  P +IA 
Sbjct  355   GKMNPEGDTIFLKVQIADREGQVRNIYFPFDVVSDTPMDVANEMVKELEITDREPSEIAG  414

Query  1046  MIDEEISALVPTW--RSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqasl  1219
             MI +EI+ LVP W  R       H +NY DD +D  N       HPFY+LSS +SS  S 
Sbjct  415   MIAQEIAVLVPDWKARGGHSDLHHVYNYADDAEDGCN-------HPFYNLSSPASSPGSA  467

Query  1220  PDL--------LEKINHD--WLQ-----NDDTSSRSSMNSYDCSNLCWATESEGDLSSIG  1354
                        L++  H   WL+     +DD  S +    Y   N     E E ++SS  
Sbjct  468   FGAGQYMGVLGLQQHPHQEGWLRGGLFSDDDDMSSTHSGKYSALNYTSGNEQESEMSSHH  527

Query  1355  GRESLLIQKTNTGTRLCPETSRSNKKKGCCGSNHQRP------------------KMSRV  1480
                S    K     R   +TS +N+ +  C  +   P                  ++SR 
Sbjct  528   SESSHNATKFCADERHREDTSLANQMEKKCNVSSPEPSRKSRSRTKGVERPSENRRLSRN  587

Query  1481  RSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAE  1603
              SMVD+RSQLLHR LV+++ K+RLFKTVGA+E+IG+  P++
Sbjct  588   LSMVDMRSQLLHRNLVDQL-KKRLFKTVGAIEDIGFQMPSD  627



>ref|XP_006403897.1| hypothetical protein EUTSA_v10010261mg [Eutrema salsugineum]
 gb|ESQ45350.1| hypothetical protein EUTSA_v10010261mg [Eutrema salsugineum]
Length=548

 Score =   531 bits (1368),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 310/537 (58%), Positives = 370/537 (69%), Gaps = 39/537 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD+VLGMEVAWNQ+KLN +FRSPE LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  40    TVYKAFDQVLGMEVAWNQVKLNEIFRSPEPLQRLYSEVHLLKNLNHESIIRYCTSWIDVN  99

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELFTSGTLREYR++Y  V+IRAIK+W  QIL GLAYLH HDPPVIHRDLKCD
Sbjct  100   RRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWSCQILNGLAYLHGHDPPVIHRDLKCD  159

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCV
Sbjct  160   NIFVNGHLGQVKIGDLGLAAILRGSQHAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCV  219

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC+NPAQIYKKVTSGKLP +F+RI N EAQ FVG+CLE  SKR SA EL
Sbjct  220   LEMLTGEYPYSECSNPAQIYKKVTSGKLPESFHRIQNMEAQLFVGKCLETVSKRLSAKEL  279

Query  719   LLDPFLAADEEEDESA------KLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             L D FLA  +E D +       +L  Q L  NG ++E  P   D   +++DM+ITG +N 
Sbjct  280   LGDTFLATTDERDLAPLYRLPPQLAIQNLAANGTVVEHLPSTTDP-TRTTDMSITGRMNS  338

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             ED TIFL+VQISD DG  RNI FPF I SDT +EVA EMVKEL+ITDW PL+IA MI+ E
Sbjct  339   EDHTIFLQVQISDGDGHMRNIHFPFSIVSDTPLEVALEMVKELDITDWDPLEIAAMIENE  398

Query  1061  ISALVPTWRSTQYQ-KQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK  1237
             IS LVP WR+       HSF + DDD      G  T   PF S SS   S  ++ D  + 
Sbjct  399   ISLLVPNWRAHDSSLPHHSFGHEDDDYSGEGGGGGT--RPFSSASSSHDSHVAVRDNNDG  456

Query  1238  INHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS  1417
               +D ++ +D     S N+Y              L S     S  I   +   +      
Sbjct  457   FGNDTIRGNDGGGSRSSNAY--------------LDSSAYHYSSAIDDDDDDDQ------  496

Query  1418  RSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGY  1588
                          +R ++ ++RS+VD R+Q+LHR+L+E +N+RR    V   E + Y
Sbjct  497   --------SRKQRRRLRLQKMRSLVDTRTQVLHRSLMELINRRRGRAHVKKEETLAY  545



>ref|XP_006290846.1| hypothetical protein CARUB_v10016958mg [Capsella rubella]
 ref|XP_006290847.1| hypothetical protein CARUB_v10016958mg [Capsella rubella]
 gb|EOA23744.1| hypothetical protein CARUB_v10016958mg [Capsella rubella]
 gb|EOA23745.1| hypothetical protein CARUB_v10016958mg [Capsella rubella]
Length=552

 Score =   530 bits (1365),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 309/524 (59%), Positives = 373/524 (71%), Gaps = 43/524 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD+VLGMEVAWNQ+KLN VFRSPE LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  40    TVYKAFDQVLGMEVAWNQVKLNEVFRSPEPLQRLYSEVHLLKNLNHESIIRYCTSWIDVN  99

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELFTSGTLREYR++Y  V+IRAIK+W RQIL GLAYLH HDPPVIHRDLKCD
Sbjct  100   RRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWARQILNGLAYLHGHDPPVIHRDLKCD  159

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS +AHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCV
Sbjct  160   NIFVNGHLGQVKIGDLGLAAILRGSQNAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCV  219

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSECTNPAQIYKKVT+GKLP +F+ I + EAQRFVG+CLE  S+R  A EL
Sbjct  220   LEMLTGEYPYSECTNPAQIYKKVTAGKLPESFHLIQHKEAQRFVGKCLETVSRRLPAKEL  279

Query  719   LLDPFLAADEEEDES--AKLPS----QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             L DPFLAA +E D +   +LP     Q L  NG +LE  P   D   +++DM+ITG +N 
Sbjct  280   LGDPFLAATDERDLTPLCRLPPQLAIQNLAANGTVLEHLPSTTD-PTRTTDMSITGRMNS  338

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             ED  IFL+VQI D +G  RNI FPF+I SDT +EVA EMVKELEITDW PL+IA  I+ E
Sbjct  339   EDHNIFLQVQILDGNGHMRNIQFPFNILSDTPLEVALEMVKELEITDWDPLEIAARIENE  398

Query  1061  ISALVPTWRSTQYQ-KQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK  1237
             IS LVP WR+     ++ SF + DDD+D+++    T    F S SS   S  ++ D  + 
Sbjct  399   ISLLVPNWRANDSSIRRESFGHEDDDEDNDDAEGRT--RLFSSASSSHDSPVAVGDNNDG  456

Query  1238  INHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS  1417
              ++D +Q+ + SSRSS N  + S   ++   + D      R   L QK            
Sbjct  457   SSNDAIQDVEGSSRSSKNWLNASTYHYSPPIDDDQCQHQRRRVRLQQK------------  504

Query  1418  RSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRR  1549
                                 +RS+VD R+Q+LHR+L+E +NKRR
Sbjct  505   --------------------MRSLVDTRTQVLHRSLMELINKRR  528



>gb|KFK34408.1| hypothetical protein AALP_AA5G141100 [Arabis alpina]
Length=536

 Score =   526 bits (1356),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 304/520 (58%), Positives = 362/520 (70%), Gaps = 50/520 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD+VLGMEVAWNQ+KLN VFRSPE LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  40    TVYKAFDQVLGMEVAWNQVKLNEVFRSPEPLQRLYSEVHLLKNLNHESIIRYFTSWIDVN  99

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             R TFNFITELFTSGTLREYR++Y  V+IRAIK+W RQIL GLAYLH HDPPVIHRDLKCD
Sbjct  100   RTTFNFITELFTSGTLREYRRKYQKVDIRAIKSWARQILNGLAYLHGHDPPVIHRDLKCD  159

Query  362   NIFVNGHLGQVKIGDLGLAAMLR-GSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LR  SHAHSVI   E        E+Y++LVDIYSFGMCV
Sbjct  160   NIFVNGHLGQVKIGDLGLAAILRESSHAHSVIELYE--------EDYNQLVDIYSFGMCV  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC+NPAQIYKKVTSGKLP +F+ I N EAQ FVG+CLE  SKR SA+EL
Sbjct  212   LEMLTGEYPYSECSNPAQIYKKVTSGKLPESFHLIQNLEAQCFVGKCLETVSKRLSANEL  271

Query  719   LLDPFLAADEEEDESA--KLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDT  892
             L DPFLA  +E D +   +LP Q L  NG + E  P   D   +++DM+ITG +N ED T
Sbjct  272   LEDPFLATADERDLAPIYRLPIQNLAANGTVTEQPPLTTD-PTRTTDMSITGRMNSEDHT  330

Query  893   IFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISAL  1072
             IFL+VQISD DG  RNI FPF+I SDT +EVA EMVKELEITDW PL+I  MI+ EIS L
Sbjct  331   IFLQVQISDGDGHVRNIHFPFNIVSDTPLEVALEMVKELEITDWDPLEITAMIENEISLL  390

Query  1073  VPTWRSTQYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD  1249
             VP WR+     Q HSF + +DDD+DN  G   TR PF S SS   +     D  E  N+D
Sbjct  391   VPNWRAHDSSLQHHSFGH-EDDDEDNGEGEGRTR-PFSSASSSPVAVR---DNKEGFNND  445

Query  1250  WLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETSRSNK  1429
              ++ +D  S SS +  + S   ++  ++ D  S   R  L +QK                
Sbjct  446   IVRGNDGGSGSSNSWLNISTYHYSPATDDDDQSQQHRRRLRLQK----------------  489

Query  1430  KKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRR  1549
                             +RS+VD R+Q+LHR+L+E +NKRR
Sbjct  490   ----------------MRSLVDTRTQVLHRSLMELINKRR  513



>ref|XP_006403896.1| hypothetical protein EUTSA_v10010261mg [Eutrema salsugineum]
 gb|ESQ45349.1| hypothetical protein EUTSA_v10010261mg [Eutrema salsugineum]
Length=549

 Score =   527 bits (1357),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 310/538 (58%), Positives = 370/538 (69%), Gaps = 40/538 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD+VLGMEVAWNQ+KLN +FRSPE LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  40    TVYKAFDQVLGMEVAWNQVKLNEIFRSPEPLQRLYSEVHLLKNLNHESIIRYCTSWIDVN  99

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELFTSGTLREYR++Y  V+IRAIK+W  QIL GLAYLH HDPPVIHRDLKCD
Sbjct  100   RRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWSCQILNGLAYLHGHDPPVIHRDLKCD  159

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCV
Sbjct  160   NIFVNGHLGQVKIGDLGLAAILRGSQHAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCV  219

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC+NPAQIYKKVTSGKLP +F+RI N EAQ FVG+CLE  SKR SA EL
Sbjct  220   LEMLTGEYPYSECSNPAQIYKKVTSGKLPESFHRIQNMEAQLFVGKCLETVSKRLSAKEL  279

Query  719   LLDPFLAADEEEDESA------KLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             L D FLA  +E D +       +L  Q L  NG ++E  P   D   +++DM+ITG +N 
Sbjct  280   LGDTFLATTDERDLAPLYRLPPQLAIQNLAANGTVVEHLPSTTDP-TRTTDMSITGRMNS  338

Query  881   EDDTIFLRVQISDKD-GKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDE  1057
             ED TIFL+VQISD D G  RNI FPF I SDT +EVA EMVKEL+ITDW PL+IA MI+ 
Sbjct  339   EDHTIFLQVQISDGDAGHMRNIHFPFSIVSDTPLEVALEMVKELDITDWDPLEIAAMIEN  398

Query  1058  EISALVPTWRSTQYQ-KQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE  1234
             EIS LVP WR+       HSF + DDD      G  T   PF S SS   S  ++ D  +
Sbjct  399   EISLLVPNWRAHDSSLPHHSFGHEDDDYSGEGGGGGT--RPFSSASSSHDSHVAVRDNND  456

Query  1235  KINHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPET  1414
                +D ++ +D     S N+Y              L S     S  I   +   +     
Sbjct  457   GFGNDTIRGNDGGGSRSSNAY--------------LDSSAYHYSSAIDDDDDDDQ-----  497

Query  1415  SRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGY  1588
                           +R ++ ++RS+VD R+Q+LHR+L+E +N+RR    V   E + Y
Sbjct  498   ---------SRKQRRRLRLQKMRSLVDTRTQVLHRSLMELINRRRGRAHVKKEETLAY  546



>ref|XP_009603877.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X3 [Nicotiana tomentosiformis]
Length=563

 Score =   527 bits (1358),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 310/551 (56%), Positives = 381/551 (69%), Gaps = 48/551 (9%)
 Frame = +2

Query  92    LQRLYSEVLLLKDLDHSSIMRFHASWIDTDRRTFNFITELFTSGTLREYRQRYTTVNIRA  271
             ++RLYSEV LL  L+H SIMRF+ SWID + RTFNFITE+FTSGTLR YR++Y  V+IRA
Sbjct  1     MERLYSEVHLLSTLNHHSIMRFYTSWIDVEHRTFNFITEMFTSGTLRGYRKKYQRVDIRA  60

Query  272   IKNWVRQILEGLAYLHSHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLAAMLRGSH-AHS  448
             IKNW RQILEGL YLH HDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLAA+LRGS  AHS
Sbjct  61    IKNWARQILEGLVYLHEHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLAAILRGSQRAHS  120

Query  449   VIGTPEFMAPelyeeeydelvdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPA  628
             VIGTPEFMAPELYEE Y+ELVD+YSFGMC+LEMLT EYPYSEC NPAQIYKKVTSGK P 
Sbjct  121   VIGTPEFMAPELYEENYNELVDVYSFGMCMLEMLTGEYPYSECVNPAQIYKKVTSGKRPR  180

Query  629   AFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPFLAADEEEDESAKLPS-QKLIPNGKL  805
             AFY++ + +AQRF+ +CLEPASKR SA EL++DPFL  D  + +S  +   QK   N K 
Sbjct  181   AFYKVQDLDAQRFIRKCLEPASKRLSAKELMVDPFLVFDNVDGKSVTMMQLQKPFLNDK-  239

Query  806   LEVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEV  985
             + +E   +++ A  ++MTITG LNPEDDTI ++VQI+DK+G  RN++FPFDI +DT  EV
Sbjct  240   IAIEDLHLNEDAPRTNMTITGKLNPEDDTILIKVQIADKEGDVRNVYFPFDIVTDTPTEV  299

Query  986   ATEMVKELEITDWMPLDIAEMIDEEISALVPTWRSTQYQKQHSFNYIddddddNNVGIST  1165
             A EMVKELEITDW P +IA MID EIS LVP W+     +   ++ +   DDDN+     
Sbjct  300   ANEMVKELEITDWKPYEIANMIDGEISGLVPQWKKWNQFESADYHVLSYKDDDND-----  354

Query  1166  TRHPFYslssqsssqaslPDLLEKINHD-------WLQN---DDTSSRSSMNSYDCSNLC  1315
               +PF   SS SSSQ SL  LL     D       WL     DDTSS+SS +S + SN  
Sbjct  355   HHNPFRGFSSCSSSQVSLSGLLSSQVIDTNTNGPHWLHGDMFDDTSSQSSSHSANYSNFN  414

Query  1316  WATESEGDLSSIGGRESLLIQKTNTGT-RLCP-------------------------ETS  1417
             + ++ E D  +   ++S      N  T R CP                          TS
Sbjct  415   YFSDDENDPVTTSTKQSQPATAINHHTSRFCPGENSSTGQSLARMCYKQCKDMLELKRTS  474

Query  1418  RSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
              ++K+KG   +     +++R +S+VD+RSQLLH+TLVEEV+KRRLFKTVGAVENIG+ +P
Sbjct  475   STSKEKGKVDTR----RLTRNKSLVDMRSQLLHKTLVEEVHKRRLFKTVGAVENIGFQQP  530

Query  1598  AEYSCKGNRSF  1630
              E S +  +S 
Sbjct  531   YEDSRRSPQSM  541



>ref|XP_006573394.1| PREDICTED: probable serine/threonine-protein kinase WNK5-like 
isoform X2 [Glycine max]
Length=514

 Score =   524 bits (1350),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 277/403 (69%), Positives = 324/403 (80%), Gaps = 16/403 (4%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VYRAFDEVLG+EVAWNQ+KL +VF SP+ L RLYSEV LLK+L+H SIM FH SWID +
Sbjct  37    VVYRAFDEVLGIEVAWNQVKLGDVFHSPDLLPRLYSEVHLLKNLEHDSIMTFHDSWIDVN  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITELFTSGTLREYR++Y  V+IRA+KNW RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    CRTFNFITELFTSGTLREYRKKYQRVDIRAVKNWARQILSGLEYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF+NGHLGQVKIGDLGLAA+LRGS HAHSVIGTPEFMAPELYEEEY+ELVDIYSFGMC+
Sbjct  157   NIFINGHLGQVKIGDLGLAAILRGSQHAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCM  216

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +E+ TSE+PYSEC+NPAQIYKKVTSGKLP A+YRI + EAQRFVG+CL   S+R SA EL
Sbjct  217   IEIFTSEFPYSECSNPAQIYKKVTSGKLPEAYYRIHDLEAQRFVGKCLANVSERLSAKEL  276

Query  719   LLDPFLAADEEED--ESAKLPSQK---LIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPE  883
             LLDPFLA ++ +    S  LP ++   L     L +        Q K S MTITG++N E
Sbjct  277   LLDPFLAKEQLDSPLPSPTLPKKQAPTLNFTASLAKELSQPKSNQTKDSHMTITGSINEE  336

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             DDT+FL+VQIS+KDG+ RNIFFPFD   DTA++VA EMVKELEI+D  PL+IA+MI+EEI
Sbjct  337   DDTVFLKVQISNKDGQKRNIFFPFDTIYDTAIDVAMEMVKELEISDLEPLEIAKMIEEEI  396

Query  1064  SALVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFY  1183
             SALVP WR   S +YQKQHSF+Y ++ D  N+       HPF+
Sbjct  397   SALVPKWRDWGSAEYQKQHSFSYEEEYDMSNH-------HPFF  432



>ref|NP_001236004.1| with no lysine kinase 10 [Glycine max]
 gb|ACN87286.1| with no lysine kinase [Glycine max]
Length=618

 Score =   527 bits (1358),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 309/573 (54%), Positives = 388/573 (68%), Gaps = 54/573 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE+LG+EVAWNQ+KL + F SPE+LQRLYSEV LLK L+H S+M F+ SWID  
Sbjct  51    TVYRAFDELLGIEVAWNQVKLGDAFHSPEQLQRLYSEVHLLKHLNHDSMMIFYGSWIDVS  110

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNF+TELFTSGTLREYRQ+Y  V+IRA+KNW RQIL GL YLHSH+PPVIHRDLKCD
Sbjct  111   NRTFNFVTELFTSGTLREYRQKYKRVDIRAVKNWARQILSGLEYLHSHNPPVIHRDLKCD  170

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH G+VKIGDLGLAA+L+ S HAHSVIGTPEFMAPELYEE+Y+EL+DIYSFGMC+
Sbjct  171   NIFVNGHQGRVKIGDLGLAAILKSSQHAHSVIGTPEFMAPELYEEKYNELIDIYSFGMCM  230

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +EMLT E+PYSEC NPAQIYKKVTSGKLP AFY+I+N EAQ FVG+CL   S+RPSA EL
Sbjct  231   IEMLTFEFPYSECANPAQIYKKVTSGKLPEAFYKIENLEAQEFVGKCLTNVSERPSAKEL  290

Query  719   LLDPFLAADEEEDE-SAKLPSQKLIPNGKLLEVEPCFVDQ--QAKSSDMTITGTLNPEDD  889
             LLDPFLA ++ E      +P+     + KL    P   D   Q K++DMTI+G++N E++
Sbjct  291   LLDPFLAMEQLEIPLPPSIPALFTNKSFKLNCPAPIPSDHRDQTKNADMTISGSINEENN  350

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
             T+FL+V+ISD  G  R++FFPFD   DTA++VA EMV+ELEI+   PL+IA  ID E+SA
Sbjct  351   TVFLKVRISDITGHTRHVFFPFDTLKDTAIQVAMEMVQELEISHLEPLEIAVRIDHEVSA  410

Query  1070  LVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFY-------slssqsssqasl  1219
             LVPTWR      +Q+Q+SFNY +D+D +N+       HPF+          S   S ++ 
Sbjct  411   LVPTWRDRVKCHHQRQYSFNYEEDEDVNNH-------HPFFLSSSPSSPRGSGHMSASNS  463

Query  1220  PDLLEKINH-----DWLQ------NDDTSSRSSMNSYDCSNLCW-------------ATE  1327
                  + NH     +W Q      NDD S ++S+NS+ CS+  +             ATE
Sbjct  464   FKTRVRGNHYPFTQEWPQDDPFMVNDDASPQASLNSFKCSSFQFLDPGQEDEHAPTDATE  523

Query  1328  SEGDLSSIGGRESLLIQKTNTGTRLCPETSRSNKKKGCC--GSNHQRPKMSRVRSMVDLR  1501
                  + +  R              CP    S    GC   GS+H  P+++R+RS    R
Sbjct  524   RTKKCTPLSYRTEEPEPNYTKPFNYCPPRMDSC-SCGCSRFGSSHAYPRLTRIRSCPHER  582

Query  1502  ---SQLLHRT-LVEEV--NKRRLFKTVGAVENI  1582
                 QLL R+ ++EE+   KRR F  VGAVEN+
Sbjct  583   RSQQQLLQRSMMLEEMYKYKRRFFNNVGAVENL  615



>emb|CAB63149.1| MAP kinase [Arabidopsis thaliana]
 dbj|BAB91128.1| Ser/Thr kinase [Arabidopsis thaliana]
Length=547

 Score =   525 bits (1351),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 273/382 (71%), Positives = 312/382 (82%), Gaps = 9/382 (2%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD+VLGMEVAWNQ+KLN VFRSPE LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  36    TVYKAFDQVLGMEVAWNQVKLNEVFRSPEPLQRLYSEVHLLKNLNHESIIRYCTSWIDVN  95

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELFTSGTLREYR++Y  V+IRAIK+W RQIL GLAYLH HDPPVIHRDLKCD
Sbjct  96    RRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWARQILNGLAYLHGHDPPVIHRDLKCD  155

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS +AHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCV
Sbjct  156   NIFVNGHLGQVKIGDLGLAAILRGSQNAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCV  215

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSECTNPAQIYKKVTSGKLP +F+ I + EAQRFVG+CLE  S+R  A EL
Sbjct  216   LEMLTGEYPYSECTNPAQIYKKVTSGKLPDSFHLIQHTEAQRFVGKCLETVSRRLPAKEL  275

Query  719   LLDPFLAADEEEDESA--KLPS----QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             L DPFLAA +E D +   +LP     Q L  NG ++E  P   D   +++DM+ITG +N 
Sbjct  276   LADPFLAATDERDLAPLFRLPQQLAIQNLAANGTVVEHLPSTTD-PTRTTDMSITGKMNS  334

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             ED TIFL+VQI D DG  RNI FPF+I SDT +EVA EMVKELEITDW PL+IA MI+ E
Sbjct  335   EDHTIFLQVQILDGDGHMRNIQFPFNILSDTPLEVALEMVKELEITDWDPLEIAAMIENE  394

Query  1061  ISALVPTWRSTQYQKQH-SFNY  1123
             IS LVP WR+     +H SF +
Sbjct  395   ISLLVPNWRANDSSIRHESFGH  416



>ref|XP_004492549.1| PREDICTED: probable serine/threonine-protein kinase WNK5-like 
[Cicer arietinum]
Length=597

 Score =   526 bits (1355),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 304/580 (52%), Positives = 381/580 (66%), Gaps = 63/580 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE+LG+EVAWNQ+KL +V  SPE+L+RLYSEV LLK LDH S+M F+ SWID +
Sbjct  41    TVYRAFDELLGIEVAWNQVKLGDVCHSPEQLERLYSEVHLLKHLDHKSMMIFYGSWIDVN  100

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNFITELFTSGTLREYRQ+Y  V+IRA+KNW  QIL GL YLH+++PPVIHRDLKCD
Sbjct  101   CKTFNFITELFTSGTLREYRQKYRKVDIRALKNWAHQILSGLEYLHNNNPPVIHRDLKCD  160

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH+GQ+KIGDLGLAA+L  S  A SVIGTPEFMAPELYEE+Y+ELVDIYSFGMC+
Sbjct  161   NIFVNGHMGQIKIGDLGLAAILCKSQLAQSVIGTPEFMAPELYEEKYNELVDIYSFGMCM  220

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +EMLT E+PY+ECTNPAQIYKKVT+GKLP AF+R+ + EAQRFVGRCL   SKRPSA EL
Sbjct  221   IEMLTLEFPYNECTNPAQIYKKVTAGKLPNAFFRVQDLEAQRFVGRCLAHVSKRPSAKEL  280

Query  719   LLDPFLAADEEE----------DESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITG  868
             LLDPFLA ++ E          +++ K+ S + + N  L             S+ MTITG
Sbjct  281   LLDPFLAMEQLELSLLSTTLSTNQTLKINSTEGVANKHL-------------STYMTITG  327

Query  869   TLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEM  1048
             ++N +D T+FL+V+ISD+ G+ R+IFFPFD  +DT+++VA EMV+ELEI+   PL+IA M
Sbjct  328   SINEDDSTLFLKVRISDETGQTRHIFFPFDTKNDTSIKVAMEMVEELEISHLEPLEIATM  387

Query  1049  IDEEISALVPTWRSTQ-----YQKQHSFNYIddddddNNVGISTTRHPFY----------  1183
             ID EI AL P W  T      YQ+QHSFNY    ++D +V I    +PF           
Sbjct  388   IDNEILALFPNWMGTTHGKGPYQRQHSFNY----EEDEDVNI---HNPFLLSSSCPSSPR  440

Query  1184  slssqsssqaslPDLLEKINHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRE  1363
                +++          +++N +   NDD SS +SMNSY CS   +  +  G       R 
Sbjct  441   DSLTKTQFCGKHATFTQELNQERFMNDDESSPNSMNSYKCSKFQYCEDEHGPTIVEECRA  500

Query  1364  SLLIQKTNTGTRLCPETSRSNKKK-----------GCCGSNHQRPKMSRVRSMVDLRSQL  1510
                  K  + +R+  E   SN  K           GC    H   +MS   SM + RS  
Sbjct  501   KNNKLKCTSSSRM-KEGETSNFTKHFLSATMDSCSGCICGGHGMIRMSH-SSMEERRSLQ  558

Query  1511  LHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSCKGNRSF  1630
             L R      +KRR+F TVGAVE IG+H P    C   R F
Sbjct  559   LQRP----QHKRRMFNTVGAVEGIGFHPPYRCGCCSRRGF  594



>gb|KEH25193.1| WNK kinase [Medicago truncatula]
Length=566

 Score =   525 bits (1352),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 305/563 (54%), Positives = 388/563 (69%), Gaps = 43/563 (8%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VY+A D+VLG+E+AWNQ+KLN   R+PE+L+RLY EV LL +L H SIM+F+ SWID D 
Sbjct  20    VYKAIDKVLGIEIAWNQVKLNEALRTPEDLERLYLEVHLLSNLKHQSIMQFYTSWIDVDN  79

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             RTFNFITE+FTSGTLREYR++Y  V+++AIK+WVRQIL GL YLH HDPPVIHRDLKCDN
Sbjct  80    RTFNFITEMFTSGTLREYRKKYKHVDMQAIKSWVRQILHGLVYLHEHDPPVIHRDLKCDN  139

Query  365   IFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             IFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEEEY+ELVD+YSFGMCVL
Sbjct  140   IFVNGHLGQVKIGDLGLAAILRGSQPAHSVIGTPEFMAPELYEEEYNELVDVYSFGMCVL  199

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             E++TS+YPYSECTNPAQIYKKVTSGKLPA  +RI++AEA+ F+G+CL  A++RPSA ELL
Sbjct  200   EIMTSDYPYSECTNPAQIYKKVTSGKLPATLFRIEDAEAREFIGKCLVNAARRPSAKELL  259

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIFL  901
              DPFL +D   DES+   S    P     E++   +   +  + M+IT   NP+ D +FL
Sbjct  260   HDPFLVSD---DESSITVSGMQDPFLNYTEMDKLQLRGDSARASMSITRKRNPDGDALFL  316

Query  902   RVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPT  1081
             +VQI DK+G ARN++FPFDI +DT ++VA EMVKEL+IT+W P +IA MI+ EIS L+P 
Sbjct  317   KVQIVDKNGSARNVYFPFDIFTDTPIDVAKEMVKELDITNWDPSEIATMIEAEISMLLPD  376

Query  1082  WRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKIN-----H  1246
              R+  YQ              NN       H F S+SS SSSQ SL   + +++     +
Sbjct  377   -RTNSYQDDE-----------NNASPRRYHH-FPSVSSVSSSQESLSGAVNRVDDISNGY  423

Query  1247  DWLQNDDT----SSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPET  1414
              W   DDT    SS  S  +Y   N C   +   +++S    +  ++  ++  TR     
Sbjct  424   RW-HPDDTFDYDSSLCSSYTYSDLNFCSVDDQYHNVASTRNNKHPIM--SHKCTRFSHGE  480

Query  1415  SRSNKKKGCCGSNHQRPK------------MSRVRSMVDLRSQLLHRTLVEEVNKRRLFK  1558
              +    +    +  Q P             ++R +S++D+RSQLLHR+LVEEVNKRRLFK
Sbjct  481   DQLTLNRCKILAKPQEPSTSECERMIENRILTRNKSLIDMRSQLLHRSLVEEVNKRRLFK  540

Query  1559  TVGAVENIGYHEPAEYSCKGNRS  1627
             TVGAVE+IGY  P  Y  K  +S
Sbjct  541   TVGAVEDIGYQTP--YKIKSKKS  561



>ref|NP_566954.2| putative serine/threonine-protein kinase WNK5 [Arabidopsis thaliana]
 ref|NP_001190056.1| putative serine/threonine-protein kinase WNK5 [Arabidopsis thaliana]
 sp|Q9SCU5.2|WNK5_ARATH RecName: Full=Probable serine/threonine-protein kinase WNK5; 
Short=AtWNK5; AltName: Full=Protein kinase with no lysine 5 
[Arabidopsis thaliana]
 emb|CAB43520.1| MAP kinase [Arabidopsis thaliana]
 gb|AEE78815.1| putative serine/threonine-protein kinase WNK5 [Arabidopsis thaliana]
 gb|AEE78816.1| putative serine/threonine-protein kinase WNK5 [Arabidopsis thaliana]
Length=549

 Score =   524 bits (1350),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 273/382 (71%), Positives = 312/382 (82%), Gaps = 9/382 (2%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD+VLGMEVAWNQ+KLN VFRSPE LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  38    TVYKAFDQVLGMEVAWNQVKLNEVFRSPEPLQRLYSEVHLLKNLNHESIIRYCTSWIDVN  97

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELFTSGTLREYR++Y  V+IRAIK+W RQIL GLAYLH HDPPVIHRDLKCD
Sbjct  98    RRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWARQILNGLAYLHGHDPPVIHRDLKCD  157

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS +AHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCV
Sbjct  158   NIFVNGHLGQVKIGDLGLAAILRGSQNAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCV  217

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSECTNPAQIYKKVTSGKLP +F+ I + EAQRFVG+CLE  S+R  A EL
Sbjct  218   LEMLTGEYPYSECTNPAQIYKKVTSGKLPDSFHLIQHTEAQRFVGKCLETVSRRLPAKEL  277

Query  719   LLDPFLAADEEEDESA--KLPS----QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             L DPFLAA +E D +   +LP     Q L  NG ++E  P   D   +++DM+ITG +N 
Sbjct  278   LADPFLAATDERDLAPLFRLPQQLAIQNLAANGTVVEHLPSTTD-PTRTTDMSITGKMNS  336

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             ED TIFL+VQI D DG  RNI FPF+I SDT +EVA EMVKELEITDW PL+IA MI+ E
Sbjct  337   EDHTIFLQVQILDGDGHMRNIQFPFNILSDTPLEVALEMVKELEITDWDPLEIAAMIENE  396

Query  1061  ISALVPTWRSTQYQKQH-SFNY  1123
             IS LVP WR+     +H SF +
Sbjct  397   ISLLVPNWRANDSSIRHESFGH  418



>ref|XP_009757971.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X3 [Nicotiana sylvestris]
Length=563

 Score =   522 bits (1345),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 307/547 (56%), Positives = 379/547 (69%), Gaps = 40/547 (7%)
 Frame = +2

Query  92    LQRLYSEVLLLKDLDHSSIMRFHASWIDTDRRTFNFITELFTSGTLREYRQRYTTVNIRA  271
             ++RLYSEV LL  L+H SIMRF+ SWID + RTFNFITE+FTSGTLR YR++Y  V+IRA
Sbjct  1     MERLYSEVHLLSTLNHHSIMRFYTSWIDVEHRTFNFITEMFTSGTLRGYRKKYQRVDIRA  60

Query  272   IKNWVRQILEGLAYLHSHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLAAMLRGSH-AHS  448
             IKNW RQILEGL YLH HDPPVIHRDLKCDNIFVNGHLGQVK+GDLGLAA+LRGS  AHS
Sbjct  61    IKNWARQILEGLVYLHEHDPPVIHRDLKCDNIFVNGHLGQVKVGDLGLAAILRGSQRAHS  120

Query  449   VIGTPEFMAPelyeeeydelvdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPA  628
             VIGTPEFMAPELYEE Y+ELVD+YSFGMC+LEMLT EYPYSEC NPAQIYKKVTSGK P 
Sbjct  121   VIGTPEFMAPELYEENYNELVDVYSFGMCMLEMLTGEYPYSECVNPAQIYKKVTSGKRPR  180

Query  629   AFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPFLAADEEEDESAKLPS-QKLIPNGKL  805
             AFY++ + +AQRF+ +CLEPASKR SA EL++DPFLA D  + +S  +   QK   N K 
Sbjct  181   AFYKVQDLDAQRFIRKCLEPASKRLSAKELMVDPFLALDNIDGKSVTMMQLQKPFLNDK-  239

Query  806   LEVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEV  985
             + +E   ++  A  ++MTITG LNPEDDTI ++VQI+D +G  RN++FPFDI +DT  EV
Sbjct  240   IAIEDLHLNDDAPRTNMTITGKLNPEDDTILIKVQIADNEGDVRNVYFPFDIVTDTPTEV  299

Query  986   ATEMVKELEITDWMPLDIAEMIDEEISALVPTWRSTQYQKQHSFNYIddddddNNVGIST  1165
             A EMVKEL+ITDW P +IA MID EIS LVP W+     +   +  +   DDDN+     
Sbjct  300   ANEMVKELDITDWKPHEIANMIDGEISGLVPQWKKWNQFESADYQVLSYKDDDND-----  354

Query  1166  TRHPFYslssqsssqaslPDLLEKINHD-------WLQN---DDTSSRSSMNSYDCSNLC  1315
               +PF   SS SSSQ SL  LL     D       WL     DDTSS+SS +S + SN  
Sbjct  355   HHNPFQGFSSCSSSQVSLSGLLSSQVIDTNTNDPHWLHGDMFDDTSSQSSSHSANYSNFN  414

Query  1316  WATESEGDLSSIGGRESLLIQKTNTGT-RLCPETSRSN----------------KKKGCC  1444
             + ++ E D  +   ++S      +  T R CP  + S                 K KG  
Sbjct  415   YFSDDENDPVTTSTKQSQPATAISHHTSRFCPGENSSTGQSLAKMCYKQCKDMLKLKGTS  474

Query  1445  GSNHQRPK-----MSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYS  1609
              ++ ++ K     ++R +S+VD+RSQLLH+TLVEEV+KRRLFKTVGAVENIG+ +P E S
Sbjct  475   STSKEKDKVDARRLTRNKSLVDMRSQLLHKTLVEEVHKRRLFKTVGAVENIGFQQPYEDS  534

Query  1610  CKGNRSF  1630
              +  +S 
Sbjct  535   RRSPQSM  541



>ref|XP_002876096.1| map kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52355.1| map kinase [Arabidopsis lyrata subsp. lyrata]
Length=547

 Score =   520 bits (1339),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 269/377 (71%), Positives = 308/377 (82%), Gaps = 8/377 (2%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD+VLGMEVAWNQ+KLN VFRSPE LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  36    TVYKAFDQVLGMEVAWNQVKLNEVFRSPEPLQRLYSEVHLLKNLNHESIIRYCTSWIDVN  95

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELFTSGTLREYR++Y  V+IRAIK+W RQIL GLAYLH HDPPVIHRDLKCD
Sbjct  96    RRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWARQILNGLAYLHGHDPPVIHRDLKCD  155

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRGS +AHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMCV
Sbjct  156   NIFVNGHLGQVKIGDLGLAAILRGSQNAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCV  215

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSECTNPAQIYKKVTSGKLP +F+ I + EAQRFVG+CLE  S+R  A EL
Sbjct  216   LEMLTGEYPYSECTNPAQIYKKVTSGKLPDSFHLIQHTEAQRFVGKCLETVSRRLPAKEL  275

Query  719   LLDPFLAADEEEDES--AKLPS----QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             L DPFLAA +E D +   +LP     Q L  NG +++  P   D   +++DM+ITG +N 
Sbjct  276   LGDPFLAATDERDLAPLCRLPQQLAIQNLASNGTVVQHLPSTTD-PTRTTDMSITGKMNS  334

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             ED TIFL+VQI D DG  RNI FPF+I SDT +EVA EMVKELEI DW PL+IA MI+ E
Sbjct  335   EDHTIFLQVQILDGDGHMRNIQFPFNILSDTPLEVALEMVKELEIVDWDPLEIAAMIENE  394

Query  1061  ISALVPTWRSTQYQKQH  1111
             IS LVP WR+     +H
Sbjct  395   ISLLVPNWRANDSSIRH  411



>ref|XP_006843706.1| hypothetical protein AMTR_s00007p00211470 [Amborella trichopoda]
 gb|ERN05381.1| hypothetical protein AMTR_s00007p00211470 [Amborella trichopoda]
Length=652

 Score =   524 bits (1349),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 309/597 (52%), Positives = 398/597 (67%), Gaps = 54/597 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDE+ GMEVAWNQ+KL +VFR+P+ELQRLYSEV LL+ L+H +I++ +ASW+DTD
Sbjct  39    TVYKAFDELRGMEVAWNQVKLKDVFRTPDELQRLYSEVHLLRTLNHDNIIKSYASWVDTD  98

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RT NFITELF SGTLREYRQ+Y  V++RAIKNW RQIL+GL YLHSH PP+IHRDLKCD
Sbjct  99    SRTINFITELFASGTLREYRQKYRRVDMRAIKNWGRQILQGLVYLHSHCPPIIHRDLKCD  158

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIF+NGH  QVKIGDLGLAA+LR S  AHSVIGTPEFMAPELYEEEY+ELVD+YSFGMCV
Sbjct  159   NIFINGHSSQVKIGDLGLAAILRQSQAAHSVIGTPEFMAPELYEEEYNELVDVYSFGMCV  218

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT++YPYSEC+NPAQIYKKVTSGK P +  R+ + EAQ F+ RCL+ A  RPSA EL
Sbjct  219   LEMLTADYPYSECSNPAQIYKKVTSGKRPDSLNRVMDPEAQWFIERCLQSAPIRPSAKEL  278

Query  719   LLDPFLAADEEEDESAKLPSQKLIPN---GKLLEVEPCF----VDQQAK-SSDMTITGTL  874
             LLDPFL  ++ E E  +   + L+ N    ++L+ E  +    ++  +K  +D  ITG  
Sbjct  279   LLDPFLEIEDGELE-IEANGETLLSNNLGSEILDFESSWPMASINMGSKRGTDFIITGKQ  337

Query  875   NPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMID  1054
             NP+DDTIFL VQ++DK+G+ R I+FPFDI +DT M+VATEMVKELEITD  P+DIA +++
Sbjct  338   NPDDDTIFLSVQMADKEGRVRKIYFPFDIVTDTVMDVATEMVKELEITDQDPIDIAALME  397

Query  1055  EEISALVPTWRSTQYQKQH-SFNY----IddddddNNVGISTTR---HPF-------Ysl  1189
              EIS+LVP W++      H SF Y      D    +++ +S+     H F       YS 
Sbjct  398   AEISSLVPDWKNKVSSLDHESFCYDDPEFRDIGPFDDISMSSAENSLHNFFPSCEAQYSD  457

Query  1190  ssqsssqaslPDL-LEKINHDWLQNDDTSSRSSMNSYDCSNLCW-ATESEGDLSSIG---  1354
             SS   + +  PD+ ++    +W+  +DTSS+SS  S    N  + +   EG+ S  G   
Sbjct  458   SSGQLASSYRPDISIDWSQEEWINEEDTSSQSSTYSIGYPNYSYHSAHKEGEDSESGLQT  517

Query  1355  ----GRESLL---------IQKTNTGTRLCPETSRSNKKKGCCGSNHQRP----------  1465
                 G+ES +         I    T +R CP T ++         N  RP          
Sbjct  518   GGRKGKESCMSITRDLPVHINTLKT-SRFCPFTDQTFSVSPRTCQNCLRPQDSTRLSRNR  576

Query  1466  KMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSCKGNRSFQP  1636
             +M R  SM+D+RSQ     L EE+ + RL+KTVGA+ENIG+H   E+ CK      P
Sbjct  577   QMLRKYSMMDIRSQFCRLNLTEELRRLRLYKTVGAIENIGFHPIHEFPCKARNVRSP  633



>gb|EPS73758.1| hypothetical protein M569_00993, partial [Genlisea aurea]
Length=420

 Score =   513 bits (1321),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 263/400 (66%), Positives = 323/400 (81%), Gaps = 27/400 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFD++LG+EVAWN+I+L+ VF+SP +LQRLY EV LL++L+H+SIMRF  SWID D
Sbjct  33    TVYRAFDQLLGIEVAWNRIELHRVFKSPVDLQRLYCEVHLLRNLNHTSIMRFFTSWIDPD  92

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITE+FTSGTLREYR+RY  V+IRAIK+W RQIL+GL YLH HDPPV+HRDLKCD
Sbjct  93    RRTFNFITEMFTSGTLREYRKRYNKVDIRAIKDWARQILKGLEYLHCHDPPVVHRDLKCD  152

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNG+LGQVKIGDLGLAA+L GS HAHSVIGTPEFMAPELY+E+YDELVDIYSFGMCV
Sbjct  153   NIFVNGYLGQVKIGDLGLAAILNGSQHAHSVIGTPEFMAPELYDEDYDELVDIYSFGMCV  212

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPY+EC+NPAQIYKKVTSG+LPA+FY +++ EA+RF+GRCLE AS+RPSA EL
Sbjct  213   LEMLTCEYPYNECSNPAQIYKKVTSGQLPASFYSVEDEEAKRFIGRCLEKASRRPSASEL  272

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             L DPFL+ +E+++ +A L  +       L E E        + + MTITGT+NP+DD+IF
Sbjct  273   LRDPFLSIEEDKELAAALQFK-----ASLKEPE--------RKTQMTITGTMNPKDDSIF  319

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQ+ D  G  RNI+FPF IT DT+++VATEMVKEL+ITDW   +IA+MIDEEIS LVP
Sbjct  320   LKVQMLDGVGGTRNIYFPFHITCDTSLDVATEMVKELDITDWRAFEIAKMIDEEISDLVP  379

Query  1079  TWRSTQY-----QKQHSFNYIddddddNNVGISTTRHPFY  1183
              W+   +     Q++H+ NY      D + G+    HPFY
Sbjct  380   AWKKCSFPKSREQQRHTVNY-----ADEDNGL---HHPFY  411



>emb|CDX78018.1| BnaA09g32130D [Brassica napus]
Length=552

 Score =   518 bits (1333),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 300/523 (57%), Positives = 367/523 (70%), Gaps = 49/523 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD+VLGMEVAWNQ+KLN +FRS E LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  43    TVYKAFDQVLGMEVAWNQVKLNEIFRSHEALQRLYSEVHLLKNLNHESIIRYCTSWIDIN  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELFTSGTLREYR++Y  V+IRAIK+W RQIL GLAY+H HDPPVIHRDLKCD
Sbjct  103   RRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWSRQILNGLAYMHGHDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LR S  AHSVIGTPEFMAPELY+EEY++LVDIYSFGMCV
Sbjct  163   NIFVNGHLGQVKIGDLGLAAVLRESQQAHSVIGTPEFMAPELYDEEYNQLVDIYSFGMCV  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPY EC NPAQIYKKVTSG LP +F  I N EA+RFVG+CLE  SKR SA EL
Sbjct  223   LEMLTGEYPYIECDNPAQIYKKVTSGTLPRSFRLIQNMEAKRFVGKCLETVSKRLSAQEL  282

Query  719   LLDPFLAADEEEDES--AKLPS----QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             L DPFLA  +E D +  ++LPS    Q L  NG ++E  P   D   +++DM+ITG +N 
Sbjct  283   LEDPFLAMTDEGDLAPLSRLPSQLAIQNLAANGTVVEPLPLVTDPN-RTTDMSITGRMNS  341

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             ED TIFL+VQISD +G  RNI FPF I SDT +EVA EMVKELEITDW PL+IA MI+ E
Sbjct  342   EDHTIFLQVQISDGNGYMRNIHFPFSIVSDTPLEVALEMVKELEITDWDPLEIAAMIENE  401

Query  1061  ISALVPTWRSTQYQK--QHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE  1234
             IS LVP W + +      HSF++    +DD++ G  T   PFY       S A  PD L 
Sbjct  402   ISLLVPNWSAHEDPSLLHHSFDH----EDDDDSGRRT--RPFY-------SAACSPDPLV  448

Query  1235  KINHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPET  1414
              +N     +++ SS   ++  D S                G  +LL   T   +    + 
Sbjct  449   AVN-----DNNNSSLEDLSLRDHS---------------FGSNTLLSSSTYQHSPPVEDD  488

Query  1415  SRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNK  1543
              +S +++      H      +++S+VD R+Q+LHR+L+E +N+
Sbjct  489   DQSPQQRRRRLRLH------KMKSLVDTRTQVLHRSLMELINR  525



>gb|EPS71002.1| hypothetical protein M569_03748, partial [Genlisea aurea]
Length=425

 Score =   512 bits (1319),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 264/399 (66%), Positives = 316/399 (79%), Gaps = 18/399 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD++LG+EVAW +++L  VF+SP +LQRLY EV LL++L+H+SIMRF  SW+D D
Sbjct  22    TVYKAFDQLLGIEVAWCRVELCKVFKSPTDLQRLYCEVHLLRNLNHASIMRFFTSWMDVD  81

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RR FNF+TE+FTSGTLREYR +Y  V+IRAIK+W RQIL+GL YLHSHDPPVIHRDLKCD
Sbjct  82    RRAFNFVTEMFTSGTLREYRNKYARVDIRAIKDWARQILKGLEYLHSHDPPVIHRDLKCD  141

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNG+LGQVKIGDLGLAA+L+GS HAHSVIGTPEFMAPELYEEEYDELVDIYSFGM V
Sbjct  142   NIFVNGYLGQVKIGDLGLAAILKGSRHAHSVIGTPEFMAPELYEEEYDELVDIYSFGMVV  201

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC+NPAQIYKKVTSGKLPA+FY +D+ EA+RF+GRCLE AS RPSA EL
Sbjct  202   LEMLTREYPYSECSNPAQIYKKVTSGKLPASFYHVDDEEARRFIGRCLEKASTRPSATEL  261

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             L DPFL+A+E E     LP+  L+     +   P  + +  K + M+ITGT+  EDD+I 
Sbjct  262   LKDPFLSAEEYE----GLPAAILVKAS--MSARPKELHKPTKKTQMSITGTM-AEDDSII  314

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQI DKDG+ +NI+FPFDIT D  + VATEMVKEL++TDW  ++IA MID EIS LVP
Sbjct  315   LKVQIPDKDGRTKNIYFPFDITDDIPLNVATEMVKELDMTDWEAVEIAHMIDSEISNLVP  374

Query  1079  TWRS----TQYQKQHSFNYIddddddNNVGISTTRHPFY  1183
              W++     Q Q QHSFNY       +    S   HPFY
Sbjct  375   DWKNGSALVQIQHQHSFNY------ADEEDDSILHHPFY  407



>ref|XP_010685972.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=594

 Score =   516 bits (1330),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 290/551 (53%), Positives = 386/551 (70%), Gaps = 39/551 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ ++ +V RSPE+L+RLYSEV LL  L+H SI+RF+ SWI+T+
Sbjct  40    TVYKAIDEVLGIEVAWNQARIKDVLRSPEQLERLYSEVHLLSTLNHDSIIRFYTSWINTN  99

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +RTFNFITELFTSGTLR+YR+ Y  V+I+AIK+W RQIL+GL YLH HDPPVIHRDLKCD
Sbjct  100   QRTFNFITELFTSGTLRQYRRTYRRVDIQAIKSWSRQILQGLVYLHGHDPPVIHRDLKCD  159

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH+GQVKIGDLGLAA+L+GS  AHS+IGTPEFMAPELYEE+Y+ELVD+YSFGMC+
Sbjct  160   NIFVNGHVGQVKIGDLGLAALLKGSKTAHSIIGTPEFMAPELYEEDYNELVDVYSFGMCL  219

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +EM T EYPYSEC NPAQIYKKVTSGKLP A +R+ + EAQRF+ +CL P S+R SA +L
Sbjct  220   IEMFTLEYPYSECANPAQIYKKVTSGKLPKALHRVQDKEAQRFIRKCLAPKSERLSASDL  279

Query  719   LLDPFLAA-DEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             LLDPFL++  +     + + S+K   N   LE +   VD   + ++MTITG L  +D TI
Sbjct  280   LLDPFLSSVGDLLHTKSFIESEKPFLNYSSLE-KLKLVDSLPR-TNMTITGNLKTKDGTI  337

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
              L+VQ SD +G  RNIFFPFDI +DT++EVATEMV+ELEI DW P +IAEMI+ EIS L 
Sbjct  338   ILKVQFSDGNGPPRNIFFPFDIINDTSLEVATEMVEELEINDWEPQEIAEMIEAEISILK  397

Query  1076  PTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH  1246
             P W+   S + Q  +SF+Y++D+ D ++    ++       S+         D L  +++
Sbjct  398   PHWKKWVSPRSQPYNSFDYLEDEYDGSHHMHHSSSCSSSVASASGVFCTQRSDRL-VMSN  456

Query  1247  DWLQ---NDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS  1417
             D LQ   +D+ +S SS +S   +NL  +   +             +Q        C + S
Sbjct  457   DHLQEDFSDEINSYSSKHSDKITNLSHSLVDD-------------VQGITVSKSKCFKNS  503

Query  1418  RSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             R               +++R RS++D++SQ LH++L+EEV+K+R+FKTVG+VENIG+  P
Sbjct  504   R---------------QLTRNRSLIDVQSQRLHQSLLEEVHKKRMFKTVGSVENIGFRSP  548

Query  1598  AEYSCKGNRSF  1630
              ++S    +  
Sbjct  549   FDFSTSQGKGL  559



>ref|XP_003623589.1| With no lysine kinase [Medicago truncatula]
 gb|AES79807.1| WNK kinase [Medicago truncatula]
 gb|KEH23268.1| WNK kinase [Medicago truncatula]
Length=603

 Score =   516 bits (1328),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 305/567 (54%), Positives = 384/567 (68%), Gaps = 47/567 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE LG+EVAWNQ+KL +V  SP++LQRLYSEV LLK LDH S+M F+ SWID +
Sbjct  41    TVYRAFDEFLGIEVAWNQVKLGDVCHSPDQLQRLYSEVHLLKHLDHKSMMIFYGSWIDIN  100

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNFITELFTSGTLREYRQ+Y  V+ +A+KNW RQIL GL YLH+H+PPVIHRDLKCD
Sbjct  101   GKTFNFITELFTSGTLREYRQKYKKVDNQALKNWARQILSGLEYLHNHNPPVIHRDLKCD  160

Query  362   NIFVNGHLGQVKIGDLGLAAML-RGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH G+VKIGDLGLAA+L R   A SVIGTPEFMAPELYEE+Y+ELVDIYS+GMC+
Sbjct  161   NIFVNGHKGEVKIGDLGLAAILCRSQLAQSVIGTPEFMAPELYEEKYNELVDIYSYGMCM  220

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +EMLT E+PY+EC+NPAQIYKKVT+GKLP AF+RI + EAQRFVGRCL   SKRPSA EL
Sbjct  221   IEMLTLEFPYNECSNPAQIYKKVTAGKLPNAFFRIKDLEAQRFVGRCLAHVSKRPSAKEL  280

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             L+DPFLA ++ E     LP+  L  N  L       +     S++MTITG+++ ED+TIF
Sbjct  281   LMDPFLATEQFE---LSLPNTTLSKNQTLHHFS---LGDSTTSTNMTITGSISEEDNTIF  334

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+V++ D+ G+ R+IFFPFD  +DTA++VA EMV+ELEI    PL IA MID EIS L P
Sbjct  335   LKVRLCDEIGQTRHIFFPFDTKNDTAIKVAMEMVEELEINHLEPLKIAAMIDNEISTLFP  394

Query  1079  TWRST----QYQKQHSFNYIddddddN-NVGISTTRHP------FYslssqsssqaslPD  1225
             TW  T    ++Q QHS+NY +D+D +N N  + ++ +P           S++   A    
Sbjct  395   TWMGTHGKCEHQLQHSYNYEEDEDVNNHNPFVLSSSYPSSPHDSLTKSHSKAHFCAKHSM  454

Query  1226  LLEKINHDWLQNDDTSSRSSMNSYDCSNLCW------------ATESEGDLSSIGGRESL  1369
               ++ N D   NDD SS SSMNSY CSN+ +            A     +L  I  R   
Sbjct  455   FPQEWNQDLYMNDDGSSPSSMNSYKCSNIQYHEDEHCPTIVEEARAKHNNLQCIRSRH--  512

Query  1370  LIQKTNTGT----RLCPETSRSNKKKGC-CG----SNHQRPKMSRVRS-MVDLRSQLLHR  1519
              I++ +T       L P+    N   GC CG    S+H   ++ +  S M   RS  LHR
Sbjct  513   -IEEGDTSNFAKYFLHPKMDYCN---GCRCGGHGTSHHGSSRIPKNHSNMEQHRSLQLHR  568

Query  1520  -TLVEEVNKRRLFKTVGAVENIGYHEP  1597
               L+EEV KR +F T+  +E IG+  P
Sbjct  569   PQLLEEVYKRPMFNTIATMEGIGFQYP  595



>emb|CDX73710.1| BnaC08g22930D [Brassica napus]
Length=553

 Score =   513 bits (1321),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 300/523 (57%), Positives = 366/523 (70%), Gaps = 48/523 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD+VLGMEVAWNQ+KLN +FRS E LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  43    TVYKAFDQVLGMEVAWNQVKLNEIFRSHEALQRLYSEVHLLKNLNHESIIRYCTSWIDIN  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELFTSGTLREYR++Y  V+IRAIK+W RQIL GLAY+H HDPPVIHRDLKCD
Sbjct  103   RRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWSRQILNGLAYMHGHDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LR S  AHSVIGTPEFMAPELY+EEY++LVDIYSFGMCV
Sbjct  163   NIFVNGHLGQVKIGDLGLAAVLRESQQAHSVIGTPEFMAPELYDEEYNQLVDIYSFGMCV  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPY EC NPAQIYKKVTSG LP +F  I N EA+RFVG+CLE  SKR SA EL
Sbjct  223   LEMLTGEYPYIECDNPAQIYKKVTSGTLPRSFRLIQNIEAKRFVGKCLETVSKRLSAKEL  282

Query  719   LLDPFLAADEEEDES--AKLPS----QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             L DPFLA  +E D +  ++LPS    Q L  NG ++E  P  +D  A+++DM+ITG +N 
Sbjct  283   LEDPFLAMTDEGDLAPLSRLPSQLAIQNLAANGTVVEPLPSVID-PARTTDMSITGRMNS  341

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             ED TIFL+VQISD +G  RNI FPF I SDT +EVA EMVKELEITDW PL+IA MI+ E
Sbjct  342   EDHTIFLQVQISDGNGYMRNIHFPFSIVSDTPLEVALEMVKELEITDWDPLEIAAMIENE  401

Query  1061  ISALVPTWRSTQYQK--QHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE  1234
             IS LVP W + +      HSF +    +DD++ G  T   PFY     S++ +  P +  
Sbjct  402   ISLLVPNWSAHEDPSLLHHSFGH----EDDDDNGRRT--RPFY-----SAACSPDPPVAV  450

Query  1235  KINHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPET  1414
             K N +             NS +  +LC    S G         S  +  ++T  +  P  
Sbjct  451   KDNKN-------------NSVE--DLCLRHHSFG---------SNTLLSSSTYQQHSPPV  486

Query  1415  SRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNK  1543
                ++         +  KM   +S+VD R+Q+LHR+L+E +N+
Sbjct  487   EDDDQSPQQRRRRLRLHKM---KSLVDTRTQVLHRSLMELINR  526



>ref|XP_004500451.1| PREDICTED: uncharacterized protein LOC101508676 [Cicer arietinum]
Length=2466

 Score =   552 bits (1422),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 314/564 (56%), Positives = 399/564 (71%), Gaps = 29/564 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ+KLN   R+PE+L+RLY EV LL  L H SIM+F+ SWID D
Sbjct  1891  TVYKAIDEVLGIEVAWNQVKLNEALRTPEDLERLYLEVHLLSTLKHQSIMQFYTSWIDVD  1950

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLREYR+ Y  V ++AIK+W RQIL+GL YLH HDPPVIHRDLKCD
Sbjct  1951  NRTFNFITEMFTSGTLREYRKTYKYVGMQAIKSWARQILQGLVYLHEHDPPVIHRDLKCD  2010

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGT-----PEFMAPelyeeeydelvdIYS  523
             NIFVNGHLGQVKIGDLGLAA+LRGS  AHSVIGT      +FMAPELYEEEY+ELVD+YS
Sbjct  2011  NIFVNGHLGQVKIGDLGLAAILRGSQPAHSVIGTYFSFAGKFMAPELYEEEYNELVDVYS  2070

Query  524   FGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRP  703
             FGMCVLE++TS+YPYSECTNPAQIYKKVTSGKLPAAF+RI++AEAQ+F+G+CL  A+KRP
Sbjct  2071  FGMCVLEIITSDYPYSECTNPAQIYKKVTSGKLPAAFFRIEDAEAQKFIGKCLVNAAKRP  2130

Query  704   SAHELLLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPE  883
             SA ELL DPFL  D+    + K+  Q   P     E++   +   +  + M+ITG LNPE
Sbjct  2131  SAKELLKDPFLVCDDASSIT-KIVMQD--PFLNYTEMDKLQLKSDSPRTSMSITGKLNPE  2187

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             DD+IFL+VQISDKDG ARN++FPFDI +DT ++VA EMVKEL+ITDW P +IA MI+ EI
Sbjct  2188  DDSIFLKVQISDKDGYARNVYFPFDIFNDTPIDVAMEMVKELDITDWEPSEIANMIEGEI  2247

Query  1064  SALVPTWRSTQY-QKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKI  1240
             S L+P  R++ +    HSF+Y    DD+N+ G     H   S SS   S +S  +  + +
Sbjct  2248  SVLLPDRRNSNHPHTCHSFSY---HDDENDEGPHQYHHSVSSCSSSQESLSSAVNRADDV  2304

Query  1241  N------HDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRL  1402
             +      HD + +D +S  SS  +Y   N C   + + +++S    +  ++    T    
Sbjct  2305  SNGYRLLHDDMCDDASSRCSSHGTYSDLNFCSVDDQDHNVASTRKDKHPIMNHKFTMFSH  2364

Query  1403  CPETSRSNKKKGCCG----SNHQRPKM------SRVRSMVDLRSQLLHRTLVEEVNKRRL  1552
               +    N+ K   G    S  +  KM      +R +S++D+RSQLLHR+LVEEVNKRRL
Sbjct  2365  GEDQITLNQCKVLAGPQAPSTSESKKMTDNRILTRNKSLIDMRSQLLHRSLVEEVNKRRL  2424

Query  1553  FKTVGAVENIGYHEPAEYSCKGNR  1624
             FKTVGAVE+IG+  P E + K ++
Sbjct  2425  FKTVGAVESIGFQTPYEITSKKSQ  2448



>dbj|BAJ91424.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=636

 Score =   511 bits (1317),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 308/565 (55%), Positives = 375/565 (66%), Gaps = 47/565 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWID--  175
             +VYR FDEV G+EVAWNQ  L +V R+P+ LQR+YSEV LL  L H SI+ FHASW+   
Sbjct  43    SVYRGFDEVRGVEVAWNQANLADVLRTPDALQRMYSEVHLLSTLRHDSIIAFHASWVSVS  102

Query  176   --------TDRRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDP  331
                       RRTFNFITELF+SGTLR YR RY  V++RA++ W RQIL GLAYLH+HDP
Sbjct  103   SPSPRAGCAPRRTFNFITELFSSGTLRAYRLRYPRVSLRAVRGWARQILRGLAYLHAHDP  162

Query  332   PVIHRDLKCDNIFVNGHLGQVKIGDLGLAAMLRGSHA-HSVIGTPEFMAPelyeeeydel  508
             PVIHRDLKCDN+FVNGH G VKIGDLGLAA+LRG+ A HSVIGTPEFMAPE+Y+E+YDEL
Sbjct  163   PVIHRDLKCDNVFVNGHQGTVKIGDLGLAAVLRGAQAAHSVIGTPEFMAPEMYDEDYDEL  222

Query  509   vdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEP  688
             VD+YSFGMC+LEMLT EYPY+EC+NPAQIYKKVTSGKLP AFYR+D+A+A+RF+GRCL P
Sbjct  223   VDVYSFGMCMLEMLTVEYPYAECSNPAQIYKKVTSGKLPDAFYRVDDADARRFIGRCLVP  282

Query  689   ASKRPSAHELLLDPFLAA-DEEEDESAKLPSQKLIPNGKLLE----VEPCFVDQQAKSSD  853
             AS RPSA ELLLDPFL+  D     S       L  +G   +     EP      A  +D
Sbjct  283   ASHRPSAQELLLDPFLSTQDTTMTLSPPPLLPALPVSGDRKDSTEKAEPV-----AAMTD  337

Query  854   MTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPL  1033
             MTITG LN +DDTIFL+VQI D+ G +RNI+FPFDI  DTA EVA EMVKEL+ITD  P 
Sbjct  338   MTITGKLNTDDDTIFLKVQIVDEAGHSRNIYFPFDIAGDTATEVAREMVKELDITDRDPS  397

Query  1034  DIAEMIDEEISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYs-lssqsssq  1210
             +IA MI+EEI  LVP W       Q  + Y   D+DDN       + PFY   SS +SS 
Sbjct  398   EIAAMIEEEIMRLVPDWVGGGCDDQQEY-YTYADNDDNE-----EQPPFYYLSSSPTSSN  451

Query  1211  aslPDLLEKINHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNT  1390
              S   +    +  W Q+   SS     S   S L +++E        G  ++  ++ T  
Sbjct  452   GSHSGVGPTTSGGWFQDYAVSSDDDETSSTRSALHYSSEEAQPEEKPGVSKTGQVKATRF  511

Query  1391  GTR---------LCPETSRSNKKKGCCGS----------NHQRPKMSRVRSMVDLRSQLL  1513
             G           +   +SR+++ +   GS            Q+ +M+R RSMVD+RSQLL
Sbjct  512   GPGDIGPGGGHDVSSSSSRADRPRHHRGSPDAGGEEGRPRRQKGRMTRNRSMVDVRSQLL  571

Query  1514  HRTLVEEVNKRRLFKTVGAVENIGY  1588
             HRTLVEE+NKR  F TVGAVENIG+
Sbjct  572   HRTLVEELNKRMFFNTVGAVENIGF  596



>dbj|BAJ95861.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=636

 Score =   511 bits (1316),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 308/565 (55%), Positives = 375/565 (66%), Gaps = 47/565 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWID--  175
             +VYR FDEV G+EVAWNQ  L +V R+P+ LQR+YSEV LL  L H SI+ FHASW+   
Sbjct  43    SVYRGFDEVRGVEVAWNQANLADVLRTPDALQRMYSEVHLLSTLRHDSIIAFHASWVSVS  102

Query  176   --------TDRRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDP  331
                       RRTFNFITELF+SGTLR YR RY  V++RA++ W RQIL GLAYLH+HDP
Sbjct  103   SPSPRAGCAPRRTFNFITELFSSGTLRAYRLRYPRVSLRAVRGWARQILRGLAYLHAHDP  162

Query  332   PVIHRDLKCDNIFVNGHLGQVKIGDLGLAAMLRGSHA-HSVIGTPEFMAPelyeeeydel  508
             PVIHRDLKCDN+FVNGH G VKIGDLGLAA+LRG+ A HSVIGTPEFMAPE+Y+E+YDEL
Sbjct  163   PVIHRDLKCDNVFVNGHKGTVKIGDLGLAAVLRGAQAAHSVIGTPEFMAPEMYDEDYDEL  222

Query  509   vdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEP  688
             VD+YSFGMC+LEMLT EYPY+EC+NPAQIYKKVTSGKLP AFYR+D+A+A+RF+GRCL P
Sbjct  223   VDVYSFGMCMLEMLTVEYPYAECSNPAQIYKKVTSGKLPDAFYRVDDADARRFIGRCLVP  282

Query  689   ASKRPSAHELLLDPFLAA-DEEEDESAKLPSQKLIPNGKLLE----VEPCFVDQQAKSSD  853
             AS RPSA ELLLDPFL+  D     S       L  +G   +     EP      A  +D
Sbjct  283   ASHRPSAQELLLDPFLSTQDTTMTLSPPPLLPALPVSGDRKDSTEKAEPV-----AAMTD  337

Query  854   MTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPL  1033
             MTITG LN +DDTIFL+VQI D+ G +RNI+FPFDI  DTA EVA EMVKEL+ITD  P 
Sbjct  338   MTITGKLNTDDDTIFLKVQIVDEAGHSRNIYFPFDIAGDTATEVAREMVKELDITDRDPS  397

Query  1034  DIAEMIDEEISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYs-lssqsssq  1210
             +IA MI+EEI  LVP W       Q  + Y   D+DDN       + PFY   SS +SS 
Sbjct  398   EIAAMIEEEIMRLVPDWVGGGCDDQQEY-YTYADNDDNE-----EQPPFYYLSSSPTSSN  451

Query  1211  aslPDLLEKINHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNT  1390
              S   +    +  W Q+   SS     S   S L +++E        G  ++  ++ T  
Sbjct  452   GSHSGVGPTTSGGWFQDYAVSSDDDETSSTRSALHYSSEEAQPEEKPGVSKTGQVKATRF  511

Query  1391  GTR---------LCPETSRSNKKKGCCGS----------NHQRPKMSRVRSMVDLRSQLL  1513
             G           +   +SR+++ +   GS            Q+ +M+R RSMVD+RSQLL
Sbjct  512   GPGDIGPGGGHDVSSSSSRADRPRHHRGSPDAGGEEGRPRRQKGRMTRNRSMVDVRSQLL  571

Query  1514  HRTLVEEVNKRRLFKTVGAVENIGY  1588
             HRTLVEE+NKR  F TVGAVENIG+
Sbjct  572   HRTLVEELNKRMFFNTVGAVENIGF  596



>gb|AAO16559.1| mitogen-activated protein kinase [Triticum aestivum]
Length=640

 Score =   511 bits (1315),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 303/564 (54%), Positives = 376/564 (67%), Gaps = 41/564 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWI---  172
             +VYR FDEV G+EVAWNQ  L +V R+P+ LQR+YSEV LL  L H +I+ FHASW+   
Sbjct  43    SVYRGFDEVRGVEVAWNQANLADVLRTPDALQRMYSEVHLLSTLRHDAIIAFHASWVSVS  102

Query  173   ----------DTDRRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHS  322
                        T RRTFNFITELF+SGTLR YR RY  V++RA++ W RQIL GLAYLH+
Sbjct  103   SPSPRGGCTGGTPRRTFNFITELFSSGTLRAYRLRYPRVSLRAVRGWARQILRGLAYLHA  162

Query  323   HDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLAAMLRGSHA-HSVIGTPEFMAPelyeeey  499
             HDPPVIHRDLKCDN+FVNGH G VKIGDLGLAA+LRG+ A HSVIGTPEFMAPE+Y+E+Y
Sbjct  163   HDPPVIHRDLKCDNVFVNGHQGTVKIGDLGLAAVLRGAQAAHSVIGTPEFMAPEMYDEDY  222

Query  500   delvdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRC  679
             DELVD+YSFGMC+LEMLT EYPY+EC+NPAQIYKKVTSGKLP AFYR+D+A+A+RF+GRC
Sbjct  223   DELVDVYSFGMCMLEMLTVEYPYAECSNPAQIYKKVTSGKLPDAFYRVDDADARRFIGRC  282

Query  680   LEPASKRPSAHELLLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMT  859
             L PAS RPSA ELLLD FL+  +     +  P    +P     +  P   +  A  +DMT
Sbjct  283   LVPASHRPSAQELLLDRFLSTQDTTMTLSPPPLLPALPTSGDRKDNPEEAEPVAARTDMT  342

Query  860   ITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDI  1039
             ITG LN +DDTIFL+VQI D+ G +RNI+FPFDI  DTA EVA EMVKEL+ITD  P +I
Sbjct  343   ITGKLNTDDDTIFLKVQIVDEAGHSRNIYFPFDIAGDTATEVAREMVKELDITDRDPSEI  402

Query  1040  AEMIDEEISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssq---  1210
             A MI++EI+ LVP W       Q  + Y   D+DDN       + PFY LSS  +S    
Sbjct  403   AAMIEQEITRLVPDWVGGGCDDQQEY-YTYADNDDNE-----EQPPFYYLSSSPTSSNGS  456

Query  1211  --aslPDLLEKINHDWLQN-----DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESL  1369
                + P         W Q+     DD  + S+ ++   S+     E +  +S  G  ++ 
Sbjct  457   HCGTGPTTSGGGYAGWFQDYAVSSDDDETSSTRSALHYSSEEAQPEEKPGVSKTGQVKAT  516

Query  1370  LIQKTNTGTRLCPETS------RSNKKKGCCGSNHQRP-----KMSRVRSMVDLRSQLLH  1516
                  ++GT     +S      R ++     G +  RP     +M+R RSMVD+RSQLLH
Sbjct  517   RFGPGDSGTAGHDVSSSRAGRPRHHRGSPDAGGDEGRPRRQQGRMTRNRSMVDVRSQLLH  576

Query  1517  RTLVEEVNKRRLFKTVGAVENIGY  1588
             RTLVEE+NKR  F TVGAVENIG+
Sbjct  577   RTLVEELNKRMFFNTVGAVENIGF  600



>ref|XP_009115849.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Brassica 
rapa]
Length=693

 Score =   512 bits (1319),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 287/465 (62%), Positives = 340/465 (73%), Gaps = 31/465 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFD+VLGMEVAWNQ+KLN +FRS E LQRLYSEV LLK+L+H SI+R+  SWID +
Sbjct  43    TVYKAFDQVLGMEVAWNQVKLNEIFRSHEALQRLYSEVHLLKNLNHESIIRYCTSWIDIN  102

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELFTSGTLREYR++Y  V+IRAIK+W RQIL GLAY+H HDPPVIHRDLKCD
Sbjct  103   RRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWSRQILNGLAYMHGHDPPVIHRDLKCD  162

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LR S  AHSVIGTPEFMAPELY+EEY++LVDIYSFGMCV
Sbjct  163   NIFVNGHLGQVKIGDLGLAAVLRESQQAHSVIGTPEFMAPELYDEEYNQLVDIYSFGMCV  222

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPY EC NPAQIYKKVTSG LP +F  I N EA+RFVG+CLE  SKR SA EL
Sbjct  223   LEMLTGEYPYIECDNPAQIYKKVTSGTLPRSFRLIQNMEAKRFVGKCLETVSKRLSAKEL  282

Query  719   LLDPFLAADEEEDES--AKLPS----QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             L DPFL+  +E D +  ++LPS    Q L PNG ++E  P   D   +++DM+ITG +N 
Sbjct  283   LEDPFLSMTDEGDLAPLSRLPSQLAIQNLAPNGTVVEPLPLVTDPN-RTTDMSITGRMNS  341

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             ED TIFL+VQISD +G  RNI FPF I SDT +EVA EMVKELEITDW PL+IA MI+ E
Sbjct  342   EDHTIFLQVQISDGNGYMRNIHFPFSIVSDTPLEVALEMVKELEITDWDPLEIAAMIENE  401

Query  1061  ISALVPTWRSTQYQK--QHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE  1234
             IS LVP W + +      HSF++    +DD++ G  T   PFY       S A  PD L 
Sbjct  402   ISLLVPNWSAHEDPSLLHHSFDH----EDDDDSGRRT--RPFY-------SAACSPDPLV  448

Query  1235  KINHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESL  1369
              +N         ++ SS+      +  +  E + D    GGR +L
Sbjct  449   AVN--------DNNNSSLEDLSLRDHSFGYEDDEDNGEGGGRRTL  485



>dbj|BAJ88098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=636

 Score =   509 bits (1311),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 307/565 (54%), Positives = 374/565 (66%), Gaps = 47/565 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWID--  175
             +VYR FDEV G+EVAWNQ  L +V R+P+ LQR+YSEV LL  L H SI+ FHASW+   
Sbjct  43    SVYRGFDEVRGVEVAWNQANLADVLRTPDALQRMYSEVHLLSTLRHDSIIAFHASWVSVS  102

Query  176   --------TDRRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDP  331
                       RRTFNFITELF+SGTLR YR RY  V++RA++ W RQIL GLAYLH+HDP
Sbjct  103   SPSPRAGCAPRRTFNFITELFSSGTLRAYRLRYPRVSLRAVRGWARQILRGLAYLHAHDP  162

Query  332   PVIHRDLKCDNIFVNGHLGQVKIGDLGLAAMLRGSHA-HSVIGTPEFMAPelyeeeydel  508
             PVIHRDLKCDN+FVNGH G VKIGDLGLAA+LRG+ A HSV GTPEFMAPE+Y+E+YDEL
Sbjct  163   PVIHRDLKCDNVFVNGHQGTVKIGDLGLAAVLRGAQAAHSVFGTPEFMAPEMYDEDYDEL  222

Query  509   vdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEP  688
             VD+YSFGMC+LEMLT EYPY+EC+NPAQIYKKVTSGKLP AFYR+D+A+A+RF+GRCL P
Sbjct  223   VDVYSFGMCMLEMLTVEYPYAECSNPAQIYKKVTSGKLPDAFYRVDDADARRFIGRCLVP  282

Query  689   ASKRPSAHELLLDPFLAA-DEEEDESAKLPSQKLIPNGKLLE----VEPCFVDQQAKSSD  853
             AS RPSA ELLLDPFL+  D     S       L  +G   +     EP      A  +D
Sbjct  283   ASHRPSAQELLLDPFLSTQDTTMTLSPPPLLPALPVSGDRKDSTEKAEPV-----AAMTD  337

Query  854   MTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPL  1033
             MTITG LN +DDTIFL+VQI D+ G +RNI+FPFDI  DTA EVA EMVKEL+ITD  P 
Sbjct  338   MTITGKLNTDDDTIFLKVQIVDEAGHSRNIYFPFDIAGDTATEVAREMVKELDITDRDPS  397

Query  1034  DIAEMIDEEISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYs-lssqsssq  1210
             +IA MI+EEI  LVP W       Q  + Y   D+DDN       + PFY   SS +SS 
Sbjct  398   EIAAMIEEEIMRLVPDWVGGGCDDQQEY-YTYADNDDNE-----EQPPFYYLSSSPTSSN  451

Query  1211  aslPDLLEKINHDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNT  1390
              S   +    +  W Q+   SS     S   S L +++E        G  ++  ++ T  
Sbjct  452   GSHSGVGPTTSGGWFQDYAVSSDDDETSSTRSALHYSSEEAQPEEKPGVSKTGQVKATRF  511

Query  1391  GTR---------LCPETSRSNKKKGCCGS----------NHQRPKMSRVRSMVDLRSQLL  1513
             G           +   +SR+++ +   GS            Q+ +M+R RSMVD+RSQLL
Sbjct  512   GPGDIGPGGGHDVSSSSSRADRPRHHRGSPDAGGEEGRPRRQKGRMTRNRSMVDVRSQLL  571

Query  1514  HRTLVEEVNKRRLFKTVGAVENIGY  1588
             HRTLVEE+NKR  F TVGAVENIG+
Sbjct  572   HRTLVEELNKRMFFNTVGAVENIGF  596



>gb|KHN29517.1| Putative serine/threonine-protein kinase WNK5 [Glycine soja]
Length=681

 Score =   509 bits (1310),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 287/513 (56%), Positives = 363/513 (71%), Gaps = 37/513 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE+LG+EVAWNQ+KL +VF SPE+LQRLYSEV LLK L+H S+M F+ SWID  
Sbjct  51    TVYRAFDELLGIEVAWNQVKLGDVFHSPEQLQRLYSEVHLLKHLNHDSMMIFYGSWIDVS  110

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNF+TELFTSGTLREYRQ+Y  V+IRA+KNW RQIL GL YLHSH+PPVIHRDLKCD
Sbjct  111   NRTFNFVTELFTSGTLREYRQKYKRVDIRAVKNWARQILSGLEYLHSHNPPVIHRDLKCD  170

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH G+VKIGDLGLAA+L+ S HAHSVIGTPEFMAPELYEE+Y+EL+DIYSFGMC+
Sbjct  171   NIFVNGHQGRVKIGDLGLAAILKSSQHAHSVIGTPEFMAPELYEEKYNELIDIYSFGMCM  230

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +EMLT E+PYSEC NPAQIYKKVTSGKLP AFY+I+N EAQ FVG+CL   S+RPSA EL
Sbjct  231   IEMLTFEFPYSECANPAQIYKKVTSGKLPEAFYKIENLEAQEFVGKCLTNVSERPSAKEL  290

Query  719   LLDPFLAADEEEDE-SAKLPSQKLIPNGKLLEVEPCFVDQ--QAKSSDMTITGTLNPEDD  889
             LLDPFLA ++ E      +P+     + KL    P   D   Q K++DMTI+G++N E++
Sbjct  291   LLDPFLAMEQLEIPLPPSIPALFTNKSFKLNCPAPIPSDHRDQTKNADMTISGSINEENN  350

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
             T+FL+V+ISD  G  R++FFPFD   DTA++VA EMV+ELEI+   PL+IA  ID E+SA
Sbjct  351   TVFLKVRISDITGHTRHVFFPFDTLKDTAIQVAMEMVQELEISHLEPLEIAVRIDHEVSA  410

Query  1070  LVPTWR---STQYQKQHSFNYIddddddNNVGISTTRHPFY-------slssqsssqasl  1219
             LVPTWR      +Q+Q+SFNY +D+D +N+       HPF+          S   S ++ 
Sbjct  411   LVPTWRDRVKCHHQRQYSFNYEEDEDVNNH-------HPFFLSSSPSSPRGSGHMSASNS  463

Query  1220  PDLLEKINH-----DWLQ------NDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRES  1366
                  + NH     +W Q      NDD S ++S+NS+ CS+  +    + D  +     +
Sbjct  464   FKTRVRGNHYPFTQEWPQDDPFMVNDDASPQASLNSFKCSSFQFLDPGQEDEHA----PT  519

Query  1367  LLIQKTNTGTRLC-PETSRSNKKKGCCGSNHQR  1462
                ++T   T L  P + R+ + +G  GS   R
Sbjct  520   DATERTKKCTPLSYPGSGRATRTRGSQGSGPAR  552



>emb|CDY32991.1| BnaA10g11970D [Brassica napus]
Length=561

 Score =   504 bits (1298),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 300/553 (54%), Positives = 383/553 (69%), Gaps = 44/553 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  32    TVYKAIDEMLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVH  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  92    SHTLNFITELFTSGTLRQYKNKYLRIDIRAIKSWARQILEGLVYLHGHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAH-SVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR  HA  SVIGTPEFMAPELYEE Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDLGLARMLRDCHAATSVIGTPEFMAPELYEENYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC NPAQIYKKV +GKLP AFYR+++ EAQRF+G+CL PAS R SA EL
Sbjct  212   LEMITSEFPYSECNNPAQIYKKVVAGKLPGAFYRVEDIEAQRFIGKCLVPASMRVSAREL  271

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             L DPFLA+DE     A   ++ L P     E++   ++          T  L+ ED+ I+
Sbjct  272   LQDPFLASDESWMVYAS-GARNLKPFLNENEMDRLKLEDDE-------TEELDSEDNKIY  323

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L++ I++++G A+N+ F FDI +DT+++VATEMVKELEIT+W P++IA+MID EIS+LVP
Sbjct  324   LKLPIANENGLAKNVSFCFDIMNDTSIDVATEMVKELEITEWDPVEIAKMIDGEISSLVP  383

Query  1079  TWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWLQ  1258
              WRS +                ++  +     PF+S SS SSS+ASL + +     DWLQ
Sbjct  384   GWRSEE----------------DDESLHDYHTPFHSSSSPSSSRASLSNYMAPGRQDWLQ  427

Query  1259  N---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS----  1417
             +   D+T S+SS NS   SNL + +  E  +SS    +   + +T+  TR CPE S    
Sbjct  428   DDFHDETYSQSSSNSGSYSNLNYISVDE-HISS----QPPAMNRTHNVTRFCPEESYHLH  482

Query  1418  --RSNKKKGCCGSNHQRPK-----MSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVE  1576
               ++N       S++ R       ++R RS+VD++ QLLHR+LVEE  KRRL KTVG VE
Sbjct  483   SGQANMYAASSSSSNLRLASDNRVLTRNRSLVDVQGQLLHRSLVEEARKRRLIKTVGDVE  542

Query  1577  NIGYHEPAEYSCK  1615
             N+G+  P   S K
Sbjct  543   NVGFQSPYAVSRK  555



>gb|KCW52442.1| hypothetical protein EUGRSUZ_J01843 [Eucalyptus grandis]
Length=595

 Score =   505 bits (1301),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 305/563 (54%), Positives = 378/563 (67%), Gaps = 64/563 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLGMEVAWNQ+KLN+ FRSP+E QRL SEV LL  L+H SIM+FH SW+D D
Sbjct  42    TVYKAIDEVLGMEVAWNQVKLNDSFRSPDEYQRLISEVHLLSTLNHDSIMKFHTSWVDVD  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
                FNFITE+FTSGTLR YR++Y  ++IRAIKNW  QIL GL YLHSHDPPVIHRDLKCD
Sbjct  102   GTAFNFITEMFTSGTLRNYRKKYPRLHIRAIKNWAVQILHGLVYLHSHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             N+FVNGHLGQVKIGDLGLAA+L GS  AHS+IGTPEFMAPELY+E Y+ELVD+YSFGMCV
Sbjct  162   NLFVNGHLGQVKIGDLGLAAILHGSRAAHSIIGTPEFMAPELYDENYNELVDVYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPY ECTNPAQIYKKVTSGKLP AFYRI +++A++F+G+CL   S R SA EL
Sbjct  222   LEMLTCEYPYIECTNPAQIYKKVTSGKLPEAFYRIKDSKARKFIGKCLANVSCRVSAREL  281

Query  719   LLDPFLAADEEEDESAKLPSQKL-IP----NGKLLEVEPCFVDQQAKSSDMTITGTLNPE  883
             L DPFL +DE +    +LP  K  +P    NG+  +V+          +DM ITG LNPE
Sbjct  282   LHDPFLLSDEGD----RLPGLKFKMPEPFLNGR--DVDNLRARDNPLRTDMMITGKLNPE  335

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
              DTIFL+VQI+D++G ARN++FPFD+ +DT ++VA EMVKELEI DW   +IA+MI  EI
Sbjct  336   GDTIFLKVQIADRNGSARNVYFPFDVLNDTPIDVAKEMVKELEIMDWEAEEIADMIGGEI  395

Query  1064  SALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKIN  1243
             SALVP W      KQ   +Y    + +N+ G +    PF S SS                
Sbjct  396   SALVPNW-----TKQDMTDY----NQENDDGFAP---PFLSFSSDVP-------------  430

Query  1244  HDWLQNDDTSSRSSMNSYDCSNLCWATESEGDLS-SIGGRESLLIQKTNTGTRLC-----  1405
                   DD SS SS++S   S+  +    + +++      +  LI ++N  TR C     
Sbjct  431   ------DDMSSPSSIHSGTYSHTSYFCPEDQEVNPGPSNPDQHLISRSNRHTRFCADDYQ  484

Query  1406  -PETSRSNKKKGCC----GSNHQRP----------KMSRVRSMVDLRSQLLHRTLVEEVN  1540
              P   +   +   C    GS+              ++SR RS+VD+ SQLLH +L+EEV+
Sbjct  485   RPRQFKDRSQTLQCQVLTGSDRDSSSVINRRMAGHRLSRNRSLVDVHSQLLHLSLLEEVS  544

Query  1541  KRRLFKTVGAVENIGYHEPAEYS  1609
             KRRL +TVG VENIG+  P E S
Sbjct  545   KRRLSRTVGEVENIGFQAPFEIS  567



>gb|KCW52443.1| hypothetical protein EUGRSUZ_J01843 [Eucalyptus grandis]
Length=622

 Score =   505 bits (1301),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 315/571 (55%), Positives = 391/571 (68%), Gaps = 53/571 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLGMEVAWNQ+KLN+ FRSP+E QRL SEV LL  L+H SIM+FH SW+D D
Sbjct  42    TVYKAIDEVLGMEVAWNQVKLNDSFRSPDEYQRLISEVHLLSTLNHDSIMKFHTSWVDVD  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
                FNFITE+FTSGTLR YR++Y  ++IRAIKNW  QIL GL YLHSHDPPVIHRDLKCD
Sbjct  102   GTAFNFITEMFTSGTLRNYRKKYPRLHIRAIKNWAVQILHGLVYLHSHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             N+FVNGHLGQVKIGDLGLAA+L GS  AHS+IGTPEFMAPELY+E Y+ELVD+YSFGMCV
Sbjct  162   NLFVNGHLGQVKIGDLGLAAILHGSRAAHSIIGTPEFMAPELYDENYNELVDVYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPY ECTNPAQIYKKVTSGKLP AFYRI +++A++F+G+CL   S R SA EL
Sbjct  222   LEMLTCEYPYIECTNPAQIYKKVTSGKLPEAFYRIKDSKARKFIGKCLANVSCRVSAREL  281

Query  719   LLDPFLAADEEEDESAKLPSQKL-IP----NGKLLEVEPCFVDQQAKSSDMTITGTLNPE  883
             L DPFL +DE +    +LP  K  +P    NG+  +V+          +DM ITG LNPE
Sbjct  282   LHDPFLLSDEGD----RLPGLKFKMPEPFLNGR--DVDNLRARDNPLRTDMMITGKLNPE  335

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
              DTIFL+VQI+D++G ARN++FPFD+ +DT ++VA EMVKELEI DW   +IA+MI  EI
Sbjct  336   GDTIFLKVQIADRNGSARNVYFPFDVLNDTPIDVAKEMVKELEIMDWEAEEIADMIGGEI  395

Query  1064  SALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLL----  1231
             SALVP W      KQ   +Y    + +N+ G +    PF S SS SSSQAS         
Sbjct  396   SALVPNW-----TKQDMTDY----NQENDDGFAP---PFLSFSSGSSSQASPSGFTAYRE  443

Query  1232  EKINHDW--LQN--DDTSSRSSMNSYDCSNLCWATESEGDLS-SIGGRESLLIQKTNTGT  1396
              +I  D+  LQ+  DD SS SS++S   S+  +    + +++      +  LI ++N  T
Sbjct  444   NEIASDYGCLQDVPDDMSSPSSIHSGTYSHTSYFCPEDQEVNPGPSNPDQHLISRSNRHT  503

Query  1397  RLC------PETSRSNKKKGCC----GSNHQRP----------KMSRVRSMVDLRSQLLH  1516
             R C      P   +   +   C    GS+              ++SR RS+VD+ SQLLH
Sbjct  504   RFCADDYQRPRQFKDRSQTLQCQVLTGSDRDSSSVINRRMAGHRLSRNRSLVDVHSQLLH  563

Query  1517  RTLVEEVNKRRLFKTVGAVENIGYHEPAEYS  1609
              +L+EEV+KRRL +TVG VENIG+  P E S
Sbjct  564   LSLLEEVSKRRLSRTVGEVENIGFQAPFEIS  594



>ref|XP_006282057.1| hypothetical protein CARUB_v10028302mg [Capsella rubella]
 gb|EOA14955.1| hypothetical protein CARUB_v10028302mg [Capsella rubella]
Length=576

 Score =   503 bits (1295),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 303/560 (54%), Positives = 374/560 (67%), Gaps = 44/560 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  33    TVYKAIDEKLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVH  92

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  93    NHTLNFITELFTSGTLRQYKNKYLRIDIRAIKSWARQILEGLVYLHGHDPPVIHRDLKCD  152

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR  H AHSVIGTPEFMAPELYEE Y+EL+D+YSFGMC 
Sbjct  153   NIFVNGHLGQVKIGDLGLARMLRDCHSAHSVIGTPEFMAPELYEENYNELIDVYSFGMCF  212

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC NPAQIYKKV SGKLP AFYR+ + EAQRF+G+CL  ASKR SA EL
Sbjct  213   LEMITSEFPYSECNNPAQIYKKVVSGKLPGAFYRVGDIEAQRFIGKCLVSASKRVSAKEL  272

Query  719   LLDPFLAADEE---EDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDD  889
             L DPFLA+DE        A  P   L  N    E++   ++     + M+I G L  ED+
Sbjct  273   LQDPFLASDESWMVYASGAGNPKPFLNEN----EMDSLKLEDDELRTQMSIAGKLGTEDN  328

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
              I L VQI+  +G A N+FFPFDI +DT+M+VA EMVKELEI DW P++IA+MID  IS+
Sbjct  329   KIDLEVQIAYDNGLANNVFFPFDIMNDTSMDVAKEMVKELEIMDWEPVEIAKMIDGAISS  388

Query  1070  LVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFY-slssqsssqaslPDLLEKINH  1246
             LVP WR           Y +DD+  ++        PF+ S S  SSSQ SL + + +   
Sbjct  389   LVPGWR-----------YEEDDEIPHDDDDHHRTDPFHSSSSHSSSSQTSLSNYMARGLQ  437

Query  1247  DWLQ------NDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCP  1408
             DW+Q      +D+T S+SS +S   SNL +    E         +S  + +T+  TR CP
Sbjct  438   DWVQGTENDLHDETYSQSSSHSGSYSNLNYIAVDE------HSSQSPALNRTHNLTRFCP  491

Query  1409  ETS------RSNKKKGCCGSNHQ-----RPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLF  1555
             E S      ++N        N +     RP ++R RS+VD++ QL HR+  EE  K+RLF
Sbjct  492   EESSHLQPGQANVYAASSSINRRLASDNRP-LTRNRSLVDVQRQLPHRSPREEARKKRLF  550

Query  1556  KTVGAVENIGYHEPAEYSCK  1615
             KTVG VE +G+  P   S K
Sbjct  551   KTVGDVETVGFQSPYAISRK  570



>ref|XP_002864565.1| hypothetical protein ARALYDRAFT_495950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40824.1| hypothetical protein ARALYDRAFT_495950 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score =   500 bits (1288),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 299/556 (54%), Positives = 371/556 (67%), Gaps = 40/556 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  32    TVYKAIDEKLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVH  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  92    NHTLNFITELFTSGTLRQYKNKYLRIDIRAIKSWARQILEGLVYLHGHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR  H AHSVIGTPEFMAPELYEE Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDLGLARMLRDCHSAHSVIGTPEFMAPELYEENYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC NPAQIYKKV +GKLP AFYR+ + EAQRF+G+CL  ASKR SA EL
Sbjct  212   LEMITSEFPYSECNNPAQIYKKVVAGKLPGAFYRVGDIEAQRFIGKCLVSASKRVSAKEL  271

Query  719   LLDPFLAADEE---EDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDD  889
             L DPFLA+DE        A  P   L  N    E++   ++     + M+I G L  ED+
Sbjct  272   LQDPFLASDESWMVYASGAGNPKPFLNEN----EMDTLKLEDDELKTQMSIAGKLGAEDN  327

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
              I L VQI+  +G A N+FFPFDI +DT+++VA EMVKELEI DW P++IA+MID  IS+
Sbjct  328   KIDLEVQIAYDNGLANNVFFPFDIMNDTSIDVAKEMVKELEIIDWEPVEIAKMIDGAISS  387

Query  1070  LVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFY-slssqsssqaslPDLLEKINH  1246
             LVP W+   Y++     +    +  +         PF+ S S  SSSQASL + + +   
Sbjct  388   LVPGWK---YEEDDETPHDHHRNRTD---------PFHSSSSHSSSSQASLSNYMARGLQ  435

Query  1247  DWLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS  1417
             DW Q+   D+T S+SS +S   SNL +    E         +S  + +T+  TR CPE S
Sbjct  436   DWGQDDLHDETYSQSSSHSGSYSNLNYIAVDE------HSSQSPAMSRTHNLTRFCPEES  489

Query  1418  ------RSNKKKGCCGSNHQRPK----MSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVG  1567
                   ++N        N         ++R RS+VD++ QLLHR+  EE  KRRLFKTVG
Sbjct  490   SHLQSGQANAYAASSSINRSLASDNRTLTRNRSLVDVQRQLLHRSPGEEARKRRLFKTVG  549

Query  1568  AVENIGYHEPAEYSCK  1615
              VE +G+  P   S K
Sbjct  550   DVETVGFQSPYAVSRK  565



>ref|XP_009120345.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Brassica 
rapa]
Length=561

 Score =   500 bits (1287),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 298/554 (54%), Positives = 382/554 (69%), Gaps = 46/554 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  32    TVYKAIDEMLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVH  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W R+ILEGL YLH HDPPVIHRDLKCD
Sbjct  92    SHTLNFITELFTSGTLRQYKNKYLRIDIRAIKSWARRILEGLVYLHGHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAH-SVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGD GLA MLR  HA  SVIGTPEFMAPELYEE Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDFGLARMLRDCHAATSVIGTPEFMAPELYEENYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC NPAQIYKKV +GKLP AFYR+++ EAQRF+G+CL PAS R SA EL
Sbjct  212   LEMITSEFPYSECNNPAQIYKKVVAGKLPGAFYRVEDIEAQRFIGKCLVPASMRVSAREL  271

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             L DPFLA+DE     A   ++ L P     E++   ++          T  L+ ED+ I+
Sbjct  272   LQDPFLASDESWMVYAS-GARNLKPFLNENEMDRLKLEDDE-------TEELDSEDNKIY  323

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L++ I++++G A+N+ F FDI +DT+++VATEMVKELEIT+W P++IA+MID EIS+LVP
Sbjct  324   LKLPIANENGLAKNVSFCFDIMNDTSIDVATEMVKELEITEWDPVEIAKMIDGEISSLVP  383

Query  1079  TWRSTQYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWL  1255
              WRS +  +  H F+                  P++  SS SSS+ASL + +     DWL
Sbjct  384   GWRSEEDDESLHDFHT-----------------PYHYSSSPSSSRASLSNYMAPGRQDWL  426

Query  1256  QN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS---  1417
             Q+   D+T S+SS NS   SNL + +  E  +SS    +   + +T+  TR CPE S   
Sbjct  427   QDDFHDETYSQSSSNSGSYSNLNYISVDE-HISS----QPPAMNRTHNVTRFCPEESYHL  481

Query  1418  ---RSNKKKGCCGSNHQRPK-----MSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAV  1573
                ++N       S++ R       ++R RS+VD++ QLLHR+LVEE  KRRL KTVG V
Sbjct  482   HSGQANMYAASSSSSNLRLASDNRVLTRNRSLVDVQGQLLHRSLVEEARKRRLIKTVGDV  541

Query  1574  ENIGYHEPAEYSCK  1615
             EN+G+  P   S K
Sbjct  542   ENVGFQSPYAVSRK  555



>emb|CDY32707.1| BnaA02g07690D [Brassica napus]
Length=560

 Score =   498 bits (1281),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 283/553 (51%), Positives = 366/553 (66%), Gaps = 45/553 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TV++A DE LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID D
Sbjct  32    TVFKAIDEKLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVD  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  92    SHTLNFITELFTSGTLRQYKNKYMRIDIRAIKSWARQILEGLVYLHEHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR    AHSV+GTPEFMAPEL+E  Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDLGLARMLRDCRSAHSVLGTPEFMAPELFEGNYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC +P  IYKKV+SG+LP+AFYR+++ EAQ F+ +CL PAS+R SA EL
Sbjct  212   LEMITSEFPYSECNSPVHIYKKVSSGRLPSAFYRVEDIEAQIFIRKCLVPASQRVSAREL  271

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPC-FVDQQAKSSDMTITGTLNPEDDTI  895
             L DPFL++DE     A+  +  L P     E++     D +   + MTITG L  ED+TI
Sbjct  272   LQDPFLSSDESWMVYAR-GAGNLKPFLNENEMDRLKLEDDELGRTQMTITGRLKAEDNTI  330

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
              L V I+D++G A+ + FPF I +DT+++VA EMVKELEITDW P++IAEMID EIS+LV
Sbjct  331   LLEVIIADENGMAKKVAFPFGIMNDTSIDVAMEMVKELEITDWDPVEIAEMIDGEISSLV  390

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWL  1255
             P WR  +  +                    T H ++S SS  +S +   + + +   DWL
Sbjct  391   PGWRYEEGDE--------------------TPHVYHSSSSSQASFS---NYMARGRQDWL  427

Query  1256  QND---DTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS---  1417
             Q+D   +T S+SS NS   SNL + T  E         +   + + +  TR  PE S   
Sbjct  428   QDDFQDETHSQSSTNSGSYSNLNYTTVDEH------SSQPSAVNRAHNVTRFRPEESYHA  481

Query  1418  ---RSNKKKGCCGSNHQRPK----MSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVE  1576
                ++N       SN ++      + R RS+ D++ QLL R+L EE   RR+ +TVG VE
Sbjct  482   HSGQANMYAASSSSNLRQASDNRTLPRNRSLADVQGQLLQRSLTEEARIRRVIRTVGDVE  541

Query  1577  NIGYHEPAEYSCK  1615
              +G+  P   S K
Sbjct  542   AVGFQPPYAVSRK  554



>ref|NP_200643.1| putative serine/threonine-protein kinase WNK4 [Arabidopsis thaliana]
 sp|Q9LVL5.1|WNK4_ARATH RecName: Full=Probable serine/threonine-protein kinase WNK4; 
Short=AtWNK4; AltName: Full=Protein kinase with no lysine 4 
[Arabidopsis thaliana]
 dbj|BAA96926.1| MAP kinase [Arabidopsis thaliana]
 gb|AAK64014.1| unknown protein [Arabidopsis thaliana]
 gb|AAL87392.1| AT5g58350/AT5g58350 [Arabidopsis thaliana]
 dbj|BAB91127.1| Ser/Thr kinase [Arabidopsis thaliana]
 gb|AED97041.1| putative serine/threonine-protein kinase WNK4 [Arabidopsis thaliana]
Length=571

 Score =   498 bits (1282),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 297/555 (54%), Positives = 372/555 (67%), Gaps = 38/555 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  32    TVYKAIDEKLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVH  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  92    NHTLNFITELFTSGTLRQYKNKYLRIDIRAIKSWARQILEGLVYLHEHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR  H AHS+IGTPEFMAPELYEE Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDLGLARMLRDCHSAHSIIGTPEFMAPELYEENYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC +PAQIYKKV  GKLP AFYR+ + EAQRF+G+CL  ASKR SA EL
Sbjct  212   LEMITSEFPYSECNHPAQIYKKVVGGKLPGAFYRVGDIEAQRFIGKCLVSASKRVSAKEL  271

Query  719   LLDPFLAADEE---EDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDD  889
             L DPFLA+DE        A  P   L  N    E++   ++     ++M+I G L  ED+
Sbjct  272   LQDPFLASDESWMVYTSGAGNPKPFLNEN----EMDTLKLEDDELRTEMSIAGKLGAEDN  327

Query  890   TIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
              I L VQI+  +G A N+FFPFDI +DT+++VA EMVKELEI DW P++IA+MID  IS+
Sbjct  328   KIDLEVQIAYDNGLANNVFFPFDIMNDTSIDVAKEMVKELEIIDWEPVEIAKMIDGAISS  387

Query  1070  LVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD  1249
             LV  W+           Y +DD+  ++     T     S S  SSSQASL + + +   D
Sbjct  388   LVSDWK-----------YEEDDETPHDHHRHRTDSFHSSSSHASSSQASLSNYMARGLQD  436

Query  1250  WLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS-  1417
             W+Q+   D+T S+SS +S   SNL +    E         +S ++ +T+  TR CPE S 
Sbjct  437   WVQDDLHDETYSQSSSHSGSYSNLNYIAVDE------YSSQSPVMSRTHNMTRFCPEESS  490

Query  1418  -----RSNKKKGCCGSNHQRPK----MSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGA  1570
                  ++N       +N         ++R RS+VD++ QLLHR+  EE  KRRLFKTVG 
Sbjct  491   HLQSGQANAYAASSSTNRSLASDNRTLTRNRSLVDVQRQLLHRSPGEEARKRRLFKTVGD  550

Query  1571  VENIGYHEPAEYSCK  1615
             VE +G+  P   S K
Sbjct  551   VETVGFQSPYAVSRK  565



>gb|KCW52444.1| hypothetical protein EUGRSUZ_J01843 [Eucalyptus grandis]
Length=628

 Score =   499 bits (1285),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 315/577 (55%), Positives = 391/577 (68%), Gaps = 59/577 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLGMEVAWNQ+KLN+ FRSP+E QRL SEV LL  L+H SIM+FH SW+D D
Sbjct  42    TVYKAIDEVLGMEVAWNQVKLNDSFRSPDEYQRLISEVHLLSTLNHDSIMKFHTSWVDVD  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
                FNFITE+FTSGTLR YR++Y  ++IRAIKNW  QIL GL YLHSHDPPVIHRDLKCD
Sbjct  102   GTAFNFITEMFTSGTLRNYRKKYPRLHIRAIKNWAVQILHGLVYLHSHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             N+FVNGHLGQVKIGDLGLAA+L GS  AHS+IGTPEFMAPELY+E Y+ELVD+YSFGMCV
Sbjct  162   NLFVNGHLGQVKIGDLGLAAILHGSRAAHSIIGTPEFMAPELYDENYNELVDVYSFGMCV  221

Query  539   LEMLTSEYPYSECTNPAQIYKKVTS------GKLPAAFYRIDNAEAQRFVGRCLEPASKR  700
             LEMLT EYPY ECTNPAQIYKKVTS      GKLP AFYRI +++A++F+G+CL   S R
Sbjct  222   LEMLTCEYPYIECTNPAQIYKKVTSRATLTQGKLPEAFYRIKDSKARKFIGKCLANVSCR  281

Query  701   PSAHELLLDPFLAADEEEDESAKLPSQKL-IP----NGKLLEVEPCFVDQQAKSSDMTIT  865
              SA ELL DPFL +DE +    +LP  K  +P    NG+  +V+          +DM IT
Sbjct  282   VSARELLHDPFLLSDEGD----RLPGLKFKMPEPFLNGR--DVDNLRARDNPLRTDMMIT  335

Query  866   GTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAE  1045
             G LNPE DTIFL+VQI+D++G ARN++FPFD+ +DT ++VA EMVKELEI DW   +IA+
Sbjct  336   GKLNPEGDTIFLKVQIADRNGSARNVYFPFDVLNDTPIDVAKEMVKELEIMDWEAEEIAD  395

Query  1046  MIDEEISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPD  1225
             MI  EISALVP W      KQ   +Y    + +N+ G +    PF S SS SSSQAS   
Sbjct  396   MIGGEISALVPNW-----TKQDMTDY----NQENDDGFAP---PFLSFSSGSSSQASPSG  443

Query  1226  LL----EKINHDW--LQN--DDTSSRSSMNSYDCSNLCWATESEGDLS-SIGGRESLLIQ  1378
                    +I  D+  LQ+  DD SS SS++S   S+  +    + +++      +  LI 
Sbjct  444   FTAYRENEIASDYGCLQDVPDDMSSPSSIHSGTYSHTSYFCPEDQEVNPGPSNPDQHLIS  503

Query  1379  KTNTGTRLC------PETSRSNKKKGCC----GSNHQRP----------KMSRVRSMVDL  1498
             ++N  TR C      P   +   +   C    GS+              ++SR RS+VD+
Sbjct  504   RSNRHTRFCADDYQRPRQFKDRSQTLQCQVLTGSDRDSSSVINRRMAGHRLSRNRSLVDV  563

Query  1499  RSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYS  1609
              SQLLH +L+EEV+KRRL +TVG VENIG+  P E S
Sbjct  564   HSQLLHLSLLEEVSKRRLSRTVGEVENIGFQAPFEIS  600



>ref|XP_010483414.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Camelina sativa]
 ref|XP_010483415.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Camelina sativa]
 ref|XP_010483416.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Camelina sativa]
 ref|XP_010483417.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Camelina sativa]
 ref|XP_010483419.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Camelina sativa]
Length=572

 Score =   497 bits (1279),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 301/560 (54%), Positives = 372/560 (66%), Gaps = 47/560 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  32    TVYKAIDEKLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVH  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  92    NHTLNFITELFTSGTLRQYKNKYLRIDIRAIKSWARQILEGLVYLHGHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR  H AHSVIGTPEFMAPELYEE Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDLGLARMLRDCHSAHSVIGTPEFMAPELYEENYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PY+EC NPAQIYKKV +GKLP AFYR+ + EAQRF+G+CL  ASKR SA EL
Sbjct  212   LEMITSEFPYNECNNPAQIYKKVVAGKLPGAFYRVGDIEAQRFIGKCLVSASKRVSAKEL  271

Query  719   LLDPFLAADEE---EDESAKLPSQKLIPNG-KLLEVEPCFVDQQAKSSDMTITGTLNPED  886
             L DPFLA+DE        A  P   L  N    L++E    D     + M+I G L  ED
Sbjct  272   LQDPFLASDESWMVYASGAGNPKPFLNENEMDSLKLE----DDDELRTQMSIAGKLGAED  327

Query  887   DTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEIS  1066
             + I L VQI+  +G A N+FFPFDI +DT+++VA EMVKELEI DW P++IA+MID  IS
Sbjct  328   NKIDLEVQIAYDNGLANNVFFPFDIMNDTSIDVAKEMVKELEIIDWEPVEIAKMIDGTIS  387

Query  1067  ALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRH---PF-YslssqsssqaslPDLLE  1234
             +LVP W S +   + S ++               RH   PF  S S   SSQASL + + 
Sbjct  388   SLVPGW-SYEEDDETSHDH--------------HRHRTEPFDSSSSHSPSSQASLSNYMA  432

Query  1235  KINHDWLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLC  1405
             +   DW+Q+   D+T S+SS +S   SNL +    E         +S  + +T+  TR C
Sbjct  433   RGLQDWVQDDLHDETYSQSSSHSGSYSNLNYIAVDE------HSSQSPAMSRTHNLTRFC  486

Query  1406  PETS------RSNKKKGCCGSNHQRPK----MSRVRSMVDLRSQLLHRTLVEEVNKRRLF  1555
             PE S      ++N       +N +       ++R RS VD++ QLLHR+  EE  K+RLF
Sbjct  487   PEESSHLQSGQANVYAASSSTNRRLASDNRTLTRNRSFVDVQRQLLHRSPGEEARKKRLF  546

Query  1556  KTVGAVENIGYHEPAEYSCK  1615
             KTVG VE +G+  P   S K
Sbjct  547   KTVGDVETVGFQSPYAVSRK  566



>ref|XP_006401094.1| hypothetical protein EUTSA_v10013105mg [Eutrema salsugineum]
 gb|ESQ42547.1| hypothetical protein EUTSA_v10013105mg [Eutrema salsugineum]
Length=557

 Score =   493 bits (1270),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 293/552 (53%), Positives = 372/552 (67%), Gaps = 46/552 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  32    TVYKAIDEMLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVH  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  92    SHTLNFITELFTSGTLRQYKNKYLRIDIRAIKSWARQILEGLVYLHEHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR  H AHSVIGTPEFMAPELYEE Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDLGLARMLRDCHSAHSVIGTPEFMAPELYEENYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSECTN AQIYKKV +GKLP AFYR+ + EAQRF+G+CL  AS R SA EL
Sbjct  212   LEMITSEFPYSECTNSAQIYKKVVAGKLPGAFYRVGDLEAQRFIGKCLVSASLRVSAKEL  271

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQ-QAKSSDMTITGTLNPEDDTI  895
             L DPFLA+DE     A   ++ L P     E++   +++ +   + MTITG LN ED+TI
Sbjct  272   LQDPFLASDESWMVYAS-GARNLKPFLNENEMDRLKLEEDELGRTQMTITGKLNDEDNTI  330

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+V I+D+ G A+N+ FPFDIT DT+++VATEMVKELEIT+W P++IA+MID EIS+LV
Sbjct  331   FLKVVIADEKGMAKNVSFPFDITIDTSIDVATEMVKELEITEWEPVEIAKMIDGEISSLV  390

Query  1076  PTWRSTQYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDW  1252
             P WR  +  +  H +++              T   + S S  SSSQASL + + +   DW
Sbjct  391   PGWRYEEDDETPHDYHH-------------RTTPSYSSSSHSSSSQASLSNYMARGRQDW  437

Query  1253  LQNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCP------ET  1414
             +Q           SY  SNL + +  E         +  ++ +T+  TR CP      ++
Sbjct  438   IQ----------GSY--SNLNYISVDE------HSSQPPVMTRTHNVTRFCPGESSHLQS  479

Query  1415  SRSNKKKGCCGSNH----QRPKMSRVRSMVDL-RSQLLHRTLVEEVNKRRLFKTVGAVEN  1579
              ++N        N     +   ++R RS+VD+       R+LVEE  KRRL +TVG VE 
Sbjct  480   GQANMYAASSSGNRRLASENRTLTRNRSLVDVQSQLQQQRSLVEEARKRRLIRTVGDVET  539

Query  1580  IGYHEPAEYSCK  1615
             +G+  P   S K
Sbjct  540   VGFQSPYAISRK  551



>ref|XP_006401095.1| hypothetical protein EUTSA_v10013105mg [Eutrema salsugineum]
 gb|ESQ42548.1| hypothetical protein EUTSA_v10013105mg [Eutrema salsugineum]
Length=572

 Score =   494 bits (1271),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 298/555 (54%), Positives = 380/555 (68%), Gaps = 37/555 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  32    TVYKAIDEMLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVH  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  92    SHTLNFITELFTSGTLRQYKNKYLRIDIRAIKSWARQILEGLVYLHEHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR  H AHSVIGTPEFMAPELYEE Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDLGLARMLRDCHSAHSVIGTPEFMAPELYEENYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSECTN AQIYKKV +GKLP AFYR+ + EAQRF+G+CL  AS R SA EL
Sbjct  212   LEMITSEFPYSECTNSAQIYKKVVAGKLPGAFYRVGDLEAQRFIGKCLVSASLRVSAKEL  271

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQ-QAKSSDMTITGTLNPEDDTI  895
             L DPFLA+DE     A   ++ L P     E++   +++ +   + MTITG LN ED+TI
Sbjct  272   LQDPFLASDESWMVYAS-GARNLKPFLNENEMDRLKLEEDELGRTQMTITGKLNDEDNTI  330

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL+V I+D+ G A+N+ FPFDIT DT+++VATEMVKELEIT+W P++IA+MID EIS+LV
Sbjct  331   FLKVVIADEKGMAKNVSFPFDITIDTSIDVATEMVKELEITEWEPVEIAKMIDGEISSLV  390

Query  1076  PTWRSTQYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDW  1252
             P WR  +  +  H +++              T   + S S  SSSQASL + + +   DW
Sbjct  391   PGWRYEEDDETPHDYHH-------------RTTPSYSSSSHSSSSQASLSNYMARGRQDW  437

Query  1253  LQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCP-----  1408
             +Q+   D+T S+SS NS   SNL + +  E         +  ++ +T+  TR CP     
Sbjct  438   IQDDFHDETYSQSSSNSGSYSNLNYISVDE------HSSQPPVMTRTHNVTRFCPGESSH  491

Query  1409  -ETSRSNKKKGCCGSNH----QRPKMSRVRSMVDL-RSQLLHRTLVEEVNKRRLFKTVGA  1570
              ++ ++N        N     +   ++R RS+VD+       R+LVEE  KRRL +TVG 
Sbjct  492   LQSGQANMYAASSSGNRRLASENRTLTRNRSLVDVQSQLQQQRSLVEEARKRRLIRTVGD  551

Query  1571  VENIGYHEPAEYSCK  1615
             VE +G+  P   S K
Sbjct  552   VETVGFQSPYAISRK  566



>ref|XP_004978535.1| PREDICTED: probable serine/threonine-protein kinase WNK7-like 
isoform X2 [Setaria italica]
Length=656

 Score =   496 bits (1277),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 297/592 (50%), Positives = 379/592 (64%), Gaps = 66/592 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             +VYR FDE  G+EVAWNQ  L +V R+P+ ++R+YSEV LL  L H +I+ FHASW+D  
Sbjct  45    SVYRGFDEERGVEVAWNQAYLADVLRTPDAVERMYSEVQLLSALRHDAIIGFHASWVDVP  104

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELF+SGTLR YR RY  V++RA+++W RQIL GLAYLH+HDPPVIHRDLKCD
Sbjct  105   RRTFNFITELFSSGTLRSYRLRYPRVSLRAVRSWARQILRGLAYLHAHDPPVIHRDLKCD  164

Query  362   NIFVNGHLGQVKIGDLGLAAMLR-GSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             N+ VNGH G VKI DLGLAA+LR  S AHSVIGTPEFMAPE+Y+EEYDE VD+YSFGMC+
Sbjct  165   NLLVNGHQGLVKIADLGLAAVLRHQSTAHSVIGTPEFMAPEMYDEEYDERVDVYSFGMCM  224

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC+NPAQIYKKVT+GKLP AFYR+ + +A+RF+GRCL  ASKRPSA EL
Sbjct  225   LEMLTVEYPYSECSNPAQIYKKVTAGKLPDAFYRVQDDDARRFIGRCLVAASKRPSAAEL  284

Query  719   LLDPFLAADEEEDESAKL--PSQKLIPNGKLLEVEPCFVDQQAKS-----SDMTITGTLN  877
             L+DPFL           +  PS  L             VD++A+      +DMTITG LN
Sbjct  285   LMDPFLLDGHHHSTPCAVMPPSSSLPAAPHSSTCSTSNVDEEAEPPGPIRTDMTITGKLN  344

Query  878   PEDDTIFLRVQISDKDG-KARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMID  1054
              E+DTIFL+VQI+D+ G   RNI+FPFD+ +DTA EVA EMVKELEITD  P +IA MI+
Sbjct  345   AEEDTIFLKVQIADQTGNNVRNIYFPFDMANDTAAEVAEEMVKELEITDRDPSEIAAMIE  404

Query  1055  EEISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLE  1234
             +EI+ L+P       ++QH ++    + DD++        PFY LSS  +S       + 
Sbjct  405   QEINRLLPG-----REQQHEYSVSTANGDDDDDENEERPPPFYYLSSSPTSSQGSHCGVG  459

Query  1235  KINHDW--------LQNDDTSSRSSMNSYDCSNLCW-ATESEGDLSSIGGRESLLIQKTN  1387
                  W        L +DD +  SSM+S   S L + A+  E D + +  ++  ++  ++
Sbjct  460   PHAGGWSKDHWYTCLSDDDDT--SSMHSGKYSALHYDASGHEEDEAQLPPQDGHVVGPSS  517

Query  1388  ---------TGTRLCPETSRSNKKKGCCGSNHQRP-------------------------  1465
                        TR  P  S S++  G   +  Q+                          
Sbjct  518   CSKASGQQVKNTRFGPGESSSSRSPGRADTAQQQSLARQLQRQCSLSPHAGRPRRRDDDH  577

Query  1466  -------KMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPA  1600
                    +M+R RSMVD+RSQLLHRTLVEE+N+R  F TVGAVE+IG+  PA
Sbjct  578   RHHGRNNRMTRNRSMVDMRSQLLHRTLVEELNRRLFFNTVGAVEDIGFRAPA  629



>emb|CDY69580.1| BnaCnng64310D [Brassica napus]
Length=529

 Score =   491 bits (1265),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 281/540 (52%), Positives = 355/540 (66%), Gaps = 50/540 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LG+EVAW+Q++L  V RS  ++QRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  32    TVYKAIDEMLGIEVAWSQVQLKEVLRSSVDIQRLYSEVHLLSTLNHKSIIRFYTSWIDVR  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  92    SHTLNFITELFTSGTLRQYKNKYLRIDIRAIKSWARQILEGLVYLHGHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAH-SVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR  HA  SVIGTPEFMAPELYEE Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDLGLARMLRDCHAATSVIGTPEFMAPELYEENYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC NPAQIYKKV +GKLP AFYR+ + EAQRF+G+CL PASKR SA EL
Sbjct  212   LEMITSEFPYSECNNPAQIYKKVVAGKLPGAFYRVGDIEAQRFIGKCLVPASKRVSAREL  271

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFV-DQQAKSSDMTITGTLNPEDDTI  895
             L DPFLA+DE     A+  ++ L P     E++   + D +   S MTITG LN ED+TI
Sbjct  272   LQDPFLASDESWMVYAR-GAENLKPFLNENEMDRLKLGDDELGRSRMTITGKLNAEDNTI  330

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL V I+D+DGKA+ + FPFDI +DT+++VA EMVKELEITDW P +IA+MID EIS+LV
Sbjct  331   FLNVLIADEDGKAKKVSFPFDIMNDTSIDVAKEMVKELEITDWEPDEIAKMIDGEISSLV  390

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWL  1255
             P WR   Y+++ + +  +     N+   S                             ++
Sbjct  391   PGWR---YEEKDAHDEANSQSSSNSGSYSNVN--------------------------YI  421

Query  1256  QNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETSRSNKKK  1435
               D+ SS+ S  +   +   +  E    L S  GR ++    +++  RL  +     + +
Sbjct  422   SFDEHSSQPSAKTRTHNVTRFCPEESSHLHS--GRANVCAASSSSNWRLASDNRALTRNR  479

Query  1436  GCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYSCK  1615
                  + QR  + R              +LVEE  KRRLFKTVG VEN+G+  P   S K
Sbjct  480   SLV--DVQRKSLQR--------------SLVEEGRKRRLFKTVGDVENVGFQSPYAVSRK  523



>emb|CDY43861.1| BnaC09g33820D [Brassica napus]
Length=553

 Score =   492 bits (1266),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 295/551 (54%), Positives = 377/551 (68%), Gaps = 48/551 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  32    TVYKAIDEMLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVH  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  92    SHTLNFITELFTSGTLRQYKNKYLRIDIRAIKSWARQILEGLVYLHGHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAH-SVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR  HA  SVIGTPEFMAPELYEE Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDLGLARMLRDCHAATSVIGTPEFMAPELYEENYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC NPAQIYKKV +GKLP AFYR+++ EAQRF+G+CL PASKR SA EL
Sbjct  212   LEMITSEFPYSECNNPAQIYKKVVAGKLPGAFYRVEDIEAQRFIGKCLVPASKRVSAREL  271

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
             L DPFLA+DE     A   ++ L P     E++   +++         TG ++ ED+ I+
Sbjct  272   LQDPFLASDESWMVYAS-GARNLKPFLNENEMDRLKLEEDE-------TGEVDFEDNKIY  323

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L++ I++++G A+N+ F FDI +DT+++VATEMVKELEIT+W P++IA+MID EIS+LVP
Sbjct  324   LKLPIANENGLAKNVSFCFDIMNDTSIDVATEMVKELEITEWDPVEIAKMIDGEISSLVP  383

Query  1079  TWRSTQYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWL  1255
              W S +  +  H ++                  PF+S SS SSS+ASL + +     DWL
Sbjct  384   GWGSEEDDESPHDYHT-----------------PFHSSSSPSSSRASLSNYMAPGRQDWL  426

Query  1256  QNDDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS------  1417
             Q+D+T S+SS NS   SNL + +  E  +SS    +   + +T+  TR CPE S      
Sbjct  427   QDDETYSQSSSNSGSYSNLNYISVDE-HISS----QPTAMNRTHNVTRFCPEESYHLHSG  481

Query  1418  -----RSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENI  1582
                   ++              ++R RS+VD     +HR+LVEE  KRRL KTVG VEN+
Sbjct  482   QASIYAASSSSSNSRLASDNRVLTRNRSLVD-----VHRSLVEEARKRRLIKTVGDVENV  536

Query  1583  GYHEPAEYSCK  1615
             G+  P   S K
Sbjct  537   GFQSPYAVSRK  547



>ref|XP_003551613.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Glycine 
max]
Length=554

 Score =   492 bits (1266),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 288/555 (52%), Positives = 358/555 (65%), Gaps = 77/555 (14%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE+LG+EVAWNQ+KL +VF SPE+LQRLYSEV LLK L+H S+M F+ SWID +
Sbjct  51    TVYRAFDELLGIEVAWNQVKLGDVFHSPEQLQRLYSEVHLLKHLNHDSMMIFYGSWIDVN  110

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +TFNF+TELFTSGTLREYRQ+Y  V+I A+KNW RQIL GL YLHSH+PPVIHRDLKCD
Sbjct  111   NKTFNFVTELFTSGTLREYRQKYKRVDITAVKNWARQILSGLEYLHSHNPPVIHRDLKCD  170

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH G+VKIGDLGLAA+L+ S HAHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMC+
Sbjct  171   NIFVNGHQGRVKIGDLGLAAILKSSQHAHSVIGTPEFMAPELYEEKYNELVDIYSFGMCM  230

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             +EMLT E+PYSEC NPAQIYKKVTSGK+P AFYRI+N EAQ+FVG+CL   S+RPSA EL
Sbjct  231   IEMLTFEFPYSECANPAQIYKKVTSGKIPEAFYRIENLEAQKFVGKCLANVSERPSAKEL  290

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVE-----PCFVDQQAKSSDMTITGTLNPE  883
             LLDPFLA ++ E +    PS   +   K  ++      P     Q KS+DMTITG++N E
Sbjct  291   LLDPFLAMEQLEIQLP--PSIPALFTNKSFKLSCPAPFPSEHRDQTKSADMTITGSINEE  348

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             D+T+FL+V+ISD  G  R++FFPFD   DTA++VA EMV+EL                EI
Sbjct  349   DNTVFLKVRISDIMGHTRHVFFPFDTLKDTAIQVAMEMVQEL----------------EI  392

Query  1064  SALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKIN  1243
              +   +++ T ++  H                                    P   E   
Sbjct  393   MSASNSFK-THFRGNHC-----------------------------------PFTQEWPQ  416

Query  1244  HDWLQNDDTSSRSSMNSYDCSNL--CWATESEGDLSSIGGRE--------SLLIQKT--N  1387
              D   NDD SS++SMNS+ CS+   C     +   +   G E        S  I++   N
Sbjct  417   DDPFMNDDASSQASMNSFKCSSFQFCDPGHEDEHATPTDGPERKKCTPLLSYRIEEPEPN  476

Query  1388  TGTRLCPETSRSNKKKGCC--GSNHQRPKMSRVRSMV-DLRSQLLHRTLVEEVNK--RRL  1552
                       R N   GC   GS+H  P+++R+RS   + RSQ     ++EE+ K  RR 
Sbjct  477   FTKPFNYYPPRMNSSCGCSRFGSSHACPRLTRIRSCPHERRSQQQRSMMLEEMYKYKRRF  536

Query  1553  FKTVGAVENIGYHEP  1597
             F TVGAVENIG+  P
Sbjct  537   FNTVGAVENIGFQHP  551



>ref|NP_001236096.1| with no lysine kinase 13 [Glycine max]
 gb|ACN87289.1| with no lysine kinase [Glycine max]
Length=550

 Score =   489 bits (1258),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 305/571 (53%), Positives = 368/571 (64%), Gaps = 80/571 (14%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++LN V R+P++LQRLYSEV LL  L H SI+RF+ SWID D
Sbjct  3     TVYKAIDEVLGIEVAWNQVRLNEVLRTPDDLQRLYSEVHLLSTLKHQSILRFYTSWIDID  62

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R FNFITE FTSG+LRE                                     DLKCD
Sbjct  63    SRAFNFITEFFTSGSLRE-------------------------------------DLKCD  85

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+L GS  AHSVIGTPEFMAPELYEEEY+EL D+YSFGMCV
Sbjct  86    NIFVNGHLGQVKIGDLGLAAILHGSQLAHSVIGTPEFMAPELYEEEYNELADVYSFGMCV  145

Query  539   LEMLTSEYPYSECTNPAQIYKKVTS------GKLPAAFYRIDNAEAQRFVGRCLEPASKR  700
             LEMLTSEYPYSEC+NPAQIYKKVTS      GKLP AF+RI++ EAQRF+G+CL PA KR
Sbjct  146   LEMLTSEYPYSECSNPAQIYKKVTSVNSDSGGKLPMAFFRIEDMEAQRFIGKCLVPAEKR  205

Query  701   PSAHELLLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNP  880
             PSA ELLLDPFL +D+    + K   QK  P   + E+E   +      + M + G LNP
Sbjct  206   PSAKELLLDPFLVSDDPS-STMKFAIQK--PFLNVNEMEKLQLSDDLPRTGMKVIGKLNP  262

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             E+DTIFL+VQISDKDG  RN+FFPFDI SDT ++VATEMVKELEI D  P +IA MID E
Sbjct  263   ENDTIFLKVQISDKDGSVRNVFFPFDILSDTPIDVATEMVKELEIEDGEPYEIANMIDRE  322

Query  1061  ISALVPTWRSTQYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK  1237
             ISAL+P  R +      H+FNY+DDD DD+              SS SS Q S+ DL+ K
Sbjct  323   ISALLPHRRQSSCSDAFHTFNYLDDDCDDDGPHHHFRS-----FSSSSSFQESMSDLVSK  377

Query  1238  -----INHDWLQN---DDTSSR-SSMNSYDCSNLCWAT---ESEGDLSSIGGRESLLIQK  1381
                    + WL +   DDTSSR SS  +Y  SNL + +     E ++ S+   +  +   
Sbjct  378   GEEISSGYYWLHDDLHDDTSSRCSSQGTY--SNLNYYSVDDHQEYNVPSLRKDKLPITTS  435

Query  1382  TNTGTRLCPETSRSNKKKGCCGSNHQRP-------------KMSRVRSMVDLRSQLLHRT  1522
              N G ++      SN  +G      Q P             +++R RS++D+RSQLLHR+
Sbjct  436   HNKGKKISTGEDLSNFNQGKLMVGSQVPLTSKSKMMINNHHRLTRNRSLIDIRSQLLHRS  495

Query  1523  LVEEVNKRRLFKTVGAVENIGYHEPAEYSCK  1615
             LVEEVNKRRLFKTVGAVENIG+  P + + K
Sbjct  496   LVEEVNKRRLFKTVGAVENIGFQAPCDVTTK  526



>ref|XP_009410524.1| PREDICTED: probable serine/threonine-protein kinase WNK5 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=539

 Score =   488 bits (1257),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 294/560 (53%), Positives = 355/560 (63%), Gaps = 82/560 (15%)
 Frame = +2

Query  8     YRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDRR  187
             Y+AFDE+ G EVAWNQ KL ++ RSPE LQR+YSEV LL  L H SI+RFHASWID + R
Sbjct  10    YKAFDELNGTEVAWNQAKLCSMLRSPEALQRMYSEVHLLSSLHHESIIRFHASWIDVENR  69

Query  188   TFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDNI  367
             TFNFITE+F SGTLREYR+RY  VNI AIK+W RQIL GLAYLH HDPPVIHRD+KCDNI
Sbjct  70    TFNFITEMFASGTLREYRRRYPHVNIGAIKSWARQILHGLAYLHRHDPPVIHRDIKCDNI  129

Query  368   FVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLEM  547
              +NGHLG VKI D GLAA+LRGS  H+VIGTPEFMAPE+YEEEY+ELVDIYSFGMCVLEM
Sbjct  130   LINGHLGHVKISDFGLAAILRGSQ-HTVIGTPEFMAPEIYEEEYNELVDIYSFGMCVLEM  188

Query  548   LTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLLD  727
             LTSEYPYSEC NPAQIYKKVTSG+LP AFYRI + EA+RFV                   
Sbjct  189   LTSEYPYSECYNPAQIYKKVTSGRLPDAFYRIQDPEAKRFV-------------------  229

Query  728   PFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRV  907
               +     +D+              L  +E    +     +DMTITG +NPEDDTIFLRV
Sbjct  230   --VTGIRSQDQDG------------LHSMEFHDANSTVWRTDMTITGKMNPEDDTIFLRV  275

Query  908   QISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             QI+D +G  RNI FPFDI  DT ++VA EMVKELEITD  P +IAEMI +E +ALVP W+
Sbjct  276   QIADAEGHVRNIHFPFDIVCDTPIDVANEMVKELEITDREPSEIAEMIAQETTALVPDWK  335

Query  1088  STQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsss------qaslPDLLEKINH-  1246
             +T      + N +    +  +       HPFY+LSS +SS            +L++  H 
Sbjct  336   ATS-----APNSVFRVYNYEDDAEDGCNHPFYNLSSSASSQGSVFGTGHRLGMLDQQQHP  390

Query  1247  ---DWLQNDDTSSR-----------SSMNSYDCSNLCWATESEGDLSSIG-------GRE  1363
                +W Q D  S             S+MN Y   +     E E  +S  G       G +
Sbjct  391   HQEEWFQGDPHSDEDAVSYTQSGRYSAMNYYSSRD-----EQESKVSFHGSHKSTKLGED  445

Query  1364  SLLIQKTNTGTRLCPETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNK  1543
             + L  +      + PE SR    K   G      +++R RSMVD+RSQLLHR LVE++ K
Sbjct  446   AALADEFCKQCNILPERSR----KPVGGQ-----RLTRNRSMVDMRSQLLHRNLVEQL-K  495

Query  1544  RRLFKTVGAVENIGYHEPAE  1603
             +RLFKTVGAVENIG+  P +
Sbjct  496   KRLFKTVGAVENIGFQTPCD  515



>ref|XP_004978534.1| PREDICTED: probable serine/threonine-protein kinase WNK7-like 
isoform X1 [Setaria italica]
Length=662

 Score =   492 bits (1266),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 296/598 (49%), Positives = 378/598 (63%), Gaps = 72/598 (12%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             +VYR FDE  G+EVAWNQ  L +V R+P+ ++R+YSEV LL  L H +I+ FHASW+D  
Sbjct  45    SVYRGFDEERGVEVAWNQAYLADVLRTPDAVERMYSEVQLLSALRHDAIIGFHASWVDVP  104

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELF+SGTLR YR RY  V++RA+++W RQIL GLAYLH+HDPPVIHRDLKCD
Sbjct  105   RRTFNFITELFSSGTLRSYRLRYPRVSLRAVRSWARQILRGLAYLHAHDPPVIHRDLKCD  164

Query  362   NIFVNGHLGQVKIGDLGLAAMLR-GSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             N+ VNGH G VKI DLGLAA+LR  S AHSVIGTPEFMAPE+Y+EEYDE VD+YSFGMC+
Sbjct  165   NLLVNGHQGLVKIADLGLAAVLRHQSTAHSVIGTPEFMAPEMYDEEYDERVDVYSFGMCM  224

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC+NPAQIYKKVT+GKLP AFYR+ + +A+RF+GRCL  ASKRPSA EL
Sbjct  225   LEMLTVEYPYSECSNPAQIYKKVTAGKLPDAFYRVQDDDARRFIGRCLVAASKRPSAAEL  284

Query  719   LLDPFLAADEEEDESAKL--PSQKLIPNGKLLEVEPCFVDQQAKS-----SDMTITGTLN  877
             L+DPFL           +  PS  L             VD++A+      +DMTITG LN
Sbjct  285   LMDPFLLDGHHHSTPCAVMPPSSSLPAAPHSSTCSTSNVDEEAEPPGPIRTDMTITGKLN  344

Query  878   PEDDTIFLRVQISDK-------DGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLD  1036
              E+DTIFL+VQI+D+           RNI+FPFD+ +DTA EVA EMVKELEITD  P +
Sbjct  345   AEEDTIFLKVQIADQTETNVDAGNNVRNIYFPFDMANDTAAEVAEEMVKELEITDRDPSE  404

Query  1037  IAEMIDEEISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqas  1216
             IA MI++EI+ L+P       ++QH ++    + DD++        PFY LSS  +S   
Sbjct  405   IAAMIEQEINRLLPG-----REQQHEYSVSTANGDDDDDENEERPPPFYYLSSSPTSSQG  459

Query  1217  lPDLLEKINHDW--------LQNDDTSSRSSMNSYDCSNLCW-ATESEGDLSSIGGRESL  1369
                 +      W        L +DD +  SSM+S   S L + A+  E D + +  ++  
Sbjct  460   SHCGVGPHAGGWSKDHWYTCLSDDDDT--SSMHSGKYSALHYDASGHEEDEAQLPPQDGH  517

Query  1370  LIQKTN---------TGTRLCPETSRSNKKKGCCGSNHQRP-------------------  1465
             ++  ++           TR  P  S S++  G   +  Q+                    
Sbjct  518   VVGPSSCSKASGQQVKNTRFGPGESSSSRSPGRADTAQQQSLARQLQRQCSLSPHAGRPR  577

Query  1466  -------------KMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPA  1600
                          +M+R RSMVD+RSQLLHRTLVEE+N+R  F TVGAVE+IG+  PA
Sbjct  578   RRDDDHRHHGRNNRMTRNRSMVDMRSQLLHRTLVEELNRRLFFNTVGAVEDIGFRAPA  635



>gb|AGA37218.1| mitogen-activated protein kinase kinase kinase ZIK2.1 [Brassica 
napus]
Length=561

 Score =   486 bits (1250),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 283/553 (51%), Positives = 365/553 (66%), Gaps = 45/553 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TV++A DE LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID D
Sbjct  33    TVFKAIDEKLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVD  92

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  93    SHTLNFITELFTSGTLRQYKNKYMRIDIRAIKSWARQILEGLVYLHEHDPPVIHRDLKCD  152

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR    AHSV+GTPEFMAPEL+E  Y+EL+D+YSFGMC 
Sbjct  153   NIFVNGHLGQVKIGDLGLARMLRDCRSAHSVLGTPEFMAPELFEGNYNELIDVYSFGMCF  212

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC +P  IYKKV+SGKLP+AFYR+++ EAQ F+ +CL PAS+R SA EL
Sbjct  213   LEMITSEFPYSECNSPVHIYKKVSSGKLPSAFYRVEDIEAQIFIRKCLVPASQRVSAREL  272

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPC-FVDQQAKSSDMTITGTLNPEDDTI  895
             L DPFL++DE     A+  +  L P     E++     D +   + MTITG L  ED+TI
Sbjct  273   LQDPFLSSDESWMVYAR-GAGNLKPFLNENEMDRLKLEDDELGRTQMTITGRLKAEDNTI  331

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
              L V I+D++G A+ + FPF I +DT+++VA EMVKELEITDW P++IAEMID EIS+LV
Sbjct  332   LLEVIIADENGMAKKVAFPFGIMNDTSVDVAMEMVKELEITDWDPVEIAEMIDGEISSLV  391

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWL  1255
             P WR  +  +                    T H ++S SS  +S +   + + +   DW 
Sbjct  392   PGWRYEEGDE--------------------TPHVYHSSSSSQASFS---NYMTRGRQDWQ  428

Query  1256  QND---DTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS---  1417
             Q+D   +T S+SS +S   SNL +    E         +   + +T+  TR  PE S   
Sbjct  429   QDDLHDETHSQSSYSSGSLSNLNYTYVDEN------SSQPPAVNRTHNVTRFRPEESYHV  482

Query  1418  ---RSNKKKGCCGSNHQRPK----MSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVE  1576
                ++N       SN ++      + R RS+ D++ QLL R+L EE   RRL +TVG VE
Sbjct  483   RSGKANMHAASSSSNLRQASDNRTLPRNRSLADVQGQLLQRSLTEEARIRRLIRTVGDVE  542

Query  1577  NIGYHEPAEYSCK  1615
              +G+  P   S K
Sbjct  543   AVGFQPPYAVSRK  555



>ref|XP_010032941.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase WNK4 [Eucalyptus grandis]
Length=652

 Score =   489 bits (1258),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 315/601 (52%), Positives = 391/601 (65%), Gaps = 83/601 (14%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLGMEVAWNQ+KLN+ FRSP+E QRL SEV LL  L+H SIM+FH SW+D D
Sbjct  42    TVYKAIDEVLGMEVAWNQVKLNDSFRSPDEYQRLISEVHLLSTLNHDSIMKFHTSWVDVD  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
                FNFITE+FTSGTLR YR++Y  ++IRAIKNW  QIL GL YLHSHDPPVIHRDLKCD
Sbjct  102   GTAFNFITEMFTSGTLRNYRKKYPRLHIRAIKNWAVQILHGLVYLHSHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHA-HSVIG---------------------------  457
             N+FVNGHLGQVKIGDLGLAA+L GS A HS+IG                           
Sbjct  162   NLFVNGHLGQVKIGDLGLAAILHGSRAAHSIIGNNFQRXAWXCHRCFRISDYLSTYRWYT  221

Query  458   ---TPEFMAPelyeeeydelvdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPA  628
                TPEFMAPELY+E Y+ELVD+YSFGMCVLEMLT EYPY ECTNPAQIYKKVTSGKLP 
Sbjct  222   LSGTPEFMAPELYDENYNELVDVYSFGMCVLEMLTCEYPYIECTNPAQIYKKVTSGKLPE  281

Query  629   AFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPFLAADEEEDESAKLPSQKL-IP----  793
             AFYRI +++A++F+G+CL   S R SA ELL DPFL +DE +    +LP  K  +P    
Sbjct  282   AFYRIKDSKARKFIGKCLANVSCRVSARELLHDPFLLSDEGD----RLPGLKFKMPEPFL  337

Query  794   NGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDT  973
             NG+  +V+          +DM ITG LNPE DTIFL+VQI+D++G ARN++FPFD+ +DT
Sbjct  338   NGR--DVDNLRARDNPLRTDMMITGKLNPEGDTIFLKVQIADRNGSARNVYFPFDVLNDT  395

Query  974   AMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRSTQYQKQHSFNYIddddddNNV  1153
              ++VA EMVKELEI DW   +IA+MI  EISALVP W      KQ   +Y    + +N+ 
Sbjct  396   PIDVAKEMVKELEIMDWEAEEIADMIGGEISALVPNW-----TKQDMTDY----NQENDD  446

Query  1154  GISTTRHPFYslssqsssqaslPDLL----EKINHDW--LQN--DDTSSRSSMNSYDCSN  1309
             G +    PF S SS SSSQAS          +I  D+  LQ+  DD SS SS++S   S+
Sbjct  447   GFAP---PFLSFSSGSSSQASPSGFTAYRENEIASDYGCLQDVPDDMSSPSSIHSGTYSH  503

Query  1310  LCWATESEGDLS-SIGGRESLLIQKTNTGTRLC------PETSRSNKKKGCC----GSNH  1456
               +    + +++      +  LI ++N  TR C      P   +   +   C    GS+ 
Sbjct  504   TSYFCPEDQEVNPGPSNPDQHLISRSNRHTRFCADDYQRPRQFKDRSQTLQCQVLTGSDR  563

Query  1457  QRP----------KMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEY  1606
                          ++SR RS+VD+ SQLLH +L+EEV+KRRL +TVG VENIG+  P E 
Sbjct  564   DSSSVINRRMAGHRLSRNRSLVDVHSQLLHLSLLEEVSKRRLSRTVGEVENIGFQAPFEI  623

Query  1607  S  1609
             S
Sbjct  624   S  624



>ref|XP_009126762.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Brassica rapa]
Length=560

 Score =   484 bits (1246),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 282/553 (51%), Positives = 365/553 (66%), Gaps = 45/553 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TV++A DE LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID D
Sbjct  32    TVFKAIDEKLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVD  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  92    SHTLNFITELFTSGTLRQYKNKYMRIDIRAIKSWARQILEGLVYLHEHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDL LA MLR    AHSV+GTPEFMAPEL+E  Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDLVLARMLRDCRSAHSVLGTPEFMAPELFEGNYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC +P  IYKKV+SG+LP+AFYR+++ EAQ F+ +CL PAS+R SA EL
Sbjct  212   LEMITSEFPYSECNSPVHIYKKVSSGRLPSAFYRVEDIEAQIFIRKCLVPASQRVSAREL  271

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPC-FVDQQAKSSDMTITGTLNPEDDTI  895
             L DPFL++DE     A+  +  L P     E++     D +   + MTITG L  ED+TI
Sbjct  272   LQDPFLSSDESWMVYAR-GAGNLKPFLNENEMDRLKLEDDELGRTQMTITGRLKAEDNTI  330

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
              L V I+D++G A+ + FPF I +DT+++VA EMVKELEITDW P++IAEMID EIS+LV
Sbjct  331   LLEVIIADENGMAKKVAFPFGIMNDTSIDVAMEMVKELEITDWDPVEIAEMIDGEISSLV  390

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWL  1255
             P WR  +  +                    T H ++S SS  +S +   + + +   DWL
Sbjct  391   PGWRYEEGDE--------------------TPHVYHSSSSSQASFS---NYMTRGRQDWL  427

Query  1256  QN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS---  1417
             Q+   D+T S+SS +S   SNL +    E         +   + +T+  TR  PE S   
Sbjct  428   QDDLHDETHSQSSYSSGSLSNLNYTYVDE------NSSQPPAVNRTHNVTRFRPEESYHV  481

Query  1418  ---RSNKKKGCCGSNHQRPK----MSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVE  1576
                ++N       SN ++      + R RS+ D++ QLL R+L EE   RRL +TVG VE
Sbjct  482   RSGKANMHAASSSSNLRQASDNRTLPRNRSLADVQGQLLQRSLTEEARIRRLIRTVGDVE  541

Query  1577  NIGYHEPAEYSCK  1615
              +G+  P   S K
Sbjct  542   TVGFQPPYAVSRK  554



>emb|CDY02813.1| BnaC02g10760D [Brassica napus]
Length=812

 Score =   488 bits (1257),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 283/553 (51%), Positives = 364/553 (66%), Gaps = 45/553 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID D
Sbjct  284   TVYKAIDEKLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVD  343

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
                 NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  344   SHNLNFITELFTSGTLRQYKNKYLRIDIRAIKSWARQILEGLVYLHEHDPPVIHRDLKCD  403

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR    AHS++GTPEFMAPEL+E  Y+EL+D+YSFGMC 
Sbjct  404   NIFVNGHLGQVKIGDLGLARMLRDRRSAHSILGTPEFMAPELFEGNYNELIDVYSFGMCF  463

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC +P  IYKKV+SGKLP+AFYR+++ EAQ F+ +CL PAS+R SA EL
Sbjct  464   LEMVTSEFPYSECNSPVHIYKKVSSGKLPSAFYRVEDIEAQIFIRKCLVPASQRVSAREL  523

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPC-FVDQQAKSSDMTITGTLNPEDDTI  895
             L DPFL++DE     A+  +  L P     E++     D +   + MTITG L  ED+TI
Sbjct  524   LQDPFLSSDESWMVYAR-GAGNLKPFLNENEMDRLKLEDDELGRTQMTITGRLKAEDNTI  582

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
              L V I+D++G A+ + FPF I +DT+++VA EMVKELEITDW P++IAEMID EIS+LV
Sbjct  583   LLEVIIADENGMAKKVAFPFGIMNDTSIDVAMEMVKELEITDWDPVEIAEMIDGEISSLV  642

Query  1076  PTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWL  1255
             P WR  +  +                    T H ++S SS  +S +   + + +   DWL
Sbjct  643   PGWRYEEGDE--------------------TPHVYHSSSSSQASFS---NYMTRGRQDWL  679

Query  1256  QN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS---  1417
             Q+   D+T S+SS +S   SNL +    E         +   + +T   TR  PE S   
Sbjct  680   QDDLHDETHSQSSYSSGSLSNLNYTYVDE------NSSQPPAVNRTQNVTRFRPEESYHV  733

Query  1418  ---RSNKKKGCCGSNHQRPK----MSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAVE  1576
                ++N       SN ++      + R RS+ D++ QLL R+L EE   RRL +TVG VE
Sbjct  734   RSGKANMHAASSSSNLRQASDNRTLPRNRSLADVQGQLLQRSLTEEARIRRLIRTVGDVE  793

Query  1577  NIGYHEPAEYSCK  1615
              +G+  P   S K
Sbjct  794   TVGFQSPYAVSRK  806



>ref|XP_009126757.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Brassica rapa]
 ref|XP_009126758.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Brassica rapa]
 ref|XP_009126759.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Brassica rapa]
 ref|XP_009126760.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Brassica rapa]
 ref|XP_009126761.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X1 [Brassica rapa]
Length=562

 Score =   479 bits (1233),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 282/555 (51%), Positives = 365/555 (66%), Gaps = 47/555 (8%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TV++A DE LG+EVAW+Q+KL  V RS  +LQRLYSEV LL  L+H SI+RF+ SWID D
Sbjct  32    TVFKAIDEKLGIEVAWSQVKLKEVLRSSVDLQRLYSEVHLLSTLNHKSIIRFYTSWIDVD  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  92    SHTLNFITELFTSGTLRQYKNKYMRIDIRAIKSWARQILEGLVYLHEHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDL LA MLR    AHSV+GTPEFMAPEL+E  Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDLVLARMLRDCRSAHSVLGTPEFMAPELFEGNYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC +P  IYKKV+SG+LP+AFYR+++ EAQ F+ +CL PAS+R SA EL
Sbjct  212   LEMITSEFPYSECNSPVHIYKKVSSGRLPSAFYRVEDIEAQIFIRKCLVPASQRVSAREL  271

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPC-FVDQQAKSSDMTITGTLNPEDDTI  895
             L DPFL++DE     A+  +  L P     E++     D +   + MTITG L  ED+TI
Sbjct  272   LQDPFLSSDESWMVYAR-GAGNLKPFLNENEMDRLKLEDDELGRTQMTITGRLKAEDNTI  330

Query  896   FLRVQISDKD--GKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISA  1069
              L V I+D++  G A+ + FPF I +DT+++VA EMVKELEITDW P++IAEMID EIS+
Sbjct  331   LLEVIIADENVPGMAKKVAFPFGIMNDTSIDVAMEMVKELEITDWDPVEIAEMIDGEISS  390

Query  1070  LVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD  1249
             LVP WR  +  +                    T H ++S SS  +S +   + + +   D
Sbjct  391   LVPGWRYEEGDE--------------------TPHVYHSSSSSQASFS---NYMTRGRQD  427

Query  1250  WLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPETS-  1417
             WLQ+   D+T S+SS +S   SNL +    E         +   + +T+  TR  PE S 
Sbjct  428   WLQDDLHDETHSQSSYSSGSLSNLNYTYVDE------NSSQPPAVNRTHNVTRFRPEESY  481

Query  1418  -----RSNKKKGCCGSNHQRPK----MSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGA  1570
                  ++N       SN ++      + R RS+ D++ QLL R+L EE   RRL +TVG 
Sbjct  482   HVRSGKANMHAASSSSNLRQASDNRTLPRNRSLADVQGQLLQRSLTEEARIRRLIRTVGD  541

Query  1571  VENIGYHEPAEYSCK  1615
             VE +G+  P   S K
Sbjct  542   VETVGFQPPYAVSRK  556



>ref|XP_007207424.1| hypothetical protein PRUPE_ppa004913mg [Prunus persica]
 gb|EMJ08623.1| hypothetical protein PRUPE_ppa004913mg [Prunus persica]
Length=486

 Score =   474 bits (1219),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 293/506 (58%), Positives = 349/506 (69%), Gaps = 58/506 (11%)
 Frame = +2

Query  209   LFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDNIFVNGHLG  388
             +FTSGTLREYR++Y  V+IRAIKNW RQIL GL YLH + PPVIHRDLKCDNIFVNGHLG
Sbjct  1     MFTSGTLREYRKKYKHVDIRAIKNWARQILRGLVYLHGNHPPVIHRDLKCDNIFVNGHLG  60

Query  389   QVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLEMLTSEYP  565
             QVKIGDLGLA +LRGS  AHSVIGTPEFMAPELY+E Y+ELVD+YSFGMCVLEMLTSEYP
Sbjct  61    QVKIGDLGLATILRGSQSAHSVIGTPEFMAPELYDENYNELVDVYSFGMCVLEMLTSEYP  120

Query  566   YSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPFLAAD  745
             YSEC NPAQIYKKVTSGKLP AFYRI + EAQRF+G+CL  ASKR  A ELLLDPFL   
Sbjct  121   YSECVNPAQIYKKVTSGKLPGAFYRIQDLEAQRFIGKCLVNASKRLPAKELLLDPFLECG  180

Query  746   EEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKS---------SDMTITGTLNPEDDTIF  898
             ++E           +P GKL   +P   D++ +          +DMTITG LNPEDDTIF
Sbjct  181   KDEP----------LPLGKLGRPKPFLNDKEMEKLQLSDDQTRTDMTITGKLNPEDDTIF  230

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             L+VQI+DKDG  RNI+FPFDI +DT  +VATEMVKELEITDW P +IA MI+ EISALVP
Sbjct  231   LKVQIADKDGSFRNIYFPFDILNDTPFDVATEMVKELEITDWEPFEIANMIEWEISALVP  290

Query  1079  TWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK--INH--  1246
              W++  Y   H+ NY      D++ G    + P +S SS SSS  SL  L+    IN   
Sbjct  291   NWKTEAY---HTINY-----QDDDDG---PQRPSHSHSSCSSSHTSLSGLISSHGINGVT  339

Query  1247  ---DWLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSI-GGRESLLIQKTNTGTRLC  1405
                DWLQ+   D+TSS+SS +S   SNL +   +E   ++I  G +   I K +  TR C
Sbjct  340   NGCDWLQDDFLDETSSQSSSHSGTYSNLNFICGNEHGTNTIPTGGDKHPISKCHKSTRFC  399

Query  1406  PETSRSN------------KKKGCCGSNHQR----PKMSRVRSMVDLRSQLLHRTLVEEV  1537
             PE +R+             K     GS  +R     ++ R +S+VD+RS LLHR+LVEEV
Sbjct  400   PEENRNTGQSMAKKYYERCKAFLASGSKDKRIMDSRRLMRNKSLVDVRSHLLHRSLVEEV  459

Query  1538  NKRRLFKTVGAVENIGYHEPAEYSCK  1615
             N+RRLFKTVGAVENIG+  P E S K
Sbjct  460   NRRRLFKTVGAVENIGFQAPCEVSKK  485



>emb|CDX88670.1| BnaA03g09790D [Brassica napus]
Length=530

 Score =   475 bits (1222),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 241/364 (66%), Positives = 288/364 (79%), Gaps = 2/364 (1%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LG+EVAW+Q++L  V RS  ++QRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  32    TVYKAIDEMLGIEVAWSQVQLKEVLRSSVDIQRLYSEVHLLSTLNHKSIIRFYTSWIDVR  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSGTLR+Y+ +Y  ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  92    SHTLNFITELFTSGTLRQYKNKYFRIDIRAIKSWARQILEGLVYLHGHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAH-SVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR  HA  SVIGTPEFMAPELYEE Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDLGLARMLRDCHAATSVIGTPEFMAPELYEENYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC NPAQIYKKV +GKLP AFYR+ + EAQRF+G+CL PASKR SA EL
Sbjct  212   LEMITSEFPYSECKNPAQIYKKVVAGKLPGAFYRVGDIEAQRFIGKCLVPASKRVSAREL  271

Query  719   LLDPFLAADEEEDESAK-LPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             L DPFL++DE     A+   + K   N   ++      D+    S MTITG LN ED+TI
Sbjct  272   LQDPFLSSDESWMVYARGAVNLKPFLNENEMDRLKLEDDELGGRSRMTITGKLNAEDNTI  331

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL V I+D++GKA+ + FPFDI +DT+++VA EMVKELEITDW P+ IA+MID EIS+LV
Sbjct  332   FLNVLIADENGKAKRVSFPFDIMNDTSIDVAKEMVKELEITDWEPVQIAKMIDGEISSLV  391

Query  1076  PTWR  1087
             P WR
Sbjct  392   PGWR  395


 Score = 65.9 bits (159),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 52/90 (58%), Gaps = 12/90 (13%)
 Frame = +2

Query  1379  KTNTGTRLCPETSRSNKKKG----CCGSNHQRPKMS-------RVRSMVDLRSQLLHRTL  1525
             +T   TR CPE  RS+   G    C  S+    +++       R RS+VD++ +LL R+L
Sbjct  436   RTRNMTRFCPE-ERSHLHSGHDNVCAASSSSNWRLTSDNRALTRNRSLVDVQRKLLQRSL  494

Query  1526  VEEVNKRRLFKTVGAVENIGYHEPAEYSCK  1615
             VEE  KRRLFKTVG VEN+G+  P   S K
Sbjct  495   VEEARKRRLFKTVGDVENVGFQSPYAVSRK  524



>ref|XP_011021024.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Populus euphratica]
Length=507

 Score =   471 bits (1211),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 285/501 (57%), Positives = 339/501 (68%), Gaps = 42/501 (8%)
 Frame = +2

Query  200   ITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDNIFVNG  379
             + +L     +  YR++Y  VNIRAIK W RQILEG+ YLH HDPPVIHRDLKCDNIFVNG
Sbjct  9     MLKLILQAGMVGYRKKYNRVNIRAIKKWARQILEGIVYLHGHDPPVIHRDLKCDNIFVNG  68

Query  380   HLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLEMLTS  556
             HLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMCVLEMLTS
Sbjct  69    HLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYEENYNELVDVYSFGMCVLEMLTS  128

Query  557   EYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPFL  736
             EYPYSECTNPAQIYKKVTSGKLPA F+RI + EAQRF+ +CL  ASKR SA ELLLDPFL
Sbjct  129   EYPYSECTNPAQIYKKVTSGKLPAVFHRIQDLEAQRFIAKCLVTASKRLSAKELLLDPFL  188

Query  737   AADEEE-DESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRVQI  913
              +DE E     +   QK   N +  E+E   ++     +DMTITG LNPEDDTIFL+VQI
Sbjct  189   GSDEAELSHVPRFRKQKPFLNDR--EMEKLQLNDHPPRTDMTITGKLNPEDDTIFLKVQI  246

Query  914   SDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRS-  1090
             +++DG  RNIFFPFDI  DT ++VA EMVKELEI DW P +IA+MID EISALVP W+  
Sbjct  247   ANEDGTLRNIFFPFDILHDTPIDVAMEMVKELEIDDWEPFEIADMIDGEISALVPNWKKW  306

Query  1091  --TQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHDWLQND  1264
                  +  H+F+Y +D             HPF+S SS SSS ASL  L+  +  D L +D
Sbjct  307   DLPHIESHHTFDYQED---------DGHNHPFHSSSSCSSSPASLSGLMPHLLQDDLFDD  357

Query  1265  -DTSSRSSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGTRLCPE----------  1411
               + S S   SY C N     E + DLSS   R+  LI KT   TR CP+          
Sbjct  358   TSSQSSSHSGSYSCLNYVSGDEHKFDLSST-RRDKHLITKTQNSTRFCPQENSNSNIGQV  416

Query  1412  --TSRSNKKKGCCGSNHQRP-----------KMSRVRSMVDLRSQLLHRTLVEEVNKRRL  1552
               T+  N  KG   S  +             +++R RS+VD+RSQLLHR+LVEEV+KRRL
Sbjct  417   LATNAYNHCKGLLESQTRASSSKSKRMMDSRRLTRNRSLVDIRSQLLHRSLVEEVHKRRL  476

Query  1553  FKTVGAVENIGYHEPAEYSCK  1615
              KTVG VE++G+ +P E  CK
Sbjct  477   SKTVGDVEDVGFQKPTEV-CK  496



>ref|XP_009132059.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Brassica 
rapa]
 ref|XP_009132060.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Brassica 
rapa]
 ref|XP_009132061.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Brassica 
rapa]
 ref|XP_009132062.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Brassica 
rapa]
Length=529

 Score =   471 bits (1212),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 239/364 (66%), Positives = 289/364 (79%), Gaps = 3/364 (1%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DE+LG+EVAW+Q++L  V RS  ++QRLYSEV LL  L+H SI+RF+ SWID  
Sbjct  32    TVYKAIDEMLGIEVAWSQVQLKEVLRSSVDIQRLYSEVHLLSTLNHKSIIRFYTSWIDVR  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
               T NFITELFTSG LR+Y+ +Y+ ++IRAIK+W RQILEGL YLH HDPPVIHRDLKCD
Sbjct  92    SHTLNFITELFTSGPLRQYKNKYSRIDIRAIKSWARQILEGLVYLHGHDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAH-SVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLA MLR  HA  SVIGTPEFMAPELYEE Y+EL+D+YSFGMC 
Sbjct  152   NIFVNGHLGQVKIGDLGLARMLRDCHAATSVIGTPEFMAPELYEENYNELIDVYSFGMCF  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+TSE+PYSEC NPAQIYKKV +GKLP  FYR+ + EAQRF+G+CL PASKR SA EL
Sbjct  212   LEMITSEFPYSECKNPAQIYKKVVAGKLPGVFYRVGDIEAQRFIGKCLVPASKRVSAREL  271

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPC-FVDQQAKSSDMTITGTLNPEDDTI  895
             L DPFLA++E     A+  +  L P     E++     D +   S MTITG LN ED+T+
Sbjct  272   LQDPFLASEESWMVYAR-GAANLKPFLNENEMDRLKLEDDELGRSRMTITGKLNAEDNTM  330

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALV  1075
             FL V I+D++GKA+ + FPFDI +DT+++VA EMVKELEITDW P++IA+MID EIS+LV
Sbjct  331   FLNVLIADENGKAKRVSFPFDIMNDTSIDVAKEMVKELEITDWEPVEIAKMIDGEISSLV  390

Query  1076  PTWR  1087
             P WR
Sbjct  391   PGWR  394


 Score = 66.2 bits (160),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 12/90 (13%)
 Frame = +2

Query  1379  KTNTGTRLCPETSRSNKKKG----CCGSNHQRPKMS-------RVRSMVDLRSQLLHRTL  1525
             +T+  TR CPE  RS+   G    C  S+    +++       R RS+VD++ +LL R+L
Sbjct  435   RTHNMTRFCPE-ERSHLHSGHDNVCAASSSSNWRLTSDNRALTRNRSLVDVQRKLLQRSL  493

Query  1526  VEEVNKRRLFKTVGAVENIGYHEPAEYSCK  1615
             VEE  KRRLFKTVG VEN+G+  P   S K
Sbjct  494   VEEARKRRLFKTVGDVENVGFQSPYAVSRK  523



>dbj|BAJ94040.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   458 bits (1178),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 247/388 (64%), Positives = 289/388 (74%), Gaps = 21/388 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWID--  175
             +VYR FDEV G+EVAWNQ  L +V R+P+ LQR+YSEV LL  L H SI+ FHASW+   
Sbjct  14    SVYRGFDEVRGVEVAWNQANLADVLRTPDALQRMYSEVHLLSTLRHDSIIAFHASWVSVS  73

Query  176   --------TDRRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDP  331
                       RRTFNFITELF+SGTLR YR RY  V++RA++ W RQIL GLAYLH+HDP
Sbjct  74    SPSPRAGCAPRRTFNFITELFSSGTLRAYRLRYPRVSLRAVRGWARQILRGLAYLHAHDP  133

Query  332   PVIHRDLKCDNIFVNGHLGQVKIGDLGLAAMLRGSHA-HSVIGTPEFMAPelyeeeydel  508
             PVIHRDLKCDN+FVNGH G VKIGDLGLAA+LRG+ A HSVIGTPEFMAPE+Y+E+YDEL
Sbjct  134   PVIHRDLKCDNVFVNGHQGTVKIGDLGLAAVLRGAQAAHSVIGTPEFMAPEMYDEDYDEL  193

Query  509   vdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEP  688
             VD+YSFGMC+LEMLT EYPY+EC+NPAQIYKKVTSGKLP AFYR+D+A+A+RF+GRCL P
Sbjct  194   VDVYSFGMCMLEMLTVEYPYAECSNPAQIYKKVTSGKLPDAFYRVDDADARRFIGRCLVP  253

Query  689   ASKRPSAHELLLDPFLAA-DEEEDESAKLPSQKLIPNG----KLLEVEPCFVDQQAKSSD  853
             AS RPSA ELLLDPFL+  D     S       L  +G       + EP      A  +D
Sbjct  254   ASHRPSAQELLLDPFLSTQDTTMTLSPPPLLPALPVSGDRKDSTEKAEPV-----AAMTD  308

Query  854   MTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPL  1033
             MTITG LN +DDTIFL+VQI D+ G +RNI+FPFDI  DTA EVA EMVKEL+ITD  P 
Sbjct  309   MTITGKLNTDDDTIFLKVQIVDEAGHSRNIYFPFDIAGDTATEVAREMVKELDITDRDPS  368

Query  1034  DIAEMIDEEISALVPTWRSTQYQKQHSF  1117
             +IA MI+EEI  LVP W       Q  +
Sbjct  369   EIAAMIEEEIMRLVPDWVGGGCDDQQEY  396



>ref|XP_006595487.1| PREDICTED: with no lysine kinase 13 isoform X3 [Glycine max]
Length=517

 Score =   459 bits (1180),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 281/500 (56%), Positives = 339/500 (68%), Gaps = 37/500 (7%)
 Frame = +2

Query  197   FITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDNIFVN  376
             F      SG  + YR+ Y  V+I+AIKNW RQIL+GL YLH HDPPVIHRDLKCDNIFVN
Sbjct  4     FARRTICSGFTQRYRKNYKRVSIQAIKNWARQILQGLVYLHCHDPPVIHRDLKCDNIFVN  63

Query  377   GHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLEMLT  553
             GHLGQVKIGDLGLAA+L GS  AHSVIGTPEFMAPELYEEEY+EL D+YSFGMCVLEMLT
Sbjct  64    GHLGQVKIGDLGLAAILHGSQLAHSVIGTPEFMAPELYEEEYNELADVYSFGMCVLEMLT  123

Query  554   SEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPF  733
             SEYPYSEC+NPAQIYKKVTSGKLP AF+RI++ EAQRF+G+CL PA KRPSA ELLLDPF
Sbjct  124   SEYPYSECSNPAQIYKKVTSGKLPMAFFRIEDMEAQRFIGKCLVPAEKRPSAKELLLDPF  183

Query  734   LAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRVQI  913
             L +D+    + K   QK  P   + E+E   +      + M + G LNPE+DTIFL+VQI
Sbjct  184   LVSDDPS-STMKFAIQK--PFLNVNEMEKLQLSDDLPRTGMKVIGKLNPENDTIFLKVQI  240

Query  914   SDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRST  1093
             SDKDG  RN+FFPFDI SDT ++VATEMVKELEI D  P +IA MID EISAL+P  R +
Sbjct  241   SDKDGSVRNVFFPFDILSDTPIDVATEMVKELEIEDGEPYEIANMIDREISALLPHRRQS  300

Query  1094  QYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK-----INHDWL  1255
                   H+FNY+DDD DD+            S SS SS Q S+ DL+ K       + WL
Sbjct  301   SCSDAFHTFNYLDDDCDDDGPHHHFR-----SFSSSSSFQESMSDLVSKGEEISSGYYWL  355

Query  1256  QN---DDTSSR-SSMNSYDCSNLCWAT---ESEGDLSSIGGRESLLIQKTNTGTRLCPET  1414
              +   DDTSSR SS  +Y  SNL + +     E ++ S+   +  +    N G ++    
Sbjct  356   HDDLHDDTSSRCSSQGTY--SNLNYYSVDDHQEYNVPSLRKDKLPITTSHNKGKKISTGE  413

Query  1415  SRSNKKKGCCGSNHQRP-------------KMSRVRSMVDLRSQLLHRTLVEEVNKRRLF  1555
               SN  +G      Q P             +++R RS++D+RSQLLHR+LVEEVNKRRLF
Sbjct  414   DLSNFNQGKLMVGSQVPLTSKSKMMINNHHRLTRNRSLIDIRSQLLHRSLVEEVNKRRLF  473

Query  1556  KTVGAVENIGYHEPAEYSCK  1615
             KTVGAVENIG+  P + + K
Sbjct  474   KTVGAVENIGFQAPCDVTTK  493



>ref|XP_009354759.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X2 [Pyrus x bretschneideri]
Length=492

 Score =   458 bits (1178),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 281/505 (56%), Positives = 341/505 (68%), Gaps = 49/505 (10%)
 Frame = +2

Query  197   FITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDNIFVN  376
             F  +   SG+ + YR++Y  V+IRAIKNW  QIL GL +LH HDPPVIHRDLKCDNIFVN
Sbjct  4     FAHQRICSGSTQRYRKKYNQVDIRAIKNWACQILRGLVHLHGHDPPVIHRDLKCDNIFVN  63

Query  377   GHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLEMLT  553
             GHLGQVKIGDLGLAA+LRGS  AHSVIGTPEFMAPELYEE+Y+ELVD+YSFGMCVLEMLT
Sbjct  64    GHLGQVKIGDLGLAAILRGSQSAHSVIGTPEFMAPELYEEDYNELVDVYSFGMCVLEMLT  123

Query  554   SEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPF  733
             SEYPYSEC NPAQIYKKVT+GKLP AFYRI++ EAQRFVG+CL  ASKR SA EL+LDPF
Sbjct  124   SEYPYSECVNPAQIYKKVTAGKLPGAFYRIEDLEAQRFVGKCLVNASKRSSAKELMLDPF  183

Query  734   LAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKS---------SDMTITGTLNPED  886
             L   ++E           +P GKL   +P   D++ +          +DMTITG LN ED
Sbjct  184   LECGKDES----------LPLGKLGLPKPFLNDKEMEKLQLSDYPTRTDMTITGKLNSED  233

Query  887   DTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEIS  1066
             DTIFL+VQI+DKDG  RNI+FPFD  +DT  +VATEMVKELEITDW P +IA MI+ EIS
Sbjct  234   DTIFLKVQIADKDGSLRNIYFPFDRLNDTPFDVATEMVKELEITDWEPFEIANMIEGEIS  293

Query  1067  ALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEKINH  1246
             AL P W+   Y   H+FNY     DD++ G     H + S S  S S       + ++ +
Sbjct  294   ALAPDWKPEAY---HTFNY----QDDDDDGPHHPSHSYSSSSHSSLSGLISSHGINRMKN  346

Query  1247  --DWLQN---DDTSSRSSMNSYDCSNLCWATESEGDLSSI-GGRESLLIQKTNTGTRLCP  1408
               DW Q+   D+TSS+SS +S   SNL + + +E     I  G +   I K +  TR CP
Sbjct  347   ACDWFQDDLLDETSSQSSSHSGTYSNLSFISGNEHGTKMIPTGGDKHPISKCHKSTRFCP  406

Query  1409  E------TSRSNKKKGCC------GSNHQR----PKMSRVRSMVDLRSQLLHRTLVEEVN  1540
             E       S + K  G C      GS  +R     K+ R RS+VD+RSQLLHR++VEEVN
Sbjct  407   EETSNAGQSIAKKYVGRCKALLASGSKDERIMDSRKLMRNRSLVDIRSQLLHRSVVEEVN  466

Query  1541  KRRLFKTVGAVENIGYHEPAEYSCK  1615
             +RRLFKTVG V+ IG+  P + S K
Sbjct  467   RRRLFKTVGDVKTIGFQAPCDVSKK  491



>ref|XP_009603878.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X4 [Nicotiana tomentosiformis]
Length=531

 Score =   456 bits (1173),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 276/503 (55%), Positives = 341/503 (68%), Gaps = 48/503 (10%)
 Frame = +2

Query  236   YRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGL  415
             YR++Y  V+IRAIKNW RQILEGL YLH HDPPVIHRDLKCDNIFVNGHLGQVKIGDLGL
Sbjct  17    YRKKYQRVDIRAIKNWARQILEGLVYLHEHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGL  76

Query  416   AAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLEMLTSEYPYSECTNPAQ  592
             AA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMC+LEMLT EYPYSEC NPAQ
Sbjct  77    AAILRGSQRAHSVIGTPEFMAPELYEENYNELVDVYSFGMCMLEMLTGEYPYSECVNPAQ  136

Query  593   IYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPFLAADEEEDESAKL  772
             IYKKVTSGK P AFY++ + +AQRF+ +CLEPASKR SA EL++DPFL  D  + +S  +
Sbjct  137   IYKKVTSGKRPRAFYKVQDLDAQRFIRKCLEPASKRLSAKELMVDPFLVFDNVDGKSVTM  196

Query  773   PS-QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFF  949
                QK   N K + +E   +++ A  ++MTITG LNPEDDTI ++VQI+DK+G  RN++F
Sbjct  197   MQLQKPFLNDK-IAIEDLHLNEDAPRTNMTITGKLNPEDDTILIKVQIADKEGDVRNVYF  255

Query  950   PFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRSTQYQKQHSFNYId  1129
             PFDI +DT  EVA EMVKELEITDW P +IA MID EIS LVP W+     +   ++ + 
Sbjct  256   PFDIVTDTPTEVANEMVKELEITDWKPYEIANMIDGEISGLVPQWKKWNQFESADYHVLS  315

Query  1130  dddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD-------WLQN---DDTSSR  1279
               DDDN+       +PF   SS SSSQ SL  LL     D       WL     DDTSS+
Sbjct  316   YKDDDND-----HHNPFRGFSSCSSSQVSLSGLLSSQVIDTNTNGPHWLHGDMFDDTSSQ  370

Query  1280  SSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGT-RLCP----------------  1408
             SS +S + SN  + ++ E D  +   ++S      N  T R CP                
Sbjct  371   SSSHSANYSNFNYFSDDENDPVTTSTKQSQPATAINHHTSRFCPGENSSTGQSLARMCYK  430

Query  1409  ---------ETSRSNKKKGCCGSNHQRPKMSRVRSMVDLRSQLLHRTLVEEVNKRRLFKT  1561
                       TS ++K+KG   +     +++R +S+VD+RSQLLH+TLVEEV+KRRLFKT
Sbjct  431   QCKDMLELKRTSSTSKEKGKVDTR----RLTRNKSLVDMRSQLLHKTLVEEVHKRRLFKT  486

Query  1562  VGAVENIGYHEPAEYSCKGNRSF  1630
             VGAVENIG+ +P E S +  +S 
Sbjct  487   VGAVENIGFQQPYEDSRRSPQSM  509



>ref|XP_004977377.1| PREDICTED: probable serine/threonine-protein kinase WNK7-like 
[Setaria italica]
Length=656

 Score =   460 bits (1183),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 246/404 (61%), Positives = 299/404 (74%), Gaps = 16/404 (4%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             +VYR FDE  G+EVAWNQ  L +V R+P  ++R+YSEV LL  L H +I+ FHASW+D  
Sbjct  45    SVYRGFDEERGVEVAWNQAHLTDVLRTPNAVERMYSEVQLLSTLRHDAIIGFHASWVDVS  104

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELF+SGTLR YR RY  V++RAI++W RQIL GLAYLH+HDPPVIHRDLKCD
Sbjct  105   RRTFNFITELFSSGTLRSYRLRYPRVSLRAIRSWARQILRGLAYLHAHDPPVIHRDLKCD  164

Query  362   NIFVNGHLGQVKIGDLGLAAMLR-GSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             N+ VNGH GQVKI DLGLAA+LR  S AHSVIGTPEFMAPE+Y+EEYDE VD+YSFGMC+
Sbjct  165   NLLVNGHQGQVKIADLGLAAVLRHQSTAHSVIGTPEFMAPEMYDEEYDERVDVYSFGMCM  224

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC+NPAQIYKKVT+GKLP AFYR+ + +A+RF+GRCL  ASKRPSA EL
Sbjct  225   LEMLTVEYPYSECSNPAQIYKKVTAGKLPDAFYRVQDDDARRFIGRCLVIASKRPSAAEL  284

Query  719   LLDPFLAADEEEDESA---KLPSQKLIPNGKLLEVEPCFVDQQAKS-----SDMTITGTL  874
             L DPFL  D    +SA     PS   +            V++ A+      +DMTITG L
Sbjct  285   LTDPFLLDDHHHSKSACAVMPPSSLHVAASCSSTCSTSDVEEDAEPPTPIRTDMTITGKL  344

Query  875   NPEDDTIFLRVQISDKDG-KARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMI  1051
             N E+DTIFL+VQI+D+ G   RNI+FPFD+ SDTAMEVA EMVKELEITD  P +IA MI
Sbjct  345   NAEEDTIFLKVQIADQTGNNVRNIYFPFDMASDTAMEVAEEMVKELEITDRDPSEIAAMI  404

Query  1052  DEEISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFY  1183
             ++EI  L+P       ++QH ++ +   + D++ G      PFY
Sbjct  405   EQEIERLLPGR-----EQQHEYS-VYAANGDDDDGNEERPPPFY  442


 Score = 66.2 bits (160),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  1484  SMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPA  1600
             SMVD+RSQLLHRTLVEE+N+R  F TVGAVENIG+  PA
Sbjct  595   SMVDMRSQLLHRTLVEELNRRLFFNTVGAVENIGFRAPA  633



>gb|KHN01888.1| Putative serine/threonine-protein kinase WNK4 [Glycine soja]
Length=555

 Score =   456 bits (1173),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 287/564 (51%), Positives = 353/564 (63%), Gaps = 87/564 (15%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+A DEVLG+EVAWNQ++LN V R+P++LQRLYSEV LL  L H SI+RF+ SWID D
Sbjct  29    TVYKAIDEVLGIEVAWNQVRLNEVLRTPDDLQRLYSEVHLLSTLKHQSILRFYTSWIDID  88

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R FNFITE FTSG+LREYR+ Y  V+I+AIKNW RQIL+                    
Sbjct  89    SRAFNFITEFFTSGSLREYRKNYKRVSIQAIKNWARQILQ--------------------  128

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
                                            GTPEFMAPELYEEEY+EL D+YSFGMCVL
Sbjct  129   -------------------------------GTPEFMAPELYEEEYNELADVYSFGMCVL  157

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EMLTSEYPYSEC+NPAQIYKKVTSGKLP AF+RI++ EAQRF+G+CL PA KRPSA ELL
Sbjct  158   EMLTSEYPYSECSNPAQIYKKVTSGKLPMAFFRIEDMEAQRFIGKCLVPAEKRPSAKELL  217

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIFL  901
             LDPFL +D+    + K   QK  P   + E+E   +      + M + G LNPE+DTIFL
Sbjct  218   LDPFLVSDDPS-STMKFAIQK--PFLNVNEMEKLQLSDDLPRTGMKVIGKLNPENDTIFL  274

Query  902   RVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPT  1081
             +VQISDKDG  RN+FFPFDI SDT ++VATEMVKELEI D  P +IA MID EISAL+P 
Sbjct  275   KVQISDKDGSVRNVFFPFDILSDTPIDVATEMVKELEIEDGEPYEIANMIDREISALLPH  334

Query  1082  WRSTQYQKQ-HSFNYIddddddNNVGISTTRHPFYslssqsssqaslPDLLEK-----IN  1243
              R +      H+FNY+DDD DD+            S SS SS Q S+ DL+ K       
Sbjct  335   RRQSSCSDAFHTFNYLDDDCDDDGPHHHFR-----SFSSSSSFQESMSDLVSKGEEISSG  389

Query  1244  HDWLQN---DDTSSR-SSMNSYDCSNLCWAT---ESEGDLSSIGGRESLLIQKTNTGTRL  1402
             + WL +   DDTSSR SS  +Y  SNL + +     E ++ S+   +  +    N G ++
Sbjct  390   YYWLHDDLHDDTSSRCSSQGTY--SNLNYYSVDDHQEYNVPSLRKDKLPITTSHNKGKKI  447

Query  1403  CPETSRSNKKKGCCGSNHQRP-------------KMSRVRSMVDLRSQLLHRTLVEEVNK  1543
                   SN  +G      Q P             +++R RS++D+RSQLLHR+LVEEVNK
Sbjct  448   STGEDLSNFNQGKLMVGSQVPLTSKSKMMINNHHRLTRNRSLIDIRSQLLHRSLVEEVNK  507

Query  1544  RRLFKTVGAVENIGYHEPAEYSCK  1615
             RRLFKTVGAVENIG+  P + + K
Sbjct  508   RRLFKTVGAVENIGFQAPCDVTTK  531



>gb|EMS65351.1| putative serine/threonine-protein kinase WNK8 [Triticum urartu]
Length=567

 Score =   456 bits (1172),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 241/386 (62%), Positives = 287/386 (74%), Gaps = 14/386 (4%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWI---  172
             +VYR FDEV G+EVAWNQ  L +V R+P+ LQR+YSEV LL  L H +I+ FHASW+   
Sbjct  43    SVYRGFDEVRGVEVAWNQANLADVLRTPDALQRMYSEVHLLSTLRHDAIIAFHASWVSVS  102

Query  173   ----------DTDRRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHS  322
                          RRTFNFITELF+SGTLR YR RY  V++RA++ W R IL GLAYLH+
Sbjct  103   SPSPRGGCAGGAPRRTFNFITELFSSGTLRAYRLRYPRVSLRAVRGWARPILRGLAYLHA  162

Query  323   HDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLAAMLRGSHA-HSVIGTPEFMAPelyeeey  499
             HDPPVIHRDLKCDN+FVNGH G VKIGDLGLAA+LRG+ A HSVIGTPEFMAPE+Y+E+Y
Sbjct  163   HDPPVIHRDLKCDNVFVNGHQGTVKIGDLGLAAVLRGAQAAHSVIGTPEFMAPEMYDEDY  222

Query  500   delvdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRC  679
             DELVD+YSFGMC+LEMLT EYPY+EC+NPAQIYKKVTSGKLP AFYR+D+A+A+RF+GRC
Sbjct  223   DELVDVYSFGMCMLEMLTVEYPYAECSNPAQIYKKVTSGKLPDAFYRVDDADARRFIGRC  282

Query  680   LEPASKRPSAHELLLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMT  859
             L PAS RPSA ELLLDPFL+  +     +  P    +P        P   +  A  +DMT
Sbjct  283   LVPASHRPSAQELLLDPFLSTQDTTMTLSPPPLLPALPTSGDRNDNPEEAEPVAARTDMT  342

Query  860   ITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDI  1039
             ITG LN +DDTIFL+VQI D+ G +RNI+FPFDI  DTA EVA EMVKEL+ITD  P +I
Sbjct  343   ITGKLNTDDDTIFLKVQIVDEAGHSRNIYFPFDIAGDTATEVAREMVKELDITDRDPSEI  402

Query  1040  AEMIDEEISALVPTWRSTQYQKQHSF  1117
             A MI++EI  LVP W       Q  +
Sbjct  403   AAMIEQEIMRLVPDWVGGGCDDQQEY  428



>ref|XP_003577137.1| PREDICTED: probable serine/threonine-protein kinase WNK8 [Brachypodium 
distachyon]
Length=645

 Score =   458 bits (1179),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 242/393 (62%), Positives = 289/393 (74%), Gaps = 34/393 (9%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+ FDEV G+EVAWNQ  L +V R+P+ L R+YSEV LL  L H SI+ FHASW+ T 
Sbjct  45    TVYKGFDEVRGVEVAWNQANLADVLRTPDALHRIYSEVHLLSTLRHDSIIAFHASWLSTT  104

Query  182   R--------------RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLH  319
                            RTFNFITELF+SGTLR YR RY  V++RA++ W RQIL GLAYLH
Sbjct  105   TSSSSSSPRAGAGGGRTFNFITELFSSGTLRSYRLRYPRVSLRAVRGWARQILRGLAYLH  164

Query  320   SHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLAAMLRGSHA--HSVIGTPEFMAPelyee  493
              HDPPVIHRDLKCDN+FVNGH G VKIGDLGLAA+LRG+ A  HSVIGTPEFMAPE+Y+E
Sbjct  165   GHDPPVIHRDLKCDNLFVNGHQGTVKIGDLGLAAVLRGARASAHSVIGTPEFMAPEMYDE  224

Query  494   eydelvdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVG  673
             +Y  LVD+YSFGMCVLEMLT+EYPYSEC NPAQIYKKVTSGKLP AFYR+++ EA+RF+G
Sbjct  225   DYGVLVDVYSFGMCVLEMLTAEYPYSECCNPAQIYKKVTSGKLPDAFYRVEDDEARRFIG  284

Query  674   RCLEPASKRPSAHELLLDPFLAADEEEDESAKLPS------------QKLIPNGKLLEVE  817
             RCL  AS RPSA ELLLDPFL+A   +D +  + S              +         +
Sbjct  285   RCLVAASARPSAQELLLDPFLSA---QDNTMIITSPPPPPLLLPSTFSTMTSGASAGRQQ  341

Query  818   PCFVDQQAKS---SDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVA  988
                V+++A     +DMTITG LN +DDTIFL+VQI+D+ G ARNI+FPFDI SDTA EVA
Sbjct  342   QDDVEEKAAEPARTDMTITGKLNTDDDTIFLKVQIADEKGHARNIYFPFDIASDTAAEVA  401

Query  989   TEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             TEMVKEL+I D  P +IA MI++EI+ LVP +R
Sbjct  402   TEMVKELDIADRDPSEIAAMIEQEITRLVPGYR  434


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  1487  MVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGY  1588
             M+D+RSQLLHRTLVEE+NKR  F TVGAVENIG+
Sbjct  574   MLDVRSQLLHRTLVEELNKRMFFNTVGAVENIGF  607



>ref|XP_009757972.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform 
X4 [Nicotiana sylvestris]
Length=531

 Score =   452 bits (1163),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 273/499 (55%), Positives = 339/499 (68%), Gaps = 40/499 (8%)
 Frame = +2

Query  236   YRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGL  415
             YR++Y  V+IRAIKNW RQILEGL YLH HDPPVIHRDLKCDNIFVNGHLGQVK+GDLGL
Sbjct  17    YRKKYQRVDIRAIKNWARQILEGLVYLHEHDPPVIHRDLKCDNIFVNGHLGQVKVGDLGL  76

Query  416   AAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLEMLTSEYPYSECTNPAQ  592
             AA+LRGS  AHSVIGTPEFMAPELYEE Y+ELVD+YSFGMC+LEMLT EYPYSEC NPAQ
Sbjct  77    AAILRGSQRAHSVIGTPEFMAPELYEENYNELVDVYSFGMCMLEMLTGEYPYSECVNPAQ  136

Query  593   IYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLLDPFLAADEEEDESAKL  772
             IYKKVTSGK P AFY++ + +AQRF+ +CLEPASKR SA EL++DPFLA D  + +S  +
Sbjct  137   IYKKVTSGKRPRAFYKVQDLDAQRFIRKCLEPASKRLSAKELMVDPFLALDNIDGKSVTM  196

Query  773   PS-QKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFF  949
                QK   N K + +E   ++  A  ++MTITG LNPEDDTI ++VQI+D +G  RN++F
Sbjct  197   MQLQKPFLNDK-IAIEDLHLNDDAPRTNMTITGKLNPEDDTILIKVQIADNEGDVRNVYF  255

Query  950   PFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRSTQYQKQHSFNYId  1129
             PFDI +DT  EVA EMVKEL+ITDW P +IA MID EIS LVP W+     +   +  + 
Sbjct  256   PFDIVTDTPTEVANEMVKELDITDWKPHEIANMIDGEISGLVPQWKKWNQFESADYQVLS  315

Query  1130  dddddNNVGISTTRHPFYslssqsssqaslPDLLEKINHD-------WLQN---DDTSSR  1279
               DDDN+       +PF   SS SSSQ SL  LL     D       WL     DDTSS+
Sbjct  316   YKDDDND-----HHNPFQGFSSCSSSQVSLSGLLSSQVIDTNTNDPHWLHGDMFDDTSSQ  370

Query  1280  SSMNSYDCSNLCWATESEGDLSSIGGRESLLIQKTNTGT-RLCPETSRSN----------  1426
             SS +S + SN  + ++ E D  +   ++S      +  T R CP  + S           
Sbjct  371   SSSHSANYSNFNYFSDDENDPVTTSTKQSQPATAISHHTSRFCPGENSSTGQSLAKMCYK  430

Query  1427  ------KKKGCCGSNHQRPK-----MSRVRSMVDLRSQLLHRTLVEEVNKRRLFKTVGAV  1573
                   K KG   ++ ++ K     ++R +S+VD+RSQLLH+TLVEEV+KRRLFKTVGAV
Sbjct  431   QCKDMLKLKGTSSTSKEKDKVDARRLTRNKSLVDMRSQLLHKTLVEEVHKRRLFKTVGAV  490

Query  1574  ENIGYHEPAEYSCKGNRSF  1630
             ENIG+ +P E S +  +S 
Sbjct  491   ENIGFQQPYEDSRRSPQSM  509



>gb|AFW64602.1| putative protein kinase superfamily protein [Zea mays]
Length=621

 Score =   452 bits (1162),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 238/398 (60%), Positives = 286/398 (72%), Gaps = 29/398 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             +VYR FDE  G+EVAWNQ  L +V RSP+ +QR+YSEV LL +L H  I+ FHASW+D  
Sbjct  3     SVYRGFDEERGVEVAWNQASLADVLRSPDAVQRMYSEVQLLSELRHDGIIGFHASWVDVP  62

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R+FNFITELF+SGTLR YR RY  VN+RA+++W RQ+L GLAYLH+ DPPVIHRDLKCD
Sbjct  63    GRSFNFITELFSSGTLRSYRLRYPRVNLRAVRSWARQLLGGLAYLHARDPPVIHRDLKCD  122

Query  362   NIFVNGHLGQVKIGDLGLAAML-RGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH G VKIGDLGLAA+L RG  AHSVIGTPEFMAPE+Y+EEYDE VD+Y+FGMC+
Sbjct  123   NIFVNGHQGHVKIGDLGLAAVLRRGGAAHSVIGTPEFMAPEMYDEEYDERVDVYAFGMCM  182

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSECTNPAQIYKKVT+G+LP AFYR+D+ +A+RF+GRCL PA+ RPSA EL
Sbjct  183   LEMLTVEYPYSECTNPAQIYKKVTAGRLPDAFYRVDDDDARRFIGRCLVPAANRPSAAEL  242

Query  719   LLDPFL--AADEEEDESAKLPSQKLIPNGKLLEVEP-------CFVDQQAKSS-------  850
             LLDPFL          +  +P    +P   +    P          D    S+       
Sbjct  243   LLDPFLLHHHHHAAAAAGTVPVPSPLPTTAVAAGAPPPSTCSSSAADDDVVSALDDDDEV  302

Query  851   ------DMTITGTLNPEDDTIFLRVQISDK-DGKARNIFFPFDITSDTAMEVATEMVKEL  1009
                   DMTITG LN E+DTIFL+VQI+D+  G ARNI+FPFD+ SDTA EVA EMVKEL
Sbjct  303   DVPPRNDMTITGKLNAEEDTIFLKVQIADEASGHARNIYFPFDMASDTAAEVAQEMVKEL  362

Query  1010  EITDWMPLDIAEMIDEEISALVPTWRSTQYQKQHSFNY  1123
             +ITD    +IA MI +EI  L+P        +QH + Y
Sbjct  363   DITDRHASEIAAMIQQEIGRLLPG-----RAQQHEYTY  395


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  1484  SMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             SMVD+RSQLLHRTLVEE+N+R  F TVGAVENIG+  P
Sbjct  544   SMVDMRSQLLHRTLVEELNRRLFFNTVGAVENIGFRAP  581



>gb|AFW64603.1| putative protein kinase superfamily protein [Zea mays]
Length=634

 Score =   451 bits (1161),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 238/398 (60%), Positives = 286/398 (72%), Gaps = 29/398 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             +VYR FDE  G+EVAWNQ  L +V RSP+ +QR+YSEV LL +L H  I+ FHASW+D  
Sbjct  16    SVYRGFDEERGVEVAWNQASLADVLRSPDAVQRMYSEVQLLSELRHDGIIGFHASWVDVP  75

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R+FNFITELF+SGTLR YR RY  VN+RA+++W RQ+L GLAYLH+ DPPVIHRDLKCD
Sbjct  76    GRSFNFITELFSSGTLRSYRLRYPRVNLRAVRSWARQLLGGLAYLHARDPPVIHRDLKCD  135

Query  362   NIFVNGHLGQVKIGDLGLAAML-RGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH G VKIGDLGLAA+L RG  AHSVIGTPEFMAPE+Y+EEYDE VD+Y+FGMC+
Sbjct  136   NIFVNGHQGHVKIGDLGLAAVLRRGGAAHSVIGTPEFMAPEMYDEEYDERVDVYAFGMCM  195

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSECTNPAQIYKKVT+G+LP AFYR+D+ +A+RF+GRCL PA+ RPSA EL
Sbjct  196   LEMLTVEYPYSECTNPAQIYKKVTAGRLPDAFYRVDDDDARRFIGRCLVPAANRPSAAEL  255

Query  719   LLDPFL--AADEEEDESAKLPSQKLIPNGKLLEVEP-------CFVDQQAKSS-------  850
             LLDPFL          +  +P    +P   +    P          D    S+       
Sbjct  256   LLDPFLLHHHHHAAAAAGTVPVPSPLPTTAVAAGAPPPSTCSSSAADDDVVSALDDDDEV  315

Query  851   ------DMTITGTLNPEDDTIFLRVQISDK-DGKARNIFFPFDITSDTAMEVATEMVKEL  1009
                   DMTITG LN E+DTIFL+VQI+D+  G ARNI+FPFD+ SDTA EVA EMVKEL
Sbjct  316   DVPPRNDMTITGKLNAEEDTIFLKVQIADEASGHARNIYFPFDMASDTAAEVAQEMVKEL  375

Query  1010  EITDWMPLDIAEMIDEEISALVPTWRSTQYQKQHSFNY  1123
             +ITD    +IA MI +EI  L+P        +QH + Y
Sbjct  376   DITDRHASEIAAMIQQEIGRLLPG-----RAQQHEYTY  408


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  1484  SMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             SMVD+RSQLLHRTLVEE+N+R  F TVGAVENIG+  P
Sbjct  557   SMVDMRSQLLHRTLVEELNRRLFFNTVGAVENIGFRAP  594



>ref|XP_008679338.1| PREDICTED: probable serine/threonine-protein kinase WNK8 [Zea 
mays]
 gb|AFW64604.1| putative protein kinase superfamily protein [Zea mays]
Length=667

 Score =   452 bits (1164),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 238/398 (60%), Positives = 286/398 (72%), Gaps = 29/398 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             +VYR FDE  G+EVAWNQ  L +V RSP+ +QR+YSEV LL +L H  I+ FHASW+D  
Sbjct  49    SVYRGFDEERGVEVAWNQASLADVLRSPDAVQRMYSEVQLLSELRHDGIIGFHASWVDVP  108

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R+FNFITELF+SGTLR YR RY  VN+RA+++W RQ+L GLAYLH+ DPPVIHRDLKCD
Sbjct  109   GRSFNFITELFSSGTLRSYRLRYPRVNLRAVRSWARQLLGGLAYLHARDPPVIHRDLKCD  168

Query  362   NIFVNGHLGQVKIGDLGLAAML-RGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGH G VKIGDLGLAA+L RG  AHSVIGTPEFMAPE+Y+EEYDE VD+Y+FGMC+
Sbjct  169   NIFVNGHQGHVKIGDLGLAAVLRRGGAAHSVIGTPEFMAPEMYDEEYDERVDVYAFGMCM  228

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSECTNPAQIYKKVT+G+LP AFYR+D+ +A+RF+GRCL PA+ RPSA EL
Sbjct  229   LEMLTVEYPYSECTNPAQIYKKVTAGRLPDAFYRVDDDDARRFIGRCLVPAANRPSAAEL  288

Query  719   LLDPFL--AADEEEDESAKLPSQKLIPNGKLLEVEP-------CFVDQQAKSS-------  850
             LLDPFL          +  +P    +P   +    P          D    S+       
Sbjct  289   LLDPFLLHHHHHAAAAAGTVPVPSPLPTTAVAAGAPPPSTCSSSAADDDVVSALDDDDEV  348

Query  851   ------DMTITGTLNPEDDTIFLRVQISDK-DGKARNIFFPFDITSDTAMEVATEMVKEL  1009
                   DMTITG LN E+DTIFL+VQI+D+  G ARNI+FPFD+ SDTA EVA EMVKEL
Sbjct  349   DVPPRNDMTITGKLNAEEDTIFLKVQIADEASGHARNIYFPFDMASDTAAEVAQEMVKEL  408

Query  1010  EITDWMPLDIAEMIDEEISALVPTWRSTQYQKQHSFNY  1123
             +ITD    +IA MI +EI  L+P        +QH + Y
Sbjct  409   DITDRHASEIAAMIQQEIGRLLPG-----RAQQHEYTY  441


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  1484  SMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             SMVD+RSQLLHRTLVEE+N+R  F TVGAVENIG+  P
Sbjct  590   SMVDMRSQLLHRTLVEELNRRLFFNTVGAVENIGFRAP  627



>gb|EMT27038.1| hypothetical protein F775_43856 [Aegilops tauschii]
Length=452

 Score =   441 bits (1134),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 235/372 (63%), Positives = 282/372 (76%), Gaps = 16/372 (4%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWI---  172
             +VYR FDEV G+EVAWNQ  L +V R+P+ LQR+YSEV LL  L H +I+ FHASW+   
Sbjct  14    SVYRGFDEVRGVEVAWNQANLADVLRTPDALQRMYSEVHLLSTLRHDAIIAFHASWVSVS  73

Query  173   ----------DTDRRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHS  322
                        T RRTFNFITELF+SGTLR YR RY  V++RA++ W RQIL GLAYLH+
Sbjct  74    SPSPRGGCTGGTPRRTFNFITELFSSGTLRAYRLRYPRVSLRAVRGWARQILRGLAYLHA  133

Query  323   HDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeey  499
             HDPPVIHRDLKCDN+FVNGH G VKIGDLGLAA+LRG+  AHSVIGTPEFMAPE+Y+E+Y
Sbjct  134   HDPPVIHRDLKCDNVFVNGHQGTVKIGDLGLAAVLRGAQAAHSVIGTPEFMAPEMYDEDY  193

Query  500   delvdIYSFGMCVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRC  679
             DELVD+YSFGMC+LEMLT EYPY+EC+NPAQIYKKVTSGKLP AFYR+D+A+A+RF+GR 
Sbjct  194   DELVDVYSFGMCMLEMLTVEYPYAECSNPAQIYKKVTSGKLPDAFYRVDDADARRFIGRG  253

Query  680   LEPASKRPSAHELLLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMT  859
               P   RPSA ELLLD FL+  +     +  P    +P     +  P   +  A  +DMT
Sbjct  254   --PGPPRPSAQELLLDRFLSTQDTTMTLSPPPLLPALPTSGDRKDNPEEAEPVAARTDMT  311

Query  860   ITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDI  1039
             ITG LN +DDTIFL+VQI D+ G +RNI+FPFDI  DTA EVA EMVKEL+ITD  P +I
Sbjct  312   ITGKLNTDDDTIFLKVQIVDEAGHSRNIYFPFDIAGDTATEVAREMVKELDITDRDPSEI  371

Query  1040  AEMIDEEISALV  1075
             A MI++EI+ LV
Sbjct  372   AAMIEQEITRLV  383



>gb|EPS72856.1| with no lysine kinase, partial [Genlisea aurea]
Length=386

 Score =   434 bits (1116),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 225/359 (63%), Positives = 272/359 (76%), Gaps = 13/359 (4%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VY+AFD  LG+EVAWN++ L +  RSPE+LQRL SEV LL  L+H SIMRF +SWID++
Sbjct  39    VVYKAFDHALGLEVAWNKVTLVDFIRSPEDLQRLRSEVHLLSTLNHRSIMRFFSSWIDSE  98

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              RTFNFITE+FTSGTLR+YR +Y  VNIRAIK W R+ILEGL YLH  DPPVIHRDLKCD
Sbjct  99    NRTFNFITEMFTSGTLRQYRAKYKRVNIRAIKRWAREILEGLVYLHGLDPPVIHRDLKCD  158

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH--AHSVIGTPEFMAPelyeeeydelvdIYSFGMC  535
             NIFVNGHLGQVKIGDLGLA +LR +   AH+++GTPEFMAPE+Y E YDELVDIYS+GMC
Sbjct  159   NIFVNGHLGQVKIGDLGLAVILRQTSRTAHTILGTPEFMAPEVYAENYDELVDIYSYGMC  218

Query  536   VLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHE  715
             VLEM+  EYPYSEC   AQIY+ VT G  P AFY++D+ EA+RF+G+CLE AS R  A E
Sbjct  219   VLEMIVHEYPYSECATSAQIYQNVTRGMKPRAFYKVDDLEARRFIGKCLERASTRLPAKE  278

Query  716   LLLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTI  895
             L++DPFL  D  +     +P+     N   L  E    ++    +DMT+TG +N  D TI
Sbjct  279   LIMDPFLDLDRRD----SIPT-----NRNPLSNEFDSKNRDDPRTDMTVTGKMN-SDGTI  328

Query  896   FLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISAL  1072
             FL+VQI+DK G   N+FFPFD+ SDT ++VATEMVKEL ITDW P +IA MID E+SAL
Sbjct  329   FLKVQIADK-GSVNNVFFPFDVESDTPLDVATEMVKELGITDWKPPEIAAMIDAEMSAL  386



>ref|XP_002987588.1| hypothetical protein SELMODRAFT_126389, partial [Selaginella 
moellendorffii]
 gb|EFJ11424.1| hypothetical protein SELMODRAFT_126389, partial [Selaginella 
moellendorffii]
Length=419

 Score =   433 bits (1113),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 225/374 (60%), Positives = 282/374 (75%), Gaps = 13/374 (3%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VYRAFDEV G+EVAWNQ+ + ++ RSP++L+RLYSEV LLK L H +I++F+ SW+D+ 
Sbjct  39    AVYRAFDEVDGLEVAWNQVNVQDLLRSPDDLERLYSEVHLLKTLKHKNIIKFYTSWVDSK  98

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RR  NFITE+FTSGTLR+YR+++  V+++A+KNW RQIL GL YLHSHDPP+IHRDLKCD
Sbjct  99    RRNVNFITEIFTSGTLRQYRKKHKNVDMKAVKNWARQILRGLLYLHSHDPPIIHRDLKCD  158

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNG+ G+VKIGDLGLA +LR +H AHSVIGTPEFMAPELYEEEYDELVDIYSFGMCV
Sbjct  159   NIFVNGNYGEVKIGDLGLATILRQAHAAHSVIGTPEFMAPELYEEEYDELVDIYSFGMCV  218

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+T EYPYSECTN AQIYK+VTSGK PAAF ++ + E ++F+ +CL   S+R  A EL
Sbjct  219   LEMVTFEYPYSECTNAAQIYKRVTSGKKPAAFEKVKDPEVRKFIEKCLAAVSRRLPAREL  278

Query  719   LLDPFLAADEEEDESAKLP---SQKLIPNGKLL--------EVEPCFVDQQAKSSDMTIT  865
             L+DPFL  D E +    +P    Q  + + + L        E +    DQQ KS D  + 
Sbjct  279   LMDPFLRCDGERESLECIPVIRKQSRVDDMEELRSSAVTNHESDQGDSDQQRKSIDFKVK  338

Query  866   GTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAE  1045
             G    EDDTIFLR++I+D +G  RNI FPFD+  DTA+ VA+EMV EL+++D     IAE
Sbjct  339   GRRR-EDDTIFLRLRIADPEGHIRNIHFPFDVEGDTALSVASEMVAELDLSDQDVTTIAE  397

Query  1046  MIDEEISALVPTWR  1087
             MID EI  LVP W+
Sbjct  398   MIDAEILNLVPDWK  411



>ref|XP_006663741.1| PREDICTED: probable serine/threonine-protein kinase WNK8-like 
[Oryza brachyantha]
Length=625

 Score =   440 bits (1131),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 235/393 (60%), Positives = 285/393 (73%), Gaps = 25/393 (6%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYR FDEV G+EVAWNQ  +++V R+P+ L R+Y+EV LL DL H +I+ FHASW+D  
Sbjct  48    TVYRGFDEVRGVEVAWNQATISDVLRTPDALHRMYAEVSLLADLRHDAIISFHASWVDPS  107

Query  182   --RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLK  355
               RR+FNFITELF+SGTLR YR RY  V+ RAI  W R +L GLAYLHS    VIHRDLK
Sbjct  108   PSRRSFNFITELFSSGTLRSYRLRYPRVSRRAIAAWARHLLRGLAYLHSRG--VIHRDLK  165

Query  356   CDNIFVNGHLGQVKIGDLGLAAMLRG-SHAHSVIGTPEFMAPelyeeeydelvdIYSFGM  532
             CDNIFVNGHLGQVKIGDLGLAA+LRG S AHSVIGTPEFMAPE+Y+E Y   VD+YSFGM
Sbjct  166   CDNIFVNGHLGQVKIGDLGLAAVLRGCSSAHSVIGTPEFMAPEMYDEHYGVGVDVYSFGM  225

Query  533   CVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAH  712
             C+LEMLT+EYPYSEC NPAQIYKKVT+GK+P AFYR+ + EA+RF+GRCL  AS RPSA 
Sbjct  226   CMLEMLTNEYPYSECNNPAQIYKKVTAGKMPDAFYRLTDPEARRFIGRCLVAASHRPSAE  285

Query  713   ELLLDPFLAADEEEDE-----------SAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMT  859
             ELL+DPFL+  +  D+               P   +       E        ++ + DMT
Sbjct  286   ELLIDPFLSPSQHHDDHNSNVITCHSAPPPPPLPLITIANSEQEEGEEAPAAESTAVDMT  345

Query  860   ITGTLNPEDDTIFLRVQI----SDKDGKA---RNIFFPFDITSDTAMEVATEMVKELEIT  1018
             ITG LN E DTIFL+VQI    S +DG     RNI+FPFDI +DTAMEVATEMVKEL+I 
Sbjct  346   ITGKLNKEHDTIFLKVQIGSDESSRDGHGGNVRNIYFPFDIVNDTAMEVATEMVKELDIG  405

Query  1019  DWMPLDIAEMIDEEISALVPTWRSTQYQKQHSF  1117
             +  P +IA MI++EI  LVP ++  Q Q+++S+
Sbjct  406   EREPREIAAMIEQEIVRLVPGYK--QQQQEYSY  436



>ref|XP_002987671.1| hypothetical protein SELMODRAFT_126444, partial [Selaginella 
moellendorffii]
 gb|EFJ11246.1| hypothetical protein SELMODRAFT_126444, partial [Selaginella 
moellendorffii]
Length=418

 Score =   432 bits (1111),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 225/374 (60%), Positives = 282/374 (75%), Gaps = 13/374 (3%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
              VYRAFDEV G+EVAWNQ+ + ++ RSP++L+RLYSEV LLK L H +I++F+ SW+D+ 
Sbjct  39    AVYRAFDEVDGLEVAWNQVNVQDLLRSPDDLERLYSEVHLLKTLKHKNIIKFYTSWVDSK  98

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RR  NFITE+FTSGTLR+YR+++  V+++A+KNW RQIL GL YLHSHDPP+IHRDLKCD
Sbjct  99    RRNVNFITEIFTSGTLRQYRKKHKNVDMKAVKNWARQILRGLLYLHSHDPPIIHRDLKCD  158

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNG+ G+VKIGDLGLA +LR +H AHSVIGTPEFMAPELYEEEYDELVDIYSFGMCV
Sbjct  159   NIFVNGNYGEVKIGDLGLATILRQAHAAHSVIGTPEFMAPELYEEEYDELVDIYSFGMCV  218

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+T EYPYSECTN AQIYK+VTSGK PAAF ++ + E ++F+ +CL   S+R  A EL
Sbjct  219   LEMVTFEYPYSECTNAAQIYKRVTSGKKPAAFEKVKDPEVRKFIEKCLAAVSRRLPAREL  278

Query  719   LLDPFLAADEEEDESAKLP---SQKLIPNGKLL--------EVEPCFVDQQAKSSDMTIT  865
             L+DPFL  D E +    +P    Q  + + + L        E +    DQQ KS D  + 
Sbjct  279   LMDPFLRCDGERETLECIPVIRKQSRVDDMEELRSSAVTNHESDQGDSDQQRKSIDFKVK  338

Query  866   GTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAE  1045
             G    EDDTIFLR++I+D +G  RNI FPFD+  DTA+ VA+EMV EL+++D     IAE
Sbjct  339   GRRR-EDDTIFLRLRIADPEGHIRNIHFPFDVEGDTALSVASEMVAELDLSDQDVTTIAE  397

Query  1046  MIDEEISALVPTWR  1087
             MID EI  LVP W+
Sbjct  398   MIDAEILNLVPDWK  411



>ref|XP_006662669.1| PREDICTED: probable serine/threonine-protein kinase WNK8-like 
[Oryza brachyantha]
Length=621

 Score =   438 bits (1127),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 238/394 (60%), Positives = 289/394 (73%), Gaps = 26/394 (7%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYR FDEV G+EVAWNQ  +++V R+P+ L R+Y+EV LL DL H +I+ FHASW+D  
Sbjct  48    TVYRGFDEVRGVEVAWNQATISDVLRTPDALHRMYAEVSLLADLRHDAIISFHASWVDPS  107

Query  182   --RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLK  355
               RR+FNFITELF+SGTLR YR RY  V+ RAI  W R +L GLAYLHS    VIHRDLK
Sbjct  108   PSRRSFNFITELFSSGTLRSYRLRYPRVSRRAIAAWARHLLRGLAYLHSRG--VIHRDLK  165

Query  356   CDNIFVNGHLGQVKIGDLGLAAMLRG-SHAHSVIGTPEFMAPelyeeeydelvdIYSFGM  532
             CDNIFVNGHLGQVKIGDLGLAA+LRG S AHSVIGTPEFMAPE+Y+E Y   VD+YSFGM
Sbjct  166   CDNIFVNGHLGQVKIGDLGLAAVLRGCSSAHSVIGTPEFMAPEMYDEHYGVAVDVYSFGM  225

Query  533   CVLEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAH  712
             C+LEMLT+EYPYSEC NPAQIYKKVT+GK+P AFYR+ + EA+RF+GRCL  AS RPSA 
Sbjct  226   CMLEMLTNEYPYSECNNPAQIYKKVTAGKMPDAFYRLTDPEARRFIGRCLVAASHRPSAE  285

Query  713   ELLLDPFLA-ADEEEDESAKLPS-----------QKLIPNGKLLEVEPCFVDQQAKSSDM  856
             ELLLDPFL+ +   ED+++ + +              I N +  E E      +  + DM
Sbjct  286   ELLLDPFLSPSQHHEDQNSNMITCHSAPPPPPLPLITIANSEQEEEEEEAPAAERTALDM  345

Query  857   TITGTLNPEDDTIFLRVQI----SDKDGKA---RNIFFPFDITSDTAMEVATEMVKELEI  1015
              ITG LN E DTIFL+VQI    S +DG     RNI+FPFDI +DTA EVATEMVKEL+I
Sbjct  346   MITGKLNKEHDTIFLKVQIGSDGSSRDGHGGNVRNIYFPFDIVNDTATEVATEMVKELDI  405

Query  1016  TDWMPLDIAEMIDEEISALVPTWRSTQYQKQHSF  1117
              D  P +IA MI++EI  LVP ++  Q Q+++S+
Sbjct  406   GDREPREIAAMIEQEIVRLVPGYK--QQQQEYSY  437


 Score = 62.8 bits (151),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  1484  SMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             SMVD+RSQLLHRTLVEE+NKR  F TVGAV +IG+ +P
Sbjct  563   SMVDMRSQLLHRTLVEELNKRLFFNTVGAVHDIGFRDP  600



>ref|XP_002986954.1| hypothetical protein SELMODRAFT_11342, partial [Selaginella moellendorffii]
 gb|EFJ12036.1| hypothetical protein SELMODRAFT_11342, partial [Selaginella moellendorffii]
Length=401

 Score =   431 bits (1107),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 225/367 (61%), Positives = 277/367 (75%), Gaps = 6/367 (2%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDEV G+EVAWNQ+K+ +V +SPE+L+RLYSEV LLK L H +I++ + SW+DT 
Sbjct  35    TVYRAFDEVDGIEVAWNQVKVEDVLQSPEDLERLYSEVHLLKSLKHKNIIKLYNSWVDTK  94

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +  NFITE+FTSGTLR+YR+++  V++RA+KNW +QIL GL YLHSH+PP+IHRDLKCD
Sbjct  95    TKNVNFITEIFTSGTLRQYRKKHKHVDMRAVKNWAKQILRGLLYLHSHNPPIIHRDLKCD  154

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNG+ G+VKIGDLGLAA+LR +H AHSVIGTPEFMAPELYEEEY+ELVDIYSFGMC+
Sbjct  155   NIFVNGNQGEVKIGDLGLAAILRQAHAAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCL  214

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+T EYPYSECTN AQIYKKVTSGK PAA  R+ + E + F+ +CL   SKR  A EL
Sbjct  215   LEMVTFEYPYSECTNAAQIYKKVTSGKKPAALDRVKDLEVRAFIEKCLATVSKRLPAREL  274

Query  719   LLDPFLAADEEEDESAKLP--SQKLIPNGKLLEVEP--CFVDQQAKSSDMTITGTLNPED  886
             L+DPFL   ++    A  P  SQ     G L   +    F ++  +S D  + G    +D
Sbjct  275   LMDPFLQKGDDAPSGASSPEQSQTDSDQGGLGSYQKGVSFREEGKRSRDFRVKGK-KKDD  333

Query  887   DTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEIS  1066
             DTIFLRV+I+D +G  RNI FPF I  DTAM VA+EMV EL+++D     IAEMID  I 
Sbjct  334   DTIFLRVRIADLEGHVRNIHFPFSIEGDTAMSVASEMVAELDLSDQDVTTIAEMIDAAIV  393

Query  1067  ALVPTWR  1087
             ALVP WR
Sbjct  394   ALVPDWR  400



>emb|CBI34208.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   434 bits (1117),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 224/367 (61%), Positives = 278/367 (76%), Gaps = 8/367 (2%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK + H++IM+F+ SW+DT 
Sbjct  38    TVYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTMKHNNIMKFYTSWVDTA  97

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YRQ++  VNIRA+K+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  98    NRNINFVTEMFTSGTLRQYRQKHKRVNIRAVKHWCRQILRGLLYLHSHDPPVIHRDLKCD  157

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  158   NIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  217

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A Y++ + E + FV +CL   S R SA ELL
Sbjct  218   EMVTFEYPYSECTHPAQIYKKVISGKKPDALYKVKDPEVREFVEKCLASVSLRLSARELL  277

Query  722   LDPFLAADEEED-----ESAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPED  886
              DPFL  D+ E      E  + P   + P G  +E+     D+   + D++I G    ED
Sbjct  278   QDPFLRIDDCESDLRPIECRREPDDMMEPTG--IELFEYHEDEHPANVDISIKGKRR-ED  334

Query  887   DTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEIS  1066
             D IFLR++I+DK+   RNI+FPFDI  DTA+ VATEMV EL+ITD     IA+MID EI+
Sbjct  335   DGIFLRLRIADKEDHIRNIYFPFDIEMDTALSVATEMVAELDITDQDVTKIADMIDGEIA  394

Query  1067  ALVPTWR  1087
             +LVP W+
Sbjct  395   SLVPEWK  401



>gb|ACN40752.1| unknown [Picea sitchensis]
Length=885

 Score =   441 bits (1133),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 237/423 (56%), Positives = 294/423 (70%), Gaps = 50/423 (12%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE+ G+EVAWNQ+K+N+V +SPE+L+RLYSEV LLK L H +I++F +SWIDT 
Sbjct  37    TVYRAFDEIEGVEVAWNQVKVNDVLQSPEDLERLYSEVHLLKTLKHKNIIKFFSSWIDTK  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NFITE+FTSGTLR+YRQ++  V++RA+KNW RQIL GL YLHSHDPP+IHRDLKCD
Sbjct  97    TRNINFITEMFTSGTLRQYRQKHKRVDLRAVKNWARQILRGLLYLHSHDPPIIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNG+ G+VKIGDLGLAA+L  SH AHSVIGTPEFMAPELY+EEY+ELVDIY+FGMC+
Sbjct  157   NIFVNGNQGEVKIGDLGLAAILCKSHSAHSVIGTPEFMAPELYDEEYNELVDIYAFGMCL  216

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT EYPYSEC+NPAQIYKKVTSGK PAA Y++ + E ++FV +CL   S+R  A EL
Sbjct  217   LEMLTFEYPYSECSNPAQIYKKVTSGKKPAALYKVKDPEVRQFVEKCLVTVSRRLPAREL  276

Query  719   LLDPFLAADEE------------EDESAKL------PSQKLIPNG------KLLEVEPCF  826
             L+DPFL  DE              D+  +L      P+ +   NG       +  V PC 
Sbjct  277   LMDPFLQTDEHGLEYSFSRLDFCRDDVGELGPLLREPNIEAFQNGGHKAHQSIHFVHPCS  336

Query  827   V------------------------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKA  934
                                      D  + + D T+ G    EDDTIFLR++I+D +G+ 
Sbjct  337   KNGISVHYENKKQRRVVPLPSYFREDSMSHNMDFTVKGKKR-EDDTIFLRLRIADTEGRI  395

Query  935   RNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRSTQYQKQHS  1114
             RNI+FPFD+  DTAM VA+EMV EL++ D     IAEMIDEEI ALVP W++      H 
Sbjct  396   RNIYFPFDVEGDTAMSVASEMVAELDLADQDVTKIAEMIDEEILALVPDWKAGVAIDDHH  455

Query  1115  FNY  1123
             + Y
Sbjct  456   YFY  458



>gb|EPS67881.1| with no lysine kinase, partial [Genlisea aurea]
Length=405

 Score =   424 bits (1089),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 223/370 (60%), Positives = 281/370 (76%), Gaps = 12/370 (3%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL++  +SPE+L+RLY E+ LLK L H++IM+F+ SW+D  
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLSDFLQSPEDLERLYREIHLLKTLKHNNIMKFYTSWVDIT  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++   NIRAIKNW RQILEGL YLHS +PPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHRRTNIRAIKNWCRQILEGLLYLHSQNPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+L+ SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAILKKSHAARCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P + YR+++ E +RFV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPDSLYRVEDPEVRRFVEKCLATVSDRLSAWELL  276

Query  722   LDPFLAADEEEDESAKL-------PSQ-KLIPNGKLLEVEPCFVDQQAKSSDMTITGTLN  877
              DPFL  D+ +   + L       PS+  L P+ +  + +    D  A + D+TI G   
Sbjct  277   NDPFLQVDDHDGRMSPLLLGHQHHPSEIHLFPSHEEEDDD---DDDHADNVDITIRGK-R  332

Query  878   PEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDE  1057
              ED  IFLR++I+DK G+ARNI+FPFDI +DTA+ VATEMV EL+ITD     IA MID+
Sbjct  333   KEDGNIFLRLRIADKQGRARNIYFPFDIETDTALSVATEMVAELDITDQDVTRIASMIDD  392

Query  1058  EISALVPTWR  1087
             EI++LV  W+
Sbjct  393   EIASLVLDWK  402



>gb|EYU45651.1| hypothetical protein MIMGU_mgv1a004522mg [Erythranthe guttata]
Length=522

 Score =   427 bits (1099),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 235/410 (57%), Positives = 285/410 (70%), Gaps = 48/410 (12%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L HS+IM+F  SW+DT 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLFDFLQSPEDLERLYCEIHLLKTLKHSNIMKFCTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NFITELFTSGTLR+YR ++  VNIRAIK+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFITELFTSGTLRQYRLKHKKVNIRAIKHWCRQILHGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAAMLR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAMLRKSHAARCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SG  P A Y++ + E +RFV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVVSGNKPDALYKVKDPEVRRFVEKCLATVSDRLSAWELL  276

Query  722   LDPFLAADE------------EEDESAKLPSQKLIP-----------NG-----------  799
              DPFL  ++            + DE   + SQ+L+            NG           
Sbjct  277   NDPFLQIEDYIHDLRPLSYHRDYDEMGPMLSQRLLSSAHHSTTSSLVNGYSNFVGYYEQE  336

Query  800   -----KLLEVEPCFV--------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARN  940
                  + +E E   +        D+  ++ D+TI G    EDD IFLR++I+DK+G  RN
Sbjct  337   NDLDCRSVEYEANEIDLFTCHEEDEHLENVDITIKGR-RGEDDNIFLRLRIADKEGPVRN  395

Query  941   IFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRS  1090
             I+FPFDI +DTA+ VATEMV EL+ITD     IAEMID EI +LVP WRS
Sbjct  396   IYFPFDIEADTALSVATEMVAELDITDQDVTKIAEMIDGEIVSLVPDWRS  445



>ref|XP_001783954.1| predicted protein [Physcomitrella patens]
 gb|EDQ51232.1| predicted protein [Physcomitrella patens]
Length=490

 Score =   426 bits (1095),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 224/368 (61%), Positives = 281/368 (76%), Gaps = 8/368 (2%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDEV G+EVAWNQ+K+ +V +SPE+L+RLYSEV LLK L H +I++F+ SW+DT 
Sbjct  32    TVYRAFDEVEGIEVAWNQVKVQDVLQSPEDLERLYSEVHLLKTLKHRNIIKFYNSWVDTK  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              +  NFITE+FTSG LR+YR+++  V+I+A+KNW RQIL GL YLHSHDPP+IHRDLKCD
Sbjct  92    TKNVNFITEIFTSGNLRQYRKKHKHVDIKAVKNWSRQILRGLLYLHSHDPPIIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNG+ G+VKIGDLGLAA+LR +H AHSVIGTPEFMAPELYEEEY+ELVDIYSFGMC+
Sbjct  152   NIFVNGNQGEVKIGDLGLAAILRQAHAAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCL  211

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEM+T EYPYSECTN AQIYKKV+SGK PAA  ++ + E + FV +CL  ASKR  A +L
Sbjct  212   LEMVTFEYPYSECTNAAQIYKKVSSGKKPAALDKVKDPEVRAFVEKCLAKASKRLPARDL  271

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPCFV-----DQQAKSSDMTITGTLNPE  883
             L+DPFL  + + +    LP+  L    +  + E   V       + K  ++ + G    +
Sbjct  272   LVDPFLQCEGDREAVEALPTITL-SKTRADDFEELGVICEDSASKQKGGELNMKGK-RKD  329

Query  884   DDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEI  1063
             D TIFLRV+I+D DG +RNI FPFDI  DTAM VA+EMV+EL++++     IAEMID EI
Sbjct  330   DVTIFLRVRIADHDGHSRNIHFPFDIEGDTAMCVASEMVEELDLSNQDVTTIAEMIDAEI  389

Query  1064  SALVPTWR  1087
              ALVP WR
Sbjct  390   LALVPEWR  397



>gb|ACN87287.1| with no lysine kinase [Glycine max]
Length=307

 Score =   419 bits (1076),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 213/307 (69%), Positives = 253/307 (82%), Gaps = 8/307 (3%)
 Frame = +2

Query  2    TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
            TVYRAFDE+LG+EVAWNQ+KL +VF SPE+LQRLYSEV LLK L+H S+M F+ SWID +
Sbjct  3    TVYRAFDELLGIEVAWNQVKLGDVFHSPEQLQRLYSEVHLLKHLNHDSMMIFYGSWIDVN  62

Query  182  RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +TFNF+TELFTSGTLREYRQ+Y  V+I A+KNW RQIL GL YLHSH+PPVIHRDLKCD
Sbjct  63   NKTFNFVTELFTSGTLREYRQKYKRVDITAVKNWARQILSGLEYLHSHNPPVIHRDLKCD  122

Query  362  NIFVNGHLGQVKIGDLGLAAMLRGS-HAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
            NIFVNGH G+VKIGDLGLAA+L+ S HAHSVIGTPEFMAPELYEE+Y+ELVDIYSFGMC+
Sbjct  123  NIFVNGHQGRVKIGDLGLAAILKSSQHAHSVIGTPEFMAPELYEEKYNELVDIYSFGMCM  182

Query  539  LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
            +EMLT E+PYSEC NPAQIYKKVTSGK+P AFYRI+N EAQ+FVG+CL   S+RPSA EL
Sbjct  183  IEMLTFEFPYSECANPAQIYKKVTSGKIPEAFYRIENLEAQKFVGKCLANVSERPSAKEL  242

Query  719  LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVE-----PCFVDQQAKSSDMTITGTLNPE  883
            LLDPFLA ++ E +    PS   +   K  ++      P     Q KS+DMTITG++N E
Sbjct  243  LLDPFLAMEQLEIQLP--PSIPALFTNKSFKLSCPAPFPSEHRDQTKSADMTITGSINEE  300

Query  884  DDTIFLR  904
            D+T+FL+
Sbjct  301  DNTVFLK  307



>ref|XP_010934871.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase WNK9 [Elaeis guineensis]
Length=758

 Score =   434 bits (1115),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 229/402 (57%), Positives = 290/402 (72%), Gaps = 41/402 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  41    TVYRAFDEYEGIEVAWNQVKLCDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTS  100

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +R  NF+TE+FTSGTLR+YRQ++  VNIRA+K+W RQIL GL YLHSHDPP+IHRDLKCD
Sbjct  101   KRNINFVTEMFTSGTLRQYRQKHRRVNIRAVKHWCRQILRGLLYLHSHDPPIIHRDLKCD  160

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  161   NIFINGNQGEVKIGDLGLAAILRKSHAVHCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  220

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SG  P A YR+ + E ++FV +CL  AS+R  A ELL
Sbjct  221   EMVTFEYPYSECTHPAQIYKKVISGTKPEALYRVKDPEVRQFVEKCLATASRRLPARELL  280

Query  722   LDPFLAADE-----EEDESA------KLPSQKLIPNGKLL-----------EVEPCF---  826
              DPFL +++     EE E +      K PS  L+P+  LL           E+E  +   
Sbjct  281   QDPFLQSNDRGVVYEEGELSIVGHIMKQPSLDLLPSNGLLYANGFSDGLHQEIENGWDYH  340

Query  827   ---------------VDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDI  961
                             D    + D+TI G    ED +IFLR++I+DKDG+ RNI+FPFD+
Sbjct  341   AADIENHGMDLFNGQEDDPPANVDITIKGR-KREDGSIFLRLRIADKDGRVRNIYFPFDV  399

Query  962   TSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
              +DTA+ VATEMV EL+ITD+    IAEMID E+++LVP W+
Sbjct  400   EADTALSVATEMVAELDITDYEVTRIAEMIDGEVASLVPEWK  441



>gb|EAY82030.1| hypothetical protein OsI_37214 [Oryza sativa Indica Group]
Length=574

 Score =   425 bits (1093),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 231/381 (61%), Positives = 277/381 (73%), Gaps = 16/381 (4%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYR FDE+ G+EVAWNQ  +++V R+P+ L R+Y+EV LL DL H +I+ FHASW+   
Sbjct  3     TVYRGFDELRGVEVAWNQATISDVLRTPDALHRMYAEVSLLADLRHDAIIAFHASWVHPS  62

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELF+SGTLR YR RY  V+ RA+  W R IL GLAYLHS    VIHRDLKCD
Sbjct  63    RRTFNFITELFSSGTLRSYRLRYPRVSRRAVAAWARAILHGLAYLHSRG--VIHRDLKCD  120

Query  362   NIFVNGHLGQVKIGDLGLAAMLRG-SHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRG + A SVIGTPEFMAPE+Y+E Y   VD+YSFGMC+
Sbjct  121   NIFVNGHLGQVKIGDLGLAAVLRGCTSARSVIGTPEFMAPEMYDECYGVGVDVYSFGMCM  180

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT+EYPYSEC NPAQIYKKVT+GKLP AFY + +A+A+RF+GRCL  A+ RPSA EL
Sbjct  181   LEMLTNEYPYSECDNPAQIYKKVTAGKLPDAFYLLTDADARRFIGRCLVDAAHRPSAEEL  240

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVE------PCFVDQQAKSSDMTITGTLNP  880
             LLDPFL+  +  D+   +      P    L                AK++ M ITG LN 
Sbjct  241   LLDPFLSPPQNHDDHNTIAHATAPPPPLPLACSNSSEEQEEEEAPAAKTTGMAITGKLNK  300

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             E DTIFL+VQI    G  RNI+FPFD+ +DTAMEVATEMVKEL+I D  P +IA MI++E
Sbjct  301   EHDTIFLKVQIG-GGGNVRNIYFPFDVANDTAMEVATEMVKELDIADREPTEIAAMIEQE  359

Query  1061  ISALVPTWRSTQYQKQHSFNY  1123
             I  LVP +      KQH ++Y
Sbjct  360   IVRLVPGY------KQHEYSY  374


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  1484  SMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYS  1609
             SMVD+RSQLLHRTLVEE+NKR  F TVGAV +IG+ +P  Y 
Sbjct  507   SMVDMRSQLLHRTLVEELNKRLFFNTVGAVHDIGFRDPTTYG  548



>sp|Q2RBE3.2|WNK7_ORYSJ RecName: Full=Probable serine/threonine-protein kinase WNK7; 
Short=OsWNK7; AltName: Full=Protein kinase with no lysine 7 
[Oryza sativa Japonica Group]
 gb|ABA91187.2| mitogen-activated protein kinase, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EAY79709.1| hypothetical protein OsI_34857 [Oryza sativa Indica Group]
 gb|EAZ17200.1| hypothetical protein OsJ_32708 [Oryza sativa Japonica Group]
Length=622

 Score =   426 bits (1096),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 243/402 (60%), Positives = 295/402 (73%), Gaps = 20/402 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYR FDE+ G+EVAWNQ  +++V R+P+ L R+Y+EV LL DL H +I+ FHASW+   
Sbjct  48    TVYRGFDELRGVEVAWNQATISDVLRTPDALHRMYAEVSLLADLRHDAIIAFHASWVHPS  107

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELF+SGTLR YR RY  V+ RA+  W R IL GLAYLH+    VIHRDLKCD
Sbjct  108   RRTFNFITELFSSGTLRSYRLRYPRVSRRAVAAWARAILRGLAYLHARG--VIHRDLKCD  165

Query  362   NIFVNGHLGQVKIGDLGLAAMLRG-SHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRG + A SVIGTPEFMAPE+Y+E Y   VD+YSFGMC+
Sbjct  166   NIFVNGHLGQVKIGDLGLAAVLRGCASARSVIGTPEFMAPEMYDECYGVGVDVYSFGMCM  225

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT+EYPYSEC NPAQIYKKVT+GKLP AFYR+ +A+A+RF+GRCL  A+ RPSA EL
Sbjct  226   LEMLTNEYPYSECDNPAQIYKKVTAGKLPDAFYRLTDADARRFIGRCLVDAAHRPSAEEL  285

Query  719   LLDPFLAADEEEDE-------SAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLN  877
             LLDPFL+  +  D+       +A  P   L  +    E E       AK++DM ITG LN
Sbjct  286   LLDPFLSPSQNHDDHNIIAHATAPPPPLPLACSNSSEEQEEAAPAPAAKTTDMAITGKLN  345

Query  878   PEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDE  1057
              E DTIFL+VQI       RNI+FPFD+ +DTAMEVATEMVKEL+I D  P +IA MI++
Sbjct  346   KEHDTIFLKVQIGGGR-NVRNIYFPFDVANDTAMEVATEMVKELDIADREPTEIAAMIEQ  404

Query  1058  EISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFY  1183
             EI  LVP +      KQH ++Y DD+DDD+   +S   +PFY
Sbjct  405   EIVRLVPGY------KQHEYSYADDNDDDD---VSGHPNPFY  437


 Score = 62.8 bits (151),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  1484  SMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             SMVD+RSQLLHRTLVEE+NKR  F TVGAV +IG+ +P
Sbjct  556   SMVDMRSQLLHRTLVEELNKRLFFNTVGAVHDIGFRDP  593



>ref|NP_001065981.1| Os12g0114100 [Oryza sativa Japonica Group]
 sp|Q2QYL8.1|WNK8_ORYSJ RecName: Full=Probable serine/threonine-protein kinase WNK8; 
Short=OsWNK8; AltName: Full=Protein kinase with no lysine 8 
[Oryza sativa Japonica Group]
 gb|ABA96277.1| mitogen-activated protein kinase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29000.1| Os12g0114100 [Oryza sativa Japonica Group]
 gb|EAZ19430.1| hypothetical protein OsJ_34990 [Oryza sativa Japonica Group]
 dbj|BAG90424.1| unnamed protein product [Oryza sativa Japonica Group]
Length=619

 Score =   426 bits (1095),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 231/381 (61%), Positives = 277/381 (73%), Gaps = 16/381 (4%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYR FDE+ G+EVAWNQ  +++V R+P+ L R+Y+EV LL DL H +I+ FHASW+   
Sbjct  48    TVYRGFDELRGVEVAWNQATISDVLRTPDALHRMYAEVSLLADLRHDAIIAFHASWVHPS  107

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELF+SGTLR YR RY  V+ RA+  W R IL GLAYLHS    VIHRDLKCD
Sbjct  108   RRTFNFITELFSSGTLRSYRLRYPRVSRRAVAAWARAILRGLAYLHSRG--VIHRDLKCD  165

Query  362   NIFVNGHLGQVKIGDLGLAAMLRG-SHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRG + A SVIGTPEFMAPE+Y+E Y   VD+YSFGMC+
Sbjct  166   NIFVNGHLGQVKIGDLGLAAVLRGCTSARSVIGTPEFMAPEMYDECYGVGVDVYSFGMCM  225

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT+EYPYSEC NPAQIYKKVT+GKLP AFY + +A+A+RF+GRCL  A+ RPSA EL
Sbjct  226   LEMLTNEYPYSECDNPAQIYKKVTAGKLPDAFYLLTDADARRFIGRCLVDAAHRPSAEEL  285

Query  719   LLDPFLAADEEEDESAKLPSQKLIPNGKLLEVEPC------FVDQQAKSSDMTITGTLNP  880
             LLDPFL+  +  D+   +      P    L                AK++ M ITG LN 
Sbjct  286   LLDPFLSPPQNHDDHNTIAHATAPPPPLPLACSNSSEEQEEEEAPAAKTTGMAITGKLNK  345

Query  881   EDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEE  1060
             E DTIFL+VQI    G  RNI+FPFD+ +DTAMEVATEMVKEL+I D  P +IA MI++E
Sbjct  346   EHDTIFLKVQIG-GGGNVRNIYFPFDVANDTAMEVATEMVKELDIADREPTEIAAMIEQE  404

Query  1061  ISALVPTWRSTQYQKQHSFNY  1123
             I  LVP +      KQH ++Y
Sbjct  405   IVRLVPGY------KQHEYSY  419


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  1484  SMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEPAEYS  1609
             SMVD+RSQLLHRTLVEE+NKR  F TVGAV +IG+ +P  Y 
Sbjct  552   SMVDMRSQLLHRTLVEELNKRLFFNTVGAVHDIGFRDPTTYG  593



>gb|ABA91188.2| mitogen-activated protein kinase, putative, expressed [Oryza 
sativa Japonica Group]
Length=577

 Score =   424 bits (1091),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 240/402 (60%), Positives = 293/402 (73%), Gaps = 20/402 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYR FDE+ G+EVAWNQ  +++V R+P+ L R+Y+EV LL DL H +I+ FHASW+   
Sbjct  3     TVYRGFDELRGVEVAWNQATISDVLRTPDALHRMYAEVSLLADLRHDAIIAFHASWVHPS  62

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             RRTFNFITELF+SGTLR YR RY  V+ RA+  W R IL GLAYLH+    VIHRDLKCD
Sbjct  63    RRTFNFITELFSSGTLRSYRLRYPRVSRRAVAAWARAILRGLAYLHARG--VIHRDLKCD  120

Query  362   NIFVNGHLGQVKIGDLGLAAMLRG-SHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCV  538
             NIFVNGHLGQVKIGDLGLAA+LRG + A SVIGTPEFMAPE+Y+E Y   VD+YSFGMC+
Sbjct  121   NIFVNGHLGQVKIGDLGLAAVLRGCASARSVIGTPEFMAPEMYDECYGVGVDVYSFGMCM  180

Query  539   LEMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHEL  718
             LEMLT+EYPYSEC NPAQIYKKVT+GKLP AFYR+ +A+A+RF+GRCL  A+ RPSA EL
Sbjct  181   LEMLTNEYPYSECDNPAQIYKKVTAGKLPDAFYRLTDADARRFIGRCLVDAAHRPSAEEL  240

Query  719   LLDPFLAADEEEDE-------SAKLPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLN  877
             LLDPFL+  +  D+       +A  P   L  +    E E       AK++DM ITG LN
Sbjct  241   LLDPFLSPSQNHDDHNIIAHATAPPPPLPLACSNSSEEQEEAAPAPAAKTTDMAITGKLN  300

Query  878   PEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDE  1057
              E DTIFL+VQI       RNI+FPFD+ +DTAMEVATEMVKEL+I D  P +IA MI++
Sbjct  301   KEHDTIFLKVQIGGGR-NVRNIYFPFDVANDTAMEVATEMVKELDIADREPTEIAAMIEQ  359

Query  1058  EISALVPTWRSTQYQKQHSFNYIddddddNNVGISTTRHPFY  1183
             EI  LVP +      KQH ++Y    DD+++  +S   +PFY
Sbjct  360   EIVRLVPGY------KQHEYSY---ADDNDDDDVSGHPNPFY  392


 Score = 62.8 bits (151),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  1484  SMVDLRSQLLHRTLVEEVNKRRLFKTVGAVENIGYHEP  1597
             SMVD+RSQLLHRTLVEE+NKR  F TVGAV +IG+ +P
Sbjct  511   SMVDMRSQLLHRTLVEELNKRLFFNTVGAVHDIGFRDP  548



>ref|XP_010674833.1| PREDICTED: probable serine/threonine-protein kinase WNK9 [Beta 
vulgaris subsp. vulgaris]
Length=742

 Score =   430 bits (1105),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 230/405 (57%), Positives = 281/405 (69%), Gaps = 45/405 (11%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT +
Sbjct  38    VYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTAK  97

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL+GL YLHSHDPPVIHRDLKCDN
Sbjct  98    RNINFVTEMFTSGTLRQYRLKHRRVNIRAVKHWCRQILKGLFYLHSHDPPVIHRDLKCDN  157

Query  365   IFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLE  544
             IFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+LE
Sbjct  158   IFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEEYNELVDIYSFGMCILE  217

Query  545   MLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLL  724
             M+T EYPYSEC+NPAQIYKKV SGK P A Y++ + E ++F+ +CL   S R SA ELL 
Sbjct  218   MVTFEYPYSECSNPAQIYKKVISGKKPNALYKVKDPEVRQFIEKCLATVSSRLSARELLN  277

Query  725   DPFLAADEEEDES------------AKLPSQKLI---------------PNGKLLEVEPC  823
             DPFL  D+ ED+S              L  Q  +                NG  LE   C
Sbjct  278   DPFLQIDDYEDDSRLTDCISEFDGLGSLIRQPFLEHYNSLSDSSYYNGYSNGIDLESYEC  337

Query  824   FV-----------------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFP  952
                                D  +   D+TI G    ED +IFLR++I+DK+G+ RNI+FP
Sbjct  338   GYNPSEIESSGIELFEQQDDDHSPDVDITIKGK-KREDGSIFLRLRIADKEGRIRNIYFP  396

Query  953   FDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             FDI  DTA+ VATEMV ELEITD     IA+MID EI+ALVP WR
Sbjct  397   FDIELDTALSVATEMVAELEITDQDVTSIADMIDGEIAALVPNWR  441



>emb|CDO99054.1| unnamed protein product [Coffea canephora]
Length=727

 Score =   428 bits (1101),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 224/411 (55%), Positives = 289/411 (70%), Gaps = 43/411 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KLN+  +SP++L+RLY E+ LLK L H +IM+F+ASW+DT+
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLNDFLQSPDDLERLYCEIHLLKTLKHKNIMKFYASWVDTE  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRAIKNW RQIL+GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRVKHKRVNIRAIKNWCRQILKGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA LR SHA   +GTPEFMAPE+Y EEY+ELVDIY+FGMC+L
Sbjct  157   NIFVNGNQGEVKIGDLGLAAFLRKSHAARCVGTPEFMAPEVYAEEYNELVDIYAFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A Y++ + E +RFV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPDALYKVKDPEVRRFVEKCLATVSDRLSARELL  276

Query  722   LDPFLAADE------------EEDESAKLPSQKLIP----NGKLLEVEPCFVDQQAK---  844
              DPFL +D+            + ++   +  + L+     +  L++    + DQ+ +   
Sbjct  277   HDPFLQSDDYLTDLGPVDDYRDFNDVGPMLQEPLLSFSQESSSLIDSYTIYFDQEHRNGL  336

Query  845   -----------------------SSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPF  955
                                    S D+TI G    EDD IFLR++I+D++G+ RNI+FPF
Sbjct  337   DYHQNGYETNGIDLLNSQEESLGSVDITINGKRR-EDDGIFLRLRIADEEGRVRNIYFPF  395

Query  956   DITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRSTQYQKQ  1108
             DI +DTA+ VA EM+ EL++TD     IAEMID EI++LVP W+   Y ++
Sbjct  396   DIETDTALCVAAEMIAELDLTDQDMSKIAEMIDGEIASLVPEWKRRLYNEE  446



>ref|XP_009760923.1| PREDICTED: probable serine/threonine-protein kinase WNK9 [Nicotiana 
sylvestris]
Length=725

 Score =   427 bits (1099),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 226/402 (56%), Positives = 283/402 (70%), Gaps = 41/402 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+D  
Sbjct  37    TVYKAFDEYEGIEVAWNQVKLYDFMQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDVS  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKRWCRQILRGLHYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+Y EEY+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAILRKSHAERCVGTPEFMAPEVYAEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T +YPYSECT+PAQIYKKVTSGK P A Y++++ E +RFV +CL   S R SA ELL
Sbjct  217   EMVTFDYPYSECTHPAQIYKKVTSGKKPDALYKVEDPEVRRFVEKCLATVSHRLSARELL  276

Query  722   LDPFLAAD------------EEEDESAKLPSQKLIP---------NGKL-----------  805
              DPFL  D            +E DE      Q+L+          NG L           
Sbjct  277   DDPFLQIDDYVSDSETLNYLQESDELDPTLGQRLLSICDTNNSLVNGYLGYEPETDSYYQ  336

Query  806   -LEVEPCFV-------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDI  961
              LE E   +       D   ++ D++I G    EDD IFLR++I+DK+G+ RNI+FPFD+
Sbjct  337   QLEYEANEIDLFTDPEDDDMENVDISIKGRRR-EDDGIFLRLRIADKEGRVRNIYFPFDV  395

Query  962   TSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
              +DTA+ VATEMV EL+ITD     IA+MID EI++LVP W+
Sbjct  396   ENDTALSVATEMVAELDITDQDVTKIADMIDGEIASLVPEWK  437



>ref|XP_004299123.1| PREDICTED: serine/threonine-protein kinase WNK1-like [Fragaria 
vesca subsp. vesca]
Length=734

 Score =   427 bits (1098),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 230/404 (57%), Positives = 281/404 (70%), Gaps = 43/404 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL    R+PE+L+RLY E+ LLK L+H  IM+F  SW+DT 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLYEFLRNPEDLERLYREIHLLKTLNHKHIMKFCTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++ +VNIRA+K+W RQILEGL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKSVNIRAVKHWCRQILEGLNYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAVLRKSHADRCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSEC++PAQIYKKV +GK P A Y++ + E  RFV +CL  AS R SA ELL
Sbjct  217   EMVTFEYPYSECSHPAQIYKKVINGKKPEALYKVKDPEVSRFVDKCLASASHRLSAKELL  276

Query  722   LDPFLAADE---------------------EEDESAKLPSQKLIPNG--KLLEVEP----  820
              DPFL  D+                      +  S    S   + NG    L  EP    
Sbjct  277   RDPFLQIDDYGYDLRPIDYHRDLYEVGPLIRQPYSGVDHSNSSLSNGYANYLGYEPENDM  336

Query  821   -------------CFV--DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPF  955
                           F   D+ +   D+TI G    EDD IFLR++I+DK+G+ RNI+FPF
Sbjct  337   DYHPDDYRMSEIDLFTQEDEHSGDIDLTIKGRRR-EDDGIFLRLRIADKEGRIRNIYFPF  395

Query  956   DITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             DI +DTA+ VATEMV EL+ITD   + IAEMID EI+ALVP W+
Sbjct  396   DIENDTALSVATEMVAELDITDQDVIKIAEMIDGEIAALVPEWK  439



>emb|CBI26245.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   421 bits (1081),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 218/380 (57%), Positives = 282/380 (74%), Gaps = 19/380 (5%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KLN+  +SPEEL+RLY E+ LLK L H++IM+F+ SW+D  
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLNDFLQSPEELERLYCEIHLLKTLKHNNIMKFYTSWVDPA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLH+H PPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHRRVNIRAVKHWCRQILRGLLYLHNHKPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  157   NIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A Y++ + E ++FV +CL   + R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPDALYKVKDPEVRQFVEKCLATVTLRLSARELL  276

Query  722   LDPFLAADEEEDESAKLPSQK---------LIPNGKLLEVE------PCFV---DQQAKS  847
              DPFL +D+   +   +  Q+          +P+  +  +E        F    D+  ++
Sbjct  277   KDPFLQSDDYGSDLRPIEYQRDLGEVGPLPRLPHYGIHHIEFERNEIDLFTYQEDEHLEN  336

Query  848   SDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWM  1027
              D++I G    +D  IFLR++ISDK+G+ RNI+FPFD+ +DTA+ VA EMV EL+ITD  
Sbjct  337   VDISIEGR-KRDDHGIFLRLRISDKEGRVRNIYFPFDMETDTALSVAMEMVSELDITDQD  395

Query  1028  PLDIAEMIDEEISALVPTWR  1087
                IA+MID+EI++LVP W+
Sbjct  396   VTKIADMIDDEIASLVPGWK  415



>emb|CDY72128.1| BnaCnng76130D, partial [Brassica napus]
Length=418

 Score =   416 bits (1068),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 211/364 (58%), Positives = 272/364 (75%), Gaps = 7/364 (2%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYR FDE  G+EVAWNQ+KL +  +SP+EL+RLY E+ LLK L H SIM+F+ SW+DT 
Sbjct  38    TVYRGFDEYEGIEVAWNQVKLYDFLQSPQELERLYCEIHLLKTLKHKSIMKFYTSWVDTK  97

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NFITE+FTSG LR+YR ++  VNIRA+K+W RQIL GL YLH+HDPPVIHRDLKCD
Sbjct  98    NRNINFITEMFTSGNLRQYRLKHKRVNIRAVKHWCRQILRGLHYLHTHDPPVIHRDLKCD  157

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+L+ SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMCVL
Sbjct  158   NIFVNGNQGEVKIGDLGLAAILQNSHAARCVGTPEFMAPEVYEEEYNELVDIYSFGMCVL  217

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T +YPYSECT+PAQIYK+V SGK P +  ++ + E + F+ +CL  AS R SA ELL
Sbjct  218   EMVTFDYPYSECTHPAQIYKRVISGKKPDSLDKVKDHEVRGFIEKCLASASLRLSARELL  277

Query  722   LDPFLAADEEEDESAK-LPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
              D FL +DE E ++ +         NG  +       + +  +  ++ITG      D +F
Sbjct  278   NDHFLCSDESESKTKENYFDHTHYSNGYYIH------NNKFDNVHISITGKRRDNGDGLF  331

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             LR++I+DK+G  RNI+FPFD+ +DTA+ VA EMV+ELE+ D    +IA+MID EI++L+P
Sbjct  332   LRLRIADKEGLVRNIYFPFDMETDTAISVAREMVEELEMDDCDVTNIADMIDGEIASLIP  391

Query  1079  TWRS  1090
              WRS
Sbjct  392   GWRS  395



>ref|XP_008224319.1| PREDICTED: probable serine/threonine-protein kinase WNK9 [Prunus 
mume]
Length=738

 Score =   426 bits (1095),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 229/408 (56%), Positives = 285/408 (70%), Gaps = 44/408 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  R+PE+L+RLY E+ LLK L H +IM+F++SW+DT 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLYDFLRNPEDLERLYREIHLLKTLKHDNIMKFYSSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL+GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRHINFVTEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILKGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAVLRKSHADRCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A Y++ + E +RFV +CL   S+R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPEALYKVKDPEVRRFVEKCLVAVSRRLSASELL  276

Query  722   LDPFLAADE---------------EEDESAKLPSQKL------IPNG-------------  799
              DPFL  D+               E     + P  +L      + NG             
Sbjct  277   KDPFLWVDDYGYDLRPVEYPRDMYEIGPLLRQPYSELHHSNSSLSNGYGHCLGYETENEL  336

Query  800   -------KLLEVE--PCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFP  952
                    +L E++   C  D+     D+TI G    EDD IFLR++I+DK+G+ RNI+FP
Sbjct  337   DYHPVDYRLSEIDLFACQEDEHLGDLDLTIKGRRR-EDDGIFLRLRIADKEGRIRNIYFP  395

Query  953   FDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRSTQ  1096
             FD  +DTA+ VA EMV EL+ITD     IAEMID EI+ LVP W+S Q
Sbjct  396   FDTETDTALSVAREMVAELDITDQDVTKIAEMIDGEIATLVPGWKSGQ  443



>ref|XP_009595956.1| PREDICTED: probable serine/threonine-protein kinase WNK9 [Nicotiana 
tomentosiformis]
Length=725

 Score =   425 bits (1093),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 229/415 (55%), Positives = 288/415 (69%), Gaps = 42/415 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+D  
Sbjct  37    TVYKAFDEYEGIEVAWNQVKLYDFMQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDVS  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKRWCRQILRGLHYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+Y EEY+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAILRKSHAERCVGTPEFMAPEVYAEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T +YPYSECT+PAQIYKKVTSGK P A Y++++ E +RFV +CL   S R SA ELL
Sbjct  217   EMVTFDYPYSECTHPAQIYKKVTSGKKPDALYKVEDPEVRRFVEKCLATVSHRLSARELL  276

Query  722   LDPFLAAD------------EEEDESAKLPSQKLIP---------NGKL-----------  805
              DPFL  D            +E DE      Q+L           NG L           
Sbjct  277   DDPFLQIDDCVSDSETLNYLQESDELDPTLGQRLFSICDPNNSPVNGYLGYEPESDSYYH  336

Query  806   -LEVEPCFVD-------QQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDI  961
              LE E   +D          ++ D++I G    EDD IFLR++I+DK+G+ RNI+FPFD+
Sbjct  337   QLEYEANEIDLFTDPEEDDMENVDISIKGRRR-EDDGIFLRLRIADKEGRVRNIYFPFDV  395

Query  962   TSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRSTQYQKQHSFNYI  1126
              +DTA+ VATEMV EL+ITD     IA+MID EI++LVP W +  +  + S NY+
Sbjct  396   ENDTALSVATEMVAELDITDQDVTKIADMIDGEIASLVPEW-TKGFGIEESPNYM  449



>ref|XP_010256027.1| PREDICTED: serine/threonine-protein kinase WNK1-like [Nelumbo 
nucifera]
Length=739

 Score =   425 bits (1093),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 229/405 (57%), Positives = 283/405 (70%), Gaps = 44/405 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +R  NF+TELFTSGTLR+YRQ++  VNIRAIK+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    KRNINFVTELFTSGTLRQYRQKHRRVNIRAIKHWCRQILRGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G++KIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEIKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECTNPAQIYKKV SGK P A Y++ + E ++FV +CL   S+R  A ELL
Sbjct  217   EMVTFEYPYSECTNPAQIYKKVISGKKPDALYKVKDPEVRQFVEKCLATVSRRLPARELL  276

Query  722   LDPFLAADE------------EEDESAKLPSQKLI---------------------PNGK  802
              DPFL  D+            E D+   L  Q L                       NG 
Sbjct  277   KDPFLQIDDCGSDVRPIECSREIDDVGPLLRQPLFQLHHSNNSWINGYSHEPNYETENGW  336

Query  803   LL---EVEPCFV-------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFP  952
             +    E+E   +       D+     D+TI G    ED +IFLR++I+DK+G+ RNI+FP
Sbjct  337   VYHPDEIEHSGIELFTYQEDEHYTDVDITIKGK-RKEDGSIFLRLRIADKEGRIRNIYFP  395

Query  953   FDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             F I +DTA+ VATEMV EL+ITD     IA+MID EI++LVP WR
Sbjct  396   FHIETDTALSVATEMVAELDITDQDVTKIADMIDGEIASLVPEWR  440



>ref|XP_007225229.1| hypothetical protein PRUPE_ppa001963mg [Prunus persica]
 gb|EMJ26428.1| hypothetical protein PRUPE_ppa001963mg [Prunus persica]
Length=735

 Score =   425 bits (1093),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 228/406 (56%), Positives = 283/406 (70%), Gaps = 44/406 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  R+PE+L+RLY E+ LLK L H++IM+F++SW+DT 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLYDFLRNPEDLERLYREIHLLKTLKHNNIMKFYSSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+F SGTLR+YR ++  VNIRA+K+W RQIL+GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRHINFVTEMFISGTLRQYRLKHKRVNIRAVKHWCRQILKGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAVLRKSHADRCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A Y++ + E +RFV +CL   S+R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPEALYKVKDPEVRRFVEKCLVAVSRRLSARELL  276

Query  722   LDPFLAADE----------EEDESAKLP-----------SQKLIPNG-------------  799
              DPFL  D+            D S   P           S   + NG             
Sbjct  277   KDPFLRVDDYGYDLRSIEYPRDMSEIGPLLRQPYSELHHSNSSLSNGYGHCLGYETENDL  336

Query  800   -------KLLEVE--PCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFP  952
                    +L E++   C  D+     D+TI G    EDD IFLR++I+DK+G+ RNI+FP
Sbjct  337   DYHSVDYRLSEIDLFACQEDEHLGDLDLTIKGRRR-EDDGIFLRLRIADKEGRIRNIYFP  395

Query  953   FDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRS  1090
             FD  +DTA+ VA EMV EL+ITD     IAEMID EI+ LVP W+S
Sbjct  396   FDTETDTALSVAREMVAELDITDQDVTKIAEMIDGEIATLVPGWKS  441



>ref|XP_011071578.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase WNK9 [Sesamum indicum]
Length=689

 Score =   423 bits (1088),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 226/406 (56%), Positives = 286/406 (70%), Gaps = 45/406 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L+H +IM+F  SW+DT 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLNHRNIMKFCTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRAIK+W RQIL+GL YLHSHDPP+IHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKKVNIRAIKHWCRQILQGLLYLHSHDPPIIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAILRKSHAARCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SG  P A Y++ + E + FV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGXKPDALYKVKDPEVRLFVEKCLATVSDRLSAWELL  276

Query  722   LDPFLAADE------------EEDESAKLPSQKLIP----------NG------------  799
              DPFL  D+            + DE   + +Q+L+           NG            
Sbjct  277   NDPFLQIDDYVYDLRPFSYHRDYDEIGPILTQRLLSAHHSTTSSLVNGYSNFLGYEQEKD  336

Query  800   ---KLLEVEPCFVD-------QQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFF  949
                + +E E   +D       +Q++  D+TI G +  ED  IFL+++I+DK+G+ RNI+F
Sbjct  337   LDCRSVEYEANEIDLFMSQDKEQSEHFDVTIKGRMR-EDGNIFLKLRIADKEGRVRNIYF  395

Query  950   PFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             PFDI +DTA+ VATEMV EL+I D     IAEMID EI++LVP WR
Sbjct  396   PFDIETDTALSVATEMVAELDIMDQDVTKIAEMIDTEIASLVPDWR  441



>ref|XP_010277340.1| PREDICTED: probable serine/threonine-protein kinase WNK9 [Nelumbo 
nucifera]
Length=742

 Score =   424 bits (1091),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 227/403 (56%), Positives = 283/403 (70%), Gaps = 42/403 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +R  NFITELFTSGTLR+YR ++  VNIRA+K+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    KRNINFITELFTSGTLRQYRHKHKRVNIRAVKHWCRQILRGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMCVL
Sbjct  157   NIFINGNQGEVKIGDLGLAAILRKSHAARCVGTPEFMAPEVYEEEYNELVDIYSFGMCVL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P   Y++ + E ++FV +CL   S+R  A ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPDVLYKVKDLEVRQFVEKCLATVSRRLPARELL  276

Query  722   LDPFLAADEEE----------DESAKLPSQKLIP------------------------NG  799
              DPFL  D+ E          D+   L  Q L                          + 
Sbjct  277   KDPFLQIDDCESDLRPLECSRDDVGPLLRQPLFDLHNSNNSWINDYSYDISYVSENEWSY  336

Query  800   KLLEVEPCFV-------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFD  958
              L E+E   +       D+Q+ + D+TI G    ED +IFLR++I+DK+G+ RNI+FPF 
Sbjct  337   HLEEIEHGGIELFTYQEDEQSANVDITIKGK-KREDGSIFLRLRIADKEGRIRNIYFPFH  395

Query  959   ITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             I +DTA+ VATEMV EL+ITD     IA+MID EI++LVP W+
Sbjct  396   IETDTALSVATEMVAELDITDQDVTKIADMIDGEIASLVPEWK  438



>emb|CDY72029.1| BnaAnng39660D, partial [Brassica napus]
Length=434

 Score =   414 bits (1063),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 212/364 (58%), Positives = 270/364 (74%), Gaps = 9/364 (2%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYR FDE  G+EVAWNQ+KL +   SP+EL+RLY E+ LLK L H SIM+F+ SW+DT 
Sbjct  20    TVYRGFDEYEGIEVAWNQVKLYDFLHSPQELERLYCEIHLLKTLKHKSIMKFYTSWVDTK  79

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NFITE+FTSG LR+YR ++  VNIRA+K+W RQIL GL YLH+HDPPVIHRDLKCD
Sbjct  80    NRNINFITEMFTSGNLRQYRLKHKRVNIRAVKHWCRQILRGLHYLHTHDPPVIHRDLKCD  139

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+L+ SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMCVL
Sbjct  140   NIFVNGNQGEVKIGDLGLAAILQNSHAAHCVGTPEFMAPEVYEEEYNELVDIYSFGMCVL  199

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T +YPYSECT+PAQIYK+V SGK P +  ++ + E + F+ +CL  AS R SA ELL
Sbjct  200   EMVTFDYPYSECTHPAQIYKRVISGKKPDSLDKVRDHEVRGFIEKCLASASLRLSARELL  259

Query  722   LDPFLAADEEEDESAK-LPSQKLIPNGKLLEVEPCFVDQQAKSSDMTITGTLNPEDDTIF  898
              D FL  DE E ++ +         N K         D++  +  ++ITG      D +F
Sbjct  260   NDHFLCNDESECKTKENYFDHTHCSNEKY--------DKKFDNVHISITGKRRDNGDGLF  311

Query  899   LRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVP  1078
             LR++I+DK+G  RNI+FPFD+ +DTA+ VA EMV+ELE+ D    +IA+MID EI++L+P
Sbjct  312   LRLRIADKEGLVRNIYFPFDMETDTAISVAREMVEELEMDDCDVTNIADMIDGEIASLIP  371

Query  1079  TWRS  1090
              WRS
Sbjct  372   GWRS  375



>ref|XP_003626403.1| With no lysine kinase [Medicago truncatula]
 gb|AES82621.1| WNK kinase [Medicago truncatula]
Length=712

 Score =   423 bits (1087),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 228/401 (57%), Positives = 280/401 (70%), Gaps = 40/401 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQIKL +  ++PE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  23    TVYRAFDEYQGIEVAWNQIKLYDFLQNPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTA  82

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TELFTSGTLR+YR ++  VNIRA+K+W RQIL+GL YLHSHDPPVIHRDLKCD
Sbjct  83    NRNINFVTELFTSGTLRQYRLKHKRVNIRAVKHWCRQILQGLHYLHSHDPPVIHRDLKCD  142

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMCVL
Sbjct  143   NIFINGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEEYNELVDIYSFGMCVL  202

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSEC++PAQIYKKV+SGK P A Y++ + E + FV +CL  AS R SA ELL
Sbjct  203   EMVTFEYPYSECSHPAQIYKKVSSGKKPDALYKVKDPEVREFVEKCLATASLRLSARELL  262

Query  722   LDPFLAADEEE-----------DESAKLPSQKLI-------------PNGKLLEVE----  817
              DPFL  D++E            +   L SQ                 NG   EV+    
Sbjct  263   DDPFLRIDDDEYDLGSVDVGEFGDLGPLVSQSFFSIDRSYSNISTEYSNGFGYEVDWYSQ  322

Query  818   -----------PCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDIT  964
                         C  D+ +K  D++I G    +D  IFLR++I+DK+   RNI+FPFDI 
Sbjct  323   PTEIEHGIELFECHDDEPSKDVDISIKGK-RKDDGGIFLRLRIADKEDHIRNIYFPFDIE  381

Query  965   SDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
              DTA+ VATEMV EL+ITD     IA MID EI++LVP WR
Sbjct  382   LDTALSVATEMVAELDITDQDVTSIAHMIDGEIASLVPEWR  422



>ref|XP_003626402.1| With no lysine kinase [Medicago truncatula]
 gb|AES82620.1| WNK kinase [Medicago truncatula]
Length=726

 Score =   423 bits (1088),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 228/401 (57%), Positives = 280/401 (70%), Gaps = 40/401 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQIKL +  ++PE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYQGIEVAWNQIKLYDFLQNPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TELFTSGTLR+YR ++  VNIRA+K+W RQIL+GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTELFTSGTLRQYRLKHKRVNIRAVKHWCRQILQGLHYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMCVL
Sbjct  157   NIFINGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEEYNELVDIYSFGMCVL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSEC++PAQIYKKV+SGK P A Y++ + E + FV +CL  AS R SA ELL
Sbjct  217   EMVTFEYPYSECSHPAQIYKKVSSGKKPDALYKVKDPEVREFVEKCLATASLRLSARELL  276

Query  722   LDPFLAADEEE-----------DESAKLPSQKLI-------------PNGKLLEVE----  817
              DPFL  D++E            +   L SQ                 NG   EV+    
Sbjct  277   DDPFLRIDDDEYDLGSVDVGEFGDLGPLVSQSFFSIDRSYSNISTEYSNGFGYEVDWYSQ  336

Query  818   -----------PCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDIT  964
                         C  D+ +K  D++I G    +D  IFLR++I+DK+   RNI+FPFDI 
Sbjct  337   PTEIEHGIELFECHDDEPSKDVDISIKGK-RKDDGGIFLRLRIADKEDHIRNIYFPFDIE  395

Query  965   SDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
              DTA+ VATEMV EL+ITD     IA MID EI++LVP WR
Sbjct  396   LDTALSVATEMVAELDITDQDVTSIAHMIDGEIASLVPEWR  436



>ref|XP_007147148.1| hypothetical protein PHAVU_006G099700g [Phaseolus vulgaris]
 gb|ESW19142.1| hypothetical protein PHAVU_006G099700g [Phaseolus vulgaris]
Length=736

 Score =   424 bits (1089),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 222/402 (55%), Positives = 278/402 (69%), Gaps = 41/402 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYQGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YRQ++  VNIRA+K+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRQKHKRVNIRAVKHWCRQILRGLHYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMCVL
Sbjct  157   NIFINGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEESYNELVDIYSFGMCVL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSEC++PAQIYKKV SGK P A Y++ + E ++FV +C+   S R SA ELL
Sbjct  217   EMVTFEYPYSECSHPAQIYKKVISGKKPEALYKVKDPEVRQFVEKCVATVSLRLSARELL  276

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKLL-------------------------------  808
              DPFL  D+ E +   + S      G L+                               
Sbjct  277   DDPFLQIDDYEYDLGSVESGAFDGLGPLIHQPFLNLHRSYSNMSTEYSNCFEYEGDWISH  336

Query  809   --EVEP-------CFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDI  961
               E+EP       C  D+  +   ++I G    +D  IFLR++I+DK+G  RNI+FPFDI
Sbjct  337   PAEIEPNGIELFKCHDDEACEDVGISIKGK-KKDDGGIFLRLRIADKEGHIRNIYFPFDI  395

Query  962   TSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
               DTA+ VATEMV EL+ITD     IA+MID EI++LVP W+
Sbjct  396   EMDTALSVATEMVAELDITDQDVTSIADMIDGEIASLVPEWK  437



>gb|AHL77723.1| mitogen activated kinase kinase kinase ZIK9 [Brassica napus]
 emb|CDX86190.1| BnaA06g29070D [Brassica napus]
Length=475

 Score =   415 bits (1066),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 216/379 (57%), Positives = 273/379 (72%), Gaps = 16/379 (4%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYR FDE  G+EVAWNQ+KL +  +SP+EL+RLY E+ LLK L H SIM+F+ SW+DTD
Sbjct  38    TVYRGFDEYEGIEVAWNQVKLYDFLQSPQELERLYCEIHLLKTLKHKSIMKFYTSWVDTD  97

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NFITE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLH+HDPPVIHRDLKCD
Sbjct  98    NRNINFITEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILRGLDYLHTHDPPVIHRDLKCD  157

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAAML+ SHA   +GTPEFMAPE+Y EEY+ELVDIYSFGMCVL
Sbjct  158   NIFVNGNQGEVKIGDLGLAAMLQHSHAAHCVGTPEFMAPEVYAEEYNELVDIYSFGMCVL  217

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T +YPYSECT+PAQIYK+V SGK P +  ++ ++E + F+ +CL  AS R SA ELL
Sbjct  218   EMVTFDYPYSECTHPAQIYKRVISGKKPDSLDKVKDSEVRGFIEKCLASASLRLSARELL  277

Query  722   LDPFLAADEEEDESAKLPSQKLIPNG---------KLLEVEPCFVDQQAKSSD-------  853
              D FL  D   +  +     +   NG         ++ E +     ++A+  D       
Sbjct  278   DDQFLCIDYPSNYYSDNDQSQWTYNGDEMIESHGIEIFEFQNEDDHEEAEEYDNKFDNVH  337

Query  854   MTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPL  1033
             ++I G      D +FLR++I+DK+G  RNI+FPFDI SDTA+ VA EMV+ELE+ D    
Sbjct  338   ISIKGKRRDNGDGLFLRLRIADKEGLVRNIYFPFDIESDTAISVAREMVEELEMDDRDVT  397

Query  1034  DIAEMIDEEISALVPTWRS  1090
              IA MID EI++LVP WRS
Sbjct  398   KIANMIDGEIASLVPRWRS  416



>ref|XP_007144811.1| hypothetical protein PHAVU_007G185900g [Phaseolus vulgaris]
 gb|ESW16805.1| hypothetical protein PHAVU_007G185900g [Phaseolus vulgaris]
Length=734

 Score =   423 bits (1088),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 225/401 (56%), Positives = 282/401 (70%), Gaps = 40/401 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYQGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILSGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMC+L
Sbjct  157   NIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A YR+ + E ++FV +CL  AS R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVVSGKKPDALYRVKDPEVRQFVEKCLATASLRLSARELL  276

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKLL-------------------------------  808
              D FL  D+ E +   + + +L   G L+                               
Sbjct  277   DDSFLRIDDYEYDMRTVENGELDEFGPLMRQPFFDLHRSYSNFSNEYSNGFGYEGDWCPH  336

Query  809   --EVEPC------FVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDIT  964
               E+EP       + D+ ++  D++I G    +D  IFLR++I+DK+G+ RNI+FPFDI 
Sbjct  337   PAEIEPSGIELFEYHDEPSEDVDISIKGK-RKDDGGIFLRLRIADKEGRIRNIYFPFDIE  395

Query  965   SDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
              DTA+ VATEMV EL+ITD     IA+MID EI++LVP WR
Sbjct  396   MDTAISVATEMVAELDITDQDVTRIADMIDGEIASLVPEWR  436



>ref|XP_003633655.1| PREDICTED: serine/threonine-protein kinase WNK1 [Vitis vinifera]
 ref|XP_010659928.1| PREDICTED: serine/threonine-protein kinase WNK1 [Vitis vinifera]
Length=743

 Score =   423 bits (1088),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 228/405 (56%), Positives = 283/405 (70%), Gaps = 44/405 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK + H++IM+F+ SW+DT 
Sbjct  38    TVYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTMKHNNIMKFYTSWVDTA  97

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YRQ++  VNIRA+K+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  98    NRNINFVTEMFTSGTLRQYRQKHKRVNIRAVKHWCRQILRGLLYLHSHDPPVIHRDLKCD  157

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  158   NIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  217

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A Y++ + E + FV +CL   S R SA ELL
Sbjct  218   EMVTFEYPYSECTHPAQIYKKVISGKKPDALYKVKDPEVREFVEKCLASVSLRLSARELL  277

Query  722   LDPFLAADE------------EEDESAKLPSQKLI---------PNG-------------  799
              DPFL  D+            E D+   L  Q  +          NG             
Sbjct  278   QDPFLRIDDCESDLRPIECRREPDDMVPLLRQPFLEYHHSNNSFSNGYSNAVDFDAHNGW  337

Query  800   --KLLEVEPCFV-------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFP  952
               + LE+EP  +       D+   + D++I G    EDD IFLR++I+DK+   RNI+FP
Sbjct  338   GYQPLEMEPTGIELFEYHEDEHPANVDISIKGKRR-EDDGIFLRLRIADKEDHIRNIYFP  396

Query  953   FDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             FDI  DTA+ VATEMV EL+ITD     IA+MID EI++LVP W+
Sbjct  397   FDIEMDTALSVATEMVAELDITDQDVTKIADMIDGEIASLVPEWK  441



>ref|XP_009151241.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase WNK9 [Brassica rapa]
Length=483

 Score =   415 bits (1066),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 216/379 (57%), Positives = 273/379 (72%), Gaps = 16/379 (4%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYR FDE  G+EVAWNQ+KL +  +SP+EL+RLY E+ LLK L H SIM+F+ SW+DTD
Sbjct  42    TVYRGFDEYEGIEVAWNQVKLYDFLQSPQELERLYCEIHLLKTLKHKSIMKFYTSWVDTD  101

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NFITE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLH+HDPPVIHRDLKCD
Sbjct  102   NRNINFITEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILRGLDYLHTHDPPVIHRDLKCD  161

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAAML+ SHA   +GTPEFMAPE+Y EEY+ELVDIYSFGMCVL
Sbjct  162   NIFVNGNQGEVKIGDLGLAAMLQHSHAAHCVGTPEFMAPEVYAEEYNELVDIYSFGMCVL  221

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T +YPYSECT+PAQIYK+V SGK P +  ++ ++E + F+ +CL  AS R SA ELL
Sbjct  222   EMVTFDYPYSECTHPAQIYKRVISGKKPDSLDKVKDSEVRGFIEKCLASASLRLSARELL  281

Query  722   LDPFLAADEEEDESAKLPSQKLIPNG---------KLLEVEPCFVDQQAKSSD-------  853
              D FL  D   +  +     +   NG         ++ E +     ++A+  D       
Sbjct  282   DDQFLCIDYPSNYYSDNDQSQWTYNGDEMIESHGIEIFEFQNEDDHEEAEEYDNKFDNVH  341

Query  854   MTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPL  1033
             ++I G      D +FLR++I+DK+G  RNI+FPFDI SDTA+ VA EMV+ELE+ D    
Sbjct  342   ISIKGKRRDNGDGLFLRLRIADKEGLVRNIYFPFDIESDTAISVAREMVEELEMDDRDVT  401

Query  1034  DIAEMIDEEISALVPTWRS  1090
              IA MID EI++LVP WRS
Sbjct  402   KIANMIDGEIASLVPDWRS  420



>ref|XP_010025060.1| PREDICTED: probable serine/threonine-protein kinase WNK9 [Eucalyptus 
grandis]
 gb|KCW61654.1| hypothetical protein EUGRSUZ_H04385 [Eucalyptus grandis]
Length=741

 Score =   423 bits (1088),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 226/403 (56%), Positives = 279/403 (69%), Gaps = 42/403 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYKGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL+GL YLH+HDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHRRVNIRAVKHWCRQILKGLLYLHNHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMCVL
Sbjct  157   NIFVNGNQGEVKIGDLGLAAILRKSHADHCVGTPEFMAPEIYEEAYNELVDIYSFGMCVL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A Y++ + E ++FV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPDALYKVKDPEVRQFVEKCLATVSLRLSARELL  276

Query  722   LDPFLAADEEE------------DESAKLPSQKLIP-------NGKL-------------  805
              DPFL  +E E            DE   +  +  +P       NG               
Sbjct  277   DDPFLRINERESDLRSLDYGREVDEMGPMLREPYLPCSDGSYGNGYCNGYGYTPANQWGY  336

Query  806   ---------LEVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFD  958
                      +E+  C  D    + D++I G    ED +IFLR++I+DKDG  RNI+FPFD
Sbjct  337   HPAELESSGMELFECHDDDHPANVDISIKGK-RKEDGSIFLRLRIADKDGPIRNIYFPFD  395

Query  959   ITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             I  DTA+ VATEMV EL++ D     IA+MID EIS+LVP WR
Sbjct  396   IEIDTALSVATEMVAELDLNDQDVTRIADMIDGEISSLVPEWR  438



>ref|NP_001235958.1| with no lysine kinase 1 [Glycine max]
 gb|ACN87277.1| with no lysine kinase [Glycine max]
Length=698

 Score =   422 bits (1084),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 224/403 (56%), Positives = 282/403 (70%), Gaps = 42/403 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYQGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILSGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMC+L
Sbjct  157   NIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A YR+ + E ++FV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPDALYRVKDPEVRQFVEKCLVTVSLRLSARELL  276

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKLL-------------------------------  808
              DPFL  D+ E +   + + +L   G L+                               
Sbjct  277   NDPFLQIDDYEYDLKTVENGELDEFGSLMRQPFFDLHRSYSNFSNEYSNGFGYEGDWGPH  336

Query  809   --EVEPCFV--------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFD  958
               E+EP  +        D+ ++  D++I G    +D  IFLR++I+DK+G+ RNI+FPFD
Sbjct  337   PAEIEPSGIELFEYHDDDEPSEDVDISIKGK-RKDDGGIFLRLRIADKEGRIRNIYFPFD  395

Query  959   ITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             I  DTA+ VATEMV EL++TD     IA+MID EI++LVP WR
Sbjct  396   IELDTAISVATEMVAELDMTDQDVTRIADMIDGEIASLVPEWR  438



>gb|KHN16182.1| Serine/threonine-protein kinase WNK1 [Glycine soja]
Length=738

 Score =   422 bits (1085),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 224/403 (56%), Positives = 282/403 (70%), Gaps = 42/403 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYQGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILSGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMC+L
Sbjct  157   NIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A YR+ + E ++FV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPDALYRVKDPEVRQFVEKCLATVSLRLSARELL  276

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKLL-------------------------------  808
              DPFL  D+ E +   + + +L   G L+                               
Sbjct  277   DDPFLQIDDYEYDLRTVDNGELDEFGPLMRQPFFDLHRSYSNFSNEYTNGFGYEGDWGPH  336

Query  809   --EVEPCFV--------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFD  958
               E+EP  +        D+ ++  D++I G    +D  IFLR++I+DK+G+ RNI+FPFD
Sbjct  337   PAEIEPSGIELFEYRDDDEPSEDVDISIKGK-RKDDGGIFLRLRIADKEGRIRNIYFPFD  395

Query  959   ITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             I  DTA+ VATEMV EL++TD     IA+MID EI++LVP WR
Sbjct  396   IEMDTAISVATEMVAELDMTDQDVTRIADMIDGEIASLVPEWR  438



>ref|XP_004494680.1| PREDICTED: serine/threonine-protein kinase WNK1-like isoform 
X2 [Cicer arietinum]
Length=774

 Score =   423 bits (1088),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 231/401 (58%), Positives = 281/401 (70%), Gaps = 41/401 (10%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT  
Sbjct  38    VYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTAN  97

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             R  NF+TELFTSGTLR+YR ++  VNIRA+K+W RQILEGL YLHSHDPPVIHRDLKCDN
Sbjct  98    RNINFVTELFTSGTLRQYRLKHKRVNIRAVKHWCRQILEGLLYLHSHDPPVIHRDLKCDN  157

Query  365   IFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLE  544
             IF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMCVLE
Sbjct  158   IFINGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEEYNELVDIYSFGMCVLE  217

Query  545   MLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLL  724
             M+T EYPYSEC++PAQIYKKV+SGK P A Y++   E + FV +CL  AS R SA ELL 
Sbjct  218   MVTFEYPYSECSHPAQIYKKVSSGKKPDALYKVKEPEVREFVDKCLATASLRLSARELLD  277

Query  725   DPFLAADEEE-----------DESAKLPSQKLIP-------------NGKLLEVE----P  820
             DPFL  D+ E           D+ + L SQ                 NG   EV+    P
Sbjct  278   DPFLRIDDYEYDLGPTDVGEFDDLSPLFSQSFFALDRSYSNISTEYSNGFGCEVDWYSLP  337

Query  821   CFV------------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDIT  964
               V            D+ +K  D++I G    +D  IFLR++I+DK+G  RNI+FPFDI 
Sbjct  338   AEVEHSGIELFESHDDEHSKDVDISIKGK-RKDDGGIFLRLRIADKEGHIRNIYFPFDIE  396

Query  965   SDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
              DTA+ VATEMV EL+ITD     IA MID EI++LVP WR
Sbjct  397   MDTALSVATEMVAELDITDQDVTRIAGMIDGEIASLVPEWR  437



>gb|KHN14724.1| Serine/threonine-protein kinase WNK1 [Glycine soja]
Length=738

 Score =   422 bits (1085),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 224/403 (56%), Positives = 282/403 (70%), Gaps = 42/403 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYQGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILSGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMC+L
Sbjct  157   NIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A YR+ + E ++FV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPDALYRVKDPEVRQFVEKCLVTVSLRLSARELL  276

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKLL-------------------------------  808
              DPFL  D+ E +   + + +L   G L+                               
Sbjct  277   NDPFLQIDDYEYDLKTVENGELDEFGSLMRQPFFDLHRSYSNFSNEYSNGFGYEGDWGPH  336

Query  809   --EVEPCFV--------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFD  958
               E+EP  +        D+ ++  D++I G    +D  IFLR++I+DK+G+ RNI+FPFD
Sbjct  337   PAEIEPSGIELFEYHDDDEPSEDVDISIKGK-RKDDGGIFLRLRIADKEGRIRNIYFPFD  395

Query  959   ITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             I  DTA+ VATEMV EL++TD     IA+MID EI++LVP WR
Sbjct  396   IELDTAISVATEMVAELDMTDQDVTRIADMIDGEIASLVPEWR  438



>ref|XP_006489378.1| PREDICTED: serine/threonine-protein kinase WNK1-like [Citrus 
sinensis]
Length=740

 Score =   422 bits (1085),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 226/407 (56%), Positives = 283/407 (70%), Gaps = 48/407 (12%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPEEL+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  38    TVYRAFDEYEGIEVAWNQVKLYDFLQSPEELERLYCEIHLLKTLKHRNIMKFYTSWVDTA  97

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLHS DPPVIHRDLKCD
Sbjct  98    NRNINFVTEMFTSGTLRQYRLKHRRVNIRAVKHWCRQILSGLLYLHSRDPPVIHRDLKCD  157

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  158   NIFVNGNQGEVKIGDLGLAAILRKSHAARCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  217

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T +YPYSECT+PAQIYKKV SGK P A +++++ E ++F+ +CL   S R SA ELL
Sbjct  218   EMVTFDYPYSECTHPAQIYKKVISGKKPEALFKVEDPEVRQFIEKCLATVSSRLSARELL  277

Query  722   LDPFLAADE------------EEDESAKLPSQKL---------------------IPNGK  802
              DPFL  D+            + DE + L  Q L                       NG 
Sbjct  278   TDPFLQIDDYDSDLRMIQYQTDYDEISPLLRQSLYGIYYSNSSSNNGYGHYIGYDTENG-  336

Query  803   LLEVEP------------CFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIF  946
              L+  P            C  D+   + D++I G    EDD IFLR++I+DK+G+ RNI+
Sbjct  337   -LDYHPHEFQESEIDLFTCQEDEHLTNFDISIKGKRR-EDDGIFLRLRIADKEGRIRNIY  394

Query  947   FPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             FPFDI +DTA+ VATEMV EL+ITD     IAE+ID EI++LVP W+
Sbjct  395   FPFDIQTDTALSVATEMVSELDITDQDVTKIAEIIDSEIASLVPEWK  441



>ref|XP_006605282.1| PREDICTED: with no lysine kinase 1 isoform X1 [Glycine max]
Length=738

 Score =   422 bits (1085),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 224/403 (56%), Positives = 282/403 (70%), Gaps = 42/403 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYQGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILSGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMC+L
Sbjct  157   NIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A YR+ + E ++FV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPDALYRVKDPEVRQFVEKCLVTVSLRLSARELL  276

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKLL-------------------------------  808
              DPFL  D+ E +   + + +L   G L+                               
Sbjct  277   NDPFLQIDDYEYDLKTVENGELDEFGSLMRQPFFDLHRSYSNFSNEYSNGFGYEGDWGPH  336

Query  809   --EVEPCFV--------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFD  958
               E+EP  +        D+ ++  D++I G    +D  IFLR++I+DK+G+ RNI+FPFD
Sbjct  337   PAEIEPSGIELFEYHDDDEPSEDVDISIKGK-RKDDGGIFLRLRIADKEGRIRNIYFPFD  395

Query  959   ITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             I  DTA+ VATEMV EL++TD     IA+MID EI++LVP WR
Sbjct  396   IELDTAISVATEMVAELDMTDQDVTRIADMIDGEIASLVPEWR  438



>ref|XP_009413325.1| PREDICTED: probable serine/threonine-protein kinase WNK9 [Musa 
acuminata subsp. malaccensis]
Length=763

 Score =   423 bits (1087),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 227/404 (56%), Positives = 280/404 (69%), Gaps = 43/404 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLYDFLQSPENLERLYCEIHLLKTLKHKNIMKFYTSWVDTS  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TELFTSGTLR+YRQ++  VNIRA+K+W RQIL  L YLHSHDPPVIHRDLKCD
Sbjct  97    ERNINFVTELFTSGTLRQYRQKHRRVNIRAVKHWCRQILSALLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMCVL
Sbjct  157   NIFINGNQGEVKIGDLGLAAILRKSHAIHCVGTPEFMAPEVYEEEYNELVDIYSFGMCVL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+P QIYKKV SG  P A YR+ + E ++FV +CL  ASKR SA ELL
Sbjct  217   EMVTFEYPYSECTHPVQIYKKVISGTKPEALYRVKDPEVRQFVEKCLATASKRLSARELL  276

Query  722   LDPFLAADEE----EDESAK-------LPSQKLI-PNGKLL-------------------  808
              DPFL  D+     +DE  +        PS +    NG  +                   
Sbjct  277   KDPFLQVDDLCSSFDDEDVRSMGHILWQPSLEYTESNGSFIANEFSDSIHHEMELENDWD  336

Query  809   -----------EVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPF  955
                        ++    +D+Q  + D+TI G    ED  IFLR++ISDKDG  RNI+F F
Sbjct  337   YDATDVEVRGNDLSNSHIDEQPINVDITIKGKRR-EDGNIFLRLRISDKDGCVRNIYFLF  395

Query  956   DITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             DI +DTA+ VATEMV EL+I D+    IA+MID E+++LVP W+
Sbjct  396   DIEADTALSVATEMVAELDIIDYDVTKIADMIDGEVASLVPEWK  439



>ref|XP_008804331.1| PREDICTED: probable serine/threonine-protein kinase WNK1 isoform 
X2 [Phoenix dactylifera]
Length=729

 Score =   422 bits (1084),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 226/404 (56%), Positives = 283/404 (70%), Gaps = 43/404 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  28    TVYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLRHKNIMKFYTSWVDTS  87

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +R  NFITE+FTSGTLR+YRQ++  V+IRA+K+W RQIL GL YLHSHDPP+IHRDLKCD
Sbjct  88    KRNINFITEMFTSGTLRQYRQKHRRVSIRAVKHWCRQILRGLLYLHSHDPPIIHRDLKCD  147

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  148   NIFINGNQGEVKIGDLGLAAILRKSHAVHCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  207

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SG  P A YR+ + E ++FV +CL  AS+R  A ELL
Sbjct  208   EMVTFEYPYSECTHPAQIYKKVISGTKPEALYRVKDPEVRQFVEKCLAAASRRLPARELL  267

Query  722   LDPFLAADEE-----EDE---------------------------SAKLPSQKLIPNG--  799
              DPFL  D+      E E                           S+ L  +  I NG  
Sbjct  268   KDPFLQIDDRGMVYGEGELSDMGRIVRQPSLNLLLSSDSSYTNGFSSSLHRETEIENGWG  327

Query  800   ---KLLEVEPCFV-----DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPF  955
                  +E+    +     D+   + D+TI G    ED  IFLR++I+DKDG+ RN++FPF
Sbjct  328   CHAAGMEIHGMDLFNSQEDEALANVDITIKGRRG-EDGGIFLRLRIADKDGRVRNVYFPF  386

Query  956   DITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             DI +DTA+ VATEMV EL+ITD     IAEMID E+ +LVP W+
Sbjct  387   DIEADTALSVATEMVAELDITDHEVTRIAEMIDGEVVSLVPEWK  430



>ref|XP_002307209.2| hypothetical protein POPTR_0005s05140g [Populus trichocarpa]
 gb|EEE94205.2| hypothetical protein POPTR_0005s05140g [Populus trichocarpa]
Length=726

 Score =   422 bits (1084),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 228/405 (56%), Positives = 281/405 (69%), Gaps = 43/405 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  30    TVYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTA  89

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  90    KRNINFVTEMFTSGTLRQYRLKHRRVNIRAVKHWCRQILRGLLYLHSHDPPVIHRDLKCD  149

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMC+L
Sbjct  150   NIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCIL  209

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A Y++ + E ++FV +CL   S R SA ELL
Sbjct  210   EMVTFEYPYSECTHPAQIYKKVISGKKPDALYKVKDPEVRQFVEKCLATVSLRLSAKELL  269

Query  722   LDPFLAAD---------EEEDESAKLPSQKLIP------------NGKL-----------  805
              DPFL  D         E   E   L     +P            NG L           
Sbjct  270   NDPFLQIDGCGSDLRPSEPGIEVHGLGPMMRLPYLELHDNTNSYSNGYLNGYGYEAQNEW  329

Query  806   ----LEVEPCFV------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPF  955
                 +EVEP  +      D+   + D++I G    +D  IFLR++I+DK+G+ RNI+FPF
Sbjct  330   EYHPVEVEPNGIELFEHHDEHPANVDISIKGKWG-DDGGIFLRIRIADKEGRIRNIYFPF  388

Query  956   DITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRS  1090
             DI +DTA  VATEMV EL+I D     IA+MID EI+ALVP W+S
Sbjct  389   DIETDTASNVATEMVAELDINDQDVTKIADMIDGEIAALVPEWKS  433



>ref|XP_006589178.1| PREDICTED: serine/threonine-protein kinase WNK1-like [Glycine 
max]
Length=738

 Score =   422 bits (1084),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 224/403 (56%), Positives = 282/403 (70%), Gaps = 42/403 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYQGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILSGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMC+L
Sbjct  157   NIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A YR+ + E ++FV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPDALYRVKDPEVRQFVEKCLATVSLRLSARELL  276

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKLL-------------------------------  808
              DPFL  D+ E +   + + +L   G L+                               
Sbjct  277   DDPFLQIDDYEYDLRTVDNGELDEFGPLMRQPFFDLHRSYSNFSNEYTNGFGYEGDWGPH  336

Query  809   --EVEPCFV--------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFD  958
               E+EP  +        D+ ++  D++I G    +D  IFLR++I+DK+G+ RNI+FPFD
Sbjct  337   PAEIEPSGIELFEYRDDDEPSEDVDISIKGK-RKDDGGIFLRLRIADKEGRIRNIYFPFD  395

Query  959   ITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             I  DTA+ VATEMV EL++TD     IA+MID EI++LVP WR
Sbjct  396   IEMDTAISVATEMVAELDMTDQDVTRIADMIDGEIASLVPEWR  438



>ref|XP_002512245.1| kinase, putative [Ricinus communis]
 gb|EEF49697.1| kinase, putative [Ricinus communis]
Length=775

 Score =   423 bits (1087),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 227/405 (56%), Positives = 279/405 (69%), Gaps = 44/405 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  38    TVYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTA  97

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  98    NRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILRGLLYLHSHDPPVIHRDLKCD  157

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVD+YSFGMC+L
Sbjct  158   NIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEAYNELVDVYSFGMCIL  217

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SG+ P A Y++ + E ++FV +CL   S R SA ELL
Sbjct  218   EMVTFEYPYSECTHPAQIYKKVISGRKPDALYKVKDPEVRQFVEKCLATVSLRLSARELL  277

Query  722   LDPFLAAD------------EEEDESAKL-------------PSQKLIPNGKLLEVEPCF  826
              DPFL  D            EE D    L             P      NG   E +  F
Sbjct  278   NDPFLQMDDCESNIKSIDYGEEFDGMGPLIRQPYYEFHDDTYPYSNGYSNGYGYEAQNEF  337

Query  827   V------------------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFP  952
                                D+ + + D++I G    +D  IFLR++I+DKDG+ RNI+FP
Sbjct  338   EYYPVEFEQSGIELFEHHDDEHSPNLDISIKGKRR-DDGGIFLRLRIADKDGRIRNIYFP  396

Query  953   FDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             FDI +DTA+ VATEMV EL+ITD     IAEMIDEEI++LVP WR
Sbjct  397   FDIETDTALTVATEMVAELDITDQDVTKIAEMIDEEIASLVPEWR  441



>ref|XP_006577277.1| PREDICTED: serine/threonine-protein kinase WNK1-like [Glycine 
max]
 gb|KHN31445.1| Serine/threonine-protein kinase WNK1 [Glycine soja]
Length=734

 Score =   422 bits (1084),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 222/401 (55%), Positives = 280/401 (70%), Gaps = 40/401 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYQGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YRQ++  VNIRA+K+W RQIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRQKHKRVNIRAVKHWCRQILRGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMCVL
Sbjct  157   NIFINGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEESYNELVDIYSFGMCVL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSEC++PAQIYKKV SGK P A Y++ + E ++FV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECSHPAQIYKKVISGKKPDALYKVKDPEVRQFVEKCLATVSLRLSARELL  276

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKL--------------------------------  805
              DPFL  D+ E +   + S      G L                                
Sbjct  277   DDPFLQIDDYEYDLGPVDSGAFDDLGPLTHQPFFDLHQSFSNMSTEYSNGFEYGDWYSHP  336

Query  806   LEVEP-------CFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDIT  964
              ++EP       C  ++ ++  D++I G    +D  IFLR++I+DK+G  RNI+FPFDI 
Sbjct  337   ADIEPSGIELFECHDEEASEDVDISIRGK-RKDDGGIFLRLRIADKEGHIRNIYFPFDIG  395

Query  965   SDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             +DTA+ VATEMV EL+ITD     IA+MID EI++LVP W+
Sbjct  396   TDTALSVATEMVAELDITDQDVTSIADMIDGEIASLVPEWK  436



>gb|KDO74608.1| hypothetical protein CISIN_1g004645mg [Citrus sinensis]
Length=740

 Score =   422 bits (1084),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 226/407 (56%), Positives = 283/407 (70%), Gaps = 48/407 (12%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPEEL+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  38    TVYRAFDEYEGIEVAWNQVKLYDFLQSPEELERLYCEIHLLKTLKHRNIMKFYTSWVDTA  97

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLHS DPPVIHRDLKCD
Sbjct  98    NRNINFVTEMFTSGTLRQYRLKHRRVNIRAVKHWCRQILSGLLYLHSRDPPVIHRDLKCD  157

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  158   NIFVNGNQGEVKIGDLGLAAILRKSHAARCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  217

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T +YPYSECT+PAQIYKKV SGK P A +++++ E ++F+ +CL   S R SA ELL
Sbjct  218   EMVTFDYPYSECTHPAQIYKKVISGKKPEALFKVEDPEVRQFIEKCLATVSSRLSARELL  277

Query  722   LDPFLAADE------------EEDESAKLPSQKL---------------------IPNGK  802
              DPFL  D+            + DE + L  Q L                       NG 
Sbjct  278   TDPFLQIDDYDSDLRMIQYQTDYDEISPLLRQSLYGIYHSNSSSNNGCGHYIGYDTENG-  336

Query  803   LLEVEP------------CFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIF  946
              L+  P            C  D+   + D++I G    EDD IFLR++I+DK+G+ RNI+
Sbjct  337   -LDYHPHEFQESEIDLFTCQEDEHLTNFDISIKGKRR-EDDGIFLRLRIADKEGRIRNIY  394

Query  947   FPFDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             FPFDI +DTA+ VATEMV EL+ITD     IAE+ID EI++LVP W+
Sbjct  395   FPFDIQTDTALSVATEMVSELDITDQDVTKIAEIIDSEIASLVPEWK  441



>ref|XP_008390886.1| PREDICTED: probable serine/threonine-protein kinase WNK9 [Malus 
domestica]
Length=737

 Score =   422 bits (1084),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 226/404 (56%), Positives = 280/404 (69%), Gaps = 44/404 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  R+PE+L+RLY E+ LLK L H++IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLYDFLRNPEDLERLYREIHLLKTLKHNNIMKFYTSWVDTT  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL+GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILKGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAVLRKSHADRCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSEC NPAQIYKKV +GK P A +++ + E +RFV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECNNPAQIYKKVITGKKPEALFKVKDPEVRRFVEKCLVTVSXRLSARELL  276

Query  722   LDPFLAADE-------EEDE--------------SAKLPSQKLIPNGK------------  802
              DPFL  D+        ED+              S+   S   + NG             
Sbjct  277   RDPFLQVDDYGYNLRPTEDQRDMYEIGPLLRQPHSSLHQSNSSLSNGHGNYLGYETENDL  336

Query  803   --------LLEVE--PCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFP  952
                     L E++   C  D+     D+TI G    EDD IFLR++I+DK+G+ RNI+FP
Sbjct  337   DYNPIDYGLSEIDLFACQEDEHFGDVDLTIKGRRR-EDDDIFLRLRIADKEGRIRNIYFP  395

Query  953   FDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTW  1084
             FD  +DTA+ VA EMV EL+ITD     IAEMID EI+ LVP W
Sbjct  396   FDTENDTALSVAREMVSELDITDQDVTKIAEMIDGEITTLVPEW  439



>ref|XP_003591018.1| With no lysine kinase [Medicago truncatula]
 gb|AES61269.1| WNK kinase [Medicago truncatula]
Length=742

 Score =   422 bits (1084),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 223/404 (55%), Positives = 283/404 (70%), Gaps = 42/404 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYQGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W  QIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKHWCIQILRGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEESYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A Y++ + E ++FV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPDALYKVKDPEVRQFVDKCLATVSLRLSAKELL  276

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKLL-------------------------------  808
              DPFL  D+ E +   + S +L   G L+                               
Sbjct  277   DDPFLQIDDYEYDLRPVDSGELGDFGPLIRQPLYDLHRSYSNFSNEYSNGFGYEGDCYYH  336

Query  809   --EVEPCFV--------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFD  958
               + EPC +        ++ ++  D++I G    +D +IFLR++ISDK+G+ RNI+FPFD
Sbjct  337   PVDNEPCGIELFEHHDDEEPSEHVDISIKGK-KKDDGSIFLRLRISDKEGRVRNIYFPFD  395

Query  959   ITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRS  1090
             I  DTA+ VATEMV EL+ITD     IA+MID EI++LVP W+S
Sbjct  396   IEMDTAISVATEMVAELDITDQDVTSIADMIDGEIASLVPEWQS  439



>ref|XP_008804330.1| PREDICTED: probable serine/threonine-protein kinase WNK1 isoform 
X1 [Phoenix dactylifera]
Length=738

 Score =   421 bits (1083),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 226/404 (56%), Positives = 283/404 (70%), Gaps = 43/404 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLRHKNIMKFYTSWVDTS  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +R  NFITE+FTSGTLR+YRQ++  V+IRA+K+W RQIL GL YLHSHDPP+IHRDLKCD
Sbjct  97    KRNINFITEMFTSGTLRQYRQKHRRVSIRAVKHWCRQILRGLLYLHSHDPPIIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAILRKSHAVHCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SG  P A YR+ + E ++FV +CL  AS+R  A ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGTKPEALYRVKDPEVRQFVEKCLAAASRRLPARELL  276

Query  722   LDPFLAADEE-----EDE---------------------------SAKLPSQKLIPNG--  799
              DPFL  D+      E E                           S+ L  +  I NG  
Sbjct  277   KDPFLQIDDRGMVYGEGELSDMGRIVRQPSLNLLLSSDSSYTNGFSSSLHRETEIENGWG  336

Query  800   ---KLLEVEPCFV-----DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPF  955
                  +E+    +     D+   + D+TI G    ED  IFLR++I+DKDG+ RN++FPF
Sbjct  337   CHAAGMEIHGMDLFNSQEDEALANVDITIKGRRG-EDGGIFLRLRIADKDGRVRNVYFPF  395

Query  956   DITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             DI +DTA+ VATEMV EL+ITD     IAEMID E+ +LVP W+
Sbjct  396   DIEADTALSVATEMVAELDITDHEVTRIAEMIDGEVVSLVPEWK  439



>ref|XP_008355810.1| PREDICTED: probable serine/threonine-protein kinase WNK9 isoform 
X1 [Malus domestica]
Length=746

 Score =   422 bits (1084),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 228/403 (57%), Positives = 278/403 (69%), Gaps = 42/403 (10%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT  
Sbjct  38    VYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTAN  97

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             R  NF+TE+FTSGTL++YR ++  VNIRA+KNW RQIL GL YLHSHDPPVIHRDLKCDN
Sbjct  98    RNINFVTEMFTSGTLKQYRLKHKRVNIRAVKNWCRQILRGLLYLHSHDPPVIHRDLKCDN  157

Query  365   IFVNGHLGQVKIGDLGLAAMLRGSH-AHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             IF+NG+ G+VKIGDLGLAA+LR SH AH V+GTPEFMAPE+YEE Y+ELVDIYSFGMCVL
Sbjct  158   IFINGNQGEVKIGDLGLAAILRKSHAAHCVVGTPEFMAPEVYEEAYNELVDIYSFGMCVL  217

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A Y++ + E + FV +CL  AS R SA ELL
Sbjct  218   EMVTFEYPYSECTHPAQIYKKVVSGKKPDALYKVKDPEVREFVEKCLATASLRLSARELL  277

Query  722   LDPFLAADEEE------------DESAKLPSQKLI---------------------PNGK  802
              D FL  DE E            D+   L  Q L+                     PN  
Sbjct  278   NDRFLQIDECEYDLRSLDYGRHLDDMGPLARQPLLELHRSNSSFSNGYSNDYDXDAPNEW  337

Query  803   LLEVEPCFV-------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDI  961
              +++E   +       D  +   D++I G    ED  IFLR++I+DK+G  RNI+FPFD 
Sbjct  338   TVDIESTGIELFEHHEDDHSDDVDISIKGKRG-EDGGIFLRLRITDKEGXVRNIYFPFDT  396

Query  962   TSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRS  1090
              +DTA+ VATEMV EL+ITD     IA MID EIS LVP W+S
Sbjct  397   ENDTALSVATEMVAELDITDQDETRIANMIDGEISMLVPDWQS  439



>ref|XP_008355813.1| PREDICTED: probable serine/threonine-protein kinase WNK9 isoform 
X4 [Malus domestica]
Length=689

 Score =   419 bits (1078),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 226/402 (56%), Positives = 276/402 (69%), Gaps = 41/402 (10%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT  
Sbjct  38    VYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTAN  97

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             R  NF+TE+FTSGTL++YR ++  VNIRA+KNW RQIL GL YLHSHDPPVIHRDLKCDN
Sbjct  98    RNINFVTEMFTSGTLKQYRLKHKRVNIRAVKNWCRQILRGLLYLHSHDPPVIHRDLKCDN  157

Query  365   IFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLE  544
             IF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMCVLE
Sbjct  158   IFINGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCVLE  217

Query  545   MLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLL  724
             M+T EYPYSECT+PAQIYKKV SGK P A Y++ + E + FV +CL  AS R SA ELL 
Sbjct  218   MVTFEYPYSECTHPAQIYKKVVSGKKPDALYKVKDPEVREFVEKCLATASLRLSARELLN  277

Query  725   DPFLAADEEE------------DESAKLPSQKLI---------------------PNGKL  805
             D FL  DE E            D+   L  Q L+                     PN   
Sbjct  278   DRFLQIDECEYDLRSLDYGRHLDDMGPLARQPLLELHRSNSSFSNGYSNDYDXDAPNEWT  337

Query  806   LEVEPCFV-------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDIT  964
             +++E   +       D  +   D++I G    ED  IFLR++I+DK+G  RNI+FPFD  
Sbjct  338   VDIESTGIELFEHHEDDHSDDVDISIKGKRG-EDGGIFLRLRITDKEGXVRNIYFPFDTE  396

Query  965   SDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRS  1090
             +DTA+ VATEMV EL+ITD     IA MID EIS LVP W+S
Sbjct  397   NDTALSVATEMVAELDITDQDETRIANMIDGEISMLVPDWQS  438



>emb|CDX80684.1| BnaC07g27600D [Brassica napus]
Length=475

 Score =   412 bits (1059),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 215/379 (57%), Positives = 272/379 (72%), Gaps = 16/379 (4%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYR FDE  G+EVAWNQ+KL +  +SP+EL+RLY E+ LLK L H SIM+F+ SW+DTD
Sbjct  38    TVYRGFDEYEGIEVAWNQVKLYDFLQSPQELERLYCEIHLLKTLKHKSIMKFYTSWVDTD  97

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NFITE+FTSGTLR+YR ++  VNIRA+K+W RQIL GL YLH+HDPPVIHRDLKCD
Sbjct  98    NRNINFITEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILRGLNYLHTHDPPVIHRDLKCD  157

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAAML+ SHA   +GTPEFMAPE+Y EEY+ELVDIYSFGMCVL
Sbjct  158   NIFVNGNQGEVKIGDLGLAAMLQHSHAAHCVGTPEFMAPEVYAEEYNELVDIYSFGMCVL  217

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T +YPYSECT+PAQIYK+V SGK P +  ++ + E + F+ +CL  AS R SA ELL
Sbjct  218   EMVTFDYPYSECTHPAQIYKRVISGKKPDSLDKVKDGEVRGFIEKCLASASLRLSARELL  277

Query  722   LDPFLAADEEEDESAKLPSQKLIPNG---------KLLEVEPCFVDQQAKSSD-------  853
              D FL  D   +  +     +   NG         ++ E +     ++A+  D       
Sbjct  278   DDQFLCIDYPSNYYSDNDQSQWTYNGDEMIESHGIEIFEFQNDDDHEEAEEYDNKFDNVH  337

Query  854   MTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDITSDTAMEVATEMVKELEITDWMPL  1033
             ++I G      D +FLR++I+DK+G  RNI+FPFDI SDTA+ VA EMV+ELE+ D    
Sbjct  338   ISIKGKRRDNGDGLFLRLRIADKEGLVRNIYFPFDIESDTAISVAREMVEELEMDDRDVT  397

Query  1034  DIAEMIDEEISALVPTWRS  1090
              IA MI+ EI++LVP WRS
Sbjct  398   KIANMINGEIASLVPDWRS  416



>ref|XP_008813013.1| PREDICTED: probable serine/threonine-protein kinase WNK9 isoform 
X2 [Phoenix dactylifera]
Length=744

 Score =   421 bits (1082),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 225/402 (56%), Positives = 282/402 (70%), Gaps = 40/402 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLCDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTS  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
             +R  NF+TE+FTSGTLR+YRQ++  VN+RA+K+W RQIL GL YLH HDPP+IHRDLKCD
Sbjct  97    KRNINFVTEMFTSGTLRQYRQKHRRVNLRAVKHWCRQILRGLLYLHGHDPPIIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMCVL
Sbjct  157   NIFINGNQGEVKIGDLGLAAILRKSHAVHCVGTPEFMAPEVYEEEYNELVDIYSFGMCVL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SG  P A YR+++ E ++FV +CL  AS+R  A ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGTKPEALYRVEDPEVRQFVEKCLATASRRLPARELL  276

Query  722   LDPFLAADE--------EEDESAKLPSQKLIP-NGKLL----------------------  808
              DPFL  D+        E     K PS  L+P NG L                       
Sbjct  277   KDPFLQIDDHGTVYREAELSVMGKQPSLDLLPSNGSLYANGFSDSFDQERRMENGWDYPA  336

Query  809   -EVEPCFV-------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDIT  964
              ++E   +       D    + D+TI G     D  IFLR++I+DKD   RNI+FPFDI 
Sbjct  337   ADIETHGMDLFNGQEDDPVANVDITIKGRKR-GDGGIFLRLRIADKDDHVRNIYFPFDIE  395

Query  965   SDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRS  1090
             +DTA+ VA EMV EL+ITD+    IAEMID E+++LVP W++
Sbjct  396   ADTALSVAAEMVAELDITDYEVTRIAEMIDGEVASLVPEWKT  437



>ref|XP_004247358.1| PREDICTED: probable serine/threonine-protein kinase WNK9 isoform 
X1 [Solanum lycopersicum]
Length=731

 Score =   420 bits (1080),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 223/404 (55%), Positives = 283/404 (70%), Gaps = 43/404 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVY+AFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+D  
Sbjct  37    TVYKAFDEYEGIEVAWNQVKLYDFMQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDVA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K W RQIL+GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKKVNIRAVKRWCRQILKGLHYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+Y EEY+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAILRKSHAARCVGTPEFMAPEVYAEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKVTSGK P + Y++ + E +RFV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVTSGKKPDSLYKVTDPEVRRFVEKCLATVSHRLSARELL  276

Query  722   LDPFLAADEEEDES--------------------AKLPSQKLIPNGKL--LEVEP-----  820
              DPFL  D+   +S                    + +     + NG L  L  EP     
Sbjct  277   DDPFLQVDDYVSDSETPNYLQDSNEFDVTLGHRPSSICDNNSLVNGCLGYLGYEPEDDSY  336

Query  821   ------------CFVDQQA---KSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPF  955
                          F D +    +++D++I G    EDD IFLR++I+DK+G+ RNI+FPF
Sbjct  337   YHQLEYEANEIDLFTDNEEDDMENADISIKGRRR-EDDGIFLRLRIADKEGRIRNIYFPF  395

Query  956   DITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             DI +DTA+ VATEMV EL+IT+     IA+MID EI++LVP W+
Sbjct  396   DIENDTALTVATEMVAELDITEQDVTKIADMIDGEIASLVPEWK  439



>ref|XP_008355811.1| PREDICTED: probable serine/threonine-protein kinase WNK9 isoform 
X2 [Malus domestica]
Length=745

 Score =   421 bits (1081),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 226/402 (56%), Positives = 276/402 (69%), Gaps = 41/402 (10%)
 Frame = +2

Query  5     VYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTDR  184
             VYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT  
Sbjct  38    VYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDTAN  97

Query  185   RTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCDN  364
             R  NF+TE+FTSGTL++YR ++  VNIRA+KNW RQIL GL YLHSHDPPVIHRDLKCDN
Sbjct  98    RNINFVTEMFTSGTLKQYRLKHKRVNIRAVKNWCRQILRGLLYLHSHDPPVIHRDLKCDN  157

Query  365   IFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVLE  544
             IF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMCVLE
Sbjct  158   IFINGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCVLE  217

Query  545   MLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELLL  724
             M+T EYPYSECT+PAQIYKKV SGK P A Y++ + E + FV +CL  AS R SA ELL 
Sbjct  218   MVTFEYPYSECTHPAQIYKKVVSGKKPDALYKVKDPEVREFVEKCLATASLRLSARELLN  277

Query  725   DPFLAADEEE------------DESAKLPSQKLI---------------------PNGKL  805
             D FL  DE E            D+   L  Q L+                     PN   
Sbjct  278   DRFLQIDECEYDLRSLDYGRHLDDMGPLARQPLLELHRSNSSFSNGYSNDYDXDAPNEWT  337

Query  806   LEVEPCFV-------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDIT  964
             +++E   +       D  +   D++I G    ED  IFLR++I+DK+G  RNI+FPFD  
Sbjct  338   VDIESTGIELFEHHEDDHSDDVDISIKGKRG-EDGGIFLRLRITDKEGXVRNIYFPFDTE  396

Query  965   SDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRS  1090
             +DTA+ VATEMV EL+ITD     IA MID EIS LVP W+S
Sbjct  397   NDTALSVATEMVAELDITDQDETRIANMIDGEISMLVPDWQS  438



>gb|KHN43209.1| Serine/threonine-protein kinase WNK1 [Glycine soja]
Length=682

 Score =   419 bits (1076),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 223/402 (55%), Positives = 278/402 (69%), Gaps = 41/402 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY EV LLK L H SIM+F+ SW+DT 
Sbjct  32    TVYRAFDEYQGIEVAWNQVKLYDFLQSPEDLERLYCEVHLLKTLKHRSIMKFYTSWVDTA  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YRQ++  VNIRA+K+W RQIL GL YLHS DPPVIHRDLKCD
Sbjct  92    NRNINFVTEMFTSGTLRQYRQKHKRVNIRAVKHWCRQILRGLLYLHSRDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA++R SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMCVL
Sbjct  152   NIFVNGNQGEVKIGDLGLAAIVRKSHAAHCVGTPEFMAPEVYEESYNELVDIYSFGMCVL  211

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSEC++PAQIYKKV SGK P A Y++ + E ++FV +CL   S R SA ELL
Sbjct  212   EMVTFEYPYSECSHPAQIYKKVISGKKPDALYKVKDPEVRKFVEKCLATVSLRLSARELL  271

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKL--------------------------------  805
              DPFL  D+ E +   + S      G L                                
Sbjct  272   DDPFLQIDDYEYDLGPVDSGSFDDLGPLTHQPFFDLHRTYSNMSTEYSNGFEYEGDWYSH  331

Query  806   -LEVEP-------CFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDI  961
               E+EP       C  D+ ++  D++I G    +D  IFLR++I+DK+G  RNI+FPFD 
Sbjct  332   PAEIEPSGIELFECHDDEASEDVDISIRGK-RKDDGGIFLRLRIADKEGHIRNIYFPFDT  390

Query  962   TSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
              +DTA+ VATEMV EL+ITD     I++MID EI++LVP W+
Sbjct  391   ETDTALSVATEMVAELDITDQDVTSISDMIDGEIASLVPEWK  432



>ref|XP_009344095.1| PREDICTED: probable serine/threonine-protein kinase WNK9 [Pyrus 
x bretschneideri]
Length=737

 Score =   421 bits (1081),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 223/404 (55%), Positives = 279/404 (69%), Gaps = 44/404 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  R+PE+L+RLY E+ LLK L H++IM+F++SW+D+ 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLYDFLRNPEDLERLYREIHLLKTLKHNNIMKFYSSWVDST  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R   F+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL+GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNITFVTEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILKGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEEEY+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAVLRKSHADRCVGTPEFMAPEVYEEEYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV +GK P A +++ + E +RFV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVITGKKPEALFKVKDPEVRRFVEKCLVTVSHRLSARELL  276

Query  722   LDPFLAADE---------------------EEDESAKLPSQKLIPNGK------------  802
              DPFL  D+                      +  S+   S   + NG             
Sbjct  277   RDPFLQVDDYGYDLRPIEYQRDMYEIGPLLRQPHSSLHQSNSSLSNGHGNYLGYETENDL  336

Query  803   --------LLEVE--PCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFP  952
                     L E++   C  D+     D+TI G    EDD IFLR++I+DK+G+ RNI+FP
Sbjct  337   DYNPIDYGLSEIDLFACQEDEHLGDVDLTIKGR-QKEDDGIFLRLRIADKEGRIRNIYFP  395

Query  953   FDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTW  1084
             FD  +DTA+ VA EMV EL+ITD     IAEMID EIS LVP W
Sbjct  396   FDTENDTALSVAREMVSELDITDQDVTKIAEMIDGEISTLVPEW  439



>gb|KDP23631.1| hypothetical protein JCGZ_23464 [Jatropha curcas]
Length=732

 Score =   420 bits (1080),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 224/405 (55%), Positives = 283/405 (70%), Gaps = 44/405 (11%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQIL+GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKHWCRQILKGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIY+FGMC+L
Sbjct  157   NIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEAYNELVDIYAFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SG+ P A Y++ + E ++FV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGRKPDALYKVKDPEVRQFVEKCLATVSLRLSARELL  276

Query  722   LDPFLAADE------------EEDESAKLPSQ----------------------------  781
              DPFL  D+            E D+++ L  Q                            
Sbjct  277   NDPFLQIDDCESNFKTIDYGVEIDDTSPLIRQPYLELHDNTYPYSNEYSNGYGYEAQNEL  336

Query  782   --KLIPNGKL-LEVEPCFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFP  952
                LI  G+  +E+     D+ + + D++I G     D  IFLR++I+DKDG+ RNI+FP
Sbjct  337   EYHLIDFGQSGIELFEYHDDEHSANLDISIKGK-KQSDGGIFLRLRIADKDGRIRNIYFP  395

Query  953   FDITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWR  1087
             FDI +DTA+ VATEMV EL+ITD     IA+MID EI++LVP WR
Sbjct  396   FDIETDTALSVATEMVAELDITDQDVTKIADMIDGEIASLVPEWR  440



>ref|XP_004495783.1| PREDICTED: serine/threonine-protein kinase WNK1-like [Cicer arietinum]
Length=736

 Score =   420 bits (1080),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 280/404 (69%), Gaps = 42/404 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFD   G+EVAWNQ+KL +  +SPE+L+RLY E+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDVYQGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W  QIL GL YLHSHDPPVIHRDLKCD
Sbjct  97    NRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKHWCIQILRGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA+LR SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMC+L
Sbjct  157   NIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSECT+PAQIYKKV SGK P A Y++ + E ++FV +CL   S+R SA ELL
Sbjct  217   EMVTFEYPYSECTHPAQIYKKVISGKKPDALYKVKDPEVRQFVEKCLATVSERLSARELL  276

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKLL-------------------------------  808
              DPFL  D+ E +  ++ S +L   G L+                               
Sbjct  277   DDPFLQIDDYEYDLRQVISGELNDFGPLIRQPLYDLHRSYSNFSYEYSNGGFGYEGDWYS  336

Query  809   ---EVEPCFV-------DQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFD  958
                + E C +       D+ ++  D++I G    +D  IFLR+ ISDK+G+ RNI FPFD
Sbjct  337   HPADNEQCGIELFEHHDDEPSEHVDISIKGK-KKDDGGIFLRINISDKEGRVRNISFPFD  395

Query  959   ITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRS  1090
             I  DTA+ VATEMV EL+ITD     IAEMID EI++LVP WR+
Sbjct  396   IEMDTAISVATEMVAELDITDQDVTSIAEMIDGEIASLVPEWRT  439



>gb|KHN15771.1| Serine/threonine-protein kinase WNK1 [Glycine soja]
Length=730

 Score =   420 bits (1079),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 220/405 (54%), Positives = 276/405 (68%), Gaps = 42/405 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+K  +  ++PE+L+RLYSE+ LLK L H +IM+F+ SW+DT 
Sbjct  37    TVYRAFDEYEGIEVAWNQVKFYDFLQNPEDLERLYSEIHLLKTLKHKNIMKFYTSWVDTA  96

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YR ++  VNIRA+K+W RQILEGL YLHSHDPPVIHRDLKCD
Sbjct  97    NRHINFVTEMFTSGTLRQYRLKHRRVNIRAVKHWCRQILEGLLYLHSHDPPVIHRDLKCD  156

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIF+NG+ G+VKIGDLGLAA+LR S+A   +GTPEFMAPE+YEE+Y+ELVDIYSFGMC+L
Sbjct  157   NIFINGNQGEVKIGDLGLAAILRKSNAARCVGTPEFMAPEVYEEDYNELVDIYSFGMCIL  216

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSEC +PAQIYKKV SGK P A Y++DN E ++FV +CL   S R SA ELL
Sbjct  217   EMVTFEYPYSECNHPAQIYKKVVSGKKPEALYKVDNPEVRQFVEKCLATVSLRLSARELL  276

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKLLEVEP----CFVDQQAKSSDMTITGTLNP---  880
              DPFL  D+   +S  L  Q+       L  +P    C ++    S D    G   P   
Sbjct  277   EDPFLQIDDYGFDSKVLQYQRDCYEVTPLIRQPVNGICIINNNLMSGDTDNIGGYGPVSE  336

Query  881   -----------------------------------EDDTIFLRVQISDKDGKARNIFFPF  955
                                                EDD IFLR++I+DK+G+ RNI+FPF
Sbjct  337   LGYHQDDFEATEIGLFDCEEDDNLAEVDTTIKGRREDDGIFLRLRIADKEGRIRNIYFPF  396

Query  956   DITSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRS  1090
             DI +DTA+ VA EMV EL+I D    ++A MID EI+ LVP W++
Sbjct  397   DIETDTALSVANEMVAELDINDQDVTNLASMIDNEIARLVPEWKT  441



>ref|NP_001235971.1| with no lysine kinase 9 [Glycine max]
 gb|ACN87285.1| with no lysine kinase [Glycine max]
Length=680

 Score =   418 bits (1075),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 229/434 (53%), Positives = 288/434 (66%), Gaps = 43/434 (10%)
 Frame = +2

Query  2     TVYRAFDEVLGMEVAWNQIKLNNVFRSPEELQRLYSEVLLLKDLDHSSIMRFHASWIDTD  181
             TVYRAFDE  G+EVAWNQ+KL +  +SPE+L+RLY EV LLK L H SIM+F+ SW+DT 
Sbjct  32    TVYRAFDEYQGIEVAWNQVKLYDFLQSPEDLERLYCEVHLLKTLKHRSIMKFYTSWVDTA  91

Query  182   RRTFNFITELFTSGTLREYRQRYTTVNIRAIKNWVRQILEGLAYLHSHDPPVIHRDLKCD  361
              R  NF+TE+FTSGTLR+YRQ++  VNIRA+K+W RQIL GL YLHS DPPVIHRDLKCD
Sbjct  92    NRNINFVTEMFTSGTLRQYRQKHKRVNIRAVKHWCRQILRGLLYLHSRDPPVIHRDLKCD  151

Query  362   NIFVNGHLGQVKIGDLGLAAMLRGSHAHSVIGTPEFMAPelyeeeydelvdIYSFGMCVL  541
             NIFVNG+ G+VKIGDLGLAA++R SHA   +GTPEFMAPE+YEE Y+ELVDIYSFGMCVL
Sbjct  152   NIFVNGNQGEVKIGDLGLAAIVRKSHAAHCVGTPEFMAPEVYEESYNELVDIYSFGMCVL  211

Query  542   EMLTSEYPYSECTNPAQIYKKVTSGKLPAAFYRIDNAEAQRFVGRCLEPASKRPSAHELL  721
             EM+T EYPYSEC++PAQIYKKV SGK P A Y++ + E ++FV +CL   S R SA ELL
Sbjct  212   EMVTFEYPYSECSHPAQIYKKVISGKKPDALYKVKDPEVRKFVEKCLATVSLRLSARELL  271

Query  722   LDPFLAADEEEDESAKLPSQKLIPNGKL--------------------------------  805
              DPFL  D+ E +   + S      G L                                
Sbjct  272   DDPFLQIDDYEYDLGPVDSGSFDDLGPLTHQPFFDLHRTYSNMSTEYSNGFEYEGDWYSH  331

Query  806   -LEVEP-------CFVDQQAKSSDMTITGTLNPEDDTIFLRVQISDKDGKARNIFFPFDI  961
               E+EP       C  D+ ++  D++I G    +D  IFLR++I+DK+G  RNI+FPFD 
Sbjct  332   PAEIEPSGIELFECHDDEASEDVDISIRGK-RKDDGGIFLRLRIADKEGHIRNIYFPFDT  390

Query  962   TSDTAMEVATEMVKELEITDWMPLDIAEMIDEEISALVPTWRSTQ--YQKQHSFNYIddd  1135
              +DTA+ VATEMV EL+ITD     I++MID EI++LVP W+      +  H  N I   
Sbjct  391   ETDTALSVATEMVAELDITDQDVTSISDMIDGEIASLVPEWKPGPGIEETNHYLNKIVCH  450

Query  1136  dddNNVGISTTRHP  1177
             +  +N G    + P
Sbjct  451   NCVSNQGRKNLQLP  464



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6376593770798