BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21247_g1_i1 len=3240 path=[1:0-1218 @1220@!:1219-2581
9373:2582-2934 2936:2935-3239]

Length=3240
                                                                      Score     E

ref|XP_004230531.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1296   0.0      
ref|XP_009792008.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1294   0.0      
ref|XP_006351785.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1291   0.0      
ref|XP_011087884.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1211   0.0      
ref|XP_002274497.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1181   0.0      Vitis vinifera
ref|XP_011004985.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1159   0.0      
ref|XP_011002071.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1149   0.0      
ref|XP_002531490.1|  copper-transporting atpase paa1, putative         1138   0.0      Ricinus communis
ref|XP_008237377.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1135   0.0      
ref|XP_010065583.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1131   0.0      
gb|KDP27349.1|  hypothetical protein JCGZ_20173                        1130   0.0      
ref|XP_010267977.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1129   0.0      
ref|XP_006487649.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1127   0.0      
ref|XP_007042963.1|  P-type ATP-ase 1 isoform 1                        1123   0.0      
ref|XP_010094160.1|  Putative copper-transporting ATPase PAA1          1114   0.0      
ref|XP_008373194.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1108   0.0      
ref|XP_006487648.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1107   0.0      
gb|KCW63155.1|  hypothetical protein EUGRSUZ_G00769                    1100   0.0      
ref|XP_004290425.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1093   0.0      
ref|XP_006579987.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1086   0.0      
ref|XP_008802207.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1083   0.0      
ref|XP_007159103.1|  hypothetical protein PHAVU_002G208800g            1082   0.0      
ref|XP_010690489.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1079   0.0      
ref|XP_008455636.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1078   0.0      
ref|XP_004137165.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1078   0.0      
ref|XP_006584981.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1078   0.0      
ref|XP_008455639.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1073   0.0      
ref|XP_004504792.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1073   0.0      
ref|XP_009409273.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1068   0.0      
ref|XP_010526997.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1061   0.0      
emb|CDO97451.1|  unnamed protein product                               1060   0.0      
ref|NP_974675.1|  putative copper-transporting ATPase PAA1             1060   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAA20565.1|  metal-transporting P-type ATPase (fragment)           1059   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437749.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1058   0.0      
ref|XP_002869211.1|  predicted protein                                 1056   0.0      
ref|XP_010937450.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1056   0.0      
ref|XP_010432548.1|  PREDICTED: LOW QUALITY PROTEIN: copper-trans...   1056   0.0      
ref|NP_974676.1|  putative copper-transporting ATPase PAA1             1056   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010315098.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1055   0.0      
ref|XP_009121393.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1055   0.0      
ref|NP_001289905.1|  copper-transporting ATPase PAA1, chloroplast...   1054   0.0      
gb|KEH31223.1|  copper-transporting ATPase PAA1, putative              1051   0.0      
ref|XP_006282942.1|  hypothetical protein CARUB_v10007505mg            1051   0.0      
ref|XP_009792009.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1050   0.0      
emb|CDX75363.1|  BnaA01g03390D                                         1049   0.0      
dbj|BAA23769.1|  metal-transporting P-type ATPase                      1049   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHN39225.1|  Putative copper-transporting ATPase PAA1               1044   0.0      
ref|XP_010526996.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1043   0.0      
emb|CDX68986.1|  BnaC01g04670D                                         1039   0.0      
ref|XP_006412347.1|  hypothetical protein EUTSA_v10024339mg            1031   0.0      
ref|XP_006849809.1|  hypothetical protein AMTR_s00176p00057350         1025   0.0      
ref|XP_008677499.1|  PREDICTED: uncharacterized protein LOC100381...   1016   0.0      
dbj|BAD09318.1|  putative potential copper-transporting ATPase         1010   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAZ43138.1|  hypothetical protein OsJ_27728                         1010   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660232.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1008   0.0      
ref|XP_002445980.1|  hypothetical protein SORBIDRAFT_07g029010         1006   0.0      Sorghum bicolor [broomcorn]
ref|XP_008455637.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1005   0.0      
ref|XP_004973751.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1004   0.0      
ref|XP_004973752.1|  PREDICTED: copper-transporting ATPase PAA1, ...   1002   0.0      
ref|XP_003574670.2|  PREDICTED: copper-transporting ATPase PAA1, ...   1001   0.0      
ref|XP_007042964.1|  P-type ATP-ase 1 isoform 2                         996   0.0      
dbj|BAJ87066.1|  predicted protein                                      994   0.0      
gb|EYU18481.1|  hypothetical protein MIMGU_mgv1a001648mg                983   0.0      
ref|XP_010526998.1|  PREDICTED: copper-transporting ATPase PAA1, ...    978   0.0      
gb|EMS52334.1|  Putative copper-transporting ATPase PAA1                951   0.0      
gb|KHN42741.1|  Putative copper-transporting ATPase PAA1                949   0.0      
ref|XP_008455638.1|  PREDICTED: copper-transporting ATPase PAA1, ...    941   0.0      
gb|KFK29977.1|  hypothetical protein AALP_AA7G201700                    933   0.0      
ref|XP_001770117.1|  predicted protein                                  835   0.0      
ref|XP_009627777.1|  PREDICTED: copper-transporting ATPase PAA1, ...    784   0.0      
gb|KGN53711.1|  hypothetical protein Csa_4G108510                       783   0.0      
ref|XP_002994064.1|  hypothetical protein SELMODRAFT_138129             760   0.0      
ref|XP_001755832.1|  predicted protein                                  759   0.0      
ref|XP_002299685.2|  hypothetical protein POPTR_0001s21290g             736   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004170351.1|  PREDICTED: copper-transporting ATPase PAA1, ...    735   0.0      
ref|XP_009627778.1|  PREDICTED: copper-transporting ATPase PAA1, ...    728   0.0      
gb|EPS61648.1|  hypothetical protein M569_13146                         725   0.0      
ref|XP_010526999.1|  PREDICTED: copper-transporting ATPase PAA1, ...    677   0.0      
ref|XP_002989060.1|  hypothetical protein SELMODRAFT_129166             657   0.0      
ref|XP_001420345.1|  P-ATPase family transporter: copper ion; hea...    649   0.0      Ostreococcus lucimarinus CCE9901
ref|XP_003082050.1|  putative potential copper-transporting ATPas...    640   0.0      
ref|XP_007201115.1|  hypothetical protein PRUPE_ppa022526mg             603   0.0      
gb|EEC83773.1|  hypothetical protein OsI_29667                          612   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_002508977.1|  p-type ATPase superfamily                          597   0.0      Micromonas commoda
ref|XP_002954184.1|  hypothetical protein VOLCADRAFT_64450              599   0.0      
ref|XP_003061782.1|  p-type ATPase superfamily                          593   0.0      
ref|XP_007509526.1|  copper-translocating P-type ATPase                 587   0.0      
ref|XP_005645490.1|  heavy metal translocatin                           575   0.0      
ref|XP_010937451.1|  PREDICTED: copper-transporting ATPase PAA1, ...    551   0.0      
ref|XP_001775850.1|  predicted protein                                  561   8e-180   
ref|WP_011611218.1|  ATPase                                             553   2e-178   
ref|WP_017660200.1|  hypothetical protein                               552   5e-178   
ref|WP_008188329.1|  ATPase                                             551   2e-177   
emb|CBI32958.3|  unnamed protein product                                538   2e-177   
ref|XP_010261895.1|  PREDICTED: copper-transporting ATPase PAA2, ...    553   8e-177   
ref|XP_005849927.1|  hypothetical protein CHLNCDRAFT_21268              553   1e-176   
ref|XP_008452788.1|  PREDICTED: copper-transporting ATPase PAA2, ...    550   2e-175   
ref|XP_004141342.1|  PREDICTED: copper-transporting ATPase PAA2, ...    549   2e-175   
ref|XP_010229103.1|  PREDICTED: copper-transporting ATPase PAA2, ...    547   1e-174   
ref|WP_009784297.1|  ATPase                                             542   4e-174   
ref|XP_002516143.1|  copper-transporting atpase paa1, putative          543   3e-173   Ricinus communis
ref|XP_010936926.1|  PREDICTED: copper-transporting ATPase PAA2, ...    543   4e-173   
ref|WP_010997923.1|  ATPase                                             539   2e-172   
ref|XP_008797345.1|  PREDICTED: copper-transporting ATPase PAA2, ...    541   2e-172   
ref|WP_023066882.1|  copper-translocating P-type ATPase                 537   3e-172   
ref|XP_010047398.1|  PREDICTED: copper-transporting ATPase PAA2, ...    540   9e-172   
ref|XP_010098373.1|  Putative copper-transporting ATPase PAA1           539   1e-171   
ref|WP_027254507.1|  ATPase                                             535   2e-171   
ref|XP_004141341.1|  PREDICTED: copper-transporting ATPase PAA2, ...    540   2e-171   
gb|AFW65111.1|  hypothetical protein ZEAMMB73_571389                    526   2e-171   
ref|WP_026794855.1|  MULTISPECIES: ATPase                               535   2e-171   
gb|EEE58431.1|  hypothetical protein OsJ_09636                          539   3e-171   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74624.1|  hypothetical protein OsI_10243                          539   3e-171   Oryza sativa Indica Group [Indian rice]
emb|CDY16605.1|  BnaC09g36680D                                          538   3e-171   
ref|XP_009414814.1|  PREDICTED: copper-transporting ATPase PAA2, ...    538   3e-171   
ref|XP_004157377.1|  PREDICTED: LOW QUALITY PROTEIN: copper-trans...    538   5e-171   
ref|XP_004245045.1|  PREDICTED: copper-transporting ATPase PAA2, ...    538   6e-171   
ref|XP_002974620.1|  hypothetical protein SELMODRAFT_50799              534   8e-171   
ref|XP_003603218.1|  Copper-exporting P-type ATPase A                   537   9e-171   
ref|WP_022606549.1|  copper-(or silver)-translocating P-type ATPase     533   1e-170   
ref|NP_001289916.1|  copper-transporting ATPase PAA2, chloroplast...    536   1e-170   
ref|WP_036481007.1|  ATPase                                             533   1e-170   
ref|XP_008360948.1|  PREDICTED: copper-transporting ATPase PAA2, ...    536   1e-170   
ref|XP_002963330.1|  hypothetical protein SELMODRAFT_60775              533   2e-170   
ref|WP_026796971.1|  ATPase                                             532   2e-170   
ref|WP_019504084.1|  hypothetical protein                               532   4e-170   
emb|CDX92394.1|  BnaA10g14330D                                          535   4e-170   
ref|XP_006849689.1|  hypothetical protein AMTR_s00024p00238030          535   6e-170   
gb|KEI68167.1|  CtaA                                                    531   8e-170   
ref|WP_011318364.1|  ATPase                                             532   1e-169   
ref|XP_006400698.1|  hypothetical protein EUTSA_v10012640mg             534   1e-169   
ref|WP_026788593.1|  ATPase                                             531   1e-169   
ref|XP_010669315.1|  PREDICTED: copper-transporting ATPase PAA2, ...    534   2e-169   
ref|WP_027249736.1|  ATPase                                             530   2e-169   
gb|ABD64063.1|  copper P1B-ATPase                                       534   2e-169   Glycine max [soybeans]
ref|WP_006104082.1|  ATPase                                             532   2e-169   
gb|KDP34025.1|  hypothetical protein JCGZ_07596                         533   2e-169   
ref|XP_007136888.1|  hypothetical protein PHAVU_009G082400g             533   3e-169   
ref|XP_009624550.1|  PREDICTED: copper-transporting ATPase PAA2, ...    533   3e-169   
ref|XP_002280050.2|  PREDICTED: copper-transporting ATPase PAA2, ...    533   3e-169   Vitis vinifera
ref|XP_009120707.1|  PREDICTED: copper-transporting ATPase PAA2, ...    533   4e-169   
ref|XP_006353854.1|  PREDICTED: copper-transporting ATPase PAA2, ...    533   4e-169   
ref|XP_009362794.1|  PREDICTED: copper-transporting ATPase PAA2, ...    533   4e-169   
ref|XP_011081596.1|  PREDICTED: copper-transporting ATPase PAA2, ...    533   4e-169   
ref|XP_006287036.1|  hypothetical protein CARUB_v10000184mg             532   5e-169   
ref|XP_004501429.1|  PREDICTED: copper-transporting ATPase PAA2, ...    531   1e-168   
ref|WP_015185222.1|  heavy metal translocating P-type ATPase            530   1e-168   
ref|XP_004985506.1|  PREDICTED: copper-transporting ATPase PAA2, ...    531   2e-168   
emb|CAC34486.1|  metal-transporting ATPase-like protein                 530   3e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011002837.1|  PREDICTED: copper-transporting ATPase PAA2, ...    530   3e-168   
ref|XP_009767519.1|  PREDICTED: copper-transporting ATPase PAA2, ...    531   3e-168   
ref|XP_010493252.1|  PREDICTED: copper-transporting ATPase PAA2, ...    530   3e-168   
ref|XP_006372043.1|  hypothetical protein POPTR_0018s08380g             530   4e-168   
ref|XP_006353855.1|  PREDICTED: copper-transporting ATPase PAA2, ...    530   4e-168   
ref|XP_006452988.1|  hypothetical protein CICLE_v10007408mg             530   6e-168   
ref|NP_680181.2|  P-type ATPase                                         529   8e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454455.1|  PREDICTED: copper-transporting ATPase PAA2, ...    529   8e-168   
ref|XP_006580903.1|  PREDICTED: chloroplast copper-translocating ...    529   1e-167   
gb|KFK26354.1|  hypothetical protein AALP_AA8G237600                    528   2e-167   
ref|XP_002871979.1|  hypothetical protein ARALYDRAFT_910174             528   4e-167   
ref|XP_007012428.1|  P-type ATPase of 2 isoform 1                       527   5e-167   
ref|WP_007310860.1|  ATPase                                             523   6e-167   
ref|WP_008276409.1|  ATPase                                             523   7e-167   
ref|WP_007305602.1|  ATPase                                             523   8e-167   
ref|WP_021835334.1|  cation-transporting P-type ATPase                  523   1e-166   
gb|AAP55720.1|  Paa2 P-type ATPase                                      526   1e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006474499.1|  PREDICTED: copper-transporting ATPase PAA2, ...    526   1e-166   
ref|WP_015203177.1|  heavy metal translocating P-type ATPase            521   5e-166   
ref|WP_038298393.1|  hypothetical protein, partial [                    521   1e-165   
ref|XP_007199846.1|  hypothetical protein PRUPE_ppa006208mg             506   2e-165   
ref|WP_015226316.1|  heavy metal translocating P-type ATPase            518   7e-165   
gb|EYU20293.1|  hypothetical protein MIMGU_mgv1a001497mg                518   1e-164   
ref|WP_016872375.1|  ATPase                                             518   1e-164   
ref|WP_035736254.1|  ATPase                                             517   2e-164   
ref|WP_009543558.1|  MULTISPECIES: ATPase                               517   2e-164   
ref|WP_015172780.1|  heavy metal translocating P-type ATPase            517   3e-164   
ref|XP_008644818.1|  PREDICTED: uncharacterized protein LOC100383...    522   8e-164   
ref|XP_004305609.1|  PREDICTED: LOW QUALITY PROTEIN: copper-trans...    518   1e-163   
ref|WP_014274764.1|  copper-transporting P-type ATPase CtaA             515   1e-163   
ref|WP_039729886.1|  ATPase                                             515   1e-163   
ref|WP_012407309.1|  ATPase                                             515   2e-163   
gb|AAO13462.1|  Unknown protein                                         518   2e-163   Oryza sativa Japonica Group [Japonica rice]
ref|WP_015199494.1|  heavy metal translocating P-type ATPase            514   6e-163   
ref|WP_012594879.1|  MULTISPECIES: ATPase                               513   8e-163   
ref|XP_010535751.1|  PREDICTED: copper-transporting ATPase PAA2, ...    516   8e-163   
ref|WP_015139738.1|  P-type ATPase, translocating                       513   3e-162   
ref|WP_006667964.1|  MULTISPECIES: ATPase                               510   1e-161   
ref|XP_003603219.1|  Copper-exporting P-type ATPase A                   512   2e-161   
ref|XP_002465760.1|  hypothetical protein SORBIDRAFT_01g045340          511   3e-161   Sorghum bicolor [broomcorn]
ref|XP_007225307.1|  hypothetical protein PRUPE_ppa001206mg             511   4e-161   
ref|WP_008056852.1|  ATPase                                             509   4e-161   
ref|WP_027843146.1|  ATPase                                             509   8e-161   
ref|XP_008220574.1|  PREDICTED: copper-transporting ATPase PAA2, ...    510   1e-160   
ref|WP_035987250.1|  ATPase                                             507   2e-160   
gb|EPS60878.1|  hypothetical protein M569_13922                         506   4e-160   
ref|WP_027403978.1|  ATPase                                             505   1e-159   
ref|WP_017288390.1|  hypothetical protein                               503   4e-159   
ref|WP_015142660.1|  heavy metal translocating P-type ATPase            504   1e-158   
ref|WP_006528049.1|  heavy metal-translocating P-type ATPase            499   3e-158   
ref|NP_001190357.1|  P-type ATPase                                      503   5e-158   
ref|XP_007012429.1|  P-type ATPase of 2 isoform 2                       503   6e-158   
ref|XP_006651094.1|  PREDICTED: copper-transporting ATPase PAA2, ...    497   2e-157   
gb|KHN32168.1|  Putative copper-transporting ATPase PAA1                499   5e-157   
ref|WP_015211246.1|  heavy metal translocating P-type ATPase            499   6e-157   
ref|WP_015230701.1|  copper/silver-translocating P-type ATPase          496   1e-156   
ref|WP_026072734.1|  ATPase                                             494   1e-155   
ref|WP_026103783.1|  ATPase                                             494   3e-155   
ref|WP_026222202.1|  ATPase                                             492   5e-155   
ref|WP_015194100.1|  heavy metal translocating P-type ATPase            493   5e-155   
ref|WP_015955160.1|  ATPase                                             493   6e-155   
gb|ABF94278.1|  copper-translocating P-type ATPase family protein...    494   1e-154   Oryza sativa Japonica Group [Japonica rice]
ref|WP_015123957.1|  copper/silver-translocating P-type ATPase,he...    491   3e-154   
dbj|BAK61879.1|  P-type ATPase                                          492   6e-154   
ref|WP_013324003.1|  ATPase                                             488   2e-153   
ref|XP_010527001.1|  PREDICTED: copper-transporting ATPase PAA1, ...    476   4e-153   
ref|WP_015133786.1|  heavy metal translocating P-type ATPase            485   1e-152   
ref|WP_017304490.1|  hypothetical protein                               486   1e-152   
ref|XP_010527000.1|  PREDICTED: copper-transporting ATPase PAA1, ...    475   1e-152   
ref|WP_012626474.1|  ATPase                                             485   6e-152   
ref|WP_006507891.1|  heavy metal translocating P-type ATPase            484   1e-151   
ref|WP_009631878.1|  heavy metal translocating P-type ATPase            483   2e-151   
ref|WP_002787160.1|  ATPase                                             481   7e-151   
ref|WP_040054633.1|  ATPase                                             478   5e-150   
gb|KFF41704.1|  copper/silver-translocating P-type ATPase               478   1e-149   
ref|WP_002767526.1|  ATPase                                             477   3e-149   
ref|WP_002779125.1|  ATPase                                             477   3e-149   
ref|WP_002741560.1|  copper-translocating P-type ATPase                 476   4e-149   
ref|WP_024546206.1|  ATPase                                             476   4e-149   
ref|WP_030007444.1|  ATPase                                             476   8e-149   
emb|CBI32959.3|  unnamed protein product                                457   1e-148   
ref|WP_002782462.1|  putative copper-transporting ATPase synA           475   1e-148   
emb|CDP13473.1|  unnamed protein product                                474   1e-148   
ref|WP_040936519.1|  ATPase                                             476   1e-148   
ref|WP_002759061.1|  ATPase                                             475   2e-148   
ref|WP_024969874.1|  ATPase                                             474   2e-148   
ref|WP_004158372.1|  ATPase                                             474   3e-148   
ref|WP_002732767.1|  copper-translocating P-type ATPase                 474   4e-148   
ref|WP_012954371.1|  ATPase                                             473   9e-148   
ref|WP_008195909.1|  ATPase                                             472   2e-147   
ref|WP_016515063.1|  Cation-transporting ATPase PacS                    472   2e-147   
ref|WP_002793826.1|  ATPase                                             472   2e-147   
ref|WP_012308205.1|  ATPase                                             472   3e-147   
ref|WP_002803118.1|  ATPase                                             472   3e-147   
dbj|GAL91527.1|  copper-translocating P-type ATPase                     471   4e-147   
ref|WP_002795941.1|  ATPase                                             470   1e-146   
ref|WP_012267551.1|  ATPase                                             470   1e-146   
ref|WP_015223700.1|  copper-translocating P-type ATPase                 462   1e-143   
ref|WP_008318138.1|  heavy metal translocating P-type ATPase            461   5e-143   
gb|KDO73635.1|  hypothetical protein CISIN_1g0027701mg                  454   2e-142   
ref|WP_040467283.1|  hypothetical protein                               458   4e-142   
gb|ESA36814.1|  heavy metal translocating p-type atpase                 457   7e-142   
ref|WP_031292600.1|  ATPase                                             458   8e-142   
ref|WP_015218718.1|  heavy metal translocating P-type ATPase            456   3e-141   
ref|WP_026103038.1|  ATPase P                                           453   3e-140   
ref|WP_006518190.1|  heavy metal translocating P-type ATPase            451   2e-139   
ref|XP_006423887.1|  hypothetical protein CICLE_v10030175mg             437   3e-139   
ref|WP_015160397.1|  copper/silver-translocating P-type ATPase          451   3e-139   
ref|WP_036535434.1|  ATPase                                             450   5e-139   
ref|XP_005649995.1|  heavy metal translocatin                           452   6e-139   
gb|KDO46478.1|  hypothetical protein CISIN_1g0023101mg                  436   1e-138   
gb|EMT16855.1|  Putative copper-transporting ATPase PAA1                444   2e-138   
ref|XP_009619125.1|  PREDICTED: copper-transporting ATPase PAA1, ...    431   2e-138   
gb|AES73470.2|  copper-transporting ATPase PAA1, putative               446   2e-137   
ref|XP_002304094.2|  hypothetical protein POPTR_0003s01850g             427   1e-136   Populus trichocarpa [western balsam poplar]
ref|WP_015166594.1|  heavy metal translocating P-type ATPase            443   6e-136   
ref|WP_010468029.1|  ATPase                                             439   8e-135   
ref|XP_006353857.1|  PREDICTED: copper-transporting ATPase PAA2, ...    435   2e-133   
gb|KDO46474.1|  hypothetical protein CISIN_1g0023102mg                  417   9e-133   
ref|WP_012162356.1|  ATPase                                             433   2e-132   
ref|XP_005850457.1|  hypothetical protein CHLNCDRAFT_6585               429   5e-131   
ref|WP_011378404.1|  MULTISPECIES: copper-transporting ATPase SynA      424   3e-129   
ref|WP_009628865.1|  heavy metal translocating P-type ATPase            424   3e-129   
ref|WP_011244095.1|  copper-transporting ATPase SynA                    419   3e-127   
ref|WP_015167413.1|  copper/silver-translocating P-type ATPase          417   7e-127   
ref|WP_006172249.1|  putative P-type ATPase transporter for copper      415   1e-125   
gb|AII44600.1|  P-type ATPase transporter for copper                    414   1e-125   
ref|WP_038547036.1|  ATPase P                                           414   2e-125   
ref|XP_001418991.1|  P-ATPase family transporter: copper ion; hea...    413   3e-125   Ostreococcus lucimarinus CCE9901
ref|WP_011827223.1|  ATPase P                                           412   6e-125   
ref|WP_036911530.1|  MULTISPECIES: ATPase P                             412   1e-124   
ref|WP_011131356.1|  P-type ATPase transporter for copper               412   1e-124   
gb|ABF94279.1|  copper-translocating P-type ATPase family protein...    412   2e-124   
ref|WP_036904725.1|  ATPase P                                           410   3e-124   
ref|XP_002503602.1|  p-type ATPase superfamily                          414   3e-124   
ref|WP_024124953.1|  P-type copper uptake ATPase CtaA                   409   4e-124   
ref|WP_028952951.1|  ATPase P                                           409   1e-123   
ref|WP_013194492.1|  haloacid dehalogenase                              412   3e-123   
ref|WP_011294130.1|  P-type ATPase transporter for copper               408   3e-123   
ref|WP_011822991.1|  P-type ATPase transporter for copper               407   1e-122   
ref|YP_002048954.1|  putative P-type ATPase transporter for copper      407   1e-122   
ref|WP_029626011.1|  ATPase P                                           404   7e-122   
emb|CEF98806.1|  P-type ATPase, phosphorylation site                    407   1e-121   
ref|WP_028947135.1|  ATPase                                             404   1e-121   
ref|WP_023845632.1|  copper/silver-translocating P-type ATPase          406   5e-121   
ref|XP_001702571.1|  heavy metal transporting ATPase                    410   5e-121   
ref|XP_002309463.2|  hypothetical protein POPTR_0006s23690g             402   6e-121   
ref|WP_025530369.1|  ATPase [                                           401   8e-121   
ref|WP_038258135.1|  ATPase [                                           401   8e-121   
ref|WP_040943876.1|  ATPase                                             404   8e-121   
gb|KHN29676.1|  Putative copper-transporting ATPase PAA1                397   8e-121   
ref|NP_001237371.1|  chloroplast copper-translocating HMA8 P-ATPase     400   9e-121   
ref|WP_038650830.1|  ATPase P                                           401   1e-120   
gb|ENY92810.1|  heavy metal translocating P-type ATPase [ [             400   1e-120   
ref|XP_007513791.1|  p-type ATPase superfamily                          407   1e-120   
ref|WP_017658806.1|  hypothetical protein                               400   2e-120   
ref|WP_034143964.1|  haloacid dehalogenase                              402   3e-120   
gb|AIQ96310.1|  Lead                                                    399   3e-120   
ref|WP_007304891.1|  ATPase                                             399   7e-120   
ref|WP_022032119.1|  hypothetical protein                               398   8e-120   
ref|WP_007310219.1|  ATPase                                             397   2e-119   
ref|WP_006194341.1|  ATPase                                             397   3e-119   
ref|WP_015176496.1|  copper-translocating P-type ATPase                 396   4e-119   
ref|WP_012361758.1|  ATPase                                             397   6e-119   
ref|WP_035140238.1|  cation-transporting ATPase PacS                    395   6e-119   
ref|WP_021830712.1|  Lead, cadmium, zinc and mercury transporting...    396   7e-119   
ref|WP_035857640.1|  cation-transporting ATPase PacS                    394   1e-118   
ref|WP_035825925.1|  cation-transporting ATPase PacS                    394   1e-118   
ref|WP_021835675.1|  Lead, cadmium, zinc and mercury transporting...    395   2e-118   
ref|WP_010873238.1|  ATPase                                             395   2e-118   
ref|WP_007151752.1|  ATPase                                             396   3e-118   
ref|WP_026102352.1|  cation-transporting ATPase PacS                    394   3e-118   
ref|WP_039882017.1|  ATPase                                             395   5e-118   
gb|EHJ03994.1|  heavy metal translocating P-type ATPase                 395   5e-118   
ref|WP_006780321.1|  hypothetical protein [                             393   6e-118   
ref|WP_035830582.1|  ATPase P                                           394   7e-118   
ref|WP_034554840.1|  ATPase                                             393   8e-118   
ref|WP_003510535.1|  copper-translocating P-type ATPase [               393   9e-118   
gb|KEF42464.1|  ATPase P                                                394   1e-117   
ref|WP_011700021.1|  ATPase                                             394   1e-117   
ref|WP_025747436.1|  ATPase                                             394   1e-117   
ref|WP_015415269.1|  Copper-exporting P-type ATPase A                   394   1e-117   
ref|WP_011611012.1|  ATPase                                             392   1e-117   
ref|WP_016879823.1|  ATPase                                             392   1e-117   
ref|WP_004461946.1|  hypothetical protein [                             392   1e-117   
ref|WP_006909079.1|  copper-translocating P-type ATPase                 394   1e-117   
ref|WP_036206278.1|  ATPase                                             394   2e-117   
ref|WP_021642384.1|  copper-exporting ATPase [                          391   4e-117   
ref|WP_009298096.1|  hypothetical protein                               391   5e-117   
ref|WP_026785382.1|  cation-transporting ATPase PacS                    391   5e-117   
ref|XP_006474502.1|  PREDICTED: copper-transporting ATPase PAA2, ...    390   5e-117   
ref|WP_015051136.1|  haloacid dehalogenase                              392   1e-116   
ref|WP_037998925.1|  haloacid dehalogenase                              392   1e-116   
ref|WP_009630904.1|  copper/silver-translocating P-type ATPase          390   1e-116   
ref|WP_036291434.1|  ATPase                                             394   2e-116   
ref|WP_013377530.1|  ATPase                                             390   2e-116   
ref|WP_002614248.1|  ATPase                                             390   2e-116   
ref|WP_027255357.1|  cation-transporting ATPase PacS                    389   3e-116   
ref|WP_035030177.1|  ATPase                                             390   3e-116   
ref|WP_028314315.1|  hypothetical protein                               390   3e-116   
ref|WP_023066029.1|  copper-translocating P-type ATPase                 388   4e-116   
ref|WP_036010590.1|  cation-transporting ATPase PacS                    388   5e-116   
ref|WP_012157939.1|  copper-translocating P-type ATPase                 390   5e-116   
ref|WP_026598989.1|  ATPase                                             393   7e-116   
ref|WP_015053232.1|  haloacid dehalogenase                              392   7e-116   
ref|WP_024613297.1|  ATPase                                             391   1e-115   
ref|WP_013489629.1|  ATPase                                             387   1e-115   
ref|WP_027985320.1|  hypothetical protein                               389   1e-115   
ref|WP_012408169.1|  ATPase                                             387   1e-115   
ref|WP_018266150.1|  ATPase                                             392   1e-115   
ref|WP_010305009.1|  copper-transporting ATPase                         387   1e-115   
ref|WP_013711514.1|  copper transporter ATPase                          388   2e-115   
ref|WP_026796377.1|  cation-transporting ATPase PacS                    386   2e-115   
ref|WP_039896251.1|  hypothetical protein                               386   2e-115   
ref|WP_015212131.1|  copper-translocating P-type ATPase                 386   2e-115   
ref|WP_020887869.1|  heavy metal translocating P-type ATPase            389   2e-115   
gb|EKD52863.1|  hypothetical protein ACD_61C00214G0001                  385   3e-115   
gb|EAZ91547.1|  cation-transporting ATPase                              386   3e-115   
ref|WP_013635891.1|  ATPase                                             388   3e-115   
ref|WP_015155686.1|  copper-translocating P-type ATPase                 386   4e-115   
ref|WP_027186344.1|  ATPase                                             387   4e-115   
ref|WP_010993963.1|  ATPase                                             385   5e-115   
ref|WP_015198192.1|  copper-translocating P-type ATPase                 385   5e-115   
gb|EAW36581.1|  cation-transporting ATPase                              385   5e-115   
ref|WP_006521004.1|  ATPase P                                           387   5e-115   
gb|AII46288.1|  P-type ATPase transporter for copper                    384   7e-115   
ref|WP_028845854.1|  hypothetical protein                               384   7e-115   
ref|WP_025593196.1|  ATPase                                             387   8e-115   
ref|WP_010995796.1|  ATPase                                             385   8e-115   
ref|WP_015484942.1|  ATPase [                                           384   9e-115   
ref|WP_035799113.1|  cation-transporting ATPase PacS                    384   9e-115   
ref|WP_034601419.1|  haloacid dehalogenase                              387   9e-115   
ref|WP_035173850.1|  cation-transporting ATPase PacS                    384   1e-114   
ref|WP_035198915.1|  ATPase                                             387   1e-114   
ref|WP_033015733.1|  ATPase P                                           385   1e-114   
ref|WP_040372614.1|  ATPase                                             386   1e-114   
ref|WP_012177931.1|  ATPase                                             386   1e-114   
gb|KEI66970.1|  CopA                                                    384   2e-114   
ref|WP_012627444.1|  ATPase                                             384   2e-114   
ref|WP_026591989.1|  ATPase P                                           385   2e-114   
ref|WP_034997024.1|  ATPase                                             387   2e-114   
ref|WP_034687304.1|  ATPase P                                           382   2e-114   
ref|WP_015364377.1|  copper-translocating P-type ATPase                 383   3e-114   
ref|WP_026330809.1|  ATPase                                             385   3e-114   
ref|WP_025048618.1|  ATPase                                             385   3e-114   
ref|WP_026149144.1|  cation-transporting ATPase PacS                    384   3e-114   
gb|KGK98674.1|  haloacid dehalogenase                                   388   3e-114   
ref|WP_012307914.1|  ATPase                                             382   4e-114   
ref|WP_017307607.1|  ATPase                                             383   4e-114   
ref|WP_008179849.1|  ATPase                                             384   5e-114   
ref|WP_035021025.1|  ATPase P                                           384   5e-114   
ref|WP_008376554.1|  copper-exporting ATPase                            384   5e-114   
ref|WP_023519982.1|  P-ATPase superfamily P-type ATPase copper (C...    382   5e-114   
ref|WP_038492772.1|  ATPase                                             385   6e-114   
ref|WP_005975481.1|  copper-exporting ATPase                            383   6e-114   
gb|AHK01063.1|  lead, cadmium, zinc and mercury transporting ATPase     384   7e-114   
dbj|GAC92171.1|  cation transport ATPase                                384   7e-114   
gb|KIJ80687.1|  cation-transporting ATPase PacS                         382   7e-114   
ref|WP_003352826.1|  ATPase P                                           383   9e-114   
ref|WP_002407447.1|  copper-translocating P-type ATPase                 384   9e-114   
ref|WP_029502751.1|  ATPase                                             382   1e-113   
ref|WP_015358639.1|  MULTISPECIES: copper-exporting P-type ATPase A     384   1e-113   
ref|WP_027317403.1|  ATPase                                             384   1e-113   
ref|WP_014323212.1|  heavy metal translocating P-type ATPase            384   1e-113   
ref|WP_010734990.1|  heavy metal translocating P-type ATPase            380   1e-113   
ref|WP_034599599.1|  haloacid dehalogenase                              384   1e-113   
ref|WP_027983449.1|  ATPase                                             383   2e-113   
ref|WP_030006823.1|  hypothetical protein                               381   2e-113   
ref|WP_015947753.1|  ATPase P                                           383   2e-113   
ref|WP_024880501.1|  ATPase                                             386   2e-113   
ref|WP_036487998.1|  cation-transporting ATPase PacS                    381   2e-113   
ref|WP_011320915.1|  ATPase                                             381   2e-113   
ref|WP_028319983.1|  hypothetical protein                               383   2e-113   
ref|WP_017744039.1|  ATPase                                             381   2e-113   
ref|WP_039718100.1|  cation-transporting ATPase PacS                    381   2e-113   
ref|WP_002393836.1|  copper-translocating P-type ATPase                 383   2e-113   
ref|WP_016615449.1|  copper-exporting ATPase                            383   2e-113   
ref|WP_016627736.1|  copper-exporting ATPase                            383   2e-113   
ref|WP_013758982.1|  heavy metal translocating P-type ATPase            381   3e-113   
ref|WP_002419239.1|  copper-exporting ATPase                            383   3e-113   
ref|WP_002386050.1|  copper-exporting ATPase                            383   3e-113   
ref|WP_010824979.1|  copper-exporting ATPase                            383   3e-113   
ref|WP_014524944.1|  copper-exporting ATPase                            382   3e-113   
ref|WP_013523214.1|  MULTISPECIES: ATPase P                             382   3e-113   
gb|ESU74647.1|  Copper-exporting ATPase                                 383   3e-113   
ref|WP_033601149.1|  ATPase                                             382   3e-113   
ref|WP_002416649.1|  copper-exporting ATPase                            382   3e-113   
ref|WP_013387943.1|  copper-translocating P-type ATPase                 384   3e-113   
gb|ELA04022.1|  copper-translocating P-type ATPase                      382   4e-113   
ref|WP_016614492.1|  copper-exporting ATPase                            382   4e-113   
dbj|GAJ41404.1|  copper-transporting P-type ATPase                      381   4e-113   
ref|WP_011057757.1|  cation-transporting P-type ATPase                  380   4e-113   
ref|WP_002383906.1|  copper-exporting ATPase                            382   4e-113   
ref|WP_035142779.1|  ATPase P                                           380   5e-113   
ref|WP_016617025.1|  copper-exporting ATPase                            382   5e-113   
ref|WP_010819712.1|  copper-exporting ATPase                            382   5e-113   
ref|WP_005588419.1|  copper transporter ATPase                          380   5e-113   
ref|WP_007711266.1|  hypothetical protein [                             380   5e-113   
gb|EET94407.1|  copper-translocating P-type ATPase                      382   5e-113   
ref|WP_036371305.1|  haloacid dehalogenase                              382   6e-113   
ref|WP_010713601.1|  heavy metal translocating P-type ATPase            382   6e-113   
ref|WP_002379951.1|  copper-translocating P-type ATPase                 382   6e-113   
ref|WP_011393490.1|  haloacid dehalogenase                              382   6e-113   
ref|WP_027717885.1|  haloacid dehalogenase                              381   7e-113   
gb|AJF61729.1|  Heavy-metal transporting P-type ATPase                  382   7e-113   
ref|WP_015374217.1|  copper-exporting P-type ATPase                     380   7e-113   
ref|WP_023633953.1|  ATPase P                                           380   8e-113   
ref|WP_037435599.1|  ATPase                                             381   8e-113   
dbj|GAD15139.1|  heavy metal-transporting ATPase                        380   8e-113   
dbj|GAF25181.1|  cation transport ATPase                                382   8e-113   
ref|WP_011934671.1|  copper-transporting ATPase                         379   8e-113   
ref|WP_033625318.1|  ATPase                                             381   8e-113   
dbj|GAJ59784.1|  heavy metal-transporting ATPase                        380   9e-113   
ref|WP_034588440.1|  ATPase                                             379   9e-113   
ref|WP_021321432.1|  MULTISPECIES: ATPase P                             380   9e-113   
ref|WP_013705635.1|  ATPase                                             379   9e-113   
ref|WP_031322725.1|  ATPase                                             381   9e-113   
emb|CBJ49060.1|  Copper-translocating P-type ATPase                     379   1e-112   
ref|WP_015116016.1|  copper-translocating P-type ATPase                 379   1e-112   
ref|WP_012201871.1|  copper-translocating P-type ATPase                 379   1e-112   
ref|WP_015162954.1|  copper-translocating P-type ATPase                 379   1e-112   
ref|WP_026697063.1|  ATPase                                             379   1e-112   
ref|WP_040834863.1|  ATPase                                             379   1e-112   
ref|WP_010775518.1|  heavy metal translocating P-type ATPase            381   1e-112   
ref|WP_033843360.1|  ATPase P                                           380   1e-112   
ref|WP_010823396.1|  copper-exporting ATPase                            381   1e-112   
ref|WP_009492198.1|  ATPase                                             381   1e-112   
ref|WP_016618189.1|  copper-exporting ATPase                            380   1e-112   
dbj|GAK26961.1|  ATPase                                                 381   1e-112   
ref|WP_034726433.1|  ATPase                                             380   2e-112   
ref|WP_010711350.1|  heavy metal translocating P-type ATPase            380   2e-112   
ref|WP_002397561.1|  copper-translocating P-type ATPase                 380   2e-112   
ref|WP_018379103.1|  hypothetical protein                               380   2e-112   
ref|WP_034552007.1|  ATPase                                             380   2e-112   
ref|WP_027181487.1|  ATPase                                             382   2e-112   
ref|WP_033599791.1|  ATPase                                             380   2e-112   
ref|WP_016619548.1|  copper-exporting ATPase                            380   2e-112   
ref|WP_039906271.1|  ATPase                                             380   2e-112   
ref|WP_016626063.1|  copper-exporting ATPase                            380   2e-112   
ref|WP_002408660.1|  copper-translocating P-type ATPase                 380   2e-112   
ref|WP_039714162.1|  cation-transporting ATPase PacS                    379   2e-112   
ref|WP_002395580.1|  copper-translocating P-type ATPase                 380   2e-112   
ref|WP_011367296.1|  copper-translocating P-type ATPase                 382   2e-112   
ref|WP_026098412.1|  hypothetical protein                               379   2e-112   
ref|WP_020153693.1|  ATPase P                                           379   2e-112   
ref|WP_017298697.1|  ATPase                                             378   2e-112   
pir||S36741  probable copper-transporting ATPase (EC 3.6.1.-) pac...    378   2e-112
ref|WP_002366062.1|  copper-translocating P-type ATPase                 380   2e-112   
ref|WP_033012830.1|  ATPase P                                           379   2e-112   
ref|WP_010824361.1|  copper-exporting ATPase                            380   2e-112   
gb|EBA13492.1|  heavy-metal transporting P-type ATPase                  380   2e-112   



>ref|XP_004230531.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X1 [Solanum lycopersicum]
Length=963

 Score =  1296 bits (3354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/840 (83%), Positives = 768/840 (91%), Gaps = 6/840 (1%)
 Frame = -2

Query  3224  KENPSVIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETA  3045
             KENPSV+A  GED S +SSDVIILDV GMTCGGCA+SVKRILESQP+VSSA+VNLTTETA
Sbjct  128   KENPSVVAETGEDISALSSDVIILDVTGMTCGGCASSVKRILESQPQVSSATVNLTTETA  187

Query  3044  VVWPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQA  2865
             +VWPVS+AKVVPNWQ+QLGE LAKHL++CGFK+NVRDSRREN FE FEKKMNAKR QL+ 
Sbjct  188   IVWPVSDAKVVPNWQKQLGEALAKHLSTCGFKSNVRDSRRENYFEIFEKKMNAKRIQLKE  247

Query  2864  SGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGL  2685
             SGR LAVSWALC VCLVGHLSHF GA ASWIH +HSTGFHM++ LFTLLVPGRQLIIDGL
Sbjct  248   SGRALAVSWALCGVCLVGHLSHFLGANASWIHAIHSTGFHMTLSLFTLLVPGRQLIIDGL  307

Query  2684  KSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRA  2505
             KSL+KG+PNMNTLVGLGALSSFAVSSMAA IPKLGWK FFEEPVMLIAFVLLGRNLEQRA
Sbjct  308   KSLIKGSPNMNTLVGLGALSSFAVSSMAALIPKLGWKTFFEEPVMLIAFVLLGRNLEQRA  367

Query  2504  KIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGI  2325
             KIKATSDMTGLLNVLPSKARLVV+ D+GE +STVEVP S+LSVGDQIIVLPGDR+PADGI
Sbjct  368   KIKATSDMTGLLNVLPSKARLVVSGDLGESSSTVEVPSSSLSVGDQIIVLPGDRVPADGI  427

Query  2324  VRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVE  2145
             VRAGRSTVDESSFTGEPLPVTKLPGA+VAAGSINLNG LTVEV+RPGGETAIGDIVRLVE
Sbjct  428   VRAGRSTVDESSFTGEPLPVTKLPGAEVAAGSINLNGTLTVEVRRPGGETAIGDIVRLVE  487

Query  2144  EAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqls  1965
             EAQSREAPVQRLADKV+GHFTYGVM LSAATFMFWNLFG R+LP +L+ GS+ SLALQLS
Sbjct  488   EAQSREAPVQRLADKVAGHFTYGVMTLSAATFMFWNLFGARILPPSLYHGSVVSLALQLS  547

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
             C+VLV+ACPCALGLATPTAVMVGTSLGAT+GLLLRGGSVLE FS VNTIVFDKTGTLTIG
Sbjct  548   CTVLVIACPCALGLATPTAVMVGTSLGATKGLLLRGGSVLERFSTVNTIVFDKTGTLTIG  607

Query  1784  RPTVTEVVP--QGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKS  1611
             RP VT+VV   QGH ++ +A++DSTS C+WSEVD+L  A+GVESNTNHPIGKAI+EAA++
Sbjct  608   RPVVTKVVSQGQGHQEDVDARQDSTSPCQWSEVDILKFAAGVESNTNHPIGKAIIEAAQT  667

Query  1610  RNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVV  1431
                  +K  DGTF+EEPGSGA+  I++K++SVGTL+WV+RHGV E   QE DDFKNQSVV
Sbjct  668   AKSPKLKVLDGTFMEEPGSGAVGYIDDKRISVGTLEWVKRHGVLENPFQESDDFKNQSVV  727

Query  1430  YVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPREN  1251
             YVGVDGVLAGLIYVEDQ+REDARHVVESL+KQGI+TYLLSGDKKNAAEYVASVVGIP+EN
Sbjct  728   YVGVDGVLAGLIYVEDQIREDARHVVESLTKQGISTYLLSGDKKNAAEYVASVVGIPKEN  787

Query  1250  VFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvV  1071
             V+YGVKPDEK+KFVS LQKDQKVVAMVGDGINDAAALAS+HVG+AIGGGVGAASDVSS+V
Sbjct  788   VYYGVKPDEKNKFVSRLQKDQKVVAMVGDGINDAAALASAHVGIAIGGGVGAASDVSSIV  847

Query  1070  LMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGA  891
             LM +RLSQLLDALELSRLTMKTVKQNLWWAFGYNIVG+PVAAG+LLP TGTMLTPSIAGA
Sbjct  848   LMHDRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGIPVAAGVLLPSTGTMLTPSIAGA  907

Query  890   LMGLSSIGVMTNSLLLRLKFASKQKEIQGPSVTIQIPsnsddsdnnSHKETLRQPYTESR  711
             LMGLSSIGVMTNSLLLRLKF S+QKEI G SV + IP       ++ ++E L+ PY  SR
Sbjct  908   LMGLSSIGVMTNSLLLRLKFKSRQKEIHGQSVIVDIP----FDSDSLNQEKLKHPYPTSR  963



>ref|XP_009792008.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=964

 Score =  1294 bits (3349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 703/840 (84%), Positives = 775/840 (92%), Gaps = 5/840 (1%)
 Frame = -2

Query  3224  KENPSVIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETA  3045
             KENPSV+A   ED S +SSDVIILDV GMTCGGCAASVKRILESQP+VSSA+VNLTTETA
Sbjct  128   KENPSVVAETSEDVSALSSDVIILDVTGMTCGGCAASVKRILESQPQVSSATVNLTTETA  187

Query  3044  VVWPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQA  2865
             +VWPVS+AKVVPNWQ+Q+GE LAKHLT+CGF +NVRDS REN FE FEKKMNAKR QL+ 
Sbjct  188   IVWPVSDAKVVPNWQKQIGEALAKHLTTCGFTSNVRDSGRENFFEIFEKKMNAKRIQLKE  247

Query  2864  SGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGL  2685
             SGRGLAVSWALCAVCLVGHLSHFFGAKASWIH +HSTGFHM++ LFTLLVPGRQLIIDGL
Sbjct  248   SGRGLAVSWALCAVCLVGHLSHFFGAKASWIHAMHSTGFHMTLSLFTLLVPGRQLIIDGL  307

Query  2684  KSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRA  2505
             KSL+KG+PNMNTLVGLGALSSFAVSSMAA IPKLGWK FFEEPVMLIAFVLLGRNLEQRA
Sbjct  308   KSLIKGSPNMNTLVGLGALSSFAVSSMAALIPKLGWKTFFEEPVMLIAFVLLGRNLEQRA  367

Query  2504  KIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGI  2325
             KIKATSDMTGLLNVLPSKARLVV+SD GE +STVEVP ++LSVGDQIIVLPGDR+PADGI
Sbjct  368   KIKATSDMTGLLNVLPSKARLVVSSDSGESSSTVEVPSNSLSVGDQIIVLPGDRVPADGI  427

Query  2324  VRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVE  2145
             VRAGRST+DESSFTGEPLPVTKLPGA+VAAGSINLNG LTVEV+RPGGETAIGDIVRLVE
Sbjct  428   VRAGRSTIDESSFTGEPLPVTKLPGAEVAAGSINLNGTLTVEVRRPGGETAIGDIVRLVE  487

Query  2144  EAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqls  1965
             EAQSREAPVQRLADKV+GHFTYGVM LSAATFMFWNLFG R+LP+TL+ GS+ SLALQLS
Sbjct  488   EAQSREAPVQRLADKVAGHFTYGVMTLSAATFMFWNLFGARILPSTLYHGSVVSLALQLS  547

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
             C+VLV+ACPCALGLATPTAVMVGTSLGAT+GLLLRGGSVLE FS VNT+VFDKTGTLTIG
Sbjct  548   CTVLVIACPCALGLATPTAVMVGTSLGATKGLLLRGGSVLERFSTVNTVVFDKTGTLTIG  607

Query  1784  RPTVTEVVP--QGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKS  1611
             RPTVT+VV   QG+ ++ +A++DSTS C+WSEVD+L  A+GVESNTNHPIGKAIVEAA++
Sbjct  608   RPTVTKVVSQGQGYQEDPDARQDSTSPCQWSEVDILKFAAGVESNTNHPIGKAIVEAART  667

Query  1610  RNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVV  1431
              N   +K  DGTF+EEPGSGA+  I+ K++SVGTL+WV+RHGV E  + EFDDFKNQSVV
Sbjct  668   ANSPKLKVLDGTFMEEPGSGAVGYIDNKRISVGTLEWVKRHGVLENPLLEFDDFKNQSVV  727

Query  1430  YVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPREN  1251
             YVGVDGVLAGLIYVEDQ+REDARHVVESLSKQGI+TYLLSGDKKNAAEYVASVVGIP+EN
Sbjct  728   YVGVDGVLAGLIYVEDQIREDARHVVESLSKQGISTYLLSGDKKNAAEYVASVVGIPKEN  787

Query  1250  VFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvV  1071
             VFYGVKPDEKS+FVS LQKDQ+VVAMVGDGIND AALAS+HVGVAIGGGVGAASDVSS+V
Sbjct  788   VFYGVKPDEKSRFVSRLQKDQRVVAMVGDGINDTAALASAHVGVAIGGGVGAASDVSSIV  847

Query  1070  LMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGA  891
             LM +RLSQLLDALELSRLTMKTVKQNLWWAFGYNIVG+PVAAG+LLP TGTMLTPSIAGA
Sbjct  848   LMHDRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGIPVAAGVLLPSTGTMLTPSIAGA  907

Query  890   LMGLSSIGVMTNSLLLRLKFASKQKEIQGPSVTIQIPsnsddsdnnSHKETLRQPYTESR  711
             LMGLSSIGVMTNSLLLRLKF S+QKEI GPSV ++IP    D+ ++ ++E LR PY  SR
Sbjct  908   LMGLSSIGVMTNSLLLRLKFQSRQKEIHGPSVIVEIP---SDASDSLNQEKLRHPYPTSR  964



>ref|XP_006351785.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
[Solanum tuberosum]
Length=965

 Score =  1291 bits (3341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 695/839 (83%), Positives = 767/839 (91%), Gaps = 6/839 (1%)
 Frame = -2

Query  3224  KENPSVIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETA  3045
             KENPSV+A  GED S +SSDVIILDV GMTCGGCA+SVKRILESQP+VSSA+VNLTTETA
Sbjct  128   KENPSVVAETGEDISALSSDVIILDVTGMTCGGCASSVKRILESQPQVSSATVNLTTETA  187

Query  3044  VVWPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQA  2865
             +VWPVS+AKVVPNWQ+QLGE LAKHL++CGFK+NVRDSRREN FE FEKKMNAKR QL+ 
Sbjct  188   IVWPVSDAKVVPNWQKQLGEALAKHLSTCGFKSNVRDSRRENYFEIFEKKMNAKRIQLKE  247

Query  2864  SGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGL  2685
             SGR LAVSWALC VCLVGHLSHF GAKASWIH +HSTGFHM++ LFTLLVPGRQLIIDGL
Sbjct  248   SGRALAVSWALCGVCLVGHLSHFLGAKASWIHAIHSTGFHMTLSLFTLLVPGRQLIIDGL  307

Query  2684  KSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRA  2505
             KSL+KG+PNMNTLVGLGALSSFAVSSMAA IPKLGWK FFEEPVMLIAFVLLGRNLEQRA
Sbjct  308   KSLIKGSPNMNTLVGLGALSSFAVSSMAALIPKLGWKTFFEEPVMLIAFVLLGRNLEQRA  367

Query  2504  KIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGI  2325
             KIKATSDMTGLLNVLPSKARLVV+ D GE +STVEVP ++LSVGDQIIVLPGDR+PADGI
Sbjct  368   KIKATSDMTGLLNVLPSKARLVVSGDSGESSSTVEVPSNSLSVGDQIIVLPGDRVPADGI  427

Query  2324  VRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVE  2145
             VRAGRSTVDESSFTGEPLPVTKLPGA+VAAGSINLNG LTVEV+RPGGETAIGDIVRLVE
Sbjct  428   VRAGRSTVDESSFTGEPLPVTKLPGAEVAAGSINLNGTLTVEVRRPGGETAIGDIVRLVE  487

Query  2144  EAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqls  1965
             EAQSREAPVQRLADKV+GHFTYGVM LSAATFMFWNLFG R+LP +L+ GS+ SLALQLS
Sbjct  488   EAQSREAPVQRLADKVAGHFTYGVMTLSAATFMFWNLFGARILPPSLYHGSVVSLALQLS  547

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
             C+VLV+ACPCALGLATPTAVMVGTSLGAT+GLLLRGGSVLE FS VNTIVFDKTGTLTIG
Sbjct  548   CTVLVIACPCALGLATPTAVMVGTSLGATKGLLLRGGSVLERFSTVNTIVFDKTGTLTIG  607

Query  1784  RPTVTEVVP--QGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKS  1611
             RP VT+VV   QGH ++ +A++DSTS C+WSEVD+L LA+GVESNTNHPIGKAIVEAA+ 
Sbjct  608   RPIVTKVVSQGQGHQEDADARQDSTSPCQWSEVDILKLAAGVESNTNHPIGKAIVEAAQK  667

Query  1610  RNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVV  1431
                  +K  DGTF+EEPGSGA+  I+ K++SVGTL+WV+RHGV E   QE DDFKNQSVV
Sbjct  668   AKSPKLKVLDGTFMEEPGSGAVGYIDNKRISVGTLEWVKRHGVLENPFQESDDFKNQSVV  727

Query  1430  YVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPREN  1251
             YVGVDGVLAGLIYVEDQ+REDARHVVESL+KQGI+TYLLSGDKKNAA+YVASVVGIP+EN
Sbjct  728   YVGVDGVLAGLIYVEDQIREDARHVVESLTKQGISTYLLSGDKKNAADYVASVVGIPKEN  787

Query  1250  VFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvV  1071
             V+YGVKPDEK+KFVS LQKDQK+VAMVGDGINDAAALAS+HVG+AIGGGVGAASDVSS+V
Sbjct  788   VYYGVKPDEKNKFVSRLQKDQKIVAMVGDGINDAAALASAHVGIAIGGGVGAASDVSSIV  847

Query  1070  LMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGA  891
             LM +RLSQLLDALELSRLTMKTVKQNLWWAFGYNIVG+PVAAG+LLP TGTMLTPSIAGA
Sbjct  848   LMHDRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGIPVAAGVLLPSTGTMLTPSIAGA  907

Query  890   LMGLSSIGVMTNSLLLRLKFASKQKEIQGPSVTIQIPsnsddsdnnSHKETLRQPYTES  714
             LMGLSSIGVMTNSLLLRLKF S+QKEI G SV + IP       ++ ++E L+ P +ES
Sbjct  908   LMGLSSIGVMTNSLLLRLKFKSRQKEIHGQSVIVDIP----SDSHSLNQEKLKHPDSES  962



>ref|XP_011087884.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic [Sesamum 
indicum]
Length=945

 Score =  1211 bits (3134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 662/837 (79%), Positives = 745/837 (89%), Gaps = 3/837 (0%)
 Frame = -2

Query  3218  NPSVIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVV  3039
              P+ +A    D   +SSDVIILDVGGMTCGGCAASVKRILESQP+VSSASVNLTTETA+V
Sbjct  111   KPAAVAPGAADNPALSSDVIILDVGGMTCGGCAASVKRILESQPQVSSASVNLTTETAIV  170

Query  3038  WPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASG  2859
             WPVSEAKV PNW++ +GE LAKHLTSCGFK+N+RD RR N +ETFEKK+N K   L+ SG
Sbjct  171   WPVSEAKVAPNWKKDIGEALAKHLTSCGFKSNLRDLRRVNFYETFEKKINEKHKLLKESG  230

Query  2858  RGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKS  2679
             RGL VSWALCAVC+VGH+SH FGAKA+WIH LHSTGFHM + LFTLL PGRQLI+DGL+S
Sbjct  231   RGLVVSWALCAVCIVGHISHLFGAKAAWIHALHSTGFHMCLSLFTLLGPGRQLIMDGLRS  290

Query  2678  LLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKI  2499
             LL+GAPNMNTLVGLGALSSFAVSS+AAFIPKLGWK FFEEPVMLIAFVLLGRNLEQRAKI
Sbjct  291   LLRGAPNMNTLVGLGALSSFAVSSLAAFIPKLGWKTFFEEPVMLIAFVLLGRNLEQRAKI  350

Query  2498  KATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVR  2319
             +ATSDMTGLL++LPSKARL+++ D  E +STVEVP ++LSVGDQIIVLPGDRIPADGIV 
Sbjct  351   RATSDMTGLLSILPSKARLLISGDAEESSSTVEVPSNSLSVGDQIIVLPGDRIPADGIVT  410

Query  2318  AGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEA  2139
             AGRS+VDESSFTGEPLPVTKLPGA+VAAGSINLNG + VEV+RPGGETAIGDIVRLVEEA
Sbjct  411   AGRSSVDESSFTGEPLPVTKLPGAEVAAGSINLNGRINVEVRRPGGETAIGDIVRLVEEA  470

Query  2138  QSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscs  1959
             Q+REAPVQRLADKV+GHFTYGVMALSAATFMFWNLF +R+LPA LHQGS  SLALQLSCS
Sbjct  471   QTREAPVQRLADKVAGHFTYGVMALSAATFMFWNLFSSRILPAALHQGSSMSLALQLSCS  530

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVVACPCALGLATPTAV+VGTSLGATRGLLLRGGS+LE FS VNTIVFDKTGTLTIG+P
Sbjct  531   VLVVACPCALGLATPTAVLVGTSLGATRGLLLRGGSILERFSTVNTIVFDKTGTLTIGKP  590

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
             TVT+VV QGH  +T ++ D TST +WSEV+VL LA+GVES+T HPIGKAIVEAAK+  C 
Sbjct  591   TVTKVVTQGHQADTKSELDPTSTHKWSEVEVLKLAAGVESSTIHPIGKAIVEAAKTLLCP  650

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHG-VGETRVQEFDDFKNQSVVYVG  1422
              VK  +GTF EEPGSGA+A I+EKKV+VGTL+WV+RHG VG++  QE ++FKNQSVVYVG
Sbjct  651   NVKVAEGTFTEEPGSGAVATIDEKKVAVGTLEWVQRHGVVGDSPFQEVEEFKNQSVVYVG  710

Query  1421  VDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFY  1242
             VDGVLAG+IYVEDQ+REDARHV+E L+ QGI TYLLSGDK++AAEYVASVVGIP+E V Y
Sbjct  711   VDGVLAGVIYVEDQIREDARHVIEWLTCQGINTYLLSGDKRSAAEYVASVVGIPKERVLY  770

Query  1241  GVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQ  1062
             GVKPDEK KFVS LQ++Q +VAMVGDGINDAAALASSHVGVAIGGGVGAAS+VSS+VLMQ
Sbjct  771   GVKPDEKKKFVSRLQENQHIVAMVGDGINDAAALASSHVGVAIGGGVGAASEVSSIVLMQ  830

Query  1061  NRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMG  882
             NRLSQLLDALELSRLTM+TVKQNLWWAF YNIVG+P+AAG LLP TGTML+PSIAGALMG
Sbjct  831   NRLSQLLDALELSRLTMRTVKQNLWWAFAYNIVGIPIAAGTLLPVTGTMLSPSIAGALMG  890

Query  881   LSSIGVMTNSLLLRLKFASKQKEIQGPSVTIQIPsnsddsdnnSHKETLRQPYTESR  711
             LSSIGVMTNSLLLRLKF S QK+I   S+ I+ P   D  +  +  E L+ PYT +R
Sbjct  891   LSSIGVMTNSLLLRLKFKSIQKDIFKTSLYIKAP--LDADNTANESERLKHPYTAAR  945



>ref|XP_002274497.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic [Vitis 
vinifera]
Length=928

 Score =  1181 bits (3056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/803 (79%), Positives = 716/803 (89%), Gaps = 4/803 (0%)
 Frame = -2

Query  3218  NPSVIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVV  3039
             NP   AAA E+ +  S DVIILDVGGMTCGGCAASVKRILESQP+VSS SVNLTTETA+V
Sbjct  98    NPK--AAAAEEVTGFSPDVIILDVGGMTCGGCAASVKRILESQPQVSSVSVNLTTETAIV  155

Query  3038  WPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASG  2859
             WPVSEAKV+PNWQQQLGEELAKHLT+CGFK+N RDS R+N F+ FE+KM+ KR +L+ SG
Sbjct  156   WPVSEAKVIPNWQQQLGEELAKHLTNCGFKSNPRDSVRDNFFKVFERKMDEKRNKLKESG  215

Query  2858  RGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKS  2679
             R LAVSWALCAVCL GHLSHF G KASWIH  HSTGFH+S+ LFTLL PGR LI+DGLKS
Sbjct  216   RELAVSWALCAVCLFGHLSHFLGTKASWIHAFHSTGFHLSLSLFTLLGPGRGLILDGLKS  275

Query  2678  LLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKI  2499
              LKGAPNMNTLVGLGA+SSF+VSS+AA IP+LGWKAFFEEP+MLIAFVLLGRNLEQRAKI
Sbjct  276   FLKGAPNMNTLVGLGAVSSFSVSSLAALIPELGWKAFFEEPIMLIAFVLLGRNLEQRAKI  335

Query  2498  KATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVR  2319
             KATSDMTGLL++LP+KARL +N D  E +STVEVPC+NLSVGDQI+VLPGDR+PADGIVR
Sbjct  336   KATSDMTGLLSILPAKARLFINGDSEEFSSTVEVPCNNLSVGDQIVVLPGDRVPADGIVR  395

Query  2318  AGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEA  2139
             AGRSTVDESSFTGEPLPVTKLPGA+V+AGSINLNG L VEV+RPGGETA+GDIVRLVE A
Sbjct  396   AGRSTVDESSFTGEPLPVTKLPGAEVSAGSINLNGTLRVEVRRPGGETAMGDIVRLVEAA  455

Query  2138  QSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscs  1959
             QSREAPVQRLADKV+GHFTYGVMALSAATFMFWNLFG R+LPA  HQGS  SLALQLSCS
Sbjct  456   QSREAPVQRLADKVAGHFTYGVMALSAATFMFWNLFGARILPAAFHQGSSVSLALQLSCS  515

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVVACPCALGLATPTA++VGTSLGAT+GLLLRGG++LE FS +NTIVFDKTGTLTIGRP
Sbjct  516   VLVVACPCALGLATPTAILVGTSLGATKGLLLRGGNILEKFSEMNTIVFDKTGTLTIGRP  575

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
              VT+VV  G   +T++++ S S   WSEV+VL LA+GVESNT HP+GKAIVEAA++ NC+
Sbjct  576   VVTKVVTPGCEKDTDSRKSSKSI--WSEVEVLKLAAGVESNTIHPVGKAIVEAARAVNCQ  633

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGV  1419
              VK  DGTF+EEPGSGA+A +E KKVSVGT DWV+RHGV E   QE D+ KNQSVVYVGV
Sbjct  634   NVKVVDGTFVEEPGSGAVATVENKKVSVGTFDWVQRHGVQENPFQEVDELKNQSVVYVGV  693

Query  1418  DGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG  1239
             DG LAGLIY EDQ+R+DARHVVESLS+QGI+ Y+LSGDK+NAAE+VAS VGIP++ V  G
Sbjct  694   DGTLAGLIYFEDQIRDDARHVVESLSRQGISVYMLSGDKRNAAEHVASSVGIPKDKVLSG  753

Query  1238  VKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQN  1059
             VKP+EKSKF+  LQK    VAMVGDGINDAAALASS +G+A+GGGVGAAS+VSS+VLM N
Sbjct  754   VKPNEKSKFIRELQKAHNTVAMVGDGINDAAALASSDIGIAMGGGVGAASEVSSIVLMGN  813

Query  1058  RLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGL  879
             RLSQLLDA ELSRLTMKTVKQNLWWAF YNIVG+P+AAG+LLP TGTMLTPSIAGALMGL
Sbjct  814   RLSQLLDAFELSRLTMKTVKQNLWWAFAYNIVGIPIAAGMLLPITGTMLTPSIAGALMGL  873

Query  878   SSIGVMTNSLLLRLKFASKQKEI  810
             SS+GVMTNSLLLR KF++KQK+I
Sbjct  874   SSVGVMTNSLLLRSKFSAKQKQI  896



>ref|XP_011004985.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
[Populus euphratica]
Length=949

 Score =  1159 bits (2997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/838 (76%), Positives = 725/838 (87%), Gaps = 6/838 (1%)
 Frame = -2

Query  3221  ENPSVIAAAG-EDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETA  3045
             E+ SV  A G E+A V+S DVIILDVGGMTCGGCAASVKRILESQ +V SASVNL TETA
Sbjct  115   ESNSVAEAVGAEEAPVLSPDVIILDVGGMTCGGCAASVKRILESQSQVFSASVNLATETA  174

Query  3044  VVWPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQA  2865
             +V PVSEAKVVPNWQ+QLGE LAKHLTSCGF +N+RD  R+N+F+ FEKKM+ KR +L+ 
Sbjct  175   IVRPVSEAKVVPNWQKQLGEALAKHLTSCGFISNLRDEGRDNVFKIFEKKMDEKRDRLKE  234

Query  2864  SGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGL  2685
             SG  LAVSWALCAVCL+GH+SH F  KASWIH+ HS GFH+S+ LFTLL PGRQLI DG+
Sbjct  235   SGHQLAVSWALCAVCLLGHVSHIFATKASWIHVFHSVGFHLSLSLFTLLGPGRQLIHDGV  294

Query  2684  KSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRA  2505
             KSL KGAPNMNTLVGLGALSSFAVSS+AA +PKLGWKAFFEEP+MLIAFVLLGRNLEQRA
Sbjct  295   KSLFKGAPNMNTLVGLGALSSFAVSSLAALVPKLGWKAFFEEPIMLIAFVLLGRNLEQRA  354

Query  2504  KIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGI  2325
             KIKATSDMTGLL+VLP+ ARLVVN D  +  S VEVPCSNLSVGDQI+VLPGDR+PADG+
Sbjct  355   KIKATSDMTGLLSVLPTIARLVVNGDAKDLGSIVEVPCSNLSVGDQIVVLPGDRVPADGM  414

Query  2324  VRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVE  2145
             VRAGRST+DESSFTGEPLPVTKLPG+QV+AGSINLNG LT+EV+RPGGETA+GDIVRLVE
Sbjct  415   VRAGRSTIDESSFTGEPLPVTKLPGSQVSAGSINLNGTLTIEVKRPGGETAMGDIVRLVE  474

Query  2144  EAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqls  1965
             EAQSREAPVQRLADKVSGHFTYGVMA+S ATFMFW++FGTR+LPA L+QG+  SLALQLS
Sbjct  475   EAQSREAPVQRLADKVSGHFTYGVMAISVATFMFWSMFGTRILPAALNQGNPVSLALQLS  534

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
             CSVLVVACPCALGLATPTAV+VGTSLGATRGLLLRGG+VLE FSMVN++VFDKTGTLTIG
Sbjct  535   CSVLVVACPCALGLATPTAVLVGTSLGATRGLLLRGGNVLEKFSMVNSVVFDKTGTLTIG  594

Query  1784  RPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRN  1605
             RP VT+VV     + T+++    +   WSEV+VL LA+GVESNT HP+GKAIVEAA++ +
Sbjct  595   RPVVTKVVSLRGMEITDSQLKPNAM--WSEVEVLKLAAGVESNTIHPVGKAIVEAAQAAS  652

Query  1604  CRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYV  1425
             C  VK  DGTF+EEPGSGA+A IE K VSVGTLDW+RR+GV E   QE +D +NQSVVYV
Sbjct  653   CTSVKVTDGTFMEEPGSGAVATIENKVVSVGTLDWIRRNGVCENPFQEVEDIENQSVVYV  712

Query  1424  GVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVF  1245
             GVD  LAGLIY EDQ+REDAR VVESLS QGI  Y+LSGD+K  AEYVAS+VGIP+E V 
Sbjct  713   GVDNTLAGLIYFEDQIREDARQVVESLSCQGINVYMLSGDRKKNAEYVASLVGIPKEKVL  772

Query  1244  YGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLM  1065
              GVKPDEK KF+S LQKDQ +VAMVGDGINDAAALA SHVGVA+G GVGAAS+VSS+VLM
Sbjct  773   SGVKPDEKKKFISELQKDQNIVAMVGDGINDAAALAESHVGVAMGEGVGAASEVSSIVLM  832

Query  1064  QNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALM  885
              NRLSQ+LDALELSRLTMKTVKQNLWWAF YNIVG+P+AAG+LLP TGT+LTPSIAGALM
Sbjct  833   GNRLSQVLDALELSRLTMKTVKQNLWWAFAYNIVGIPIAAGMLLPITGTILTPSIAGALM  892

Query  884   GLSSIGVMTNSLLLRLKFASKQKEIQGPSVTIQIPsnsddsdnnSHKETLRQPYTESR  711
             GLSSIGVMTNSLLLRLKF+SKQK++ G S     P    DS     KE ++ P ++SR
Sbjct  893   GLSSIGVMTNSLLLRLKFSSKQKKVHGASPD---PKIYLDSVLLDQKEKIKPPCSDSR  947



>ref|XP_011002071.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
[Populus euphratica]
Length=949

 Score =  1149 bits (2972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/839 (76%), Positives = 723/839 (86%), Gaps = 5/839 (1%)
 Frame = -2

Query  3221  ENPSVIAAAG-EDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETA  3045
             E+ SV  A G E+ S +S DVIILDVGGMTCGGCAASVKRILESQP+VSSASVNL TETA
Sbjct  110   ESNSVAGAVGAEEVSTLSPDVIILDVGGMTCGGCAASVKRILESQPQVSSASVNLATETA  169

Query  3044  VVWPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQA  2865
             +VWPVSEAK VPNWQ+QLGE LAKHLTSCGF +N+RD+ R+N F+ FEKKM+ KR +L+ 
Sbjct  170   IVWPVSEAKGVPNWQKQLGEALAKHLTSCGFMSNLRDAGRQNFFKIFEKKMDEKRDRLKE  229

Query  2864  SGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGL  2685
             S   LAVS ALCAVCL+GH+SH F AK  WIH+ HS GFH+S+ LFTLL PGRQLI+DG+
Sbjct  230   SSHQLAVSCALCAVCLLGHVSHIFAAKPPWIHVFHSVGFHVSLSLFTLLGPGRQLILDGV  289

Query  2684  KSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRA  2505
             KSL KGAPNMNTLVGLGALSSFAVSS+AA IPKLGWKAFFEEP+MLIAFVLLGRNLEQRA
Sbjct  290   KSLSKGAPNMNTLVGLGALSSFAVSSLAALIPKLGWKAFFEEPIMLIAFVLLGRNLEQRA  349

Query  2504  KIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGI  2325
             KIKATSDMTGLL+VLP+ ARLVVN D  +  S VEVPCS+LSVGD+I+VLPGDR+PADG 
Sbjct  350   KIKATSDMTGLLSVLPTIARLVVNGDAKDLGSIVEVPCSSLSVGDKIVVLPGDRVPADGT  409

Query  2324  VRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVE  2145
             V AGRST+DESSFTGEPLPVTKLPG+QV+AGSINLNG L +EV RPGGETA+GDIVRLVE
Sbjct  410   VTAGRSTIDESSFTGEPLPVTKLPGSQVSAGSINLNGTLKIEVTRPGGETAMGDIVRLVE  469

Query  2144  EAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqls  1965
             EAQSREAPVQRLADKVSGHFTYGVM +SAATFMFW++FGTR+LPATL+QG+  SLALQLS
Sbjct  470   EAQSREAPVQRLADKVSGHFTYGVMTISAATFMFWSMFGTRILPATLNQGNPISLALQLS  529

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
             CSVLVVACPCALGLATPTAV+VGTSLGATRGLLLRGG+VLE FSMVN++VFDKTGTLTIG
Sbjct  530   CSVLVVACPCALGLATPTAVLVGTSLGATRGLLLRGGNVLEKFSMVNSVVFDKTGTLTIG  589

Query  1784  RPTVTEVVPQGHNDETNAKRDSTST-CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSR  1608
             RP VT+VVP G    T+++ +  +T    SEV++L LA+GVESNT HP+GKAIVEAA++ 
Sbjct  590   RPAVTKVVPFGGMKITDSQLNPDATDATLSEVELLKLAAGVESNTIHPVGKAIVEAAQAA  649

Query  1607  NCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVY  1428
              C+ VK  +GTF+EEPGSGA+A IE K VS+GTLDW++RHGV E   QE +D KNQSVVY
Sbjct  650   GCQNVKVTEGTFMEEPGSGAVATIENKVVSIGTLDWIQRHGVDEKPFQEVEDLKNQSVVY  709

Query  1427  VGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENV  1248
             VGVD  LAGLIY EDQ+REDAR VVESLS QGI  Y+LSGDKK+ AE+VAS+VGIP+E V
Sbjct  710   VGVDNTLAGLIYFEDQIREDARQVVESLSCQGINVYMLSGDKKSTAEHVASLVGIPKEKV  769

Query  1247  FYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVL  1068
               GVKPDEK KF+S LQKDQ +VAMVGDGINDAAA A SHVGVA+GGGVGAAS+VSS+VL
Sbjct  770   LSGVKPDEKKKFISELQKDQSIVAMVGDGINDAAAFAESHVGVAMGGGVGAASEVSSIVL  829

Query  1067  MQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGAL  888
             M NRLSQ+LDALELSRLTMKTVKQNLWWAF YNIVG+P+AAG+LLP  GT+LTPSIAGAL
Sbjct  830   MGNRLSQVLDALELSRLTMKTVKQNLWWAFAYNIVGIPIAAGMLLPVNGTILTPSIAGAL  889

Query  887   MGLSSIGVMTNSLLLRLKFASKQKEIQGPSVTIQIPsnsddsdnnSHKETLRQPYTESR  711
             MGLSSIGVMTNSLLLR KF+ KQK++ G S   +I     DS     KE  +QPY++SR
Sbjct  890   MGLSSIGVMTNSLLLRFKFSLKQKKVYGASPNTKI---DVDSVLLYQKEKTKQPYSDSR  945



>ref|XP_002531490.1| copper-transporting atpase paa1, putative [Ricinus communis]
 gb|EEF30897.1| copper-transporting atpase paa1, putative [Ricinus communis]
Length=947

 Score =  1138 bits (2943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 622/801 (78%), Positives = 706/801 (88%), Gaps = 3/801 (0%)
 Frame = -2

Query  3212  SVIAAAG-EDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVW  3036
             S +AA G ED S +S DVIILDVGGMTCGGCAASVKRILESQP+VSSA+VNLTTETAVVW
Sbjct  112   SNLAAGGTEDVSALSPDVIILDVGGMTCGGCAASVKRILESQPQVSSATVNLTTETAVVW  171

Query  3035  PVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGR  2856
             PVSEA V+PNW+++LGE LAKHLT+CGF +N RD+ R+N F+ FEKKM+ KRA+L+ SGR
Sbjct  172   PVSEATVIPNWKKELGEALAKHLTTCGFSSNPRDAGRQNFFDVFEKKMDEKRARLKESGR  231

Query  2855  GLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSL  2676
              LAVSWALCAVCL+GHLSH F  KASWIHL HSTGFH+SM LFTLL PGRQLI+DGLKSL
Sbjct  232   ELAVSWALCAVCLLGHLSHIFPLKASWIHLFHSTGFHLSMSLFTLLGPGRQLILDGLKSL  291

Query  2675  LKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIK  2496
              KGAPNMNTLVGLGALSSFAVSS+AA IP+LGWKAFFEEP+MLIAFVLLGRNLEQRAKIK
Sbjct  292   FKGAPNMNTLVGLGALSSFAVSSLAALIPRLGWKAFFEEPIMLIAFVLLGRNLEQRAKIK  351

Query  2495  ATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRA  2316
             A SDMTGLL++LPSKARL+V S++ +  S VEVPC++LSVGDQI+VLPGDR+PADGIVRA
Sbjct  352   AASDMTGLLSILPSKARLLVQSNIEDPGSIVEVPCTSLSVGDQIVVLPGDRVPADGIVRA  411

Query  2315  GRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQ  2136
             GRST+DESSFTGEPLPVTKLPG++VAAGSINLNG LTVEVQRPGGETAIGDIVRLVEEAQ
Sbjct  412   GRSTIDESSFTGEPLPVTKLPGSKVAAGSINLNGTLTVEVQRPGGETAIGDIVRLVEEAQ  471

Query  2135  SREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsv  1956
              REAPVQRLADKVSGHFTYGVMALSAATFMFW LFGT +LP  ++ G+  SLALQLSCSV
Sbjct  472   GREAPVQRLADKVSGHFTYGVMALSAATFMFWKLFGTHMLPPAVYHGNPVSLALQLSCSV  531

Query  1955  lvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPT  1776
             LV+ACPCALGLATPTAV+VGTSLGATRGLLLRGG+VLE FSMV TIVFDKTGTLTIGRP 
Sbjct  532   LVIACPCALGLATPTAVLVGTSLGATRGLLLRGGNVLEKFSMVKTIVFDKTGTLTIGRPV  591

Query  1775  VTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRI  1596
             VT+VV  G    T+ + ++    +WSEV+VL LA+ VESNT HP+GKAIV+AA++   + 
Sbjct  592   VTKVVTLGDIKITDTQMNANH--KWSEVEVLRLAAAVESNTLHPVGKAIVQAAQAVTYQN  649

Query  1595  VKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVD  1416
             +K  DGTF+EEPGSGA+A ++ K+VSVGTLDWV+R+GV     QE +D KNQS+VYVGV+
Sbjct  650   MKVTDGTFMEEPGSGAVATVDNKQVSVGTLDWVQRNGVDGILFQEVEDLKNQSIVYVGVE  709

Query  1415  GVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGV  1236
               LAG+IY+EDQ+REDAR VVESL +QGI  Y+LSGDK+  AE+VASVVGI +E V  GV
Sbjct  710   NTLAGIIYLEDQIREDARQVVESLCRQGIDVYMLSGDKRTTAEHVASVVGIQKEKVLAGV  769

Query  1235  KPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNR  1056
             KPDEK KF+S LQK Q +VAMVGDGINDAAALA SHVGVA+GGGVGAAS+VSSVVL  NR
Sbjct  770   KPDEKKKFISELQKHQNIVAMVGDGINDAAALALSHVGVAMGGGVGAASEVSSVVLTGNR  829

Query  1055  LSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLS  876
             LSQLLDALELSRLTMKTVKQNLWWAF YNI+G+P+AAG+LLP TGTMLTPSIAGALMGLS
Sbjct  830   LSQLLDALELSRLTMKTVKQNLWWAFAYNIIGIPIAAGMLLPLTGTMLTPSIAGALMGLS  889

Query  875   SIGVMTNSLLLRLKFASKQKE  813
             SIGVMTNSLLLR KF+SKQ +
Sbjct  890   SIGVMTNSLLLRFKFSSKQTQ  910



>ref|XP_008237377.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic [Prunus 
mume]
Length=953

 Score =  1135 bits (2937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/804 (77%), Positives = 701/804 (87%), Gaps = 2/804 (0%)
 Frame = -2

Query  3209  VIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPV  3030
             V+AA  ++ S VS+DV++LDVGGMTCGGCAASVKRILESQP+VSSASVNLTTETAVVWPV
Sbjct  123   VVAAGCDEISAVSTDVVVLDVGGMTCGGCAASVKRILESQPQVSSASVNLTTETAVVWPV  182

Query  3029  SEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGL  2850
             SEAKV PNWQ+QLGE LAKHLT+CGFK+N+RDS R+N  + FE+KM  KR +L+ SG  L
Sbjct  183   SEAKVTPNWQKQLGETLAKHLTNCGFKSNLRDSGRDNFLKVFERKMEEKRKRLKESGNEL  242

Query  2849  AVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLK  2670
             A SWALCAVCLVGHLSHFFGAKASWIH LHSTGFH+S+CLFTLL PGR+LI+DGL+SL+K
Sbjct  243   AFSWALCAVCLVGHLSHFFGAKASWIHALHSTGFHLSLCLFTLLGPGRRLIVDGLRSLVK  302

Query  2669  GAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKAT  2490
             GAPNMNTLVGLGALSSF VSS+AAFIPKLGWK FFEEP+MLIAFVLLGRNLEQRAKIKAT
Sbjct  303   GAPNMNTLVGLGALSSFTVSSIAAFIPKLGWKTFFEEPIMLIAFVLLGRNLEQRAKIKAT  362

Query  2489  SDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGR  2310
             SDMT LL+++PSKARL+VN    E  S VEVP ++LSVGDQI+VLPG+R+P DGIV+AGR
Sbjct  363   SDMTELLSIIPSKARLLVNDGAKELESIVEVPSNSLSVGDQIVVLPGERVPVDGIVKAGR  422

Query  2309  STVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSR  2130
             S +DESSFTGEPLPVTKLPG+QVAAGSINLNG LTVEVQRPGGETA+ DIVRLVEEAQSR
Sbjct  423   SIIDESSFTGEPLPVTKLPGSQVAAGSINLNGTLTVEVQRPGGETAMADIVRLVEEAQSR  482

Query  2129  EAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlv  1950
             EAPVQRLADKV+GHFTYGVM LSAATF+FW+L G  +LPA    G+  SLALQLSCSVLV
Sbjct  483   EAPVQRLADKVAGHFTYGVMTLSAATFLFWSLIGGHILPAAFQGGNSVSLALQLSCSVLV  542

Query  1949  vaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVT  1770
             VACPCALGLATPTAV+VGTSLGA RGLLLRGG++LE FSMVNTIVFDKTGTLT+G+P VT
Sbjct  543   VACPCALGLATPTAVLVGTSLGAKRGLLLRGGNILEKFSMVNTIVFDKTGTLTMGKPVVT  602

Query  1769  EVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVK  1590
             +++    +  T+ +     T  WSEVDVL  A+GVESNT HP+GKAIVEAA++ NC+ +K
Sbjct  603   KILTPERSKVTDLQEKFNHT--WSEVDVLKFAAGVESNTVHPVGKAIVEAAQAVNCQNMK  660

Query  1589  AEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGV  1410
               DGTF+EEPGSGA+A IE KKVS+GTLDWV+RHGV E    E +  K+QSVVYVG+D  
Sbjct  661   IVDGTFLEEPGSGAVATIENKKVSIGTLDWVQRHGVNENPFLEVEAHKSQSVVYVGIDST  720

Query  1409  LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKP  1230
             LAGLIY EDQ+REDA  VV+SLSKQGI  Y+LSGDK+N AEYVASVVGIP+E V  GVKP
Sbjct  721   LAGLIYFEDQIREDAGQVVKSLSKQGINVYMLSGDKRNNAEYVASVVGIPKEKVISGVKP  780

Query  1229  DEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLS  1050
              EK KF++ LQKDQ +VAMVGDGINDAAALASSHVG+A+GGGVGAAS+VSS+VL+ NRLS
Sbjct  781   REKKKFITELQKDQNIVAMVGDGINDAAALASSHVGIAMGGGVGAASEVSSIVLLGNRLS  840

Query  1049  QLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSI  870
             Q+LDALELSRLTMKTVKQNLWWAF YNIVGLP+AAG+LLP TGTMLTPSIAGALMGLSS+
Sbjct  841   QVLDALELSRLTMKTVKQNLWWAFAYNIVGLPIAAGVLLPVTGTMLTPSIAGALMGLSSV  900

Query  869   GVMTNSLLLRLKFASKQKEIQGPS  798
             GVM NSL LR KF+SKQ EI   S
Sbjct  901   GVMANSLFLRYKFSSKQGEIYSRS  924



>ref|XP_010065583.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic [Eucalyptus 
grandis]
 gb|KCW63154.1| hypothetical protein EUGRSUZ_G00769 [Eucalyptus grandis]
Length=953

 Score =  1131 bits (2925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/803 (77%), Positives = 708/803 (88%), Gaps = 3/803 (0%)
 Frame = -2

Query  3191  EDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVV  3012
             EDAS VSSDVIILDVGGMTCGGCAASVKRILE+QP+VS+ASVNLTTETA+VWPVSEAK V
Sbjct  131   EDASAVSSDVIILDVGGMTCGGCAASVKRILENQPKVSAASVNLTTETAIVWPVSEAKAV  190

Query  3011  PNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWAL  2832
             P+WQ++LGE LAK LT+CGF++N RD    N F+ FE+KMN K  +L+ SGR LAVSWAL
Sbjct  191   PDWQKELGETLAKQLTNCGFESNPRDGGGHNFFKVFERKMNEKHDRLKESGRQLAVSWAL  250

Query  2831  CAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMN  2652
             CAVCL+GHLSHFFGAKA WIH  HSTGFH+S+ LFTL+ PGR LI DGL++LL+GAPNMN
Sbjct  251   CAVCLLGHLSHFFGAKAPWIHAFHSTGFHLSLSLFTLIGPGRGLIFDGLRNLLRGAPNMN  310

Query  2651  TLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGL  2472
             TLVGLGALSSF VS++A  +PKLGWKAFFEEP+ML+AFVLLGRNLEQRAKIKATSDMTGL
Sbjct  311   TLVGLGALSSFCVSTLATLVPKLGWKAFFEEPIMLVAFVLLGRNLEQRAKIKATSDMTGL  370

Query  2471  LNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDES  2292
             L++LPSKARL+V+ D  +  S VEVPC+ L+VGD+I++LPGDR+PADG+VRAGRSTVDES
Sbjct  371   LSILPSKARLLVSGDEEDLGSIVEVPCNTLAVGDRIVILPGDRVPADGVVRAGRSTVDES  430

Query  2291  SFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQR  2112
             SFTGEPLP TKLPG+QVAAGSINLNG LTVEVQRPGGETA+GDIVRLVEEAQ+REAPVQR
Sbjct  431   SFTGEPLPATKLPGSQVAAGSINLNGSLTVEVQRPGGETAMGDIVRLVEEAQTREAPVQR  490

Query  2111  LADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCA  1932
             LADKVSGHFTYGVMALSAATF+FWN+FG+R+LPA L+QGS  SLALQLSCSVLVVACPCA
Sbjct  491   LADKVSGHFTYGVMALSAATFVFWNVFGSRILPAALNQGSSVSLALQLSCSVLVVACPCA  550

Query  1931  LGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQG  1752
             LGLATPTAV+VGTSLGAT+GLLLRGGSVLE FSMVNT+VFDKTGTLT+G+P VT+VV  G
Sbjct  551   LGLATPTAVLVGTSLGATKGLLLRGGSVLEKFSMVNTVVFDKTGTLTLGKPVVTKVVTPG  610

Query  1751  HNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTF  1572
                  +++ +S  T  WSEV+VL  A+GVESNT HP+GKAIVEAA++RNC  VKA DGTF
Sbjct  611   CAQPIDSRHNSDDT--WSEVEVLQFAAGVESNTIHPVGKAIVEAAQARNCTKVKAVDGTF  668

Query  1571  IEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIY  1392
             IEEPGSGA+AVI  K+VSVG L+W+RRHGV +  ++  ++ KNQSVVYVGVD  LAGLIY
Sbjct  669   IEEPGSGAVAVINNKRVSVGNLEWIRRHGV-DADIRLMEEPKNQSVVYVGVDNSLAGLIY  727

Query  1391  VEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKF  1212
             +EDQ+REDARHVV SLSK G+  Y+LSGD+++ A+YVAS+VGIP E V  GVKPD+K KF
Sbjct  728   IEDQIREDARHVVSSLSKHGVDVYMLSGDRRSTADYVASMVGIPLEKVISGVKPDQKKKF  787

Query  1211  VSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             +S LQ+D KVVAMVGDGINDAAALASSHVGVA+GGGVGAAS+VSSVVLM NRLSQLLDAL
Sbjct  788   ISELQQDDKVVAMVGDGINDAAALASSHVGVAMGGGVGAASEVSSVVLMGNRLSQLLDAL  847

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
             ELS+LTMKT+KQNLWWAF YNIVG+P+AAG+LLP TG  LTPSIAGALMGLSSIGVM NS
Sbjct  848   ELSQLTMKTIKQNLWWAFAYNIVGIPIAAGVLLPMTGITLTPSIAGALMGLSSIGVMANS  907

Query  851   LLLRLKFASKQKEIQGPSVTIQI  783
             LLLR KF+SKQ +I     TI +
Sbjct  908   LLLRFKFSSKQNKISRLPSTIHL  930



>gb|KDP27349.1| hypothetical protein JCGZ_20173 [Jatropha curcas]
Length=953

 Score =  1130 bits (2922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/832 (75%), Positives = 714/832 (86%), Gaps = 6/832 (1%)
 Frame = -2

Query  3203  AAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSE  3024
             A A ED S +SSDVIILDVGGMTCGGCAASVKRILE+QP+VSSASVNLTTE AVVWPVSE
Sbjct  122   AGAAEDVSALSSDVIILDVGGMTCGGCAASVKRILENQPQVSSASVNLTTEIAVVWPVSE  181

Query  3023  AKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAV  2844
             AKVVPNWQ+QLGEELAKHLT+CGFK+N+RD+  +N    FEKKM+ K  +L+ SGR LAV
Sbjct  182   AKVVPNWQKQLGEELAKHLTNCGFKSNLRDAGTDNFLRVFEKKMDEKHDRLKESGRELAV  241

Query  2843  SWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGA  2664
             SWALCAVCL GHLSH F  K  WI+L HSTGFH+S+ LFTLL PGRQLI+DG+KSL KGA
Sbjct  242   SWALCAVCLFGHLSHIFALKLPWINLFHSTGFHLSLSLFTLLGPGRQLILDGMKSLFKGA  301

Query  2663  PNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSD  2484
             PNMNTLVGLGALSSF VSS+AA IP LGWKAFFEEP+MLIAFVLLGRNLEQRAKIKATSD
Sbjct  302   PNMNTLVGLGALSSFTVSSLAALIPSLGWKAFFEEPIMLIAFVLLGRNLEQRAKIKATSD  361

Query  2483  MTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             MTGLL++LPSKARL+V+ D     S VEVP ++LS+GDQI+V PGDR+PADGIV+AGRST
Sbjct  362   MTGLLSILPSKARLLVHCDAKGPDSIVEVPSTSLSIGDQIVVRPGDRVPADGIVKAGRST  421

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             +DESSFTGEPLPVTKLPG+QVAAGSINLNG LTVEV+RPGGETAI DI+RLVEEAQSREA
Sbjct  422   IDESSFTGEPLPVTKLPGSQVAAGSINLNGTLTVEVRRPGGETAIADIIRLVEEAQSREA  481

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvva  1944
             PVQRLADKVSG FTYGVMALSAATFMFWNLFGT VLPA  H G+  SLALQLSCSVLV+A
Sbjct  482   PVQRLADKVSGQFTYGVMALSAATFMFWNLFGTHVLPAIQH-GNPVSLALQLSCSVLVIA  540

Query  1943  CPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV  1764
             CPCALGLATPTAV+VGTSLGATRGLLLRGGS+LE FSMV TIVFDKTGTLT+GRP VT++
Sbjct  541   CPCALGLATPTAVLVGTSLGATRGLLLRGGSILEKFSMVKTIVFDKTGTLTVGRPVVTKI  600

Query  1763  VPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVK-A  1587
             +  G    T+A+ +S S   WSE +VL LA+ VESNT HP+GKAIVEAA++   + VK  
Sbjct  601   LTLGGVKITDAQLNSNSM--WSEGEVLKLAAAVESNTVHPVGKAIVEAAQAVGHQNVKQV  658

Query  1586  EDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVL  1407
              DGTF+EEPGSGA+A IE KKVSVGTLDWV+RHGV +   QE +D K QSVVYVGVD  L
Sbjct  659   ADGTFMEEPGSGAVATIENKKVSVGTLDWVQRHGVYQNPFQEVEDVKEQSVVYVGVDDTL  718

Query  1406  AGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPD  1227
             AGLIY+EDQ+REDAR+VVESLS+QGI  Y+LSGDK+  AEYVAS+VGIP+E V  GVKP+
Sbjct  719   AGLIYLEDQIREDARNVVESLSRQGINVYMLSGDKRKTAEYVASIVGIPKEKVLAGVKPN  778

Query  1226  EKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQ  1047
             EK KF++ LQKD  +VAMVGDGINDAAALASSHVGVA+GGGVGAAS+VSS+VL  N+LSQ
Sbjct  779   EKEKFITELQKDHNIVAMVGDGINDAAALASSHVGVAMGGGVGAASEVSSIVLTGNKLSQ  838

Query  1046  LLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIG  867
             LLDALELSRLTMKTVKQNLWWAF YNI+G+P+AAG+LLP TGTMLTPSIAGALMGLSSIG
Sbjct  839   LLDALELSRLTMKTVKQNLWWAFAYNIIGIPIAAGMLLPITGTMLTPSIAGALMGLSSIG  898

Query  866   VMTNSLLLRLKFASKQKEIQGPSVTIQIPsnsddsdnnSHKETLRQPYTESR  711
             VM+NSLLLRLKF+SKQK+  G S + +  +          ++ + Q YT+++
Sbjct  899   VMSNSLLLRLKFSSKQKQAHGESPSTK--TFLGSDFLMDQRKKMDQSYTDAK  948



>ref|XP_010267977.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic [Nelumbo 
nucifera]
Length=961

 Score =  1129 bits (2919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/800 (76%), Positives = 704/800 (88%), Gaps = 4/800 (1%)
 Frame = -2

Query  3206  IAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVS  3027
             IA   E+ S +S DVIILDVGGMTCGGCAASVKRILE+QP+VSSA+VNL TETA+VWPV+
Sbjct  130   IAGGSEEVSALSPDVIILDVGGMTCGGCAASVKRILENQPQVSSANVNLATETAIVWPVA  189

Query  3026  EAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLA  2847
               KV  NWQQQLGE LAKHLT+CGFK+ +RDS RE+ F+ FE+KM+ KR  LQ SGR LA
Sbjct  190   AVKVTQNWQQQLGETLAKHLTNCGFKSKLRDSSRESFFQVFERKMDEKRIHLQESGRNLA  249

Query  2846  VSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKG  2667
             VSWALCAVCL GHLSHF GA ASW+H  HSTGFH S+ LFTLL PGRQLI+DGLKSL++G
Sbjct  250   VSWALCAVCLFGHLSHFLGANASWMHAFHSTGFHFSLSLFTLLGPGRQLILDGLKSLMRG  309

Query  2666  APNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATS  2487
             APNMNTLVGLGALSSFAVSS+AA IPKLGWKAFFEEP+MLIAFVLLGRNLEQRAK+KATS
Sbjct  310   APNMNTLVGLGALSSFAVSSIAALIPKLGWKAFFEEPIMLIAFVLLGRNLEQRAKLKATS  369

Query  2486  DMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRS  2307
             DMTGLL++LPSKARLVV+ D+ E  S VEVPCSNL++GD+I+VLPGDRIPADGIVRAGRS
Sbjct  370   DMTGLLSILPSKARLVVDGDVEEVNSIVEVPCSNLAIGDKIVVLPGDRIPADGIVRAGRS  429

Query  2306  TVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSRE  2127
             TVDESSFTGEPLP+TKLPGA+VAAGSINLNG LT+EV+R GGE+ +G IV LVEEAQSRE
Sbjct  430   TVDESSFTGEPLPITKLPGAEVAAGSINLNGTLTIEVRRSGGESVMGGIVXLVEEAQSRE  489

Query  2126  APVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvv  1947
             APVQRLADKV+GHFTYGVMALSAATFMFW  FGT++LPA  HQG   SLALQLSCSVLV+
Sbjct  490   APVQRLADKVAGHFTYGVMALSAATFMFWKFFGTQILPAAFHQGDSLSLALQLSCSVLVI  549

Query  1946  aCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTE  1767
             ACPCALGLATPTAV+VGTSLGATRGLLLRGGS+LE F++VNTIVFDKTGTLT GRP VT+
Sbjct  550   ACPCALGLATPTAVLVGTSLGATRGLLLRGGSILEKFALVNTIVFDKTGTLTAGRPIVTK  609

Query  1766  V-VPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVK  1590
             + +P+   D+ NAK++S    EWSE++VL LA+ VESNT HPIGKAIVEAA+   C+ VK
Sbjct  610   IAIPECEGDK-NAKKNSDH--EWSEMEVLRLAAAVESNTIHPIGKAIVEAARLAGCQHVK  666

Query  1589  AEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGV  1410
               DGTF EEPGSGA+A I +KKVS+GTL+WV+RHGV     +E ++FKNQS+VYVG+D  
Sbjct  667   VVDGTFKEEPGSGAVATIGQKKVSIGTLEWVQRHGVDGNPFKEVEEFKNQSIVYVGIDSS  726

Query  1409  LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKP  1230
             LAGLIY ED++REDA +VVESLSKQG + Y+LSGDKK+ AEYVASVVGI ++ V  GVKP
Sbjct  727   LAGLIYFEDKIREDACYVVESLSKQGKSIYMLSGDKKHTAEYVASVVGISKDKVLSGVKP  786

Query  1229  DEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLS  1050
             DEK KF+S LQK++K+VAMVGDGINDAAALASS +GVA+G GVGAASDVS+VVL+ N+LS
Sbjct  787   DEKKKFISELQKNRKIVAMVGDGINDAAALASSDIGVAMGSGVGAASDVSNVVLLGNKLS  846

Query  1049  QLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSI  870
             QLL+A+ELS++TM+TVKQNLWWAF YNIVG+P+AAG+LLP TGT+LTPSIAGALMGLSS+
Sbjct  847   QLLEAMELSKMTMRTVKQNLWWAFAYNIVGIPIAAGLLLPVTGTILTPSIAGALMGLSSL  906

Query  869   GVMTNSLLLRLKFASKQKEI  810
             GVMTNSLLLRLKFAS++K I
Sbjct  907   GVMTNSLLLRLKFASREKPI  926



>ref|XP_006487649.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=932

 Score =  1127 bits (2916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/802 (77%), Positives = 708/802 (88%), Gaps = 7/802 (1%)
 Frame = -2

Query  3194  GEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKV  3015
             GE+ S +SSDVIILDVGGMTCGGCAASVKRILESQP+VSSASVNLTTETA+VWPVS+AKV
Sbjct  117   GEELSALSSDVIILDVGGMTCGGCAASVKRILESQPQVSSASVNLTTETAIVWPVSKAKV  176

Query  3014  VPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWA  2835
             +PNWQ+QLGE LAKHLTSCGFK+++RD   +N F+ FE KM+ KR +L+ SGRGLAVSWA
Sbjct  177   IPNWQRQLGEALAKHLTSCGFKSSLRDMGTDNFFKVFETKMHEKRNRLKESGRGLAVSWA  236

Query  2834  LCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNM  2655
             LCAVCLVGHLSH  GAKASWIH+ HSTGFH+S+ LFTLL PG QLI+DG+KSL KGAPNM
Sbjct  237   LCAVCLVGHLSHILGAKASWIHVFHSTGFHLSLSLFTLLGPGFQLILDGVKSLFKGAPNM  296

Query  2654  NTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTG  2475
             NTLVGLGA+SSF VSS+AA +PKLGWKAFFEEP+MLIAFVLLG+NLEQRAKIKATSDMTG
Sbjct  297   NTLVGLGAVSSFTVSSLAALVPKLGWKAFFEEPIMLIAFVLLGKNLEQRAKIKATSDMTG  356

Query  2474  LLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDE  2295
             LL +LPSKARL+V++D   + S +EVPC++L VGD I+VLPGDRIPADG+VRAGRSTVDE
Sbjct  357   LLGILPSKARLLVDND--AKDSIIEVPCNSLHVGDHIVVLPGDRIPADGVVRAGRSTVDE  414

Query  2294  SSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQ  2115
             SSFTGEPLPVTK+P ++VAAGSINLNG LTVEV+RPGGETA+GDIVRLVEEAQSREAPVQ
Sbjct  415   SSFTGEPLPVTKIPESEVAAGSINLNGTLTVEVRRPGGETAMGDIVRLVEEAQSREAPVQ  474

Query  2114  RLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPC  1935
             RLAD+VSGHFTYGV+ALSAATF+FWNLFG RVLP  +H G   SLALQLSCSVLVVACPC
Sbjct  475   RLADQVSGHFTYGVIALSAATFVFWNLFGARVLPTAIHYGGPVSLALQLSCSVLVVACPC  534

Query  1934  ALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQ  1755
             ALGLATPTA++VGTSLGATRGLLLRGG++LE F+MVNT+VFDKTGTLTIGRP VT+VV  
Sbjct  535   ALGLATPTAMLVGTSLGATRGLLLRGGNILEKFAMVNTVVFDKTGTLTIGRPVVTKVVTS  594

Query  1754  GHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGT  1575
             G   + N+K++       SE ++L  A+GVESNT HPIGKAIVEAA+  NC+ VK  DGT
Sbjct  595   GSLTDPNSKQNPIH--PLSETEILKFAAGVESNTVHPIGKAIVEAAEFSNCQNVKVADGT  652

Query  1574  FIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQ--EFDDFKNQSVVYVGVDGVLAG  1401
             FIEEPGSG +A+IE++KVSVGT+DW+R HGV  +  Q  E ++  NQS+VYVGVD +LAG
Sbjct  653   FIEEPGSGTVAIIEDRKVSVGTIDWLRSHGVDTSTFQEVEMEELMNQSLVYVGVDNMLAG  712

Query  1400  LIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEK  1221
             LIYVED++R+DA HVV SLS QGI  Y+LSGDKKN+AEYVAS+VGIP++ V  GVKP+EK
Sbjct  713   LIYVEDRIRDDAAHVVNSLSSQGIGVYMLSGDKKNSAEYVASLVGIPKDKVLSGVKPNEK  772

Query  1220  SKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLL  1041
              +F++ LQ D+ VVAMVGDGINDAAALASSH+GVA+GGGVGAAS+V+SVVLM NRLSQLL
Sbjct  773   KRFINELQNDENVVAMVGDGINDAAALASSHIGVAMGGGVGAASEVASVVLMGNRLSQLL  832

Query  1040  DALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVM  861
              ALELSRLTMKTVKQNLWWAFGYNIVG+P+AAG+LLP TGTMLTPSIAGALMGLSSIGVM
Sbjct  833   VALELSRLTMKTVKQNLWWAFGYNIVGIPIAAGVLLPVTGTMLTPSIAGALMGLSSIGVM  892

Query  860   TNSLLLRLKFASKQK-EIQGPS  798
              NSLLLRLKF+SKQK   Q PS
Sbjct  893   ANSLLLRLKFSSKQKASFQAPS  914



>ref|XP_007042963.1| P-type ATP-ase 1 isoform 1 [Theobroma cacao]
 gb|EOX98794.1| P-type ATP-ase 1 isoform 1 [Theobroma cacao]
Length=938

 Score =  1123 bits (2906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/812 (74%), Positives = 699/812 (86%), Gaps = 14/812 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGCAASV+RILESQP+VSSASVNLTTETA+VWPVSEA  VPNWQ++LGE LA+HL
Sbjct  139   GGMTCGGCAASVRRILESQPQVSSASVNLTTETAIVWPVSEAMDVPNWQKELGEALARHL  198

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             TSCGFK+N+RDS  +N F+ FE+KM  KR +L+ SGR LAVSWALCAVCL+GHL+H  GA
Sbjct  199   TSCGFKSNLRDSGPDNFFKVFERKMEEKRNRLKESGRELAVSWALCAVCLIGHLAHILGA  258

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
             KASW+H  HSTGFH+++ +FTLL PGRQLI++G+K+LLKGAPNMNTLVGLGALSSFAVSS
Sbjct  259   KASWMHAFHSTGFHLTLSMFTLLGPGRQLILEGVKNLLKGAPNMNTLVGLGALSSFAVSS  318

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +A  IPK GWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+++PSKARL+V+  
Sbjct  319   LAVLIPKWGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSIVPSKARLMVDD-  377

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
                  S +EVPC++LSVGDQI+VLPGDR+PADGIVRAGRST+DESSFTGEP+PVTK PG+
Sbjct  378   -----SIIEVPCNSLSVGDQIVVLPGDRVPADGIVRAGRSTIDESSFTGEPMPVTKEPGS  432

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAGSINLNG LTVEV+RPGGETA+GDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA
Sbjct  433   QVAAGSINLNGTLTVEVRRPGGETAMGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  492

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATFMFWNLFG R+LPA   QG+  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  493   LSAATFMFWNLFGARILPAAFSQGTAVSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  552

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTC  1707
             GATRGLLLRGG++LE FSMVN IVFDKTGTLTIGRP VT+VV  G  D ++++++  +  
Sbjct  553   GATRGLLLRGGNILEKFSMVNAIVFDKTGTLTIGRPVVTKVVTPGGMDHSDSRQNLENIL  612

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEK  1527
               SE +VL LA+ VESNT HP+GKAIVEAA+   C  +K  DGTFIEEPGSG +A+++ K
Sbjct  613   --SEGEVLKLAAAVESNTLHPVGKAIVEAARGVKCPNLKVVDGTFIEEPGSGVVAIVDNK  670

Query  1526  KVSVGTLDWVRRHGVGETRVQEFD-DFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVE  1350
             KVSVGTL+WV+RHGV E   QE D + +N+SVVYVGV+  LAGLIY EDQ+REDARH+V+
Sbjct  671   KVSVGTLEWVQRHGVAENLFQEVDEELRNKSVVYVGVNNTLAGLIYFEDQIREDARHIVD  730

Query  1349  SLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMV  1170
             SL +QGI  Y+LSGDK++ AEYVAS+VGIP E V   VKP +K KFVS LQK+Q +VAMV
Sbjct  731   SLHRQGIDVYMLSGDKRSTAEYVASIVGIPEEKVLSEVKPADKRKFVSELQKNQNIVAMV  790

Query  1169  GDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNL  990
             GDGINDAAALAS+H+GVA+GGGVGAAS+VSS+VLM NRLSQLLDALELSRLTMKTVKQNL
Sbjct  791   GDGINDAAALASAHIGVAVGGGVGAASEVSSIVLMGNRLSQLLDALELSRLTMKTVKQNL  850

Query  989   WWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEI  810
             WWAF YNIVG+P+AAG+LLP TGTMLTPSIAGALMGLSSIGVMTNSLLLR KF+ KQ++ 
Sbjct  851   WWAFAYNIVGIPIAAGMLLPLTGTMLTPSIAGALMGLSSIGVMTNSLLLRFKFSLKQQQT  910

Query  809   QGPSVTIQIPsnsddsdnnSHKETLRQPYTES  714
              G S     P   +       K  L++PY+ +
Sbjct  911   HGSS-----PIYLNTDFVVDPKGKLKKPYSSA  937



>ref|XP_010094160.1| Putative copper-transporting ATPase PAA1 [Morus notabilis]
 gb|EXB55293.1| Putative copper-transporting ATPase PAA1 [Morus notabilis]
Length=950

 Score =  1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/802 (74%), Positives = 679/802 (85%), Gaps = 27/802 (3%)
 Frame = -2

Query  3203  AAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSE  3024
             A   ED S   +DVIILDVGGMTCGGCAASVKRILESQP+VSSASVNLTTETA+VWPV+E
Sbjct  145   ATGAEDVSANPTDVIILDVGGMTCGGCAASVKRILESQPQVSSASVNLTTETAIVWPVAE  204

Query  3023  AKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAV  2844
             AKVVP+WQQQLGE LAKHLT+CGFK+N+RDS  +N  + F +KM  K+ +L+ SGR LA 
Sbjct  205   AKVVPDWQQQLGEALAKHLTNCGFKSNLRDSGGDNFLKVFAQKMQEKQCRLKESGRELAF  264

Query  2843  SWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGA  2664
             SWALCAVCL GHLSHFFGAKA+WIH  HSTGFH+S+ LFTLL PGR+LI+DG+KSL++GA
Sbjct  265   SWALCAVCLFGHLSHFFGAKAAWIHAFHSTGFHLSLSLFTLLGPGRELILDGMKSLIRGA  324

Query  2663  PNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSD  2484
             PNMNTLVGLGALSSF VS++AAFIPKLGWK FFEEP+MLIAFVLLGRNLEQRAKIKATSD
Sbjct  325   PNMNTLVGLGALSSFTVSTLAAFIPKLGWKTFFEEPIMLIAFVLLGRNLEQRAKIKATSD  384

Query  2483  MTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             MTGLL++LPSKARL++N+D  E  STVEVPC++L VGD I+VLPGDR+P DGIVRAGRST
Sbjct  385   MTGLLSILPSKARLLLNNDEKESGSTVEVPCNSLLVGDLIVVLPGDRVPVDGIVRAGRST  444

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             +DESSFTGEPLPVTKLPG+QVAAGSINLNG LTVEV+RPGGETA+GDIVRLVEEAQSREA
Sbjct  445   IDESSFTGEPLPVTKLPGSQVAAGSINLNGTLTVEVRRPGGETAMGDIVRLVEEAQSREA  504

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvva  1944
             PVQRLADKVSGHFTYGVMALSAATF+FW+LFG R+LPA LH GS                
Sbjct  505   PVQRLADKVSGHFTYGVMALSAATFLFWSLFGARILPAALHHGSS---------------  549

Query  1943  CPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV  1764
                +L L    +V+VGTSLGA RGLLLRGG++LE FSMVN+IVFDKTGTLT+GRP VT+V
Sbjct  550   --VSLALQLSCSVLVGTSLGARRGLLLRGGNILEKFSMVNSIVFDKTGTLTVGRPVVTKV  607

Query  1763  VPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAE  1584
             V               S+  WSEV+VL LA+GVE+NT HP+GKAIVEAA++ NC+ VK  
Sbjct  608   VTPSVQQ---------SSYSWSEVEVLKLAAGVEANTVHPVGKAIVEAAQAINCQNVKVA  658

Query  1583  DGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLA  1404
             DGTF+EEPGSGA+A+I+ KKVSVGTLDWV+R+GV +   Q  ++ +NQSVVYVGVD  LA
Sbjct  659   DGTFVEEPGSGAVAIIDNKKVSVGTLDWVQRNGVNQNPFQVVENHQNQSVVYVGVDNDLA  718

Query  1403  GLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDE  1224
             GLIY EDQ+REDAR VVESLS+QGI  Y+LSGDK+N AEYVASVVGIP+E V   VKP+E
Sbjct  719   GLIYFEDQIREDARQVVESLSRQGINVYMLSGDKRNTAEYVASVVGIPKEQVLSEVKPEE  778

Query  1223  KSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQL  1044
             K KFVS LQ +Q +VAMVGDGINDAAALASSH+G+A+G  VGAASDVSS+VLM NRLSQL
Sbjct  779   KKKFVSKLQ-EQNIVAMVGDGINDAAALASSHIGIAMGASVGAASDVSSIVLMGNRLSQL  837

Query  1043  LDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGV  864
             LDALELSRLTMKTVKQNLWWAF YNIVG+P+AAG+LLP TGT+LTPSIAGALMGLSSIGV
Sbjct  838   LDALELSRLTMKTVKQNLWWAFAYNIVGIPIAAGMLLPVTGTLLTPSIAGALMGLSSIGV  897

Query  863   MTNSLLLRLKFASKQKEIQGPS  798
               NSLLLR +F+  QK+I G S
Sbjct  898   TLNSLLLRFRFSENQKQIYGSS  919



>ref|XP_008373194.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic [Malus 
domestica]
Length=957

 Score =  1108 bits (2867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/802 (75%), Positives = 691/802 (86%), Gaps = 2/802 (0%)
 Frame = -2

Query  3209  VIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPV  3030
             V+AA G++ SV+S+DVIILDVGGMTCGGCAASVKRILE+QP+VSSASVNLTTETA+VWPV
Sbjct  127   VVAAGGDEVSVLSTDVIILDVGGMTCGGCAASVKRILENQPQVSSASVNLTTETAIVWPV  186

Query  3029  SEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGL  2850
             SE K  PNWQ+QLGE LA  LTSCGFK+N+RDS R+N  + FE+KM  KR +L+ SG  L
Sbjct  187   SEEKAAPNWQKQLGETLANQLTSCGFKSNLRDSGRDNFLKVFERKMEEKRKRLKDSGNEL  246

Query  2849  AVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLK  2670
             A SWALCAVCLVGH SHFFGAKA WIH LHSTGFH+S+CLFTLL PGR+LI DGL+SL+K
Sbjct  247   AFSWALCAVCLVGHASHFFGAKAPWIHALHSTGFHLSLCLFTLLGPGRRLIFDGLRSLVK  306

Query  2669  GAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKAT  2490
             GAPNMNTLVGLGALSSF VSS+AAFIPKLGWK FFEEP+MLIAFVLLGRNLEQRAKIKA+
Sbjct  307   GAPNMNTLVGLGALSSFTVSSLAAFIPKLGWKTFFEEPIMLIAFVLLGRNLEQRAKIKAS  366

Query  2489  SDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGR  2310
             SDMT LL+++PSKARL+VN+   E  S VEV  ++LSVGD+I+VLPGDR+P DGIV+AGR
Sbjct  367   SDMTELLSIVPSKARLLVNNGEQELESVVEVSTNSLSVGDKIVVLPGDRVPVDGIVKAGR  426

Query  2309  STVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSR  2130
             S +DESSFTGEPLPVTKLPG+QVAAGSINLNG LTVEVQRPGGETA+ DIVRLVEEAQSR
Sbjct  427   SIIDESSFTGEPLPVTKLPGSQVAAGSINLNGTLTVEVQRPGGETAMADIVRLVEEAQSR  486

Query  2129  EAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlv  1950
             EAPVQRLADKVSGHFTYGVM LSAATF+FW+L G  +LPA  H G+  SLALQLSCSVLV
Sbjct  487   EAPVQRLADKVSGHFTYGVMTLSAATFLFWSLIGGHILPAAFHGGNSVSLALQLSCSVLV  546

Query  1949  vaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVT  1770
             VACPCALGLATPTAV+VGTSLGA RGLLLRGGS+LE FSMVNTIVFDKTGTLT+G+P VT
Sbjct  547   VACPCALGLATPTAVLVGTSLGAKRGLLLRGGSILEKFSMVNTIVFDKTGTLTVGKPVVT  606

Query  1769  EVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVK  1590
             ++V    +  T+ K     T  WSEVDVL  A+GVESNT HP+ KAIVEA+++ NC+ +K
Sbjct  607   KIVTPERSKVTDLKEKINHT--WSEVDVLKFAAGVESNTVHPVAKAIVEASQALNCQNMK  664

Query  1589  AEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGV  1410
               DGTF+EEPGSGA+A +E KKVSVGTL+WV+RHGV +    E +   +QS+VYVG+D  
Sbjct  665   VADGTFLEEPGSGAVATVENKKVSVGTLEWVQRHGVTKNPFDEVEAHTSQSIVYVGIDST  724

Query  1409  LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKP  1230
             LAGLIY+EDQ+R+DA  VV+SLSKQGI  Y+LSGDK+N AEYVAS VGIP+E V  GVKP
Sbjct  725   LAGLIYLEDQIRDDAGQVVKSLSKQGIDVYMLSGDKRNNAEYVASAVGIPKEKVISGVKP  784

Query  1229  DEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLS  1050
              EK KF+  LQKDQ +VAMVGDGINDAAALASSHVG+A+GGGVGAAS+VSS+VL+ NRLS
Sbjct  785   TEKKKFIMELQKDQNIVAMVGDGINDAAALASSHVGIAMGGGVGAASEVSSIVLLGNRLS  844

Query  1049  QLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSI  870
             QLLDALELSRLTMKTVKQNLWWAF YNIVGLP+AAG+LLP TGT+LTPSIAG LMGLSS+
Sbjct  845   QLLDALELSRLTMKTVKQNLWWAFAYNIVGLPIAAGVLLPVTGTILTPSIAGGLMGLSSV  904

Query  869   GVMTNSLLLRLKFASKQKEIQG  804
             GVM NSL LR KF+ ++ +  G
Sbjct  905   GVMANSLFLRYKFSKQEHKYSG  926



>ref|XP_006487648.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=969

 Score =  1107 bits (2863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/839 (73%), Positives = 708/839 (84%), Gaps = 44/839 (5%)
 Frame = -2

Query  3194  GEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKV  3015
             GE+ S +SSDVIILDVGGMTCGGCAASVKRILESQP+VSSASVNLTTETA+VWPVS+AKV
Sbjct  117   GEELSALSSDVIILDVGGMTCGGCAASVKRILESQPQVSSASVNLTTETAIVWPVSKAKV  176

Query  3014  VPNWQQQLGEELAKHLTSCGFKANVRDSRRE-----------------------------  2922
             +PNWQ+QLGE LAKHLTSCGFK+++R   ++                             
Sbjct  177   IPNWQRQLGEALAKHLTSCGFKSSLRGELQQLLGVDCWNGSLVLRSHLLSRIYSPQSKFS  236

Query  2921  --------NLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAKASWIHL  2766
                     N F+ FE KM+ KR +L+ SGRGLAVSWALCAVCLVGHLSH  GAKASWIH+
Sbjct  237   KFLNMGTDNFFKVFETKMHEKRNRLKESGRGLAVSWALCAVCLVGHLSHILGAKASWIHV  296

Query  2765  LHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPK  2586
              HSTGFH+S+ LFTLL PG QLI+DG+KSL KGAPNMNTLVGLGA+SSF VSS+AA +PK
Sbjct  297   FHSTGFHLSLSLFTLLGPGFQLILDGVKSLFKGAPNMNTLVGLGAVSSFTVSSLAALVPK  356

Query  2585  LGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTST  2406
             LGWKAFFEEP+MLIAFVLLG+NLEQRAKIKATSDMTGLL +LPSKARL+V++D   + S 
Sbjct  357   LGWKAFFEEPIMLIAFVLLGKNLEQRAKIKATSDMTGLLGILPSKARLLVDND--AKDSI  414

Query  2405  VEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSI  2226
             +EVPC++L VGD I+VLPGDRIPADG+VRAGRSTVDESSFTGEPLPVTK+P ++VAAGSI
Sbjct  415   IEVPCNSLHVGDHIVVLPGDRIPADGVVRAGRSTVDESSFTGEPLPVTKIPESEVAAGSI  474

Query  2225  NLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFM  2046
             NLNG LTVEV+RPGGETA+GDIVRLVEEAQSREAPVQRLAD+VSGHFTYGV+ALSAATF+
Sbjct  475   NLNGTLTVEVRRPGGETAMGDIVRLVEEAQSREAPVQRLADQVSGHFTYGVIALSAATFV  534

Query  2045  FWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrgll  1866
             FWNLFG RVLP  +H G   SLALQLSCSVLVVACPCALGLATPTA++VGTSLGATRGLL
Sbjct  535   FWNLFGARVLPTAIHYGGPVSLALQLSCSVLVVACPCALGLATPTAMLVGTSLGATRGLL  594

Query  1865  lrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDV  1686
             LRGG++LE F+MVNT+VFDKTGTLTIGRP VT+VV  G   + N+K++       SE ++
Sbjct  595   LRGGNILEKFAMVNTVVFDKTGTLTIGRPVVTKVVTSGSLTDPNSKQNPIHPL--SETEI  652

Query  1685  LTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTL  1506
             L  A+GVESNT HPIGKAIVEAA+  NC+ VK  DGTFIEEPGSG +A+IE++KVSVGT+
Sbjct  653   LKFAAGVESNTVHPIGKAIVEAAEFSNCQNVKVADGTFIEEPGSGTVAIIEDRKVSVGTI  712

Query  1505  DWVRRHGVGETRVQ--EFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQG  1332
             DW+R HGV  +  Q  E ++  NQS+VYVGVD +LAGLIYVED++R+DA HVV SLS QG
Sbjct  713   DWLRSHGVDTSTFQEVEMEELMNQSLVYVGVDNMLAGLIYVEDRIRDDAAHVVNSLSSQG  772

Query  1331  ITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGIND  1152
             I  Y+LSGDKKN+AEYVAS+VGIP++ V  GVKP+EK +F++ LQ D+ VVAMVGDGIND
Sbjct  773   IGVYMLSGDKKNSAEYVASLVGIPKDKVLSGVKPNEKKRFINELQNDENVVAMVGDGIND  832

Query  1151  AAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGY  972
             AAALASSH+GVA+GGGVGAAS+V+SVVLM NRLSQLL ALELSRLTMKTVKQNLWWAFGY
Sbjct  833   AAALASSHIGVAMGGGVGAASEVASVVLMGNRLSQLLVALELSRLTMKTVKQNLWWAFGY  892

Query  971   NIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK-EIQGPS  798
             NIVG+P+AAG+LLP TGTMLTPSIAGALMGLSSIGVM NSLLLRLKF+SKQK   Q PS
Sbjct  893   NIVGIPIAAGVLLPVTGTMLTPSIAGALMGLSSIGVMANSLLLRLKFSSKQKASFQAPS  951



>gb|KCW63155.1| hypothetical protein EUGRSUZ_G00769 [Eucalyptus grandis]
Length=919

 Score =  1100 bits (2844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/774 (77%), Positives = 688/774 (89%), Gaps = 3/774 (0%)
 Frame = -2

Query  3191  EDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVV  3012
             EDAS VSSDVIILDVGGMTCGGCAASVKRILE+QP+VS+ASVNLTTETA+VWPVSEAK V
Sbjct  131   EDASAVSSDVIILDVGGMTCGGCAASVKRILENQPKVSAASVNLTTETAIVWPVSEAKAV  190

Query  3011  PNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWAL  2832
             P+WQ++LGE LAK LT+CGF++N RD    N F+ FE+KMN K  +L+ SGR LAVSWAL
Sbjct  191   PDWQKELGETLAKQLTNCGFESNPRDGGGHNFFKVFERKMNEKHDRLKESGRQLAVSWAL  250

Query  2831  CAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMN  2652
             CAVCL+GHLSHFFGAKA WIH  HSTGFH+S+ LFTL+ PGR LI DGL++LL+GAPNMN
Sbjct  251   CAVCLLGHLSHFFGAKAPWIHAFHSTGFHLSLSLFTLIGPGRGLIFDGLRNLLRGAPNMN  310

Query  2651  TLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGL  2472
             TLVGLGALSSF VS++A  +PKLGWKAFFEEP+ML+AFVLLGRNLEQRAKIKATSDMTGL
Sbjct  311   TLVGLGALSSFCVSTLATLVPKLGWKAFFEEPIMLVAFVLLGRNLEQRAKIKATSDMTGL  370

Query  2471  LNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDES  2292
             L++LPSKARL+V+ D  +  S VEVPC+ L+VGD+I++LPGDR+PADG+VRAGRSTVDES
Sbjct  371   LSILPSKARLLVSGDEEDLGSIVEVPCNTLAVGDRIVILPGDRVPADGVVRAGRSTVDES  430

Query  2291  SFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQR  2112
             SFTGEPLP TKLPG+QVAAGSINLNG LTVEVQRPGGETA+GDIVRLVEEAQ+REAPVQR
Sbjct  431   SFTGEPLPATKLPGSQVAAGSINLNGSLTVEVQRPGGETAMGDIVRLVEEAQTREAPVQR  490

Query  2111  LADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCA  1932
             LADKVSGHFTYGVMALSAATF+FWN+FG+R+LPA L+QGS  SLALQLSCSVLVVACPCA
Sbjct  491   LADKVSGHFTYGVMALSAATFVFWNVFGSRILPAALNQGSSVSLALQLSCSVLVVACPCA  550

Query  1931  LGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQG  1752
             LGLATPTAV+VGTSLGAT+GLLLRGGSVLE FSMVNT+VFDKTGTLT+G+P VT+VV  G
Sbjct  551   LGLATPTAVLVGTSLGATKGLLLRGGSVLEKFSMVNTVVFDKTGTLTLGKPVVTKVVTPG  610

Query  1751  HNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTF  1572
                  +++ +S  T  WSEV+VL  A+GVESNT HP+GKAIVEAA++RNC  VKA DGTF
Sbjct  611   CAQPIDSRHNSDDT--WSEVEVLQFAAGVESNTIHPVGKAIVEAAQARNCTKVKAVDGTF  668

Query  1571  IEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIY  1392
             IEEPGSGA+AVI  K+VSVG L+W+RRHGV +  ++  ++ KNQSVVYVGVD  LAGLIY
Sbjct  669   IEEPGSGAVAVINNKRVSVGNLEWIRRHGV-DADIRLMEEPKNQSVVYVGVDNSLAGLIY  727

Query  1391  VEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKF  1212
             +EDQ+REDARHVV SLSK G+  Y+LSGD+++ A+YVAS+VGIP E V  GVKPD+K KF
Sbjct  728   IEDQIREDARHVVSSLSKHGVDVYMLSGDRRSTADYVASMVGIPLEKVISGVKPDQKKKF  787

Query  1211  VSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             +S LQ+D KVVAMVGDGINDAAALASSHVGVA+GGGVGAAS+VSSVVLM NRLSQLLDAL
Sbjct  788   ISELQQDDKVVAMVGDGINDAAALASSHVGVAMGGGVGAASEVSSVVLMGNRLSQLLDAL  847

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSI  870
             ELS+LTMKT+KQNLWWAF YNIVG+P+AAG+LLP TG  LTPSIAGALMGLSSI
Sbjct  848   ELSQLTMKTIKQNLWWAFAYNIVGIPIAAGVLLPMTGITLTPSIAGALMGLSSI  901



>ref|XP_004290425.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=955

 Score =  1093 bits (2828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/800 (74%), Positives = 690/800 (86%), Gaps = 2/800 (0%)
 Frame = -2

Query  3212  SVIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWP  3033
             +V+A+  ++AS +S+DVI+LDVGGMTCGGCAASVKRILESQP+VSSASVNLTTE A+VWP
Sbjct  122   NVVASGCDEASAISTDVIMLDVGGMTCGGCAASVKRILESQPQVSSASVNLTTEVAIVWP  181

Query  3032  VSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRG  2853
             VSEAK+ PNWQQQLGE LAKHLT+CGF +N+RDS R +  + F+ KM  K  +L+ SG  
Sbjct  182   VSEAKLTPNWQQQLGETLAKHLTNCGFNSNIRDSGRNSFLKIFKGKMEDKHKRLKESGHE  241

Query  2852  LAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLL  2673
             LA SWALCAVCLVGHLSHFFG  ASWIH  HSTGFHMS+ LFTL+ PGRQLI+DGLKSL+
Sbjct  242   LAFSWALCAVCLVGHLSHFFGPMASWIHAFHSTGFHMSLSLFTLVGPGRQLILDGLKSLV  301

Query  2672  KGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKA  2493
             KGAPNMNTLVGLGALSSFAVSS+AA IPKLGWK FFEEP+MLIAFVLLGRNLEQRAKI+A
Sbjct  302   KGAPNMNTLVGLGALSSFAVSSLAALIPKLGWKTFFEEPIMLIAFVLLGRNLEQRAKIRA  361

Query  2492  TSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAG  2313
             +SDMT LL++LP+KARL+VN  + E  + VEVP ++L VGDQ++VLPGDR+P DGIV+AG
Sbjct  362   SSDMTELLSILPAKARLLVNDGVKESETIVEVPSNSLCVGDQVVVLPGDRVPVDGIVKAG  421

Query  2312  RSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQS  2133
             RST+DESSFTGEPLPVTKLPG+QV AGSINLNG LT+ VQRPGGETA+ DIVRLVEEAQS
Sbjct  422   RSTIDESSFTGEPLPVTKLPGSQVQAGSINLNGSLTIVVQRPGGETAMADIVRLVEEAQS  481

Query  2132  REAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvl  1953
             +EAPVQRLADKVSGHFTYGVM LSAATF+FW+L G  +LP  L  G+  SLALQLSCSVL
Sbjct  482   QEAPVQRLADKVSGHFTYGVMGLSAATFLFWSLVGGNILPGVLQGGNSVSLALQLSCSVL  541

Query  1952  vvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTV  1773
             VVACPCALGLATPTAV+VGTSLGA R LLLRGG+VLE FSMVNT+VFDKTGTLT+G+P V
Sbjct  542   VVACPCALGLATPTAVLVGTSLGAKRRLLLRGGNVLEKFSMVNTVVFDKTGTLTMGKPVV  601

Query  1772  TEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIV  1593
             T+++   H + T+ +  S  T  WS+++VL  A+GVESNT HP+GKAIVEAA++ NC+ +
Sbjct  602   TKILTPEHAELTDLEEKSKHT--WSDLEVLKFAAGVESNTIHPVGKAIVEAARAVNCQDI  659

Query  1592  KAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDG  1413
             K  DGTFIEEPGSGA+A++E+K+VSVGTLDWVRRHGV +   +E +  K+QSVVYV +D 
Sbjct  660   KVADGTFIEEPGSGAVAIVEDKQVSVGTLDWVRRHGVNKNPFEEVEAHKSQSVVYVAIDS  719

Query  1412  VLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVK  1233
              LAGLIY ED++R+DA  VV+SLS QGI  Y+LSGDK+  AEYVASVVGIP+E V  GVK
Sbjct  720   TLAGLIYFEDRIRDDAGQVVKSLSSQGINVYMLSGDKRENAEYVASVVGIPKEKVISGVK  779

Query  1232  PDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRL  1053
             P EK KF++ LQ DQ +VAMVGDGINDAAALASSHVG+A+GGGVGAAS+VSS+VL+ NRL
Sbjct  780   PREKKKFITELQNDQNIVAMVGDGINDAAALASSHVGIAMGGGVGAASEVSSIVLLGNRL  839

Query  1052  SQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSS  873
             SQL+DALELSRLTMKTVKQNLWWAF YNI+GLP+AAG+LLP TGT+LTPSIAGALMGLSS
Sbjct  840   SQLVDALELSRLTMKTVKQNLWWAFAYNIIGLPIAAGVLLPVTGTILTPSIAGALMGLSS  899

Query  872   IGVMTNSLLLRLKFASKQKE  813
             +GVM NSL LR KF+ +Q+ 
Sbjct  900   VGVMANSLFLRYKFSLEQER  919



>ref|XP_006579987.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
[Glycine max]
Length=940

 Score =  1086 bits (2808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/787 (74%), Positives = 673/787 (86%), Gaps = 2/787 (0%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGCAA+VKRILESQP+VSSASVNLTTETA+VWPVSEAK  PNWQ+QLGE LA+HLT
Sbjct  139   GMVCGGCAATVKRILESQPQVSSASVNLTTETAIVWPVSEAKNAPNWQKQLGEALAEHLT  198

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             SCG+ +++RDS R+N  + FE+KM  +  QL+ SGR LAVSWALCAVCLVGH SHFF AK
Sbjct  199   SCGYNSSLRDSTRDNFLQIFERKMEERHRQLRESGRELAVSWALCAVCLVGHFSHFFAAK  258

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
             A WIH+ HS GFH+S+ LFTLL PGRQLI+DGLKSLLK  PNMNTLVGLGALSSF VSS 
Sbjct  259   APWIHVFHSIGFHLSLSLFTLLGPGRQLILDGLKSLLKRTPNMNTLVGLGALSSFTVSSF  318

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             AA +P+LGWKAFFEEP+MLIAFVLLGRNLEQRAKIKATSDMTGLL++LP KARL++N+  
Sbjct  319   AALLPRLGWKAFFEEPIMLIAFVLLGRNLEQRAKIKATSDMTGLLSLLPPKARLLLNNRE  378

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
              E  S VEVP  +LSVGDQIIVLPGDRIPADGIVR+GRSTVDESSFTGEPLPVTK+ G++
Sbjct  379   TEVGSVVEVPSDSLSVGDQIIVLPGDRIPADGIVRSGRSTVDESSFTGEPLPVTKVAGSE  438

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             VAAGSINLNG LT+EVQRPGGETA+ +IVRLVEEAQSREAPVQRLADKV+GHFTYGVMA 
Sbjct  439   VAAGSINLNGTLTMEVQRPGGETAMANIVRLVEEAQSREAPVQRLADKVAGHFTYGVMAA  498

Query  2063  SAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslg  1884
             SAATF FW+L+GT +LP  L+QGS  SLALQL+CSVLVVACPCALGLATPTAV+VGTSLG
Sbjct  499   SAATFTFWSLYGTHILPPALYQGSAVSLALQLACSVLVVACPCALGLATPTAVLVGTSLG  558

Query  1883  atrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCE  1704
             A RGLLLRGG++LE F+MVNTIVFDKTGTLT+GRP VT +V        NA    T    
Sbjct  559   AKRGLLLRGGNILEKFAMVNTIVFDKTGTLTVGRPVVTNIVIP--TCIKNAISSQTEENA  616

Query  1703  WSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKK  1524
              S+V+VL LA+ VESN+ HP+G+AIV AA++ NC   K +DGTF+EEPGSGA+A I+ KK
Sbjct  617   LSDVEVLRLAAAVESNSVHPVGQAIVNAAQAANCHDAKVKDGTFLEEPGSGAVATIDNKK  676

Query  1523  VSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESL  1344
             VSVGTL+W+ RHGV  +  QE +   NQS VYVGVD  LAGLIY ED++REDAR VV+ L
Sbjct  677   VSVGTLEWITRHGVINSIHQEVEKSNNQSFVYVGVDDTLAGLIYFEDEIREDARDVVDRL  736

Query  1343  SKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGD  1164
             SKQ I  Y+LSGDK+NAAE+VAS+VGIP+E V   VKPDEK KF++ LQKD+ +VAMVGD
Sbjct  737   SKQNIGVYMLSGDKRNAAEHVASLVGIPKEKVLSQVKPDEKKKFINELQKDKNIVAMVGD  796

Query  1163  GINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWW  984
             GINDAAALASSHVG+A+GGGVGAAS+VSS+VLM+N+LSQL+DALELSRLTM T+KQNLWW
Sbjct  797   GINDAAALASSHVGIALGGGVGAASEVSSIVLMRNQLSQLVDALELSRLTMNTIKQNLWW  856

Query  983   AFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQG  804
             AF YNIVG+P+AAG+L P  GT+LTPSIAGALMGLSSIGVMTNSLLLR KF+SKQK+I G
Sbjct  857   AFIYNIVGIPIAAGVLFPINGTVLTPSIAGALMGLSSIGVMTNSLLLRFKFSSKQKQIHG  916

Query  803   PSVTIQI  783
              S   +I
Sbjct  917   TSPKTKI  923



>ref|XP_008802207.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic [Phoenix 
dactylifera]
Length=957

 Score =  1083 bits (2801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/780 (74%), Positives = 684/780 (88%), Gaps = 5/780 (1%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM+CGGCAASVKRILESQP+VS+ASVNL TETA+VW V E K   NW+QQLGE+LA HL
Sbjct  146   GGMSCGGCAASVKRILESQPQVSAASVNLATETAIVWAVPEVKATENWKQQLGEKLAGHL  205

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+ GFK+N+RD+ +E+L+  FEKKM+ K  +L+ SG+ LAVSWALCAVCL+GH++HFFGA
Sbjct  206   TTSGFKSNLRDTSKEDLYRVFEKKMDEKLQRLKESGQELAVSWALCAVCLLGHIAHFFGA  265

Query  2786  KAS-WIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
              AS W+H  HSTGFH+S+ L T + PGR+LI DGLKSLLKG+PNMNTLVGLGALSSF VS
Sbjct  266   NASSWLHTFHSTGFHLSLSLMTFVGPGRKLIFDGLKSLLKGSPNMNTLVGLGALSSFLVS  325

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
             S+AAF+PKLGWK FFEEP+MLIAFVLLG+NLEQRAK+KATSDM+GLLN+LP+KARL+V+S
Sbjct  326   SIAAFMPKLGWKTFFEEPIMLIAFVLLGKNLEQRAKLKATSDMSGLLNILPTKARLMVDS  385

Query  2429  DMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPG  2250
             D  + +S VEVPC NL++GD+I+VLPGDR+PADGIV+AGRSTVDESSFTGEPLPVTKLPG
Sbjct  386   DAEQLSSVVEVPCRNLTIGDRIVVLPGDRVPADGIVKAGRSTVDESSFTGEPLPVTKLPG  445

Query  2249  AQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVM  2070
             A+V AGSINLNG LTVEV+RPGGET +GDIVRLVEEAQ+REAPVQRLADKV+GHFTYGVM
Sbjct  446   AEVTAGSINLNGTLTVEVRRPGGETVMGDIVRLVEEAQTREAPVQRLADKVAGHFTYGVM  505

Query  2069  ALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgts  1890
             A SAATFMFWNLFG++++PA +HQGS  SLAL LSCSVLVVACPCALGLATPTAV+VGTS
Sbjct  506   AFSAATFMFWNLFGSQLVPAAIHQGSPLSLALHLSCSVLVVACPCALGLATPTAVLVGTS  565

Query  1889  lgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTST  1710
             LGATRGLLLRGG+VLE F+ V+T+VFDKTGTLT G+P VT+++   H+ + ++K  ++  
Sbjct  566   LGATRGLLLRGGNVLEKFAEVDTVVFDKTGTLTTGKPVVTKILASQHDGDWDSK--NSLD  623

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
              +W+EVD+L LA+GVESNTNHP+GK+IVEAA + +C  VKA DGTF EEPGSGA+A +E+
Sbjct  624   YKWTEVDILRLAAGVESNTNHPVGKSIVEAASAASCLNVKATDGTFREEPGSGAVATVEK  683

Query  1529  KKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVE  1350
             K+V+VGTL W+RRHGV      +  +F +QSVVYVGVDGVLAG+I +ED++REDA  VVE
Sbjct  684   KQVTVGTLSWLRRHGVVHNPFPD-AEFIDQSVVYVGVDGVLAGVICIEDKIREDAHEVVE  742

Query  1349  SLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQ-KVVAM  1173
              LSKQGI+TY+LSGDK+N AE+VAS+VGI ++ V  GVKPDEK KF++ LQ DQ KVVAM
Sbjct  743   ILSKQGISTYILSGDKRNTAEHVASMVGIHKDKVLSGVKPDEKKKFIADLQNDQKKVVAM  802

Query  1172  VGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQN  993
             VGDGINDAAALASS VG+A+G GVGAASDVSS+VLM NRLSQL+DALELS+ TM+TVKQN
Sbjct  803   VGDGINDAAALASSDVGIAMGEGVGAASDVSSIVLMGNRLSQLIDALELSKQTMRTVKQN  862

Query  992   LWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             LWWAF YNIVGLP+AAGILLP TGTMLTPSIAGALMGLSS+ VMTNSLLLRL+   KQKE
Sbjct  863   LWWAFAYNIVGLPIAAGILLPVTGTMLTPSIAGALMGLSSVAVMTNSLLLRLRLEPKQKE  922



>ref|XP_007159103.1| hypothetical protein PHAVU_002G208800g [Phaseolus vulgaris]
 gb|ESW31097.1| hypothetical protein PHAVU_002G208800g [Phaseolus vulgaris]
Length=944

 Score =  1082 bits (2798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/793 (73%), Positives = 676/793 (85%), Gaps = 12/793 (2%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGCAA+VKRILE++P+VSSASVNLTTETA+VWP+SEAK  PNWQ+QLGE LA HLT
Sbjct  141   GMVCGGCAATVKRILENRPQVSSASVNLTTETAIVWPISEAKNAPNWQKQLGEALADHLT  200

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             SCG+ +++RDS R+N  + FE+KM  +  QL+ SGR LAVSWALCAVCLVGH SHFF AK
Sbjct  201   SCGYNSSLRDSTRDNFLQIFERKMEERHRQLRESGRELAVSWALCAVCLVGHFSHFFAAK  260

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
             A WIH+ HS GFH+S+ LFTLL PGRQLI+DGLKSLLK  PNMNTLVGLGALSSF VSS 
Sbjct  261   APWIHVFHSIGFHLSLSLFTLLGPGRQLILDGLKSLLKRTPNMNTLVGLGALSSFTVSSF  320

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             AA +PKLGWKAFFEEP+MLIAFVLLGRNLEQRAKIKATSDMTGLL++LP KARL+VN+  
Sbjct  321   AALVPKLGWKAFFEEPIMLIAFVLLGRNLEQRAKIKATSDMTGLLSLLPPKARLLVNNGE  380

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
              E  S VEVP  +LS+GDQIIVLPGDRIPADG+VRAGRSTVDESSFTGEPLPVTK+PG++
Sbjct  381   TEAGSVVEVPSDSLSIGDQIIVLPGDRIPADGVVRAGRSTVDESSFTGEPLPVTKVPGSE  440

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             VAAGSINLNG LT++VQRPGGET++ +IVRLVEEAQSREAPVQRLADKV+GHFTYGVMA 
Sbjct  441   VAAGSINLNGTLTMQVQRPGGETSMANIVRLVEEAQSREAPVQRLADKVAGHFTYGVMAA  500

Query  2063  SAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslg  1884
             SAATF FW+L+GT +LP  L+QGS  SLALQL+CSVLVVACPCALGLATPTAV+VGTSLG
Sbjct  501   SAATFTFWSLYGTHILPPALYQGSSVSLALQLACSVLVVACPCALGLATPTAVLVGTSLG  560

Query  1883  atrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCE  1704
             A RGLL+RGG++LE F+MVNT+VFDKTGTLT+GRP VT +V        + K+  +S  E
Sbjct  561   AKRGLLVRGGNILEKFAMVNTVVFDKTGTLTVGRPVVTNIV------TPSCKKAISSQTE  614

Query  1703  ---WSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIE  1533
                 S+V+VL LA+ VESN+ HP+GKAIV+AA + NC   K  DGTF+EEPGSGA+A I+
Sbjct  615   ENVLSDVEVLRLAAAVESNSIHPVGKAIVDAALAVNCHNAKVIDGTFLEEPGSGAVATID  674

Query  1532  EKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVV  1353
              KKVSVGTL+W+ RHGV  +  QE + + NQS VYVG+D  LAGLIY ED++REDAR VV
Sbjct  675   NKKVSVGTLEWITRHGVINSLHQEVEKYNNQSFVYVGIDDTLAGLIYFEDEIREDARDVV  734

Query  1352  ESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAM  1173
             + LSKQ +  Y+LSGDK+NAAE+VAS+VGIP++ V   VKPDEK KF++ LQKD+ +VAM
Sbjct  735   DRLSKQNLGVYMLSGDKRNAAEHVASLVGIPKDKVLSEVKPDEKKKFINDLQKDKNIVAM  794

Query  1172  VGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQN  993
             VGDGINDAAALASSHVG+A+GGGVGAAS+VSS+VLM+N+LSQLLDALELSRLTM TVKQN
Sbjct  795   VGDGINDAAALASSHVGIALGGGVGAASEVSSIVLMRNQLSQLLDALELSRLTMNTVKQN  854

Query  992   LWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             LWWAF YNIVG+P+AAG+L P  GT+LTPSIAGALMGLSSIGVMTNSLLLR KF+SKQK+
Sbjct  855   LWWAFVYNIVGIPIAAGVLFPINGTILTPSIAGALMGLSSIGVMTNSLLLRFKFSSKQKQ  914

Query  812   IQG---PSVTIQI  783
             I     P+  I +
Sbjct  915   IHNSTSPNTKIHV  927



>ref|XP_010690489.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=945

 Score =  1079 bits (2790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/812 (73%), Positives = 687/812 (85%), Gaps = 8/812 (1%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GMTCGGCAA VK+ILE+Q +VSSASVNL TETA+VWPVSEAK VPNW+Q+LGE LAKHLT
Sbjct  136   GMTCGGCAAKVKKILETQTQVSSASVNLATETAIVWPVSEAKDVPNWKQELGEMLAKHLT  195

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             +CGF++N+RD  +EN+F+ FE+KM+ K+ +L+ SGR LAVSWALC VC+ GHLSH F AK
Sbjct  196   NCGFESNLRDLGKENVFQIFERKMDQKQNKLRESGRDLAVSWALCTVCMFGHLSHLFWAK  255

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
             ASWIH+ HSTGFH+SM LFTLL PGRQLI+DGLKS  +GAPNMNTLVGLGALSSF VS++
Sbjct  256   ASWIHVFHSTGFHLSMSLFTLLGPGRQLIVDGLKSFFRGAPNMNTLVGLGALSSFTVSTL  315

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A  IPKLGWKAFFEEP+MLIAFVLLGRNLEQRAKIKATSD+T LL++LPSKARL+VN D 
Sbjct  316   ATLIPKLGWKAFFEEPIMLIAFVLLGRNLEQRAKIKATSDLTSLLSILPSKARLLVN-DA  374

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
              +  STVEVPCSNLSVGD+I+VLPGDR+PADGIVRAGRSTVDESSF+GEPLPVTKLPGA+
Sbjct  375   EDTVSTVEVPCSNLSVGDKIVVLPGDRVPADGIVRAGRSTVDESSFSGEPLPVTKLPGAE  434

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V+AG+INLNG LT+EVQ+PGGET +G IVRLVEEAQSREAPVQRLADKV+G FTYGVMAL
Sbjct  435   VSAGTINLNGTLTIEVQKPGGETTMGSIVRLVEEAQSREAPVQRLADKVAGQFTYGVMAL  494

Query  2063  SAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslg  1884
             SAATFMFW LFG+R+LP+ L  GS  SLALQLSCSVLVVACPCALGLATPTAV+VGTSLG
Sbjct  495   SAATFMFWTLFGSRILPSVLSGGSSVSLALQLSCSVLVVACPCALGLATPTAVLVGTSLG  554

Query  1883  atrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCE  1704
             A RGLLLRGG +LE FS  N +VFDKTGTLTIG+P VT+VV +G   E NA  D+ S   
Sbjct  555   AKRGLLLRGGDILEKFSEANVVVFDKTGTLTIGKPVVTKVVTRG--SERNAPSDNNS-FH  611

Query  1703  WSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKK  1524
              S+ +VL LA+ VESNT HP+GKAIVEAA S   +  KA DGTF EEPGSGA+A I  ++
Sbjct  612   LSDAEVLKLAASVESNTIHPVGKAIVEAAHSIGVQSFKAADGTFTEEPGSGAVATIGNRR  671

Query  1523  VSVGTLDWVRRHGVGETRVQEFDDFKN-QSVVYVGVDGVLAGLIYVEDQLREDARHVVES  1347
             V+VGTLDW++R GV +  +QE ++  N QSVVYVGVDG LAGLIY+EDQ+REDA++VV+S
Sbjct  672   VAVGTLDWLQRQGVEDNSLQELEEKNNIQSVVYVGVDGNLAGLIYIEDQIREDAKNVVQS  731

Query  1346  LSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVG  1167
             L  QGI  ++LSGDK+  AE+VASVVGIP++ VF GVKP +K KF+S LQ D K+VAM+G
Sbjct  732   LRNQGIDVFMLSGDKRQTAEHVASVVGIPKDKVFSGVKPHQKEKFISQLQND-KIVAMIG  790

Query  1166  DGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLW  987
             DGINDAAALAS+HVGVA+GGGVGAAS+VSS+VLM N+L+Q+LDALELS+LTMKTVKQNLW
Sbjct  791   DGINDAAALASAHVGVAMGGGVGAASEVSSIVLMGNKLTQVLDALELSKLTMKTVKQNLW  850

Query  986   WAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQ  807
             WAFGYNIVGLP+AAG+LLP TG MLTPSIAGALMG SSIGVMTNSLLLRL+F+SKQ  I 
Sbjct  851   WAFGYNIVGLPIAAGLLLPATGVMLTPSIAGALMGFSSIGVMTNSLLLRLRFSSKQ--IY  908

Query  806   GPSVTIQIPsnsddsdnnSHKETLRQPYTESR  711
             G  ++      S         E    PY+ SR
Sbjct  909   GSEISSTTADQSALEVLVDPNEKSETPYSNSR  940



>ref|XP_008455636.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X1 [Cucumis melo]
Length=928

 Score =  1078 bits (2788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/778 (73%), Positives = 672/778 (86%), Gaps = 2/778 (0%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGCAASVKRILE+QP+VSSASVNLTTETAV+WPV E K  P+  +QLGE LA HL
Sbjct  143   GGMTCGGCAASVKRILENQPQVSSASVNLTTETAVIWPVPEVKDSPHRVKQLGETLASHL  202

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T CGF +++R+S R+N+F  FE+KM  KR +L+ SGR L  SWALCAVCL+GH+SHFFGA
Sbjct  203   TRCGFASSLRESGRDNIFMVFERKMEEKRNRLRESGRNLVFSWALCAVCLLGHISHFFGA  262

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
             KASWIH  H+T FH+S+CLFTLL PGRQLIIDG+KSL+KGAPNMNTLVGLGALSSF+VSS
Sbjct  263   KASWIHTCHTTQFHLSLCLFTLLGPGRQLIIDGMKSLVKGAPNMNTLVGLGALSSFSVSS  322

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA +PKLGWKAFFEEPVMLIAFVLLGRNLEQRAKI+A SDMTGLL++LPSKARLVV+  
Sbjct  323   LAALMPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIRAASDMTGLLSILPSKARLVVDGG  382

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               E +STVE+PCS+LSVGD++IVLPGDRIPADGIV++GRS VDESSFTGEPLPVTKLPG+
Sbjct  383   T-ELSSTVEIPCSSLSVGDEVIVLPGDRIPADGIVKSGRSIVDESSFTGEPLPVTKLPGS  441

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAG+INLNG LTVEV R GG++A+GDI+RLVEEAQSREAPVQRLADKVSGHFTYGVM 
Sbjct  442   QVAAGTINLNGTLTVEVHRHGGDSAMGDIIRLVEEAQSREAPVQRLADKVSGHFTYGVMG  501

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF+FW+ FG+R+LP   H GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  502   LSAATFIFWSQFGSRILPTAFHHGSSVSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  561

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTC  1707
             GAT+GLLLRGG++LE FSM +T+VFDKTGTLT+G+P VT+V       E N    + S  
Sbjct  562   GATKGLLLRGGNILEQFSMADTVVFDKTGTLTVGKPVVTKVFATSRY-ERNVDSQTNSHG  620

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEK  1527
              +SE ++L  A+ VESNT HP+GKAIVEAA++ N   +K  +GTF+EEPGSGA+A ++ +
Sbjct  621   NYSENEILKFAAAVESNTVHPVGKAIVEAARAVNGHSLKVVEGTFVEEPGSGAVATVQNR  680

Query  1526  KVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVES  1347
              VS+GTLDWV+R GV     QE DD K QSVVYVG+D +LAG IY ED +REDARHVV++
Sbjct  681   IVSIGTLDWVQRQGVTVEDFQETDDLKAQSVVYVGIDNILAGCIYYEDGIREDARHVVDT  740

Query  1346  LSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVG  1167
             LS+QGI TY+LSGDK++ AEY+AS+VGIP+E V  GVKP EK KF+S LQ++  +VAMVG
Sbjct  741   LSRQGINTYMLSGDKRSNAEYIASLVGIPKEKVRSGVKPQEKKKFISELQENNNIVAMVG  800

Query  1166  DGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLW  987
             DGINDAAALA++ +G+A+GGGVGAAS+VS +VLM NRLSQLLDALELSRLTMKTVKQNLW
Sbjct  801   DGINDAAALATADIGIAMGGGVGAASEVSPIVLMGNRLSQLLDALELSRLTMKTVKQNLW  860

Query  986   WAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             WAFGYNIVG+PVAAG+LLP TGT+LTPSIAGALMGLSS+GVM NSLLLR++F+  +K+
Sbjct  861   WAFGYNIVGIPVAAGVLLPITGTILTPSIAGALMGLSSVGVMANSLLLRIRFSQNRKK  918



>ref|XP_004137165.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
[Cucumis sativus]
Length=933

 Score =  1078 bits (2788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/783 (73%), Positives = 674/783 (86%), Gaps = 7/783 (1%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGCAASVKRILE+QP+VSSASVNLTTETAV+WPV E K  P+  ++LGE LA HL
Sbjct  143   GGMTCGGCAASVKRILENQPQVSSASVNLTTETAVIWPVPEVKDSPHRVKKLGETLANHL  202

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T CGF +++RDS R+N+F  FEKKM  KR +L+ SGR L  SWALCAVCL+GH+SHFFGA
Sbjct  203   TRCGFASSLRDSGRDNIFMVFEKKMEEKRNRLKESGRNLVFSWALCAVCLLGHISHFFGA  262

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
             KASWIH  H+T FH+S+CLFTLL PGRQLIIDG+KSL+KGAPNMNTLVGLGALSSF+VSS
Sbjct  263   KASWIHTFHTTQFHLSLCLFTLLGPGRQLIIDGMKSLVKGAPNMNTLVGLGALSSFSVSS  322

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA +PKLGWKAFFEEPVMLIAFVLLGRNLEQRAKI+A SDMTGLL++LPSKARLVV+ D
Sbjct  323   LAALMPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIRAASDMTGLLSILPSKARLVVDGD  382

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               E +STVE+PCS+LS+GD++IVLPGDRIPADGIV++GRS VDESSFTGEPLPVTKLPG+
Sbjct  383   T-ELSSTVEIPCSSLSIGDEVIVLPGDRIPADGIVKSGRSIVDESSFTGEPLPVTKLPGS  441

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAG+INLNG LTV+V R GG+TA+GDI+RLVEEAQSREAPVQRLADKVSGHFTYGVM 
Sbjct  442   QVAAGTINLNGTLTVKVHRQGGDTAMGDIIRLVEEAQSREAPVQRLADKVSGHFTYGVMV  501

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF+FW+ FG+R+LPA  + GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  502   LSAATFIFWSQFGSRILPAAFYHGSSVSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  561

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTC  1707
             GAT+GLLLRGG++LE FSMV+T+VFDKTGTLT+GRP VT+V       E N    + S  
Sbjct  562   GATKGLLLRGGNILEQFSMVDTVVFDKTGTLTVGRPVVTKVFATSRY-ERNVDTQTNSHG  620

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEK  1527
              +SE ++L  A+ VESNT HP+GKAIVEAA++ N   +K  +GTF+EEPGSGA+A +E +
Sbjct  621   NYSENEILKFAAAVESNTVHPVGKAIVEAARAVNGHSLKVVEGTFVEEPGSGAVATVENR  680

Query  1526  KVSVGTLDWVRRHGVGETRVQEFD-----DFKNQSVVYVGVDGVLAGLIYVEDQLREDAR  1362
              +S+GTLDWV+RHGV     QE D     D K  SVVYVG+D  LAG IY ED +REDAR
Sbjct  681   IISIGTLDWVQRHGVIVDDFQETDDLKAHDLKAHSVVYVGIDNSLAGCIYYEDGIREDAR  740

Query  1361  HVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKV  1182
             HVV++LS+QGI TY+LSGDK++ AEY+AS+VGIP+E V  GVKP EK KF+S LQ++  +
Sbjct  741   HVVDTLSRQGINTYILSGDKRSNAEYIASLVGIPKEKVRSGVKPHEKKKFISELQENNNI  800

Query  1181  VAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTV  1002
             VAMVGDGINDAAALA++ +G+A+GGGVGAAS+VS +VLM NRLSQLLDALELSRLTMKTV
Sbjct  801   VAMVGDGINDAAALATADIGIAMGGGVGAASEVSPIVLMGNRLSQLLDALELSRLTMKTV  860

Query  1001  KQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASK  822
             KQNLWWAFGYNIVG+PVAAG+LLP TGT+LTPSIAGALMGLSS+GVM NSLLLR++F+  
Sbjct  861   KQNLWWAFGYNIVGIPVAAGVLLPITGTILTPSIAGALMGLSSVGVMANSLLLRIRFSQN  920

Query  821   QKE  813
             +K+
Sbjct  921   RKK  923



>ref|XP_006584981.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic [Glycine 
max]
Length=937

 Score =  1078 bits (2787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/788 (73%), Positives = 671/788 (85%), Gaps = 4/788 (1%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGCAA+VKRILE+QP+VSSASVNLTTETA+VWPVSEAK  PNWQ+QLGE LA+HLT
Sbjct  141   GMVCGGCAATVKRILENQPQVSSASVNLTTETAIVWPVSEAKNAPNWQKQLGEALAEHLT  200

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             SCG+ +++RDS R+N  + FE+KM  +  QL+ SGR LAVSWALCAVCLVGH SHFF AK
Sbjct  201   SCGYNSSLRDSTRDNFLQIFERKMEERHRQLRESGRELAVSWALCAVCLVGHFSHFFAAK  260

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
             A WIH+ HS GFH+S+ LFTLL PGRQLI+DGLKSLLK  PNMNTLVGLGALSSF VSS 
Sbjct  261   APWIHVFHSIGFHLSLSLFTLLGPGRQLILDGLKSLLKRTPNMNTLVGLGALSSFTVSSF  320

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             AA +PKLGWKAFFEEP+MLIAFVLLGRNLEQRAKIKA SDMTGLL++LP KARL++N+  
Sbjct  321   AALLPKLGWKAFFEEPIMLIAFVLLGRNLEQRAKIKAASDMTGLLSLLPPKARLLLNNGE  380

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
              E  S VEVP  +LSVGDQIIVLPGDRIPADG+VR+GRSTVDESSFTGEPLPVTK+PG++
Sbjct  381   TEVGSVVEVPSDSLSVGDQIIVLPGDRIPADGVVRSGRSTVDESSFTGEPLPVTKVPGSE  440

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             VAAGSINLNG LT+EVQRPG ETA+ +IVRLVEEAQSREAPVQRLADKV+GHFTYGVMA 
Sbjct  441   VAAGSINLNGTLTMEVQRPGSETAMANIVRLVEEAQSREAPVQRLADKVAGHFTYGVMAT  500

Query  2063  SAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslg  1884
             SAATF FW+L+GT +LP  L+QG   SLALQL+CSVLVVACPCALGLATPTAV+VGTSLG
Sbjct  501   SAATFTFWSLYGTHILPPALYQGRAVSLALQLACSVLVVACPCALGLATPTAVLVGTSLG  560

Query  1883  atrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTE-VVPQGHNDETNAKRDSTSTC  1707
             A RGLLLRGG++LE F+MV+T+VFDKTGTLT+GRP VT  V+P       NA    T   
Sbjct  561   AKRGLLLRGGNILEKFAMVDTVVFDKTGTLTVGRPVVTNIVIPICIK---NAISSQTEEN  617

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEK  1527
               S+V+VL LA+ VE+N+ HP+GKAIV+AA++ NC   K +DGTF+EEPGSGA+A I +K
Sbjct  618   ALSDVEVLRLAAAVETNSVHPVGKAIVDAAQAANCHNAKVKDGTFLEEPGSGAVATIYDK  677

Query  1526  KVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVES  1347
             KVSVGTL+W+ RHGV  +  QE +   NQS VYVGVD  LAGLIY ED++REDAR VV+ 
Sbjct  678   KVSVGTLEWITRHGVINSIHQEVEKSNNQSFVYVGVDDTLAGLIYFEDEIREDARDVVDR  737

Query  1346  LSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVG  1167
             LSKQ I  Y+LSGDK+NAAE+VAS+VGIP+E V   VKPDEK KF++ LQKD  +VAMVG
Sbjct  738   LSKQNIGVYMLSGDKRNAAEHVASLVGIPKEKVLSEVKPDEKKKFINELQKDNNIVAMVG  797

Query  1166  DGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLW  987
             DGINDAAALASSHVG+A+GGGVGAAS+VSS+VLM+N+LSQ++DALELSRLTM T+KQNLW
Sbjct  798   DGINDAAALASSHVGIALGGGVGAASEVSSIVLMRNQLSQIVDALELSRLTMNTIKQNLW  857

Query  986   WAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQ  807
             WAF YNIVG+P+AAG+L P  GT+LTPSIAGALMGLSSIGVMTNSLLLR KF+SKQK+I 
Sbjct  858   WAFIYNIVGIPIAAGVLFPINGTVLTPSIAGALMGLSSIGVMTNSLLLRFKFSSKQKQIH  917

Query  806   GPSVTIQI  783
               S   +I
Sbjct  918   SISPKTKI  925



>ref|XP_008455639.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X4 [Cucumis melo]
Length=784

 Score =  1073 bits (2776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/776 (73%), Positives = 670/776 (86%), Gaps = 2/776 (0%)
 Frame = -2

Query  3140  MTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLTS  2961
             MTCGGCAASVKRILE+QP+VSSASVNLTTETAV+WPV E K  P+  +QLGE LA HLT 
Sbjct  1     MTCGGCAASVKRILENQPQVSSASVNLTTETAVIWPVPEVKDSPHRVKQLGETLASHLTR  60

Query  2960  CGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAKA  2781
             CGF +++R+S R+N+F  FE+KM  KR +L+ SGR L  SWALCAVCL+GH+SHFFGAKA
Sbjct  61    CGFASSLRESGRDNIFMVFERKMEEKRNRLRESGRNLVFSWALCAVCLLGHISHFFGAKA  120

Query  2780  SWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMA  2601
             SWIH  H+T FH+S+CLFTLL PGRQLIIDG+KSL+KGAPNMNTLVGLGALSSF+VSS+A
Sbjct  121   SWIHTCHTTQFHLSLCLFTLLGPGRQLIIDGMKSLVKGAPNMNTLVGLGALSSFSVSSLA  180

Query  2600  AFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMG  2421
             A +PKLGWKAFFEEPVMLIAFVLLGRNLEQRAKI+A SDMTGLL++LPSKARLVV+    
Sbjct  181   ALMPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIRAASDMTGLLSILPSKARLVVDGGT-  239

Query  2420  EQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQV  2241
             E +STVE+PCS+LSVGD++IVLPGDRIPADGIV++GRS VDESSFTGEPLPVTKLPG+QV
Sbjct  240   ELSSTVEIPCSSLSVGDEVIVLPGDRIPADGIVKSGRSIVDESSFTGEPLPVTKLPGSQV  299

Query  2240  AAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALS  2061
             AAG+INLNG LTVEV R GG++A+GDI+RLVEEAQSREAPVQRLADKVSGHFTYGVM LS
Sbjct  300   AAGTINLNGTLTVEVHRHGGDSAMGDIIRLVEEAQSREAPVQRLADKVSGHFTYGVMGLS  359

Query  2060  AATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslga  1881
             AATF+FW+ FG+R+LP   H GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSLGA
Sbjct  360   AATFIFWSQFGSRILPTAFHHGSSVSLALQLSCSVLVVACPCALGLATPTAMLVGTSLGA  419

Query  1880  trglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEW  1701
             T+GLLLRGG++LE FSM +T+VFDKTGTLT+G+P VT+V       E N    + S   +
Sbjct  420   TKGLLLRGGNILEQFSMADTVVFDKTGTLTVGKPVVTKVFATSRY-ERNVDSQTNSHGNY  478

Query  1700  SEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKV  1521
             SE ++L  A+ VESNT HP+GKAIVEAA++ N   +K  +GTF+EEPGSGA+A ++ + V
Sbjct  479   SENEILKFAAAVESNTVHPVGKAIVEAARAVNGHSLKVVEGTFVEEPGSGAVATVQNRIV  538

Query  1520  SVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLS  1341
             S+GTLDWV+R GV     QE DD K QSVVYVG+D +LAG IY ED +REDARHVV++LS
Sbjct  539   SIGTLDWVQRQGVTVEDFQETDDLKAQSVVYVGIDNILAGCIYYEDGIREDARHVVDTLS  598

Query  1340  KQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDG  1161
             +QGI TY+LSGDK++ AEY+AS+VGIP+E V  GVKP EK KF+S LQ++  +VAMVGDG
Sbjct  599   RQGINTYMLSGDKRSNAEYIASLVGIPKEKVRSGVKPQEKKKFISELQENNNIVAMVGDG  658

Query  1160  INDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWA  981
             INDAAALA++ +G+A+GGGVGAAS+VS +VLM NRLSQLLDALELSRLTMKTVKQNLWWA
Sbjct  659   INDAAALATADIGIAMGGGVGAASEVSPIVLMGNRLSQLLDALELSRLTMKTVKQNLWWA  718

Query  980   FGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             FGYNIVG+PVAAG+LLP TGT+LTPSIAGALMGLSS+GVM NSLLLR++F+  +K+
Sbjct  719   FGYNIVGIPVAAGVLLPITGTILTPSIAGALMGLSSVGVMANSLLLRIRFSQNRKK  774



>ref|XP_004504792.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
[Cicer arietinum]
Length=934

 Score =  1073 bits (2775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/779 (73%), Positives = 666/779 (85%), Gaps = 3/779 (0%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGCAASVKRILESQP+VSSASVNLTTETA+VWPVSEAK  PNWQ+QLG+ LA+HLT
Sbjct  144   GMVCGGCAASVKRILESQPQVSSASVNLTTETAIVWPVSEAKTTPNWQKQLGKILAEHLT  203

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             +CGF + +RDS REN  + FE+K+  +  QL+ SGR LAVSWALCAVCLVGHLSH F AK
Sbjct  204   NCGFNSCLRDSTRENFLQIFERKVEERNRQLKESGRELAVSWALCAVCLVGHLSHLFAAK  263

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
               WIH  HS GFH+S+CLFTLL PGR+LI+DGLKSL K  PNMNTLVGLGALSSF VSS 
Sbjct  264   TPWIHAFHSVGFHLSLCLFTLLGPGRRLILDGLKSLFKRVPNMNTLVGLGALSSFTVSSF  323

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A  +PKLGWKAFFEEP+MLIAFVLLGRNLEQRAKIKATSDMTGLL++LPSKARL+VN+  
Sbjct  324   AVLLPKLGWKAFFEEPIMLIAFVLLGRNLEQRAKIKATSDMTGLLSILPSKARLLVNNGE  383

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
              E  S VEVP  +LSV DQII+LPGDRIPADGIVRAGRSTVDESSFTGEPLPVTK  G++
Sbjct  384   TEAASVVEVPSDSLSVEDQIIILPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKELGSE  443

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             VAAGSINLNG LT+EV+RPGGETAIGDI+RLVEEAQSREAPVQRLADKV+G+FTYGVMA 
Sbjct  444   VAAGSINLNGTLTIEVRRPGGETAIGDIIRLVEEAQSREAPVQRLADKVAGYFTYGVMAT  503

Query  2063  SAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslg  1884
             S  TF FW++FG+ +LPA ++QGS  SLALQL+CSVLV+ACPCALGLATPTAV+VGTSLG
Sbjct  504   SVTTFTFWSVFGSHILPAAVYQGSTVSLALQLACSVLVIACPCALGLATPTAVLVGTSLG  563

Query  1883  atrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCE  1704
             A RGLLLRGG++LE F+MVN +VFDKTGTLTIG+P VT++V     +  NA    T    
Sbjct  564   AKRGLLLRGGNILEKFAMVNAVVFDKTGTLTIGKPVVTKIVTPTCIE--NANSSQTKNNA  621

Query  1703  WSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKK  1524
              S+++VL+LA+ VESN+ HP+GKAIV+AA++ N    K  + TF+EEPGSG +A +  KK
Sbjct  622   LSDIEVLSLAAAVESNSVHPVGKAIVDAARAVNSHDAKVANETFLEEPGSGVVATVNNKK  681

Query  1523  VSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESL  1344
             VSVGTL+W+ RHGV  +  QE  ++KNQS VYVGVD  LAG+IY ED++R+DARHVV++L
Sbjct  682   VSVGTLEWITRHGVNNSIHQEV-EYKNQSFVYVGVDDTLAGVIYFEDEIRKDARHVVDTL  740

Query  1343  SKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGD  1164
             SKQ I  Y+LSGDK+NAAEYVAS+VGIP+E V   +KP+EK+KF+  LQ+D+KVVAMVGD
Sbjct  741   SKQDIGVYMLSGDKRNAAEYVASLVGIPKEKVLSEMKPEEKNKFIKELQQDKKVVAMVGD  800

Query  1163  GINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWW  984
             GINDAAALASSH+G+A+GGGVGAAS+VSS+VLM N LSQLLDALELSRLTM TVKQNLWW
Sbjct  801   GINDAAALASSHIGIALGGGVGAASEVSSIVLMHNHLSQLLDALELSRLTMNTVKQNLWW  860

Query  983   AFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQ  807
             AF YNIVG+P+AAG+L P  GTMLTPSIAGALMGLSSIGVMTNSLLLR+KF+ KQK+IQ
Sbjct  861   AFVYNIVGIPIAAGVLFPVNGTMLTPSIAGALMGLSSIGVMTNSLLLRIKFSLKQKQIQ  919



>ref|XP_009409273.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=952

 Score =  1068 bits (2763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/780 (73%), Positives = 667/780 (86%), Gaps = 3/780 (0%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM+CGGCAASVKRILESQP+VSSA+VNL TETA+VW +SEAKV+PNW+QQLG  LA HL
Sbjct  143   GGMSCGGCAASVKRILESQPQVSSANVNLATETAIVWAISEAKVMPNWKQQLGNRLAGHL  202

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CGFK+++RDS R++ ++ FE+KM+ K   L+ SGR LAVSWALCAVCL+GHLSHFF A
Sbjct  203   TTCGFKSSLRDSARDSFYKVFERKMDEKLQNLKESGRELAVSWALCAVCLLGHLSHFFKA  262

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
               SWIH  HST FH+S+ LFT L PGR+L++DG +SLL G+PNMNTLVGLGALSSFAVSS
Sbjct  263   GPSWIHTCHSTSFHLSLSLFTFLGPGRKLVLDGFRSLLMGSPNMNTLVGLGALSSFAVSS  322

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA +PKLGWK FFEEP+MLIAFVLLG+NLEQRAKIKATSDMTGLLN+LP+KARL+V+SD
Sbjct  323   IAAIMPKLGWKTFFEEPIMLIAFVLLGKNLEQRAKIKATSDMTGLLNILPTKARLMVDSD  382

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
              G+  S VEVPCS+LS+GDQI+VLPGDR+PADGIV+AGRS++DESSFTGEPLPVTKLPGA
Sbjct  383   AGKVPSLVEVPCSSLSIGDQIVVLPGDRVPADGIVKAGRSSIDESSFTGEPLPVTKLPGA  442

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             +V AGSINLNG LT+EV+RPGGETA+GDIVRLVE AQ+R APVQRLADKV+GHFTY VMA
Sbjct  443   EVTAGSINLNGTLTIEVKRPGGETAMGDIVRLVENAQTRGAPVQRLADKVAGHFTYAVMA  502

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF FW+LFG++++PA L  GS  SLALQLSCSVLVVACPCALGLATPTAV+VGTSL
Sbjct  503   LSAATFTFWSLFGSQLVPAALKHGSSMSLALQLSCSVLVVACPCALGLATPTAVLVGTSL  562

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTC  1707
             GATRGLLLRGG VLE F+ V+ +VFDKTGTLT G+P VT V+   H +   +    T   
Sbjct  563   GATRGLLLRGGDVLEKFAAVDAVVFDKTGTLTTGKPVVTRVITHQHGEHEYSYE--TPKF  620

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEK  1527
             +W+E D+L LA+ VESNTNHP+GKAIVEAA+S   + VK  DGTF EEPGSG +AV+++K
Sbjct  621   KWTEADILRLAASVESNTNHPVGKAIVEAARSVGSQNVKVIDGTFSEEPGSGVVAVVDQK  680

Query  1526  KVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVES  1347
             KV+VGTL W+RRHGV +    +  +  NQSVVYVGVD  LAGLIY ED++REDA HVVE+
Sbjct  681   KVAVGTLSWLRRHGVVDNPFPD-AELNNQSVVYVGVDSALAGLIYFEDKIREDAPHVVET  739

Query  1346  LSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVG  1167
             LSKQGI  Y+LSGDKKNAAEYVAS+VGI +  V   VKP+EK  F+S LQK+QKVV MVG
Sbjct  740   LSKQGINIYMLSGDKKNAAEYVASMVGIDKTKVISEVKPEEKKMFISELQKNQKVVVMVG  799

Query  1166  DGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLW  987
             DGINDAAALAS+ +G+A+G GVGAASDVSS+VLM NRLSQL+DAL+LS++TMKTVKQNLW
Sbjct  800   DGINDAAALASADIGIAMGEGVGAASDVSSIVLMGNRLSQLIDALDLSKVTMKTVKQNLW  859

Query  986   WAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQ  807
             WAF YNIVG+PVAAGILLP TGTMLTPSIAGALMGLSS+GVMTNSL LR +    +K + 
Sbjct  860   WAFAYNIVGIPVAAGILLPSTGTMLTPSIAGALMGLSSVGVMTNSLFLRFRAGKGKKHMH  919



>ref|XP_010526997.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=956

 Score =  1061 bits (2744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/795 (73%), Positives = 675/795 (85%), Gaps = 9/795 (1%)
 Frame = -2

Query  3203  AAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSE  3024
             A AG+     SSDVIILDVGGMTCGGCAASVK+ILESQP+VS+ASVNLTTETA+VWPV E
Sbjct  149   AGAGDGVPSPSSDVIILDVGGMTCGGCAASVKKILESQPQVSTASVNLTTETAIVWPVLE  208

Query  3023  AKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAV  2844
             AK VPNW+++LGE LAKHL++CGF++  R     N F  FE KM  K  +L+ SGR LAV
Sbjct  209   AKSVPNWKEELGEMLAKHLSNCGFESTPRGLTNVNFFRVFESKMKEKHTRLKESGRELAV  268

Query  2843  SWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGA  2664
             SWALCAVC+VGHL+HF G K  WIH  HSTGFH+S+ L TLL PGRQLIIDG+KSLLKGA
Sbjct  269   SWALCAVCVVGHLTHFLGVKVPWIHAFHSTGFHVSLSLLTLLGPGRQLIIDGIKSLLKGA  328

Query  2663  PNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSD  2484
             PNMNTLVGLGALSSF VSS+AA IPKLGWK FFEEPVMLIAF+LLGRNLEQRAKIKATSD
Sbjct  329   PNMNTLVGLGALSSFTVSSLAAMIPKLGWKTFFEEPVMLIAFILLGRNLEQRAKIKATSD  388

Query  2483  MTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             MTGLL+VLPSKARL+++ D    +STVEVPC++LSVGD +++LPGDR+PADGIVR+GRST
Sbjct  389   MTGLLSVLPSKARLLLDGDPQNPSSTVEVPCNSLSVGDLVVILPGDRVPADGIVRSGRST  448

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             +DESS TGEPLPVTK  G+QVAAG INLNG LTVEV+R GGETA+GDIVRLVEEAQSREA
Sbjct  449   IDESSLTGEPLPVTKESGSQVAAGCINLNGTLTVEVRRSGGETAVGDIVRLVEEAQSREA  508

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvva  1944
             PVQRL DKV+G FTYGVMALSAATFMFWNLFG+ +LP+TLH GS ASLALQLSCSVLVVA
Sbjct  509   PVQRLVDKVAGRFTYGVMALSAATFMFWNLFGSYILPSTLHNGSPASLALQLSCSVLVVA  568

Query  1943  CPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV  1764
             CPCALGLATPTA++VG SLGA RGLLLRGG +LE F+ V+T+VFDKTGTLT G P VT+V
Sbjct  569   CPCALGLATPTAMLVGISLGARRGLLLRGGDILEKFASVDTVVFDKTGTLTRGHPVVTKV  628

Query  1763  VPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAE  1584
             V   ++               SEV+VL LA+ VESNT+HP+GKAI+EAA++ NC+I+K E
Sbjct  629   VIPEYSRYNLGD-------TLSEVEVLKLAASVESNTSHPVGKAIIEAARNHNCQIIKVE  681

Query  1583  DGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQ--EFDDFKNQSVVYVGVDGV  1410
             DGTF EEPGSGA+A++  K+V+VGTLDW++RHGV E  +   E  +FK+QS VY+GVD  
Sbjct  682   DGTFSEEPGSGAVAIVNNKRVTVGTLDWLQRHGVAENPLHAIEGHEFKSQSTVYIGVDNT  741

Query  1409  LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKP  1230
             LA LI  ED++REDA+ VVE+LS+QGI  Y+LSGDK+N A YVASVVGIP+E V  GVKP
Sbjct  742   LAALICFEDKVREDAQQVVENLSRQGIDVYMLSGDKRNNANYVASVVGIPQERVIAGVKP  801

Query  1229  DEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLS  1050
              EK +F++ LQK +K VAMVGDGINDAAALASS VGVA+GGGVGAAS+VS +VLM NRLS
Sbjct  802   GEKKRFINELQKTRKGVAMVGDGINDAAALASSDVGVAMGGGVGAASEVSPIVLMSNRLS  861

Query  1049  QLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSI  870
             QLL+ALELSR TMKTVKQNLWWAFGYNIVG+P+AAG+LLP TGTMLTPSIAGALMGLSS+
Sbjct  862   QLLEALELSRQTMKTVKQNLWWAFGYNIVGIPIAAGVLLPLTGTMLTPSIAGALMGLSSV  921

Query  869   GVMTNSLLLRLKFAS  825
             GVM+NSLLLRL+F+S
Sbjct  922   GVMSNSLLLRLRFSS  936



>emb|CDO97451.1| unnamed protein product [Coffea canephora]
Length=718

 Score =  1060 bits (2740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/728 (78%), Positives = 651/728 (89%), Gaps = 10/728 (1%)
 Frame = -2

Query  2894  MNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLV  2715
             MN KR QL+ SGRGL VSWALCAVCL+GHLSHF GAK SWIH  HSTGFHMS+ LFTLL 
Sbjct  1     MNEKRNQLKESGRGLVVSWALCAVCLIGHLSHFIGAKVSWIHAFHSTGFHMSLSLFTLLG  60

Query  2714  PGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFV  2535
             PGR+LI DGLKSL+KGAPNMNTLVGLGA+SSFAVSS+AA IPKLGWK FFEEPVMLIAFV
Sbjct  61    PGRKLITDGLKSLIKGAPNMNTLVGLGAISSFAVSSLAALIPKLGWKTFFEEPVMLIAFV  120

Query  2534  LLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVL  2355
             LLGRNLEQRAKIKATSDMTGLL++LPSKARL+VN D+     +VEVPC+NLSVGDQIIVL
Sbjct  121   LLGRNLEQRAKIKATSDMTGLLSLLPSKARLIVNGDL-----SVEVPCNNLSVGDQIIVL  175

Query  2354  PGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGET  2175
             PGDR+PADGIVRAGRSTVDESSFTGEPLPVTKLPGA+VAAGS+NLNG LT+EV+RPGGET
Sbjct  176   PGDRVPADGIVRAGRSTVDESSFTGEPLPVTKLPGAEVAAGSVNLNGTLTIEVRRPGGET  235

Query  2174  AIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQG  1995
             ++GDIVRLVEEAQ+REAPVQ+LADK++GHFTYGVMALSAATF+FWNLFG RVLPA LHQG
Sbjct  236   SMGDIVRLVEEAQTREAPVQQLADKIAGHFTYGVMALSAATFVFWNLFGARVLPAALHQG  295

Query  1994  slaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIV  1815
             S  SLALQLSCSVLVVACPCALGLATPTAV+VGTSLGA +GLL RGGSVLE FS VNTIV
Sbjct  296   SPVSLALQLSCSVLVVACPCALGLATPTAVLVGTSLGAKKGLLFRGGSVLERFSAVNTIV  355

Query  1814  FDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGK  1635
             FDKTGTLT+GRP VT+++ QGH+ +TN K+D  S+ +WSEVD+L LA+GVE+NTNHP+GK
Sbjct  356   FDKTGTLTLGRPVVTKIMTQGHDKDTNTKQD--SSLKWSEVDILRLAAGVETNTNHPVGK  413

Query  1634  AIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFD  1455
             AIV AA++ NC ++KA +GT+IEEPGSGA+A++E +KV VG LDW++RHGV E+ +QE +
Sbjct  414   AIVHAAQAANCPVMKAGEGTYIEEPGSGAVAIVENRKVLVGALDWLKRHGVDESPLQELE  473

Query  1454  DFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVAS  1275
             + KNQS VYVG+D  LAG+IYVED++REDA HVVESLSKQGI+TYLLSGDKKNAAEYVAS
Sbjct  474   ETKNQSAVYVGIDDDLAGIIYVEDEIREDASHVVESLSKQGISTYLLSGDKKNAAEYVAS  533

Query  1274  VVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvga  1095
             VVGIP++ V YGVKP++K KF+SGLQK+  +VAMVGDGINDAAALAS+HVGVAIGGGVGA
Sbjct  534   VVGIPKDKVLYGVKPEQKKKFISGLQKEH-IVAMVGDGINDAAALASAHVGVAIGGGVGA  592

Query  1094  asdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTM  915
             AS+VSSVVLM NRLSQLLDALELSRLTMKTVKQNLWWAF YNI G+P+AAG LLP TGTM
Sbjct  593   ASEVSSVVLMHNRLSQLLDALELSRLTMKTVKQNLWWAFAYNIFGIPIAAGALLPVTGTM  652

Query  914   LTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQGPSVTIQIPsnsddsdnnSHKETL  735
             LTPSIAGALMGLSSIGVMTNSLLLR K++S++KEI GPSV I IP ++D   +   K  L
Sbjct  653   LTPSIAGALMGLSSIGVMTNSLLLRFKYSSREKEIGGPSVRIDIPLDADRVVDQDKK--L  710

Query  734   RQPYTESR  711
             + P+  +R
Sbjct  711   KDPFVSTR  718



>ref|NP_974675.1| putative copper-transporting ATPase PAA1 [Arabidopsis thaliana]
 sp|Q9SZC9.1|HMA6_ARATH RecName: Full=Copper-transporting ATPase PAA1, chloroplastic; 
AltName: Full=Protein HEAVY METAL ATPASE 6; AltName: Full=Protein 
glucose insensitive root 1; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB38810.1| metal-transporting P-type ATPase [Arabidopsis thaliana]
 emb|CAB80069.1| metal-transporting P-type ATPase [Arabidopsis thaliana]
 dbj|BAF00934.1| metal-transporting P-type ATPase [Arabidopsis thaliana]
 gb|AEE86239.1| putative copper-transporting ATPase PAA1 [Arabidopsis thaliana]
Length=949

 Score =  1060 bits (2740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/781 (73%), Positives = 670/781 (86%), Gaps = 13/781 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGC+ASVK+ILESQP+V+SASVNLTTETA+VWPV EAK VP+WQ+ LGE LA HL
Sbjct  155   GGMTCGGCSASVKKILESQPQVASASVNLTTETAIVWPVPEAKSVPDWQKSLGETLANHL  214

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CGF++  RD   EN F+ FE K   K+A+L+ SGR LAVSWALCAVCLVGHL+HF G 
Sbjct  215   TNCGFQSTPRDLVTENFFKVFETKTKDKQARLKESGRELAVSWALCAVCLVGHLTHFLGV  274

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
              A WIH +HSTGFH+S+CL TLL PGR+L++DG+KSLLKG+PNMNTLVGLGALSSF+VSS
Sbjct  275   NAPWIHAIHSTGFHVSLCLITLLGPGRKLVLDGIKSLLKGSPNMNTLVGLGALSSFSVSS  334

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA IPKLGWK FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+VLPSKARL+++ D
Sbjct  335   LAAMIPKLGWKTFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLPSKARLLLDGD  394

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
             +  Q STVEVPC++LSVGD +++LPGDR+PADG+V++GRST+DESSFTGEPLPVTK  G+
Sbjct  395   L--QNSTVEVPCNSLSVGDLVVILPGDRVPADGVVKSGRSTIDESSFTGEPLPVTKESGS  452

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAGSINLNG LTVEV R GGETA+GDI+RLVEEAQSREAPVQ+L DKV+G FTYGVMA
Sbjct  453   QVAAGSINLNGTLTVEVHRSGGETAVGDIIRLVEEAQSREAPVQQLVDKVAGRFTYGVMA  512

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF FWNLFG  VLP+ LH GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  513   LSAATFTFWNLFGAHVLPSALHNGSPMSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  572

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTST  1710
             GA RGLLLRGG +LE FS+V+T+VFDKTGTLT G P VTEV +P+      N + +   T
Sbjct  573   GARRGLLLRGGDILEKFSLVDTVVFDKTGTLTKGHPVVTEVIIPE------NPRHNLNDT  626

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
               WSEV+VL LA+ VESNT HP+GKAIV+AA++RNC+ +KAEDGTF EEPGSGA+A++  
Sbjct  627   --WSEVEVLMLAAAVESNTTHPVGKAIVKAARARNCQTMKAEDGTFTEEPGSGAVAIVNN  684

Query  1529  KKVSVGTLDWVRRHG-VGETRVQ-EFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHV  1356
             K+V+VGTL+WV+RHG  G + +  E  +  NQSVVY+GVD  LA +I  ED++REDA  V
Sbjct  685   KRVTVGTLEWVKRHGATGNSLLALEEHEINNQSVVYIGVDNTLAAVIRFEDKVREDAAQV  744

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             VE+L++QGI  Y+LSGDK+NAA YVASVVGI  E V  GVKP EK  F++ LQK++K+VA
Sbjct  745   VENLTRQGIDVYMLSGDKRNAANYVASVVGINHERVIAGVKPAEKKNFINELQKNKKIVA  804

Query  1175  MVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             MVGDGINDAAALASS+VGVA+GGG GAAS+VS VVLM NRL+QLLDA+ELSR TMKTVKQ
Sbjct  805   MVGDGINDAAALASSNVGVAMGGGAGAASEVSPVVLMGNRLTQLLDAMELSRQTMKTVKQ  864

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             NLWWAFGYNIVG+P+AAG+LLP TGTMLTPS+AGALMG+SS+GVMTNSLLLR +F S + 
Sbjct  865   NLWWAFGYNIVGIPIAAGVLLPLTGTMLTPSMAGALMGVSSLGVMTNSLLLRYRFFSNRN  924

Query  815   E  813
             +
Sbjct  925   D  925



>emb|CAA20565.1| metal-transporting P-type ATPase (fragment) [Arabidopsis thaliana]
Length=870

 Score =  1059 bits (2739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/781 (73%), Positives = 670/781 (86%), Gaps = 13/781 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGC+ASVK+ILESQP+V+SASVNLTTETA+VWPV EAK VP+WQ+ LGE LA HL
Sbjct  76    GGMTCGGCSASVKKILESQPQVASASVNLTTETAIVWPVPEAKSVPDWQKSLGETLANHL  135

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CGF++  RD   EN F+ FE K   K+A+L+ SGR LAVSWALCAVCLVGHL+HF G 
Sbjct  136   TNCGFQSTPRDLVTENFFKVFETKTKDKQARLKESGRELAVSWALCAVCLVGHLTHFLGV  195

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
              A WIH +HSTGFH+S+CL TLL PGR+L++DG+KSLLKG+PNMNTLVGLGALSSF+VSS
Sbjct  196   NAPWIHAIHSTGFHVSLCLITLLGPGRKLVLDGIKSLLKGSPNMNTLVGLGALSSFSVSS  255

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA IPKLGWK FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+VLPSKARL+++ D
Sbjct  256   LAAMIPKLGWKTFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLPSKARLLLDGD  315

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
             +  Q STVEVPC++LSVGD +++LPGDR+PADG+V++GRST+DESSFTGEPLPVTK  G+
Sbjct  316   L--QNSTVEVPCNSLSVGDLVVILPGDRVPADGVVKSGRSTIDESSFTGEPLPVTKESGS  373

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAGSINLNG LTVEV R GGETA+GDI+RLVEEAQSREAPVQ+L DKV+G FTYGVMA
Sbjct  374   QVAAGSINLNGTLTVEVHRSGGETAVGDIIRLVEEAQSREAPVQQLVDKVAGRFTYGVMA  433

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF FWNLFG  VLP+ LH GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  434   LSAATFTFWNLFGAHVLPSALHNGSPMSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  493

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTST  1710
             GA RGLLLRGG +LE FS+V+T+VFDKTGTLT G P VTEV +P+      N + +   T
Sbjct  494   GARRGLLLRGGDILEKFSLVDTVVFDKTGTLTKGHPVVTEVIIPE------NPRHNLNDT  547

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
               WSEV+VL LA+ VESNT HP+GKAIV+AA++RNC+ +KAEDGTF EEPGSGA+A++  
Sbjct  548   --WSEVEVLMLAAAVESNTTHPVGKAIVKAARARNCQTMKAEDGTFTEEPGSGAVAIVNN  605

Query  1529  KKVSVGTLDWVRRHG-VGETRVQ-EFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHV  1356
             K+V+VGTL+WV+RHG  G + +  E  +  NQSVVY+GVD  LA +I  ED++REDA  V
Sbjct  606   KRVTVGTLEWVKRHGATGNSLLALEEHEINNQSVVYIGVDNTLAAVIRFEDKVREDAAQV  665

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             VE+L++QGI  Y+LSGDK+NAA YVASVVGI  E V  GVKP EK  F++ LQK++K+VA
Sbjct  666   VENLTRQGIDVYMLSGDKRNAANYVASVVGINHERVIAGVKPAEKKNFINELQKNKKIVA  725

Query  1175  MVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             MVGDGINDAAALASS+VGVA+GGG GAAS+VS VVLM NRL+QLLDA+ELSR TMKTVKQ
Sbjct  726   MVGDGINDAAALASSNVGVAMGGGAGAASEVSPVVLMGNRLTQLLDAMELSRQTMKTVKQ  785

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             NLWWAFGYNIVG+P+AAG+LLP TGTMLTPS+AGALMG+SS+GVMTNSLLLR +F S + 
Sbjct  786   NLWWAFGYNIVGIPIAAGVLLPLTGTMLTPSMAGALMGVSSLGVMTNSLLLRYRFFSNRN  845

Query  815   E  813
             +
Sbjct  846   D  846



>ref|XP_010437749.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=951

 Score =  1058 bits (2736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/781 (72%), Positives = 665/781 (85%), Gaps = 13/781 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGC+ASVK+ILESQP+V+SASVNLTTETA+VWPV EAK VP+WQ+ LGE LA HL
Sbjct  157   GGMTCGGCSASVKKILESQPQVASASVNLTTETAIVWPVPEAKSVPDWQKSLGETLANHL  216

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CGF++  RD   EN F+ FE K   K+A+L+ SGR LAVSWALCAVCLVGHL+HF G 
Sbjct  217   TNCGFQSTPRDLVTENFFKVFETKTKDKQARLKESGRELAVSWALCAVCLVGHLTHFLGV  276

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
              A WIH +HSTGFH+S+CL TLL PGR+L++DG+KSLLKG+PNMNTLVGLGALSSF+VSS
Sbjct  277   NAPWIHAIHSTGFHVSLCLITLLGPGRKLVLDGVKSLLKGSPNMNTLVGLGALSSFSVSS  336

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA IPKLGWK FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+VLPSKARL+++ D
Sbjct  337   LAAMIPKLGWKMFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLPSKARLLLDED  396

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               +Q STVEVPC++LSVGD +++LPGDR+PADG+V++GRS +DESSFTGEPLPVTK PG+
Sbjct  397   --QQNSTVEVPCNSLSVGDLVVILPGDRVPADGVVKSGRSAIDESSFTGEPLPVTKEPGS  454

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAGSINLNG LTVEV R GGETA+GDI+RLVEEAQSREAPVQ+L DKV+G FTYGVMA
Sbjct  455   QVAAGSINLNGTLTVEVHRSGGETAVGDIIRLVEEAQSREAPVQQLVDKVAGRFTYGVMA  514

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF FWNLFG  VLP+ L  GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  515   LSAATFTFWNLFGAHVLPSALQNGSPMSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  574

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTST  1710
             GA RGLLLRGG +LE FS V+T+VFDKTGTLT G P VTEV +P+   D  N        
Sbjct  575   GARRGLLLRGGDILEKFSSVDTVVFDKTGTLTKGHPVVTEVIIPEDPRDNLNDT------  628

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
               WSE +VL LA+ VESNT HP+GKAI++AA++RNC+ +KAE+GTF EEPGSGA+A++  
Sbjct  629   --WSEFEVLMLAAAVESNTTHPVGKAIIKAARTRNCQTMKAEEGTFTEEPGSGAVAIVNN  686

Query  1529  KKVSVGTLDWVRRHGVGETRVQ--EFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHV  1356
             K+V+VGTL+WV+RHG   + +   E  +F NQSVVY+GVD  LA +I  ED++REDA  V
Sbjct  687   KRVTVGTLEWVQRHGATGSSLHALEEHEFNNQSVVYIGVDNTLAAVIRFEDKIREDAAQV  746

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             VE+L++QGI  Y+LSGDK+NAA YVASVVGI +E V  GVKP EK  F++ LQK++K+VA
Sbjct  747   VENLTRQGIDVYMLSGDKRNAANYVASVVGINQERVIAGVKPAEKKNFINELQKNKKIVA  806

Query  1175  MVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             MVGDGIND AALASS VGVA+GGG GAAS+VS +VLM NRL+QLLDA+ELSR TMKTVKQ
Sbjct  807   MVGDGINDVAALASSDVGVAMGGGAGAASEVSPIVLMGNRLTQLLDAMELSRQTMKTVKQ  866

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             NLWWAFGYNIVG+P+AAG+LLP TGTMLTPS+AGALMG+SS+GVMTNSLLLR +F S +K
Sbjct  867   NLWWAFGYNIVGIPIAAGVLLPLTGTMLTPSMAGALMGVSSLGVMTNSLLLRYRFFSNRK  926

Query  815   E  813
             +
Sbjct  927   D  927



>ref|XP_002869211.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45470.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=949

 Score =  1056 bits (2732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/781 (73%), Positives = 666/781 (85%), Gaps = 13/781 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGC+ASVK+ILESQP+V+SASVNLTTETA+VWPV EAK VP+WQ+ LGE LA HL
Sbjct  155   GGMTCGGCSASVKKILESQPQVASASVNLTTETAIVWPVPEAKSVPDWQKSLGETLANHL  214

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CGF++  RD   EN F+ FE K   K+A+L+ SGR LAVSWALCAVCLVGHL+HF G 
Sbjct  215   TNCGFQSTPRDLVTENFFKVFETKTKDKQARLKESGRELAVSWALCAVCLVGHLTHFLGV  274

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
              A WIH +HSTGFH+S+CL TLL PGR+L++DG+KSLLKG+PNMNTLVGLGALSSF+VSS
Sbjct  275   NAPWIHAIHSTGFHVSLCLITLLGPGRKLVLDGIKSLLKGSPNMNTLVGLGALSSFSVSS  334

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA IPKLGWK FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+VLPSKARL+++ D
Sbjct  335   LAAMIPKLGWKTFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLPSKARLLLDGD  394

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
             +  Q STVEVPC++LSVGD +++LPGDR+PADG+V++GRST+DESSFTGEPLPVTK  G+
Sbjct  395   L--QNSTVEVPCNSLSVGDLVVILPGDRVPADGVVKSGRSTIDESSFTGEPLPVTKESGS  452

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAGSINLNG LTVEV R GGETA+GDI+RLVEEAQSREAPVQ+L DKV+G FTYGVMA
Sbjct  453   QVAAGSINLNGTLTVEVHRSGGETAVGDIIRLVEEAQSREAPVQQLVDKVAGRFTYGVMA  512

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF FWNLFG  VLP+ LH GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  513   LSAATFTFWNLFGAHVLPSALHNGSPMSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  572

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTST  1710
             GA RGLLLRGG +LE FS V+T+VFDKTGTLT G P VTEV +P+      N + +   T
Sbjct  573   GARRGLLLRGGDILEKFSSVDTVVFDKTGTLTKGHPVVTEVIIPE------NPRHNLNDT  626

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
               WSEV+VL LA+ VESNT HP+GKAIV+AA++ NC+ +KAEDGTF EEPGSGA+A++  
Sbjct  627   --WSEVEVLMLAAAVESNTTHPVGKAIVKAARACNCQTMKAEDGTFTEEPGSGAVAIVNN  684

Query  1529  KKVSVGTLDWVRRHGV--GETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHV  1356
             K+V+VGTL+WV+RHG     T   E  +  NQSVVY+GVD  LA +I  ED++REDA  V
Sbjct  685   KRVTVGTLEWVQRHGATGNSTLALEEHELNNQSVVYIGVDNTLAAVIRFEDKVREDAAQV  744

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             VE+L++QGI  Y+LSGDK+NAA YVASVVGI +E V  GVKP EK  F++ LQK++K+VA
Sbjct  745   VENLTRQGIDVYMLSGDKRNAANYVASVVGINQERVIAGVKPAEKKTFINELQKNKKIVA  804

Query  1175  MVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             MVGDGINDAAALASS VGVA+GGG GAAS+VS VVLM NRL+QLLDA+ELSR TMKTVKQ
Sbjct  805   MVGDGINDAAALASSDVGVAMGGGAGAASEVSPVVLMGNRLTQLLDAMELSRQTMKTVKQ  864

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             NLWWAFGYNIVG+P+AAG+LLP TGTMLTPS+AGALMG+SS+GVMTNSLLLR +F S + 
Sbjct  865   NLWWAFGYNIVGIPIAAGVLLPLTGTMLTPSMAGALMGVSSLGVMTNSLLLRYRFFSNRN  924

Query  815   E  813
             +
Sbjct  925   D  925



>ref|XP_010937450.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=961

 Score =  1056 bits (2731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/780 (73%), Positives = 679/780 (87%), Gaps = 5/780 (1%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM+CGGCAASVKRILESQP+VS+ASVNL TETA+VW V E K   NW+QQLGE+LA  L
Sbjct  150   GGMSCGGCAASVKRILESQPQVSAASVNLATETAIVWAVPEVKATENWKQQLGEKLADRL  209

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+ GFK+N+RD+ RENL   FEKKM+ +  +L+ SG+ LAVSWALCAVC +GH++HF GA
Sbjct  210   TTSGFKSNLRDTSRENLDRVFEKKMDERLQRLKESGQELAVSWALCAVCFLGHIAHFLGA  269

Query  2786  KA-SWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
              A SW+H  HST FH+S+ L T + PGR+LI DGLKSLLKG+PNMNTLVGLGALSSF VS
Sbjct  270   SAPSWLHAFHSTRFHLSLSLMTFVGPGRKLIFDGLKSLLKGSPNMNTLVGLGALSSFLVS  329

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
             S+AAF+PKLGWK FFEEP+MLIAFVLLG+NLEQRAK+KATSDMTGLLN+LP KARL+V+S
Sbjct  330   SIAAFMPKLGWKTFFEEPIMLIAFVLLGKNLEQRAKLKATSDMTGLLNILPKKARLMVDS  389

Query  2429  DMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPG  2250
             +  + +S VEVPCSNL++GD I++LPGDR+PADGIV+AGRSTVDESS +GEPLPVTKLPG
Sbjct  390   NAEQLSSVVEVPCSNLAIGDHIVILPGDRVPADGIVKAGRSTVDESSLSGEPLPVTKLPG  449

Query  2249  AQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVM  2070
             A+V AGSINLNG LTVEV+RPGGET +GDIVRLVEEAQ+REAPVQRLADKV+GHFTYGVM
Sbjct  450   AEVTAGSINLNGTLTVEVRRPGGETVMGDIVRLVEEAQTREAPVQRLADKVAGHFTYGVM  509

Query  2069  ALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgts  1890
             A SAATFMFW+LFG+R++PA +HQGS  SLALQLSCSVLVVACPCALGLATPTAV+VGTS
Sbjct  510   AFSAATFMFWSLFGSRLVPAAIHQGSPLSLALQLSCSVLVVACPCALGLATPTAVLVGTS  569

Query  1889  lgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTST  1710
             LGATRGLLLRGG+VLE F+ V+T+VFDKTGTLTIG+P VT+++   ++ + ++K  ++  
Sbjct  570   LGATRGLLLRGGNVLEKFAEVDTVVFDKTGTLTIGKPVVTKIIASQNDGDWDSK--NSFD  627

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
              +W+EVD+L LA+GVESNTNHP+GKAIVEAA + +C  VKA DGTF EEPGSGA+A +E 
Sbjct  628   YKWTEVDILRLAAGVESNTNHPVGKAIVEAASAASCLNVKATDGTFREEPGSGAVATVEN  687

Query  1529  KKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVE  1350
             KKV+VGTL W+RRHGV      +  +F +QSVVYVGVDGVLAG+IY ED+LR+DA  VVE
Sbjct  688   KKVAVGTLSWLRRHGVVHNPFPD-AEFIDQSVVYVGVDGVLAGIIYFEDKLRDDACEVVE  746

Query  1349  SLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQ-KVVAM  1173
              LSKQGI+TY+LSGDK++ AE+VAS+VGI ++ VF GVKPDEK KF++ LQKDQ KVVAM
Sbjct  747   ILSKQGISTYMLSGDKRSTAEHVASMVGIHKDKVFSGVKPDEKKKFIADLQKDQKKVVAM  806

Query  1172  VGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQN  993
             VGDGINDAAALASS +G+A+G GVGAASDVS +VLM NRLSQL+DAL+LS+ TM+TVKQN
Sbjct  807   VGDGINDAAALASSDIGIAMGEGVGAASDVSCIVLMGNRLSQLIDALDLSKQTMRTVKQN  866

Query  992   LWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             LWWAF YN+VGLP+AAGILLP TGTMLTPSIAGALMGLSS+ VMTNSLLLRL+  SK KE
Sbjct  867   LWWAFAYNMVGLPIAAGILLPVTGTMLTPSIAGALMGLSSVAVMTNSLLLRLRLGSKHKE  926



>ref|XP_010432548.1| PREDICTED: LOW QUALITY PROTEIN: copper-transporting ATPase PAA1, 
chloroplastic-like [Camelina sativa]
Length=951

 Score =  1056 bits (2730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/781 (72%), Positives = 666/781 (85%), Gaps = 13/781 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGC+ASVK+ILESQP+V+SASVNLTTETA+VWPV EAK VP+WQ+ LGE LA HL
Sbjct  157   GGMTCGGCSASVKKILESQPQVASASVNLTTETAIVWPVPEAKSVPDWQKSLGETLANHL  216

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CGF++  RD   EN F+ FE K   K+A+L+ SGR LAVSWALCAVCLVGHL+HF G 
Sbjct  217   TNCGFQSTPRDLVTENFFKVFETKTKDKQARLKESGRELAVSWALCAVCLVGHLTHFLGV  276

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
              A WIH +HSTGFH+S+CL TLL PGR+L++DG+KSLLKG+PNMNTLVGLGALSSF+VSS
Sbjct  277   NAPWIHTIHSTGFHVSLCLITLLGPGRKLVLDGVKSLLKGSPNMNTLVGLGALSSFSVSS  336

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA IPKLGWK FFEEPVMLIAFVLLGRNLEQ+AKIKATSDMTGLL+VLPSKARL+++ D
Sbjct  337   LAAMIPKLGWKMFFEEPVMLIAFVLLGRNLEQQAKIKATSDMTGLLSVLPSKARLLLDGD  396

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               +Q STVEVPC++LSVGD +++LPGDR+PADG+V++GRS +DESSFTGEPLPVTK PG+
Sbjct  397   --QQNSTVEVPCNSLSVGDLVVILPGDRVPADGVVKSGRSAIDESSFTGEPLPVTKEPGS  454

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAGSINLNG LTVEV R GGETA+GDI+RLVEEAQSREAPVQ+L DKV+G FTYGVMA
Sbjct  455   QVAAGSINLNGTLTVEVHRSGGETAVGDIIRLVEEAQSREAPVQQLVDKVAGRFTYGVMA  514

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF FWNLFG  VLP+ L  GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  515   LSAATFTFWNLFGAHVLPSALQNGSPMSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  574

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTST  1710
             GA RGLLLRGG +LE FS V+T+VFDKTGTLT G P VTEV +P+   D  N        
Sbjct  575   GARRGLLLRGGDILEKFSSVDTVVFDKTGTLTKGHPVVTEVIIPEDPRDNLNDT------  628

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
               WSE +VL LA+ VESNT HP+GKAI++AA++RNC+ +KAE+GTF EEPGSGA+A++  
Sbjct  629   --WSEFEVLMLAAAVESNTTHPVGKAIIKAARARNCQTMKAEEGTFTEEPGSGAVAIVNN  686

Query  1529  KKVSVGTLDWVRRHGVGETRVQ--EFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHV  1356
             K+V+VGTL+WV+RHG     +   E  +F NQSVVY+GVD ++A +I  ED++REDA  V
Sbjct  687   KRVTVGTLEWVQRHGATGNSLHALEEHEFNNQSVVYIGVDNLVAAVIRFEDKIREDAAQV  746

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             VE+L++QGI  Y+LSGDK+NAA YVASVVGI +E V  GVKP EK  F++ LQK++K+VA
Sbjct  747   VENLTRQGIDVYMLSGDKRNAANYVASVVGINQERVIAGVKPAEKKNFINELQKNKKIVA  806

Query  1175  MVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             MVGDGINDAAALASS VGVA+GGG GAAS+VS +VLM NRL+QLLDA+ELSR TMKTVKQ
Sbjct  807   MVGDGINDAAALASSDVGVAMGGGAGAASEVSPIVLMGNRLTQLLDAMELSRQTMKTVKQ  866

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             NLWWAFGYNIVG+P+AAG+LLP TGTMLTPS+AGALMG+SS+GVMTNSLLLR +F S +K
Sbjct  867   NLWWAFGYNIVGIPIAAGVLLPLTGTMLTPSMAGALMGVSSLGVMTNSLLLRYRFFSNRK  926

Query  815   E  813
             +
Sbjct  927   D  927



>ref|NP_974676.1| putative copper-transporting ATPase PAA1 [Arabidopsis thaliana]
 gb|AEE86241.1| putative copper-transporting ATPase PAA1 [Arabidopsis thaliana]
Length=949

 Score =  1056 bits (2730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/781 (73%), Positives = 669/781 (86%), Gaps = 13/781 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGC+ASVK+ILESQP+V+SASVNLTTETA+VWPV EAK VP+WQ+ LGE LA HL
Sbjct  155   GGMTCGGCSASVKKILESQPQVASASVNLTTETAIVWPVPEAKSVPDWQKSLGETLANHL  214

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CGF++  RD   EN F+ FE K   K+A+L+ SGR LAVSWALCAVCLVGHL+HF G 
Sbjct  215   TNCGFQSTPRDLVTENFFKVFETKTKDKQARLKESGRELAVSWALCAVCLVGHLTHFLGV  274

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
              A WIH +HSTGFH+S+CL TLL PGR+L++DG+KSLLKG+PNMNTLVGLGALSSF+VSS
Sbjct  275   NAPWIHAIHSTGFHVSLCLITLLGPGRKLVLDGIKSLLKGSPNMNTLVGLGALSSFSVSS  334

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA IPKLGWK FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+VLPSKARL+++ D
Sbjct  335   LAAMIPKLGWKTFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLPSKARLLLDGD  394

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
             +  Q STVEVPC++LSVGD +++LPGDR+PADG+V++GRST+DESSFTGEPLPVTK  G+
Sbjct  395   L--QNSTVEVPCNSLSVGDLVVILPGDRVPADGVVKSGRSTIDESSFTGEPLPVTKESGS  452

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAGSINLNG LTVEV R GGETA+GDI+RLVEEAQSREAPVQ+L DKV+G FTYGVMA
Sbjct  453   QVAAGSINLNGTLTVEVHRSGGETAVGDIIRLVEEAQSREAPVQQLVDKVAGRFTYGVMA  512

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF FWNLFG  VLP+ LH GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  513   LSAATFTFWNLFGAHVLPSALHNGSPMSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  572

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTST  1710
             GA RGLLLRGG +LE FS+V+T+VFDKTGTLT G P VTEV +P+      N + +   T
Sbjct  573   GARRGLLLRGGDILEKFSLVDTVVFDKTGTLTKGHPVVTEVIIPE------NPRHNLNDT  626

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
               WSEV+VL LA+ VESNT HP+GKAIV+AA++RNC+ +KAEDGTF EEPGSGA+A++  
Sbjct  627   --WSEVEVLMLAAAVESNTTHPVGKAIVKAARARNCQTMKAEDGTFTEEPGSGAVAIVNN  684

Query  1529  KKVSVGTLDWVRRHG-VGETRVQ-EFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHV  1356
             K+V+VGTL+WV+RHG  G + +  E  +  NQSVVY+GVD  LA +I  ED++REDA  V
Sbjct  685   KRVTVGTLEWVKRHGATGNSLLALEEHEINNQSVVYIGVDNTLAAVIRFEDKVREDAAQV  744

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             VE+L++QGI  Y+LSGDK+NAA YVASVVGI  E V  GVKP EK  F++ LQK++K+VA
Sbjct  745   VENLTRQGIDVYMLSGDKRNAANYVASVVGINHERVIAGVKPAEKKNFINELQKNKKIVA  804

Query  1175  MVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             MVGDGINDAAALASS+VGVA+GGG GAAS+VS VVLM NRL+QLLDA+ELSR TMKTVKQ
Sbjct  805   MVGDGINDAAALASSNVGVAMGGGAGAASEVSPVVLMGNRLTQLLDAMELSRQTMKTVKQ  864

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             NLWWAFGYNIV +P+AAG+LLP TGTMLTPS+AGALMG+SS+GVMTNSLLLR +F S + 
Sbjct  865   NLWWAFGYNIVRIPIAAGVLLPLTGTMLTPSMAGALMGVSSLGVMTNSLLLRYRFFSNRN  924

Query  815   E  813
             +
Sbjct  925   D  925



>ref|XP_010315098.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X2 [Solanum lycopersicum]
Length=805

 Score =  1055 bits (2729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/661 (83%), Positives = 609/661 (92%), Gaps = 2/661 (0%)
 Frame = -2

Query  3224  KENPSVIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETA  3045
             KENPSV+A  GED S +SSDVIILDV GMTCGGCA+SVKRILESQP+VSSA+VNLTTETA
Sbjct  128   KENPSVVAETGEDISALSSDVIILDVTGMTCGGCASSVKRILESQPQVSSATVNLTTETA  187

Query  3044  VVWPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQA  2865
             +VWPVS+AKVVPNWQ+QLGE LAKHL++CGFK+NVRDSRREN FE FEKKMNAKR QL+ 
Sbjct  188   IVWPVSDAKVVPNWQKQLGEALAKHLSTCGFKSNVRDSRRENYFEIFEKKMNAKRIQLKE  247

Query  2864  SGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGL  2685
             SGR LAVSWALC VCLVGHLSHF GA ASWIH +HSTGFHM++ LFTLLVPGRQLIIDGL
Sbjct  248   SGRALAVSWALCGVCLVGHLSHFLGANASWIHAIHSTGFHMTLSLFTLLVPGRQLIIDGL  307

Query  2684  KSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRA  2505
             KSL+KG+PNMNTLVGLGALSSFAVSSMAA IPKLGWK FFEEPVMLIAFVLLGRNLEQRA
Sbjct  308   KSLIKGSPNMNTLVGLGALSSFAVSSMAALIPKLGWKTFFEEPVMLIAFVLLGRNLEQRA  367

Query  2504  KIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGI  2325
             KIKATSDMTGLLNVLPSKARLVV+ D+GE +STVEVP S+LSVGDQIIVLPGDR+PADGI
Sbjct  368   KIKATSDMTGLLNVLPSKARLVVSGDLGESSSTVEVPSSSLSVGDQIIVLPGDRVPADGI  427

Query  2324  VRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVE  2145
             VRAGRSTVDESSFTGEPLPVTKLPGA+VAAGSINLNG LTVEV+RPGGETAIGDIVRLVE
Sbjct  428   VRAGRSTVDESSFTGEPLPVTKLPGAEVAAGSINLNGTLTVEVRRPGGETAIGDIVRLVE  487

Query  2144  EAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqls  1965
             EAQSREAPVQRLADKV+GHFTYGVM LSAATFMFWNLFG R+LP +L+ GS+ SLALQLS
Sbjct  488   EAQSREAPVQRLADKVAGHFTYGVMTLSAATFMFWNLFGARILPPSLYHGSVVSLALQLS  547

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
             C+VLV+ACPCALGLATPTAVMVGTSLGAT+GLLLRGGSVLE FS VNTIVFDKTGTLTIG
Sbjct  548   CTVLVIACPCALGLATPTAVMVGTSLGATKGLLLRGGSVLERFSTVNTIVFDKTGTLTIG  607

Query  1784  RPTVTEVVP--QGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKS  1611
             RP VT+VV   QGH ++ +A++DSTS C+WSEVD+L  A+GVESNTNHPIGKAI+EAA++
Sbjct  608   RPVVTKVVSQGQGHQEDVDARQDSTSPCQWSEVDILKFAAGVESNTNHPIGKAIIEAAQT  667

Query  1610  RNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVV  1431
                  +K  DGTF+EEPGSGA+  I++K++SVGTL+WV+RHGV E   QE DDFKNQSVV
Sbjct  668   AKSPKLKVLDGTFMEEPGSGAVGYIDDKRISVGTLEWVKRHGVLENPFQESDDFKNQSVV  727

Query  1430  YVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPREN  1251
             YVGVDGVLAGLIYVEDQ+REDARHVVESL+KQGI+TYLLSGDKKNAAEYVASVVGIP+EN
Sbjct  728   YVGVDGVLAGLIYVEDQIREDARHVVESLTKQGISTYLLSGDKKNAAEYVASVVGIPKEN  787

Query  1250  V  1248
             +
Sbjct  788   M  788



>ref|XP_009121393.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic [Brassica 
rapa]
Length=940

 Score =  1055 bits (2727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/781 (72%), Positives = 664/781 (85%), Gaps = 16/781 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGC+ASVK+ILESQP+V++ASVNLTTETA+VWPV EAK VP+WQ+ LGE LA HL
Sbjct  148   GGMTCGGCSASVKKILESQPQVATASVNLTTETAIVWPVPEAKSVPDWQKTLGETLANHL  207

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CGF++  RD   EN F+ FE K   K+A+L+ SGR LAVSWALCAVCLVGH++HF G 
Sbjct  208   TNCGFQSTPRDLVTENFFKVFETKTKDKQARLKQSGRELAVSWALCAVCLVGHVTHFLGV  267

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
             KA W+H +HSTGFH+S+CL TLL PGRQLI+DG KSLLKG+PNMNTLVGLGA+SSF+VS+
Sbjct  268   KAPWLHAVHSTGFHVSLCLLTLLGPGRQLILDGFKSLLKGSPNMNTLVGLGAMSSFSVSA  327

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA IPKLGWK FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+VLPSKARL+++ D
Sbjct  328   LAALIPKLGWKTFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLPSKARLLLDGD  387

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
                  STVEVPC++LSVGD +++LPGDR+PADGIV++GRS +DESSFTGEPLPVTK  G+
Sbjct  388   -----STVEVPCNSLSVGDLVVILPGDRVPADGIVKSGRSAIDESSFTGEPLPVTKEAGS  442

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAGSINLNG LTVEV R GGETA+GDIVR+VEEAQSREAPVQ+L DKV+G FTYGVMA
Sbjct  443   QVAAGSINLNGTLTVEVHRSGGETAVGDIVRMVEEAQSREAPVQQLVDKVAGRFTYGVMA  502

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             +SAATF FWNLFG  +LP+ LH GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  503   ISAATFTFWNLFGGHILPSALHNGSPISLALQLSCSVLVVACPCALGLATPTAMLVGTSL  562

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTST  1710
             GA RGLLLRGG +LE FS V+T+VFDKTGTLT G P VTEV +P+      N        
Sbjct  563   GARRGLLLRGGDILEKFSSVDTVVFDKTGTLTKGHPVVTEVIIPEDSRHNLNDT------  616

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
               WSEVDVLTLA+ VESNT HP+GKAIV+AA++ NC+I+KAEDGTF EEPGSGA+A++  
Sbjct  617   --WSEVDVLTLAAAVESNTTHPVGKAIVKAARAHNCQIMKAEDGTFTEEPGSGAVAIVNN  674

Query  1529  KKVSVGTLDWVRRHGVGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHV  1356
             K+V+VGTL+WV+RHG         E ++  NQSVVY+GVD  LA +I  ED++REDA  V
Sbjct  675   KRVAVGTLEWVQRHGATGNLLNASEENESNNQSVVYIGVDNTLAAVIRFEDKIREDAAQV  734

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             VE+L++QGI  Y+LSGDKK+AA YVASVVGIP++ V  GVKP EK KF++ LQK++ +VA
Sbjct  735   VENLTRQGIDVYMLSGDKKSAANYVASVVGIPQDRVISGVKPAEKKKFINELQKNKNIVA  794

Query  1175  MVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             MVGDGINDAAALASS VGVA+GGG GAAS+VS VVLM NRL+QLLDALELSR TMKTVKQ
Sbjct  795   MVGDGINDAAALASSDVGVAMGGGAGAASEVSPVVLMGNRLTQLLDALELSRQTMKTVKQ  854

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             NLWWAFGYNIVG+PVAAG+LLP TGTMLTPS+AGALMG+SS+GVMTNSLLLR +F S ++
Sbjct  855   NLWWAFGYNIVGIPVAAGVLLPLTGTMLTPSMAGALMGVSSLGVMTNSLLLRYRFFSNRE  914

Query  815   E  813
             +
Sbjct  915   D  915



>ref|NP_001289905.1| copper-transporting ATPase PAA1, chloroplastic-like [Camelina 
sativa]
 gb|AID81886.1| heavy metal ATPase transporter 6 [Camelina sativa]
Length=951

 Score =  1054 bits (2725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/781 (72%), Positives = 665/781 (85%), Gaps = 13/781 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGC+ASVK+ILESQP+V+SASVNLTTETA+VWPV EAK VP+WQ+ LGE LA HL
Sbjct  157   GGMTCGGCSASVKKILESQPQVASASVNLTTETAIVWPVPEAKSVPDWQKSLGETLANHL  216

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CGF++  RD   EN F+ FE K   K+A+L+ SGR LAVSWALCAVCLVGHL+HF G 
Sbjct  217   TNCGFQSTPRDLVTENFFKVFETKTRDKQARLKESGRELAVSWALCAVCLVGHLTHFLGV  276

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
              A WIH +HSTGFH+S+CL TLL PGR+L++DG+KSLLKG+PNMNTLVGLGALSSF+VSS
Sbjct  277   NAPWIHAIHSTGFHVSLCLITLLGPGRKLVLDGVKSLLKGSPNMNTLVGLGALSSFSVSS  336

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA IPKLGWK FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+VLPSKARL+++ D
Sbjct  337   LAAMIPKLGWKMFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLPSKARLLLDGD  396

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               +Q STVEVPC++LSVGD +++LPGDR+PADG+V++GRS +DESSFTGEPLPVTK PG+
Sbjct  397   --QQNSTVEVPCNSLSVGDLVVILPGDRVPADGVVKSGRSAIDESSFTGEPLPVTKEPGS  454

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAGSINLNG LTVEV R GGETA+GDI+RLVEEAQSREAPVQ+L DKV+G FTYGVMA
Sbjct  455   QVAAGSINLNGTLTVEVHRSGGETAVGDIIRLVEEAQSREAPVQQLVDKVAGRFTYGVMA  514

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF FWNLFG  +LP+ L  GS  SLA+QLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  515   LSAATFTFWNLFGAHILPSALQNGSPMSLAIQLSCSVLVVACPCALGLATPTAMLVGTSL  574

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTST  1710
             GA RGLLLRGG +LE FS V+T+VFDKTGTLT G P VTEV +P+   +  N        
Sbjct  575   GARRGLLLRGGDILEKFSSVDTVVFDKTGTLTKGHPVVTEVIIPEDPRENLNDT------  628

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
               WSE +VL LA+ VESNT HP+GKAI++AA++RNC+ +KAE+GTF EEPGSGA+A++  
Sbjct  629   --WSEFEVLVLAAAVESNTTHPVGKAIIKAAQARNCQTMKAEEGTFTEEPGSGAVAIVNS  686

Query  1529  KKVSVGTLDWVRRHGVGETRVQ--EFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHV  1356
             K+V+VGTL+WV+RHG     +   E  +F NQSVVY+GVD  LA +I  ED++REDA  V
Sbjct  687   KRVTVGTLEWVQRHGATGNSLHALEEHEFNNQSVVYIGVDNTLAAVIRFEDKIREDAAQV  746

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             VE+L++QGI  Y+LSGDK+NAA YVASVVGI +E V  GVKP EK  F++ LQ+++K+VA
Sbjct  747   VENLTRQGIDVYMLSGDKRNAANYVASVVGINQERVIAGVKPAEKKNFINKLQRNKKIVA  806

Query  1175  MVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             MVGDGINDAAALASS VGVA+GGG GAAS+VS +VLM NRL+QLLDA+ELSR TMKTVKQ
Sbjct  807   MVGDGINDAAALASSDVGVAMGGGAGAASEVSPIVLMGNRLTQLLDAMELSRQTMKTVKQ  866

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             NLWWAFGYNIVG+P+AAG+LLP TGTMLTPS+AGALMG+SS+GVMTNSLLLR +F S +K
Sbjct  867   NLWWAFGYNIVGIPIAAGVLLPLTGTMLTPSMAGALMGVSSLGVMTNSLLLRYRFFSNRK  926

Query  815   E  813
             +
Sbjct  927   D  927



>gb|KEH31223.1| copper-transporting ATPase PAA1, putative [Medicago truncatula]
Length=943

 Score =  1051 bits (2719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/780 (73%), Positives = 663/780 (85%), Gaps = 3/780 (0%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGCAASVKRILESQP+VSSASVNLTTETA+VWPVSEAK   NWQ+QLG+ LA+HLT
Sbjct  143   GMVCGGCAASVKRILESQPQVSSASVNLTTETAIVWPVSEAKAAANWQKQLGKTLAEHLT  202

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             SCGF + +RDS REN  + FE+KM  +   L+ SGR LAVSWALCAVCLVGHLSH F AK
Sbjct  203   SCGFNSCLRDSTRENFIQIFERKMEERNKLLKESGRELAVSWALCAVCLVGHLSHLFAAK  262

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
             A WIH  HS GFH+S+CL TLL PGRQLI+DGLKSL K APNMN+LVGLGALSSF VSS 
Sbjct  263   APWIHAFHSVGFHLSLCLLTLLGPGRQLILDGLKSLFKRAPNMNSLVGLGALSSFTVSSF  322

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A  +PKLGWKAFFEEP+MLIAFVLLGRNLEQRAKIKATSDMTGLL++LPSKARL+VN+  
Sbjct  323   AVLLPKLGWKAFFEEPIMLIAFVLLGRNLEQRAKIKATSDMTGLLSILPSKARLLVNNGE  382

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
              +  S VEVP  +LSV DQII+ PGDRIPADGIVRAGRS+VDESSFTGEPLPVTK  G++
Sbjct  383   TDAASVVEVPSDSLSVEDQIIIFPGDRIPADGIVRAGRSSVDESSFTGEPLPVTKELGSE  442

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             VAAG+INLNG LT+EV+RPGGETAIGDI+RLVEEAQSREAP+QRLADK++G+FTYGVMA+
Sbjct  443   VAAGTINLNGTLTIEVRRPGGETAIGDIIRLVEEAQSREAPIQRLADKIAGYFTYGVMAI  502

Query  2063  SAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslg  1884
             S  TF FW++FG +++P  ++QGS  SLALQL+CSVLV+ACPCALGLATPTAV+VGTSLG
Sbjct  503   SVTTFTFWSVFGPQIIPTAVYQGSSVSLALQLACSVLVIACPCALGLATPTAVLVGTSLG  562

Query  1883  atrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCE  1704
             A RGLLLRGG++LE F+MVNT+VFDKTGTLTIG+P VT++V  G   E NA    T    
Sbjct  563   AKRGLLLRGGNILEKFAMVNTVVFDKTGTLTIGKPVVTKIV-TGTCIE-NANSSQTKINA  620

Query  1703  WSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKK  1524
              S+++VL LA+ VESN+ HP+GKAIV+AA++ NC   K  D TF+EEPGSG +A +  +K
Sbjct  621   LSDIEVLRLAAAVESNSVHPVGKAIVDAAQAVNCNDAKVADETFLEEPGSGVVATVNNRK  680

Query  1523  VSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESL  1344
             VSVGTL+W+ RHGV  +  QE  ++KNQS+VYVGVD  LAG IY ED++R+DARHVV++L
Sbjct  681   VSVGTLEWITRHGVNNSVHQEV-EYKNQSIVYVGVDDTLAGQIYFEDEIRKDARHVVDTL  739

Query  1343  SKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGD  1164
             SKQ I  Y+LSGDK+NAAEYVAS+VGIP+  V   VKP+EK+KF+  LQKD+KVVAMVGD
Sbjct  740   SKQDIDVYMLSGDKRNAAEYVASLVGIPKAKVLSEVKPEEKNKFIKELQKDKKVVAMVGD  799

Query  1163  GINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWW  984
             GINDAAALASSH+G+A+GGGVGAAS+VSS+VLM N LSQLLDALELSRLTM TVKQNLWW
Sbjct  800   GINDAAALASSHIGIALGGGVGAASEVSSIVLMHNHLSQLLDALELSRLTMNTVKQNLWW  859

Query  983   AFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQG  804
             AF YNIVG+P+AAG+L P  GTMLTPSIAGALMGLSSIGVMTNSLLLR KF+ KQK I G
Sbjct  860   AFVYNIVGIPIAAGVLFPINGTMLTPSIAGALMGLSSIGVMTNSLLLRFKFSLKQKHIHG  919



>ref|XP_006282942.1| hypothetical protein CARUB_v10007505mg [Capsella rubella]
 gb|EOA15840.1| hypothetical protein CARUB_v10007505mg [Capsella rubella]
Length=950

 Score =  1051 bits (2717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/781 (72%), Positives = 663/781 (85%), Gaps = 13/781 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGC+ASVK+ILESQP+V+SASVNLTTETA+VWPV EAK VP+WQ+ LGE LA HL
Sbjct  156   GGMTCGGCSASVKKILESQPQVASASVNLTTETAIVWPVPEAKSVPDWQKSLGETLANHL  215

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CGF++  RD   EN F+ FE K   K+A+L+ SGR L VSWALCAVCLVGHL+HF G 
Sbjct  216   TNCGFQSTPRDLVTENFFKVFETKTKDKQARLKESGRELVVSWALCAVCLVGHLTHFLGV  275

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
              A WIH +HSTGFH+S+CL TLL PGR+L++DG+KSLLKG+PNMNTLVGLGALSSF+VSS
Sbjct  276   NAPWIHAIHSTGFHVSLCLITLLGPGRKLVLDGVKSLLKGSPNMNTLVGLGALSSFSVSS  335

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA IPKLGWK FFEEPVMLIAFVLLGRNLEQRAKIKATSDMT LL+VLPSKARL+++ D
Sbjct  336   LAAMIPKLGWKTFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTSLLSVLPSKARLLLDGD  395

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               +Q STVEVPC++LSVGD +I+LPGDR+PADG+V++GRS +DESSFTGEPLPVTK PG+
Sbjct  396   --QQNSTVEVPCNSLSVGDLVIILPGDRVPADGVVKSGRSAIDESSFTGEPLPVTKEPGS  453

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAGSINLNG LTVEV R GGETA+GDI+RLVEEAQSREAPVQ L DKV+G FTYGVMA
Sbjct  454   QVAAGSINLNGTLTVEVHRSGGETAVGDIIRLVEEAQSREAPVQHLVDKVAGRFTYGVMA  513

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF FWNLFG  VLP+ L  GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  514   LSAATFTFWNLFGAHVLPSALQNGSPMSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  573

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTST  1710
             GA RGLLLRGG +LE FS V+T+VFDKTGTLT G P VTEV +P+   D  +   DS   
Sbjct  574   GARRGLLLRGGDILEKFSSVDTVVFDKTGTLTKGHPVVTEVIIPEDPRDNLS---DS---  627

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
               WSEV+VL LA+ VESNT HP+GKAI++AA++RNC  +KAEDGTF EEPGSGA A++  
Sbjct  628   --WSEVEVLMLAAAVESNTTHPVGKAIIKAARARNCPTMKAEDGTFTEEPGSGAFAIVNN  685

Query  1529  KKVSVGTLDWVRRHGVGETRVQ--EFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHV  1356
             K+V+VGTL+WV+RHG  +  +   E  +F NQSVVY+ VD  LA +I  ED++RE++  V
Sbjct  686   KRVTVGTLEWVQRHGAIKNSLHALEEHEFNNQSVVYIAVDNTLAAVIRFEDKIREESAQV  745

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             VE+L++QGI  Y+LSGDK+NAA YVASVVGI +E V  GVKP EK  F++ LQK++K+VA
Sbjct  746   VENLTRQGIDVYMLSGDKRNAANYVASVVGINQERVIAGVKPAEKKNFINELQKNKKIVA  805

Query  1175  MVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             MVGDGINDAAALASS VGVA+GGG GAAS+VS VVLM NRL+QLLDA+ELSR TMKTVKQ
Sbjct  806   MVGDGINDAAALASSDVGVAMGGGAGAASEVSPVVLMGNRLTQLLDAMELSRQTMKTVKQ  865

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             NLWWAFGYNIV +P+AAG+LLPFTGTMLTPS+AGALMG+SS+GVMTNSLLLR +F S +K
Sbjct  866   NLWWAFGYNIVRIPIAAGVLLPFTGTMLTPSMAGALMGVSSLGVMTNSLLLRYRFFSNRK  925

Query  815   E  813
             +
Sbjct  926   D  926



>ref|XP_009792009.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X2 [Nicotiana sylvestris]
Length=803

 Score =  1050 bits (2714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/661 (84%), Positives = 613/661 (93%), Gaps = 2/661 (0%)
 Frame = -2

Query  3224  KENPSVIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETA  3045
             KENPSV+A   ED S +SSDVIILDV GMTCGGCAASVKRILESQP+VSSA+VNLTTETA
Sbjct  128   KENPSVVAETSEDVSALSSDVIILDVTGMTCGGCAASVKRILESQPQVSSATVNLTTETA  187

Query  3044  VVWPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQA  2865
             +VWPVS+AKVVPNWQ+Q+GE LAKHLT+CGF +NVRDS REN FE FEKKMNAKR QL+ 
Sbjct  188   IVWPVSDAKVVPNWQKQIGEALAKHLTTCGFTSNVRDSGRENFFEIFEKKMNAKRIQLKE  247

Query  2864  SGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGL  2685
             SGRGLAVSWALCAVCLVGHLSHFFGAKASWIH +HSTGFHM++ LFTLLVPGRQLIIDGL
Sbjct  248   SGRGLAVSWALCAVCLVGHLSHFFGAKASWIHAMHSTGFHMTLSLFTLLVPGRQLIIDGL  307

Query  2684  KSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRA  2505
             KSL+KG+PNMNTLVGLGALSSFAVSSMAA IPKLGWK FFEEPVMLIAFVLLGRNLEQRA
Sbjct  308   KSLIKGSPNMNTLVGLGALSSFAVSSMAALIPKLGWKTFFEEPVMLIAFVLLGRNLEQRA  367

Query  2504  KIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGI  2325
             KIKATSDMTGLLNVLPSKARLVV+SD GE +STVEVP ++LSVGDQIIVLPGDR+PADGI
Sbjct  368   KIKATSDMTGLLNVLPSKARLVVSSDSGESSSTVEVPSNSLSVGDQIIVLPGDRVPADGI  427

Query  2324  VRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVE  2145
             VRAGRST+DESSFTGEPLPVTKLPGA+VAAGSINLNG LTVEV+RPGGETAIGDIVRLVE
Sbjct  428   VRAGRSTIDESSFTGEPLPVTKLPGAEVAAGSINLNGTLTVEVRRPGGETAIGDIVRLVE  487

Query  2144  EAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqls  1965
             EAQSREAPVQRLADKV+GHFTYGVM LSAATFMFWNLFG R+LP+TL+ GS+ SLALQLS
Sbjct  488   EAQSREAPVQRLADKVAGHFTYGVMTLSAATFMFWNLFGARILPSTLYHGSVVSLALQLS  547

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
             C+VLV+ACPCALGLATPTAVMVGTSLGAT+GLLLRGGSVLE FS VNT+VFDKTGTLTIG
Sbjct  548   CTVLVIACPCALGLATPTAVMVGTSLGATKGLLLRGGSVLERFSTVNTVVFDKTGTLTIG  607

Query  1784  RPTVTEVVP--QGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKS  1611
             RPTVT+VV   QG+ ++ +A++DSTS C+WSEVD+L  A+GVESNTNHPIGKAIVEAA++
Sbjct  608   RPTVTKVVSQGQGYQEDPDARQDSTSPCQWSEVDILKFAAGVESNTNHPIGKAIVEAART  667

Query  1610  RNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVV  1431
              N   +K  DGTF+EEPGSGA+  I+ K++SVGTL+WV+RHGV E  + EFDDFKNQSVV
Sbjct  668   ANSPKLKVLDGTFMEEPGSGAVGYIDNKRISVGTLEWVKRHGVLENPLLEFDDFKNQSVV  727

Query  1430  YVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPREN  1251
             YVGVDGVLAGLIYVEDQ+REDARHVVESLSKQGI+TYLLSGDKKNAAEYVASVVGIP+EN
Sbjct  728   YVGVDGVLAGLIYVEDQIREDARHVVESLSKQGISTYLLSGDKKNAAEYVASVVGIPKEN  787

Query  1250  V  1248
             +
Sbjct  788   I  788



>emb|CDX75363.1| BnaA01g03390D [Brassica napus]
Length=937

 Score =  1049 bits (2713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/781 (72%), Positives = 661/781 (85%), Gaps = 16/781 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGC+ASVK+ILESQP+V++ASVNLTTETA+VWPV EAK VP+WQ+ LGE LA HL
Sbjct  146   GGMTCGGCSASVKKILESQPQVATASVNLTTETAIVWPVPEAKSVPDWQKTLGETLANHL  205

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CGF++  RD   EN F+ FE K   K+A+L+ SGR LAVSWALCAVCLVGHL+HF G 
Sbjct  206   TNCGFESTPRDLVTENFFKVFESKTKDKQARLKQSGRELAVSWALCAVCLVGHLTHFLGV  265

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
             KA W+H +HSTGFH+S+CL TLL PGRQLI+DG KSLLKG+PNMNTLVGLGA+SSF+VSS
Sbjct  266   KAPWLHAVHSTGFHVSLCLLTLLGPGRQLILDGFKSLLKGSPNMNTLVGLGAMSSFSVSS  325

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA IPKLGWK FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+VLPSKARL+++ D
Sbjct  326   LAALIPKLGWKTFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLPSKARLLLDGD  385

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
                  STVEVPC++LSVGD +++LPGDR+PADGIV++GRS +DESSFTGEPLPVTK  G+
Sbjct  386   -----STVEVPCNSLSVGDLVVILPGDRVPADGIVKSGRSAIDESSFTGEPLPVTKEAGS  440

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAGSINLNG LTVEV R GGETA+GDIVR+VEEAQSREAPVQ+L DKV+G FTYGVMA
Sbjct  441   QVAAGSINLNGTLTVEVHRSGGETAVGDIVRMVEEAQSREAPVQQLVDKVAGRFTYGVMA  500

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             +SAATF FWNLFG  +LP+ LH GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  501   ISAATFTFWNLFGGHILPSALHNGSPISLALQLSCSVLVVACPCALGLATPTAMLVGTSL  560

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTST  1710
             GA RGLLLRGG +LE FS V+T+VFDKTGTLT G P VTEV +PQ      N        
Sbjct  561   GARRGLLLRGGDILEKFSSVDTVVFDKTGTLTKGHPVVTEVIIPQDSRHNLNDT------  614

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
                SEVDVL LA+ VESNT HP+GKAIV+AA++ NC+ +KAEDGTF EEPGSGA+A++  
Sbjct  615   --LSEVDVLMLAAAVESNTTHPVGKAIVKAARAHNCQTMKAEDGTFTEEPGSGAVAIVNN  672

Query  1529  KKVSVGTLDWVRRHGVGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHV  1356
             K+V+VGTL+WV+RHG         E ++  NQSVVY+GVD  LA +I  ED++REDA  V
Sbjct  673   KRVAVGTLEWVQRHGATGNLLNASEENESNNQSVVYIGVDNTLAAVIRFEDKIREDAAQV  732

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             VE+L++QGI  Y+LSGDKK+AA YVASVVGIP++ V  GVKP EK KF++ LQK++ +VA
Sbjct  733   VENLTRQGIDVYMLSGDKKSAANYVASVVGIPQDRVISGVKPAEKKKFINELQKNKNIVA  792

Query  1175  MVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             MVGDGINDAAALASS VGVA+GGG GAAS+VS VVLM NRL+QLLDA+ELSR TMKTVKQ
Sbjct  793   MVGDGINDAAALASSDVGVAMGGGAGAASEVSPVVLMGNRLTQLLDAMELSRQTMKTVKQ  852

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             NLWWAFGYNIVG+PVAAG+LLP TGTMLTPS+AGALMG+SS+GVMTNSLLLR +F S ++
Sbjct  853   NLWWAFGYNIVGIPVAAGVLLPLTGTMLTPSMAGALMGVSSLGVMTNSLLLRYRFFSNRE  912

Query  815   E  813
             +
Sbjct  913   D  913



>dbj|BAA23769.1| metal-transporting P-type ATPase [Arabidopsis thaliana]
Length=949

 Score =  1049 bits (2713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/781 (72%), Positives = 668/781 (86%), Gaps = 13/781 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGC+ASVK+ILESQP+V+SASVNLTTETA+VWPV EAK VP+WQ+ LGE LA HL
Sbjct  155   GGMTCGGCSASVKKILESQPQVASASVNLTTETAIVWPVPEAKSVPDWQKSLGETLANHL  214

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             ++CGF++  RD   EN F+ FE +   K+A+L+ SGR LAVSWA CAVCLVGHL+HF G 
Sbjct  215   SNCGFQSTPRDLVTENFFKVFETQPKDKQARLKESGRELAVSWAPCAVCLVGHLTHFLGV  274

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
              A WIH +HSTGFH+S+CL TLL PGR+L++DG+KSLLKG+PNMNTLVGLGALSSF+VSS
Sbjct  275   NAPWIHAIHSTGFHVSLCLITLLGPGRKLVLDGIKSLLKGSPNMNTLVGLGALSSFSVSS  334

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA IPKLGWK FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+VL SKARL+++ D
Sbjct  335   LAAMIPKLGWKTFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLASKARLLLDGD  394

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
             +  Q STVEVPC++LSVGD +++LPGDR+PADG+V++GRST+DESSFTGEPLPVTK  G+
Sbjct  395   L--QNSTVEVPCNSLSVGDLVVILPGDRVPADGVVKSGRSTIDESSFTGEPLPVTKESGS  452

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAGSINLNG LTVEV R GGETA+GDI+RLVEEAQSREAPVQ+L DKV+G FTYGVMA
Sbjct  453   QVAAGSINLNGTLTVEVHRSGGETAVGDIIRLVEEAQSREAPVQQLVDKVAGRFTYGVMA  512

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF FWNLFG  VLP+ LH GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  513   LSAATFTFWNLFGAHVLPSALHNGSPMSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  572

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTST  1710
             GA RGLLLRGG +LE FS+V+T+VFDKTGTLT G P VTEV +P+      N + +   T
Sbjct  573   GARRGLLLRGGDILEKFSLVDTVVFDKTGTLTKGHPVVTEVIIPE------NPRHNLNDT  626

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
               WSEV+VL LA+ VESNT HP+GKAIV+AA++RNC+ +KAEDGTF EEPGSGA+A++  
Sbjct  627   --WSEVEVLMLAAAVESNTTHPVGKAIVKAARARNCQTMKAEDGTFTEEPGSGAVAIVNN  684

Query  1529  KKVSVGTLDWVRRHG-VGETRVQ-EFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHV  1356
             K+V+VGTL+WV+RHG  G + +  E  +  NQSVVY+GVD  LA +I  ED++REDA  V
Sbjct  685   KRVTVGTLEWVKRHGATGNSLLALEEHEINNQSVVYIGVDNTLAAVIRFEDKVREDAAQV  744

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             VE+L++QGI  Y+LSGDK+NAA YVASVVGI  E V  GVKP EK  F++ LQK++K+VA
Sbjct  745   VENLTRQGIDVYMLSGDKRNAANYVASVVGINHERVIAGVKPAEKKNFINELQKNKKIVA  804

Query  1175  MVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             MVGDGINDAAALASS+VGVA+GGG GAAS+VS VVLM NRL+QLLDA+ELSR TMKTVKQ
Sbjct  805   MVGDGINDAAALASSNVGVAMGGGAGAASEVSPVVLMGNRLTQLLDAMELSRQTMKTVKQ  864

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             NLWWAFGYNIVG+P+AAG+LLP TGTMLTPS+AGALMG++S+GVMTNSLLLR +F S + 
Sbjct  865   NLWWAFGYNIVGIPIAAGVLLPLTGTMLTPSMAGALMGVTSLGVMTNSLLLRYRFFSNRN  924

Query  815   E  813
             +
Sbjct  925   D  925



>gb|KHN39225.1| Putative copper-transporting ATPase PAA1 [Glycine soja]
Length=933

 Score =  1044 bits (2699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/822 (70%), Positives = 666/822 (81%), Gaps = 44/822 (5%)
 Frame = -2

Query  3125  CAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLTSCGFKA  2946
             CAA+VKRILE+QP+VSSASVNLTTETA+VWPVSEAK  PNWQ+QLGE LA+HLTSCG+ +
Sbjct  103   CAATVKRILENQPQVSSASVNLTTETAIVWPVSEAKNAPNWQKQLGEALAEHLTSCGYNS  162

Query  2945  NVRD----------------------------------------SRRENLFETFEKKMNA  2886
             ++RD                                        S R+N  + FE+KM  
Sbjct  163   SLRDVPCNIGHITPLAVHFAVKKLATEGVISPYKCKKWLSGVNDSTRDNFLQIFERKMEE  222

Query  2885  KRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGR  2706
             +  QL+ SGR LAVSWALCAVCLVGH SHFF AKA WIH+ HS GFH+S+ LFTLL PGR
Sbjct  223   RHRQLRESGRELAVSWALCAVCLVGHFSHFFAAKAPWIHVFHSIGFHLSLSLFTLLGPGR  282

Query  2705  QLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLG  2526
             QLI+DGLKSLLK  PNMNTLVGLGALSSF VSS AA +PKLGWKAFFEEP+MLIAFVLLG
Sbjct  283   QLILDGLKSLLKRTPNMNTLVGLGALSSFTVSSFAALLPKLGWKAFFEEPIMLIAFVLLG  342

Query  2525  RNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGD  2346
             RNLEQRAKIKA SDMTGLL++LP KARL++N+   E  S VEVP  +LSVGDQIIVLPGD
Sbjct  343   RNLEQRAKIKAASDMTGLLSLLPPKARLLLNNGETEVGSVVEVPSDSLSVGDQIIVLPGD  402

Query  2345  RIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIG  2166
             RIPADG+VR+GRSTVDESSFTGEPLPVTK+PG++VAAGSINLNG LT+EVQRPG ETA+ 
Sbjct  403   RIPADGVVRSGRSTVDESSFTGEPLPVTKVPGSEVAAGSINLNGTLTMEVQRPGSETAMA  462

Query  2165  DIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGsla  1986
             +IVRLVEEAQSREAPVQRLADKV+GHFTYGVMA SAATF FW+L+GT +LP  L+QG   
Sbjct  463   NIVRLVEEAQSREAPVQRLADKVAGHFTYGVMATSAATFTFWSLYGTHILPPALYQGRAV  522

Query  1985  slalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDK  1806
             SLALQL+CSVLVVACPCALGLATPTAV+VGTSLGA RGLLLRGG++LE F+MV+T+VFDK
Sbjct  523   SLALQLACSVLVVACPCALGLATPTAVLVGTSLGAKRGLLLRGGNILEKFAMVDTVVFDK  582

Query  1805  TGTLTIGRPTVTE-VVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAI  1629
             TGTLT+GRP VT  V+P       NA    T     S+V+VL LA+ VE+N+ HP+GKAI
Sbjct  583   TGTLTVGRPVVTNIVIPICIK---NAISSQTEENALSDVEVLRLAAAVETNSVHPVGKAI  639

Query  1628  VEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDF  1449
             V+AA++ NC   K +DGTF+EEPGSGA+A I +KKVSVGTL+W+ RHGV  +  QE +  
Sbjct  640   VDAAQAANCHNAKVKDGTFLEEPGSGAVATIYDKKVSVGTLEWITRHGVINSIHQEVEKS  699

Query  1448  KNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVV  1269
              NQS VYVGVD  LAGLIY ED++REDAR VV+ LSKQ I  Y+LSGDK+NAAE+VAS+V
Sbjct  700   NNQSFVYVGVDDTLAGLIYFEDEIREDARDVVDRLSKQNIGVYMLSGDKRNAAEHVASLV  759

Query  1268  GIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaas  1089
             GIP+E V   VKPDEK KF++ LQKD  +VAMVGDGINDAAALASSHVG+A+GGGVGAAS
Sbjct  760   GIPKEKVLSEVKPDEKKKFINELQKDNNIVAMVGDGINDAAALASSHVGIALGGGVGAAS  819

Query  1088  dvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLT  909
             +VSS+VLM+N+LSQ++DALELSRLTM T+KQNLWWAF YNIVG+P+AAG+L P  GT+LT
Sbjct  820   EVSSIVLMRNQLSQIVDALELSRLTMNTIKQNLWWAFIYNIVGIPIAAGVLFPINGTVLT  879

Query  908   PSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQGPSVTIQI  783
             PSIAGALMGLSSIGVMTNSLLLR KF+SKQK+I   S   +I
Sbjct  880   PSIAGALMGLSSIGVMTNSLLLRFKFSSKQKQIHSISPKTKI  921



>ref|XP_010526996.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=990

 Score =  1043 bits (2696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/849 (69%), Positives = 682/849 (80%), Gaps = 48/849 (6%)
 Frame = -2

Query  3203  AAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSE  3024
             A AG+     SSDVIILDVGGMTCGGCAASVK+ILESQP+VS+ASVNLTTETA+VWPV E
Sbjct  149   AGAGDGVPSPSSDVIILDVGGMTCGGCAASVKKILESQPQVSTASVNLTTETAIVWPVLE  208

Query  3023  AKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAV  2844
             AK VPNW+++LGE LAKHL++CGF++  R     N F  FE KM  K  +L+ SGR LAV
Sbjct  209   AKSVPNWKEELGEMLAKHLSNCGFESTPRGLTNVNFFRVFESKMKEKHTRLKESGRELAV  268

Query  2843  SWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGA  2664
             SWALCAVC+VGHL+HF G K  WIH  HSTGFH+S+ L TLL PGRQLIIDG+KSLLKGA
Sbjct  269   SWALCAVCVVGHLTHFLGVKVPWIHAFHSTGFHVSLSLLTLLGPGRQLIIDGIKSLLKGA  328

Query  2663  PNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSD  2484
             PNMNTLVGLGALSSF VSS+AA IPKLGWK FFEEPVMLIAF+LLGRNLEQRAKIKATSD
Sbjct  329   PNMNTLVGLGALSSFTVSSLAAMIPKLGWKTFFEEPVMLIAFILLGRNLEQRAKIKATSD  388

Query  2483  MTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             MTGLL+VLPSKARL+++ D    +STVEVPC++LSVGD +++LPGDR+PADGIVR+GRST
Sbjct  389   MTGLLSVLPSKARLLLDGDPQNPSSTVEVPCNSLSVGDLVVILPGDRVPADGIVRSGRST  448

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             +DESS TGEPLPVTK  G+QVAAG INLNG LTVEV+R GGETA+GDIVRLVEEAQSREA
Sbjct  449   IDESSLTGEPLPVTKESGSQVAAGCINLNGTLTVEVRRSGGETAVGDIVRLVEEAQSREA  508

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvva  1944
             PVQRL DKV+G FTYGVMALSAATFMFWNLFG+ +LP+TLH GS ASLALQLSCSVLVVA
Sbjct  509   PVQRLVDKVAGRFTYGVMALSAATFMFWNLFGSYILPSTLHNGSPASLALQLSCSVLVVA  568

Query  1943  CPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV  1764
             CPCALGLATPTA++VG SLGA RGLLLRGG +LE F+ V+T+VFDKTGTLT G P VT+V
Sbjct  569   CPCALGLATPTAMLVGISLGARRGLLLRGGDILEKFASVDTVVFDKTGTLTRGHPVVTKV  628

Query  1763  VPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAE  1584
             V   ++               SEV+VL LA+ VESNT+HP+GKAI+EAA++ NC+I+K E
Sbjct  629   VIPEYSRYNLGD-------TLSEVEVLKLAASVESNTSHPVGKAIIEAARNHNCQIIKVE  681

Query  1583  DGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQ--EFDDFKNQSVVYVGVDGV  1410
             DGTF EEPGSGA+A++  K+V+VGTLDW++RHGV E  +   E  +FK+QS VY+GVD  
Sbjct  682   DGTFSEEPGSGAVAIVNNKRVTVGTLDWLQRHGVAENPLHAIEGHEFKSQSTVYIGVDNT  741

Query  1409  LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKP  1230
             LA LI  ED++REDA+ VVE+LS+QGI  Y+LSGDK+N A YVASVVGIP+E V  GVKP
Sbjct  742   LAALICFEDKVREDAQQVVENLSRQGIDVYMLSGDKRNNANYVASVVGIPQERVIAGVKP  801

Query  1229  DEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLS  1050
              EK +F++ LQK +K VAMVGDGINDAAALASS VGVA+GGGVGAAS+VS +VLM NRLS
Sbjct  802   GEKKRFINELQKTRKGVAMVGDGINDAAALASSDVGVAMGGGVGAASEVSPIVLMSNRLS  861

Query  1049  QLLDALELSRLTMKTVKQNLWWAFGYNI--------------------------------  966
             QLL+ALELSR TMKTVKQNLWWAFGYNI                                
Sbjct  862   QLLEALELSRQTMKTVKQNLWWAFGYNIDLVGTLSVELGGGRDVSLRVGEWERHTQASDG  921

Query  965   --VGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFAS-----KQKEIQ  807
               VG+P+AAG+LLP TGTMLTPSIAGALMGLSS+GVM+NSLLLRL+F+S     + K + 
Sbjct  922   GKVGIPIAAGVLLPLTGTMLTPSIAGALMGLSSVGVMSNSLLLRLRFSSDNNLNRTKHLD  981

Query  806   GPSVTIQIP  780
             G + +   P
Sbjct  982   GRARSKDTP  990



>emb|CDX68986.1| BnaC01g04670D [Brassica napus]
Length=936

 Score =  1039 bits (2686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/781 (72%), Positives = 657/781 (84%), Gaps = 16/781 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGC+ASVK+ILESQP+V++ASVNLTTETA+VWPV EAK VP+WQ+ LGE LA HL
Sbjct  145   GGMTCGGCSASVKKILESQPQVATASVNLTTETAIVWPVPEAKSVPDWQKTLGEALANHL  204

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+ GF +  RD   EN F+ FE K   K+A+L+ SGR LAVSWALCAVCLVGH++HF G 
Sbjct  205   TNFGFDSTPRDLVTENFFKVFESKTKDKQARLKQSGRELAVSWALCAVCLVGHVTHFLGV  264

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
             KA W+H +HSTGFH+S+CL TLL PGRQLI+DG KSLL G+PNMNTLVGLGA+SSF+VSS
Sbjct  265   KAPWLHAVHSTGFHVSLCLLTLLGPGRQLILDGFKSLLNGSPNMNTLVGLGAMSSFSVSS  324

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA IPKLGWK FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+VLPSKARL+++ D
Sbjct  325   LAALIPKLGWKTFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLPSKARLLLDGD  384

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
                  STVEVPC++LSVGD +I+LPGDR+PADGIV++GRS +DESSFTGEPLPVTK  G+
Sbjct  385   -----STVEVPCNSLSVGDLVIILPGDRVPADGIVKSGRSAIDESSFTGEPLPVTKEAGS  439

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAGSINLNG LTVEV R GGETA+GDIVR+VEEAQSREAPVQ+L DKV+G FTYGVMA
Sbjct  440   QVAAGSINLNGTLTVEVHRSGGETAVGDIVRMVEEAQSREAPVQQLVDKVAGRFTYGVMA  499

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             +SAATF FWNLFG  +LP+ LH GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  500   ISAATFTFWNLFGGHILPSALHNGSPISLALQLSCSVLVVACPCALGLATPTAMLVGTSL  559

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTST  1710
             GA RGLLLRGG +LE FS V+T+VFDKTGTLT G P VT V +PQ      N        
Sbjct  560   GARRGLLLRGGDILEKFSSVDTVVFDKTGTLTKGHPVVTGVIIPQDSRHNLNDT------  613

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
                SEVDVL LA+ VESNT HP+GKAIV+AA++ NC+ +KAEDGTF EEPGSGA+A++  
Sbjct  614   --LSEVDVLMLAAAVESNTTHPVGKAIVKAARAHNCQTMKAEDGTFTEEPGSGAVAIVNN  671

Query  1529  KKVSVGTLDWVRRHGVGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHV  1356
             K+V+VGTL+WV+RHG         E ++  NQSVVY+GVD  LA +I  ED++REDA  V
Sbjct  672   KRVAVGTLEWVQRHGATGNLLNASEENESNNQSVVYIGVDNTLAAVIRFEDKIREDAAQV  731

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             VE+L++QGI  Y+LSGDKK+AA YVASVVGIP++ V  GVKP EK KF++ LQK++ +VA
Sbjct  732   VENLTRQGIDVYMLSGDKKSAANYVASVVGIPQDRVISGVKPAEKKKFINDLQKNKNIVA  791

Query  1175  MVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             MVGDGINDAAALASS VGVA+GGG GAAS+VS VVLM NRL+QLLDALELSR TMKTVKQ
Sbjct  792   MVGDGINDAAALASSDVGVAMGGGAGAASEVSPVVLMGNRLTQLLDALELSRQTMKTVKQ  851

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             NLWWAFGYNIVG+P+AAG+LLP TGTMLTPS+AGALMG+SS+GVMTNSLLLR +F S ++
Sbjct  852   NLWWAFGYNIVGIPIAAGVLLPLTGTMLTPSMAGALMGVSSLGVMTNSLLLRYRFFSNRE  911

Query  815   E  813
             +
Sbjct  912   D  912



>ref|XP_006412347.1| hypothetical protein EUTSA_v10024339mg [Eutrema salsugineum]
 gb|ESQ53800.1| hypothetical protein EUTSA_v10024339mg [Eutrema salsugineum]
Length=932

 Score =  1031 bits (2666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/767 (72%), Positives = 651/767 (85%), Gaps = 13/767 (2%)
 Frame = -2

Query  3104  ILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRR  2925
             IL+  P+V+SASVNLTTETA+VWPV EAK VP+WQ+ LGE LA HLT+CGF++  RD   
Sbjct  152   ILDVGPQVASASVNLTTETAIVWPVPEAKSVPDWQKTLGETLANHLTNCGFQSTPRDLVT  211

Query  2924  ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFH  2745
             EN F+ FE K   K+A+L+ SGR LAVSWALCAVCLVGHL+HF G  A W+H +HSTGFH
Sbjct  212   ENFFKVFETKTKDKQARLRESGRELAVSWALCAVCLVGHLTHFLGVNAPWLHAIHSTGFH  271

Query  2744  MSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFF  2565
             +S+CL TLL PGR+L++DG+KSLLKG+PNMNTLVGLGALSSF+VSS+AA IPKLGWK FF
Sbjct  272   VSLCLITLLGPGRKLVLDGVKSLLKGSPNMNTLVGLGALSSFSVSSLAALIPKLGWKTFF  331

Query  2564  EEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSN  2385
             EEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+VLPSKARL+++ D+  Q STVEVPC++
Sbjct  332   EEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLPSKARLLLHGDL--QNSTVEVPCNS  389

Query  2384  LSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLT  2205
             LSVGD +++LPGDR+PADGIV++GRST+DESSFTGEPLPVTK PG+QVAAGSINLNG LT
Sbjct  390   LSVGDLVVILPGDRVPADGIVKSGRSTIDESSFTGEPLPVTKEPGSQVAAGSINLNGTLT  449

Query  2204  VEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGT  2025
             VEV R GGETA+GDI+RLVEEAQSREAPVQ+L DKV+G FTYGVMALSAATF FWNLFGT
Sbjct  450   VEVHRSGGETAVGDIIRLVEEAQSREAPVQQLVDKVAGRFTYGVMALSAATFTFWNLFGT  509

Query  2024  RVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVL  1845
              +LP  LH GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSLGA RGLLLRGG +L
Sbjct  510   HILPPALHNGSPMSLALQLSCSVLVVACPCALGLATPTAMLVGTSLGARRGLLLRGGDIL  569

Query  1844  ESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTSTCEWSEVDVLTLASG  1668
             E FS V+T+VFDKTGTLT G P VTEV +P+      N          WSEV+VL LA+ 
Sbjct  570   EKFSSVDTVVFDKTGTLTKGHPVVTEVIIPEDPRHNLNGT--------WSEVEVLMLAAA  621

Query  1667  VESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRH  1488
             VESNT HP+GKAI++A ++RNC+ +KAEDGTF EEPGSGA+A++  K+V+VGTL+WV+RH
Sbjct  622   VESNTTHPVGKAIIKAVRARNCQTMKAEDGTFTEEPGSGAVAIVNNKRVTVGTLEWVQRH  681

Query  1487  GVGETRVQEFD--DFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLL  1314
             G     +  F+  ++ NQSVVY+GVD  LA +I  ED++REDA  VVE+L++QGI  Y+L
Sbjct  682   GATGNSLHPFEEHEYNNQSVVYIGVDNTLAAVIRFEDKIREDAAQVVENLTRQGIDVYML  741

Query  1313  SGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALas  1134
             SGDK+NAA YVASVVGI +E V  GVKP EK  F+S LQK++K+VAMVGDGINDAAALAS
Sbjct  742   SGDKRNAANYVASVVGIDQERVIAGVKPAEKKNFISELQKNKKIVAMVGDGINDAAALAS  801

Query  1133  shvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLP  954
             S VGVA+GGG GAAS+VS +VLM NRL+QLLDALELSR TMKTVKQNLWWAFGYNIVG+P
Sbjct  802   SDVGVAMGGGAGAASEVSPIVLMGNRLTQLLDALELSRQTMKTVKQNLWWAFGYNIVGIP  861

Query  953   VAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             +AAG+LLP TGTMLTPS+AGALMG+SS+GVMTNSLLLR +F S +K+
Sbjct  862   IAAGVLLPMTGTMLTPSMAGALMGVSSLGVMTNSLLLRYRFFSNRKD  908



>ref|XP_006849809.1| hypothetical protein AMTR_s00176p00057350 [Amborella trichopoda]
 gb|ERN11390.1| hypothetical protein AMTR_s00176p00057350 [Amborella trichopoda]
Length=933

 Score =  1025 bits (2650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/778 (71%), Positives = 661/778 (85%), Gaps = 10/778 (1%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM+CGGCAASVKRILESQP+VSSASVNL TE AVVW + E +V  NWQQ LGE LA HL
Sbjct  131   GGMSCGGCAASVKRILESQPQVSSASVNLATEIAVVWAIPEVQVTQNWQQHLGEILASHL  190

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             TSCGFK+N+R    ++  + FE++   + ++L+ SGR L VSWALCA CL+GH SH FGA
Sbjct  191   TSCGFKSNLRTGPGQSYNKIFEQRRLERLSRLERSGRELVVSWALCAACLLGHTSHMFGA  250

Query  2786  KA-SWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
              A SWIH  HSTGFHMS+ L TLL PGRQ+I+DG++SL KGAPNMNTLVGLGA+SSFAVS
Sbjct  251   NAASWIHAFHSTGFHMSLSLVTLLGPGRQIILDGIRSLWKGAPNMNTLVGLGAMSSFAVS  310

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
             S+A FIPKLGW+AFFEEP+ML+AFVLLGRNLEQRAK+KA +DMTGLL+++P KARL+V+S
Sbjct  311   SIATFIPKLGWRAFFEEPIMLLAFVLLGRNLEQRAKLKAVNDMTGLLSIIPKKARLMVDS  370

Query  2429  DMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPG  2250
             ++      VEVPC +L++GD+++VLPGDR+P DGIV AGRSTVDESSFTGEPLP+TKLPG
Sbjct  371   NV------VEVPCDSLTIGDKVVVLPGDRVPIDGIVTAGRSTVDESSFTGEPLPITKLPG  424

Query  2249  AQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVM  2070
              +V AGSIN+NG LTVEV+RPGGET +GDIVRLVE+AQ+REAPVQRLADKV+G FTYGVM
Sbjct  425   TEVTAGSININGTLTVEVKRPGGETVMGDIVRLVEDAQNREAPVQRLADKVAGRFTYGVM  484

Query  2069  ALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgts  1890
             ALS ATF+FWNLFG++++PA + QGS  SLALQLSCSVLVVACPC+LGLATPTAV+VGTS
Sbjct  485   ALSTATFLFWNLFGSKLVPAIVQQGSPISLALQLSCSVLVVACPCSLGLATPTAVLVGTS  544

Query  1889  lgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTST  1710
             LGATRGLL+RGG VLE F++VNTIVFDKTGTLT GRP VT+VV     +  +  ++ TS 
Sbjct  545   LGATRGLLIRGGDVLEKFALVNTIVFDKTGTLTAGRPVVTKVVTL-EQEHLHFSQNRTS-  602

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
             C WSE +VL LA+ VESNTNHPIGKAI+EAA++  C+ VKA DGTF EEPGSGA+A +E 
Sbjct  603   CTWSEHEVLRLAAAVESNTNHPIGKAIIEAAQAAGCQYVKATDGTFYEEPGSGAVATVEY  662

Query  1529  KKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVE  1350
             K+V+VGT  W++R GV +  +   ++  NQSVV VGVDG LAGL+YVED++REDA  +VE
Sbjct  663   KRVAVGTTSWLQRQGVDKGSLPNLEE-NNQSVVCVGVDGTLAGLVYVEDKIREDANQMVE  721

Query  1349  SLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMV  1170
             SLSK+GI  Y+LSGD+K  AEYVA++VGI +ENV  GVKPDEK KF+  LQK+++VVAMV
Sbjct  722   SLSKKGIDVYMLSGDRKQTAEYVATMVGIQKENVLAGVKPDEKKKFIGELQKEKRVVAMV  781

Query  1169  GDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNL  990
             GDG+NDAAALAS+ VG+A+GGGVG AS+VS+VVLM N+LSQLLDALELSRLTMKT++QNL
Sbjct  782   GDGVNDAAALASADVGIAMGGGVGVASEVSTVVLMGNKLSQLLDALELSRLTMKTIEQNL  841

Query  989   WWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             WWAF YNIVG+P+AAG+LLP TGTMLTPSIAGALMGLSS+GVM+NSLLL+LKF    K
Sbjct  842   WWAFTYNIVGIPIAAGLLLPVTGTMLTPSIAGALMGLSSLGVMSNSLLLKLKFGLNYK  899



>ref|XP_008677499.1| PREDICTED: uncharacterized protein LOC100381708 isoform X1 [Zea 
mays]
 gb|AFW65110.1| hypothetical protein ZEAMMB73_571389 [Zea mays]
Length=928

 Score =  1016 bits (2627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/778 (71%), Positives = 657/778 (84%), Gaps = 4/778 (1%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM+CGGCAASVKRILES+P+V SA+VNL TE AVVW V E  VV +W++QLGE+LA  L
Sbjct  135   GGMSCGGCAASVKRILESEPQVRSATVNLATEMAVVWAVPEDSVVQDWKEQLGEKLANQL  194

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CG+K+N+RDS +      FE+KM  K  QL+ SGR LAVSWALCAVCLVGH+SH FG 
Sbjct  195   TTCGYKSNLRDSSKVGSQTVFERKMQDKLEQLKQSGRELAVSWALCAVCLVGHISHLFGV  254

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
                 +H++HSTGFH+S+ +FT + PGR+LI+DGLKSLLKG+PNMNTLVGLGALSSFAVSS
Sbjct  255   NMPLMHVIHSTGFHLSLSIFTFVGPGRRLILDGLKSLLKGSPNMNTLVGLGALSSFAVSS  314

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AAFIPKLGWK FFEEPVMLIAFVLLG+NLEQRAK+KATSDMTGLL++LPSKARL+V++D
Sbjct  315   IAAFIPKLGWKTFFEEPVMLIAFVLLGKNLEQRAKLKATSDMTGLLSILPSKARLMVDND  374

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               E++S +EVPC  L+VGD ++VLPGD IPADGIV+AGRSTVDESS TGEP+PVTK+ GA
Sbjct  375   -AEKSSLIEVPCDTLAVGDYVVVLPGDHIPADGIVKAGRSTVDESSLTGEPMPVTKITGA  433

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             +V+AGSINLNG LTVEV+RPGGET + DI+ LVEEAQ+R APVQRLADKV+G+FTYGVMA
Sbjct  434   EVSAGSINLNGKLTVEVRRPGGETVMSDILHLVEEAQTRAAPVQRLADKVAGNFTYGVMA  493

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAAT+MFW++ G++++PA +  G   SLALQLSCSVLV+ACPCALGLATPTAV+VGTSL
Sbjct  494   LSAATYMFWSILGSQLVPAAIQHGGAMSLALQLSCSVLVIACPCALGLATPTAVLVGTSL  553

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTC  1707
             GATRGLLLRGG VLE FS V+ +VFDKTGTLTIGRP +T+V+P     + N K       
Sbjct  554   GATRGLLLRGGDVLEKFSDVDAVVFDKTGTLTIGRPVITKVIPSRGMGDANTK--DLGAN  611

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEK  1527
             +W+E D+L+ A+GVESNTNHP+GKAI+EAA + NC I+KA DG+F+EEPGSGA+A I EK
Sbjct  612   QWAEADILSFAAGVESNTNHPLGKAIMEAAGAANCVIMKANDGSFMEEPGSGAVATIGEK  671

Query  1526  KVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVES  1347
             +VSVGTLDW+RRHGV      E + F  QSV YV V+G LAGLI  ED+LR D+R V+E+
Sbjct  672   QVSVGTLDWIRRHGVIHNPFPEAEHF-GQSVAYVAVNGALAGLICFEDKLRGDSRQVIET  730

Query  1346  LSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVG  1167
             LSKQGI+ Y+LSGDK++AA  VASVVGI  + V   VKP EK KF+S LQK+ KVVAMVG
Sbjct  731   LSKQGISVYMLSGDKESAAMNVASVVGIQADKVLAEVKPHEKKKFISELQKEHKVVAMVG  790

Query  1166  DGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLW  987
             DGINDAAALAS+ VG+A+GGGVGAASDVSSVVLM NRLSQL+DALELS+ TMKTVKQNLW
Sbjct  791   DGINDAAALASADVGIAMGGGVGAASDVSSVVLMGNRLSQLIDALELSKETMKTVKQNLW  850

Query  986   WAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             WAF YNIVGLP+AAG LLP TGT+LTPSIAGALMG SS+GVM NSLLLR++ +S++K 
Sbjct  851   WAFLYNIVGLPIAAGALLPATGTILTPSIAGALMGFSSVGVMANSLLLRVRLSSRRKR  908



>dbj|BAD09318.1| putative potential copper-transporting ATPase [Oryza sativa Japonica 
Group]
Length=959

 Score =  1010 bits (2612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/804 (69%), Positives = 676/804 (84%), Gaps = 5/804 (1%)
 Frame = -2

Query  3200  AAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEA  3021
             A  E+AS   +DVIILDVGGM+CGGCAASVKRILES+P+V SA+VNL TE AVVW V E 
Sbjct  141   AVAEEASGQEADVIILDVGGMSCGGCAASVKRILESEPQVRSANVNLATEMAVVWAVPED  200

Query  3020  KVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVS  2841
             +   NW+ QLGE+LA  LT+CG+K+N+RDS + +    FE+KM+ K  QL+ SGR LAVS
Sbjct  201   EDAKNWKLQLGEKLANQLTTCGYKSNLRDSSKASSQTVFERKMDEKLQQLKQSGRELAVS  260

Query  2840  WALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAP  2661
             WALCAVCL+GH+SH FG  A  +HLLHSTGFH+S+ +FT + PGR+LI+DGL SL KG+P
Sbjct  261   WALCAVCLLGHISHLFGVNAPLMHLLHSTGFHLSLSIFTFIGPGRRLILDGLNSLFKGSP  320

Query  2660  NMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDM  2481
             NMNTLVGLGALSSFAVSS+AAF+PKLGWK FFEEPVML+AFVLLG+NLEQRAK+KATSDM
Sbjct  321   NMNTLVGLGALSSFAVSSIAAFVPKLGWKTFFEEPVMLVAFVLLGKNLEQRAKLKATSDM  380

Query  2480  TGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             TGLLN+LPSKARL+V++D  EQ+S  EVPC  LSVGD I+VLPGDR+PADG+V++GRSTV
Sbjct  381   TGLLNILPSKARLMVDND-PEQSSFTEVPCDTLSVGDYIVVLPGDRVPADGVVKSGRSTV  439

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DESS TGEP+PVTK+ G +V+AGSINLNG +TVEV+RPGGETA+ DI+RLVEEAQ+REAP
Sbjct  440   DESSLTGEPMPVTKIAGTEVSAGSINLNGKITVEVRRPGGETAMSDILRLVEEAQTREAP  499

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaC  1941
             VQRLADKV+G+FTYGVMALSAAT+ FW++FG++++PA +  GS  +LALQLSCSVLV+AC
Sbjct  500   VQRLADKVAGNFTYGVMALSAATYTFWSIFGSQLVPAAIQHGSAMALALQLSCSVLVIAC  559

Query  1940  PCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVV  1761
             PCALGLATPTAV+VGTSLGATRGLLLRGG +LE FS V+ IVFDKTGTLTIG+P VT+V+
Sbjct  560   PCALGLATPTAVLVGTSLGATRGLLLRGGDILEKFSEVDAIVFDKTGTLTIGKPVVTKVI  619

Query  1760  PQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAED  1581
                   + N K DS +  EW+  ++L+LA+GVESNT HP+GKAI+EAA++ NC  ++A+D
Sbjct  620   ASHREGDENTK-DSCNN-EWTG-EILSLAAGVESNTTHPLGKAIMEAAQAANCLYLQAKD  676

Query  1580  GTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAG  1401
             G+F+EEPGSGA+A I EK+VSVGTLDW+RRHGV      + ++F  QSV YV VDG LAG
Sbjct  677   GSFMEEPGSGAVATIGEKQVSVGTLDWIRRHGVLHNPFADGENF-GQSVAYVAVDGTLAG  735

Query  1400  LIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEK  1221
             LI  ED+LRED+  +++ LSKQGI+ Y+LSGDKK+AA  VAS+VGI  + V   VKP EK
Sbjct  736   LICFEDKLREDSHQIIDILSKQGISVYMLSGDKKSAAMNVASLVGIQADKVIAEVKPHEK  795

Query  1220  SKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLL  1041
               F+S LQK+ K+VAMVGDGINDAAALAS+ VG+A+GGGVGAASDVSSVVLM NRLSQL+
Sbjct  796   KSFISELQKEHKLVAMVGDGINDAAALASADVGIAMGGGVGAASDVSSVVLMGNRLSQLV  855

Query  1040  DALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVM  861
             DALELS+ TM+TVKQNLWWAF YNIVGLP+AAG LLP TGT+LTPSIAGALMG SS+GVM
Sbjct  856   DALELSKETMRTVKQNLWWAFLYNIVGLPIAAGALLPVTGTVLTPSIAGALMGFSSVGVM  915

Query  860   TNSLLLRLKFASKQKEIQGPSVTI  789
              NSL LR++ +S+Q+ I  P  TI
Sbjct  916   ANSLFLRMRLSSRQQPIHKPQATI  939



>gb|EAZ43138.1| hypothetical protein OsJ_27728 [Oryza sativa Japonica Group]
Length=840

 Score =  1010 bits (2612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/804 (69%), Positives = 676/804 (84%), Gaps = 5/804 (1%)
 Frame = -2

Query  3200  AAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEA  3021
             A  E+AS   +DVIILDVGGM+CGGCAASVKRILES+P+V SA+VNL TE AVVW V E 
Sbjct  22    AVAEEASGQEADVIILDVGGMSCGGCAASVKRILESEPQVRSANVNLATEMAVVWAVPED  81

Query  3020  KVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVS  2841
             +   NW+ QLGE+LA  LT+CG+K+N+RDS + +    FE+KM+ K  QL+ SGR LAVS
Sbjct  82    EDAKNWKLQLGEKLANQLTTCGYKSNLRDSSKASSQTVFERKMDEKLQQLKQSGRELAVS  141

Query  2840  WALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAP  2661
             WALCAVCL+GH+SH FG  A  +HLLHSTGFH+S+ +FT + PGR+LI+DGL SL KG+P
Sbjct  142   WALCAVCLLGHISHLFGVNAPLMHLLHSTGFHLSLSIFTFIGPGRRLILDGLNSLFKGSP  201

Query  2660  NMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDM  2481
             NMNTLVGLGALSSFAVSS+AAF+PKLGWK FFEEPVML+AFVLLG+NLEQRAK+KATSDM
Sbjct  202   NMNTLVGLGALSSFAVSSIAAFVPKLGWKTFFEEPVMLVAFVLLGKNLEQRAKLKATSDM  261

Query  2480  TGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             TGLLN+LPSKARL+V++D  EQ+S  EVPC  LSVGD I+VLPGDR+PADG+V++GRSTV
Sbjct  262   TGLLNILPSKARLMVDND-PEQSSFTEVPCDTLSVGDYIVVLPGDRVPADGVVKSGRSTV  320

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DESS TGEP+PVTK+ G +V+AGSINLNG +TVEV+RPGGETA+ DI+RLVEEAQ+REAP
Sbjct  321   DESSLTGEPMPVTKIAGTEVSAGSINLNGKITVEVRRPGGETAMSDILRLVEEAQTREAP  380

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaC  1941
             VQRLADKV+G+FTYGVMALSAAT+ FW++FG++++PA +  GS  +LALQLSCSVLV+AC
Sbjct  381   VQRLADKVAGNFTYGVMALSAATYTFWSIFGSQLVPAAIQHGSAMALALQLSCSVLVIAC  440

Query  1940  PCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVV  1761
             PCALGLATPTAV+VGTSLGATRGLLLRGG +LE FS V+ IVFDKTGTLTIG+P VT+V+
Sbjct  441   PCALGLATPTAVLVGTSLGATRGLLLRGGDILEKFSEVDAIVFDKTGTLTIGKPVVTKVI  500

Query  1760  PQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAED  1581
                   + N K DS +  EW+  ++L+LA+GVESNT HP+GKAI+EAA++ NC  ++A+D
Sbjct  501   ASHREGDENTK-DSCNN-EWTG-EILSLAAGVESNTTHPLGKAIMEAAQAANCLYLQAKD  557

Query  1580  GTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAG  1401
             G+F+EEPGSGA+A I EK+VSVGTLDW+RRHGV      + ++F  QSV YV VDG LAG
Sbjct  558   GSFMEEPGSGAVATIGEKQVSVGTLDWIRRHGVLHNPFADGENF-GQSVAYVAVDGTLAG  616

Query  1400  LIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEK  1221
             LI  ED+LRED+  +++ LSKQGI+ Y+LSGDKK+AA  VAS+VGI  + V   VKP EK
Sbjct  617   LICFEDKLREDSHQIIDILSKQGISVYMLSGDKKSAAMNVASLVGIQADKVIAEVKPHEK  676

Query  1220  SKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLL  1041
               F+S LQK+ K+VAMVGDGINDAAALAS+ VG+A+GGGVGAASDVSSVVLM NRLSQL+
Sbjct  677   KSFISELQKEHKLVAMVGDGINDAAALASADVGIAMGGGVGAASDVSSVVLMGNRLSQLV  736

Query  1040  DALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVM  861
             DALELS+ TM+TVKQNLWWAF YNIVGLP+AAG LLP TGT+LTPSIAGALMG SS+GVM
Sbjct  737   DALELSKETMRTVKQNLWWAFLYNIVGLPIAAGALLPVTGTVLTPSIAGALMGFSSVGVM  796

Query  860   TNSLLLRLKFASKQKEIQGPSVTI  789
              NSL LR++ +S+Q+ I  P  TI
Sbjct  797   ANSLFLRMRLSSRQQPIHKPQATI  820



>ref|XP_006660232.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
[Oryza brachyantha]
Length=871

 Score =  1008 bits (2605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/798 (70%), Positives = 675/798 (85%), Gaps = 4/798 (1%)
 Frame = -2

Query  3200  AAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEA  3021
             A  E+AS   +DVIILDVGGM+CGGCAASVKRILES+P+V SA+VNL TE AVVW V E 
Sbjct  45    AVAEEASGQEADVIILDVGGMSCGGCAASVKRILESEPQVRSATVNLATEMAVVWAVPED  104

Query  3020  KVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVS  2841
             K V NW+ QLGE+LA  LT+ G+K+N+RDS + +    FE+KM+ K  QL+ SG+ LAVS
Sbjct  105   KDVKNWKLQLGEKLADQLTTRGYKSNLRDSSKVSSQVVFERKMDEKLQQLKQSGQELAVS  164

Query  2840  WALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAP  2661
             WALCAVCL+GH+SH FG     +HLLHSTGFH+S+ +FT + PGR+LI+DG+ SLLKG+P
Sbjct  165   WALCAVCLLGHISHLFGVNVPLMHLLHSTGFHLSLSIFTFIGPGRRLILDGVNSLLKGSP  224

Query  2660  NMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDM  2481
             NMNTLVGLGALSSFAVSS+AAFIPKLGWK FFEEPVMLIAFVLLG+NLEQRAK+KATSDM
Sbjct  225   NMNTLVGLGALSSFAVSSIAAFIPKLGWKTFFEEPVMLIAFVLLGKNLEQRAKLKATSDM  284

Query  2480  TGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             TGLLN+LPSKARL+V++D  EQ+S  EVPC  L+VGD I+VLPGDR+PADG+V++GRSTV
Sbjct  285   TGLLNILPSKARLMVDND-AEQSSFTEVPCDTLAVGDYIVVLPGDRVPADGVVKSGRSTV  343

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DESS TGEP+PVTK+ G +V+AGSINLNG LTVEV+RPGGETA+ DI+RLVEEAQ+REAP
Sbjct  344   DESSLTGEPMPVTKIAGTEVSAGSINLNGKLTVEVRRPGGETAMSDILRLVEEAQAREAP  403

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaC  1941
             VQRLADKV+G+FTYGVMALSAAT+ FW++FG++++PA L  GS  SLALQLSCSVLV+AC
Sbjct  404   VQRLADKVAGNFTYGVMALSAATYTFWSIFGSQLVPAALQHGSAMSLALQLSCSVLVIAC  463

Query  1940  PCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVV  1761
             PCALGLATPTAV+VGTSLGAT+GLLLRGG +LE FS V+ IVFDKTGTLTIG+P VT+V+
Sbjct  464   PCALGLATPTAVLVGTSLGATKGLLLRGGDILEKFSEVDAIVFDKTGTLTIGKPVVTKVI  523

Query  1760  PQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAED  1581
                H +     +DS +   W+E ++L+LA+GVESNT HP+GKAI+EAA+  NC  ++AED
Sbjct  524   AS-HREGDEDTKDSWNNG-WTEGEILSLAAGVESNTTHPLGKAIMEAAQVANCLHLQAED  581

Query  1580  GTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAG  1401
             G+F+EEPGSGA+A I+ K+VSVGTLDW+RRHG       + ++F  QSV YV VDG LAG
Sbjct  582   GSFMEEPGSGAVATIDGKQVSVGTLDWIRRHGALHNPYADAENF-GQSVAYVAVDGTLAG  640

Query  1400  LIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEK  1221
             LI  ED+LRED+R ++++LSKQGI+ Y+LSGD+K+AA  VAS+VGI  + V   VKP EK
Sbjct  641   LICFEDKLREDSRQIIDTLSKQGISVYMLSGDRKSAAMNVASLVGIQTDKVIAEVKPQEK  700

Query  1220  SKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLL  1041
              +F+S LQK+ K+VAMVGDGINDAAALAS+ VG+A+GGGVGAASDVSSVVLM NRLSQL 
Sbjct  701   KRFISELQKEHKLVAMVGDGINDAAALASADVGIAMGGGVGAASDVSSVVLMGNRLSQLA  760

Query  1040  DALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVM  861
             DALELS+LTM+TVKQNLWWAF YNIVGLP+AAG LLP TGT+LTPSIAGALMG SS+GVM
Sbjct  761   DALELSKLTMRTVKQNLWWAFLYNIVGLPIAAGALLPVTGTVLTPSIAGALMGFSSVGVM  820

Query  860   TNSLLLRLKFASKQKEIQ  807
              NSLLLR++ +S+Q+ I 
Sbjct  821   ANSLLLRMRLSSRQQPIH  838



>ref|XP_002445980.1| hypothetical protein SORBIDRAFT_07g029010 [Sorghum bicolor]
 gb|EES15475.1| hypothetical protein SORBIDRAFT_07g029010 [Sorghum bicolor]
Length=817

 Score =  1006 bits (2600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/777 (70%), Positives = 654/777 (84%), Gaps = 4/777 (1%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM+CGGCAASVKRILES+P+V SA+VNL TE AVVW V +   V +W++QLGE+LA  LT
Sbjct  30    GMSCGGCAASVKRILESEPQVRSATVNLATEMAVVWAVPKDSEVQDWKEQLGEKLANQLT  89

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             +CG+K+N+RDS + +    FE+KM  K  QL+ SGR LAVSWALC VCL+GH+SH  G  
Sbjct  90    TCGYKSNLRDSSKVSSQTVFERKMQDKLEQLKQSGRELAVSWALCTVCLLGHISHLLGVN  149

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                +HL+HSTGFH+S+ +FT + PGR+LI+DGLKSL KG+PNMNTLVGLGALSSFAVSS+
Sbjct  150   VPLMHLIHSTGFHLSLSIFTFVGPGRRLILDGLKSLFKGSPNMNTLVGLGALSSFAVSSI  209

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             AAFIPKLGWK FFEEPVMLIAFVLLG+NLEQRAK+KATSDMTGLL++LPSKARL+V++D 
Sbjct  210   AAFIPKLGWKTFFEEPVMLIAFVLLGKNLEQRAKLKATSDMTGLLSILPSKARLMVDND-  268

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
              E++S +EVPC  L+VGD ++VLPGDRIPADGIV+AGRSTVDESS TGEP+PVTK+ GA+
Sbjct  269   AEKSSLIEVPCDTLAVGDYVVVLPGDRIPADGIVKAGRSTVDESSLTGEPMPVTKIAGAE  328

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V+AGSINLNG LTVEV+RPGGET + DI+ LVEEAQ+R APVQRLADKV+G+FTYGVMAL
Sbjct  329   VSAGSINLNGKLTVEVRRPGGETVMSDILHLVEEAQTRAAPVQRLADKVAGNFTYGVMAL  388

Query  2063  SAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslg  1884
             SAAT+MFW+L G++++PA +  G   SLALQLSCSVLV+ACPCALGLATPTAV+VGTSLG
Sbjct  389   SAATYMFWSLLGSQLVPAAIQHGGAMSLALQLSCSVLVIACPCALGLATPTAVLVGTSLG  448

Query  1883  atrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCE  1704
             ATRGLLLRGG VLE FS V+ IVFDKTGTLTIGRP VT+V+      + N K       +
Sbjct  449   ATRGLLLRGGDVLEKFSDVDAIVFDKTGTLTIGRPVVTKVIASRGMGDANTK--DLGANQ  506

Query  1703  WSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKK  1524
             W+E ++L+ A+GVESNTNHP+GKAI++AA S NC ++KA DG+F+EEPGSGA+A + EK+
Sbjct  507   WTEAEILSFAAGVESNTNHPLGKAIMDAAGSANCIVMKANDGSFMEEPGSGAVATVGEKQ  566

Query  1523  VSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESL  1344
             VSVGTLDW+RRHGV      E + F  QSV YV V+G LAGLI  ED+LRED+R V+++L
Sbjct  567   VSVGTLDWIRRHGVIHNPFPEAEHF-GQSVAYVAVNGALAGLICFEDKLREDSRQVIDTL  625

Query  1343  SKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGD  1164
             SKQGI  Y+LSGDK++AA  VASVVGI  + V   VKP EK KF+S LQK+ ++VAMVGD
Sbjct  626   SKQGINVYMLSGDKESAAMNVASVVGIQADKVLAEVKPHEKKKFISELQKEHRLVAMVGD  685

Query  1163  GINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWW  984
             GINDAAALAS+ VG+A+GGGVGAASDVSSVVL+ NRLSQL+DALELS+ TMKTVKQNLWW
Sbjct  686   GINDAAALASADVGIAMGGGVGAASDVSSVVLLGNRLSQLVDALELSKETMKTVKQNLWW  745

Query  983   AFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             AF YNIVGLP+AAG LLP TGT+LTPSIAGALMG SS+GVM NSLLLR++ +S+QK+
Sbjct  746   AFLYNIVGLPIAAGALLPVTGTILTPSIAGALMGFSSVGVMANSLLLRVRLSSRQKQ  802



>ref|XP_008455637.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X2 [Cucumis melo]
Length=901

 Score =  1005 bits (2598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/778 (70%), Positives = 645/778 (83%), Gaps = 29/778 (4%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGCAASVKRILE+QP+VSSASVNLTTETAV+WPV E K  P+  +QLGE LA HL
Sbjct  143   GGMTCGGCAASVKRILENQPQVSSASVNLTTETAVIWPVPEVKDSPHRVKQLGETLASHL  202

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T CGF +++R+S R+N+F  FE+KM  KR +L+ SGR L  SWALCAVCL+GH+SHFFGA
Sbjct  203   TRCGFASSLRESGRDNIFMVFERKMEEKRNRLRESGRNLVFSWALCAVCLLGHISHFFGA  262

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
             KASWIH  H+T FH+S+CLFTLL PGRQLIIDG+KSL+KGAPNMNTLVGLGALSSF+VSS
Sbjct  263   KASWIHTCHTTQFHLSLCLFTLLGPGRQLIIDGMKSLVKGAPNMNTLVGLGALSSFSVSS  322

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA +PKLGWKAFFEEPVMLIAFVLLGRNLEQRAKI+A SDMTGLL++LPSKARLVV+  
Sbjct  323   LAALMPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIRAASDMTGLLSILPSKARLVVDGG  382

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               E +STVE+PCS+LSVGD++IVLPGDRIPADGIV++GRS VDESSFTGEPLPVTKLPG+
Sbjct  383   T-ELSSTVEIPCSSLSVGDEVIVLPGDRIPADGIVKSGRSIVDESSFTGEPLPVTKLPGS  441

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAG+INLNG LTVEV R GG++A+GDI+RLVEEAQSREAPVQRLADKVSGHFTYGVM 
Sbjct  442   QVAAGTINLNGTLTVEVHRHGGDSAMGDIIRLVEEAQSREAPVQRLADKVSGHFTYGVMG  501

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF+FW+ FG+R+LP   H GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  502   LSAATFIFWSQFGSRILPTAFHHGSSVSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  561

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTC  1707
             GAT+GLLLRGG++LE FSM +T+VFDKTGTLT+G+P VT+V       E N    + S  
Sbjct  562   GATKGLLLRGGNILEQFSMADTVVFDKTGTLTVGKPVVTKVFATSRY-ERNVDSQTNSHG  620

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEK  1527
              +SE ++L  A+ VESNT HP+GKAIVEAA++ N   +K  +GTF+EEPGSGA+A ++ +
Sbjct  621   NYSENEILKFAAAVESNTVHPVGKAIVEAARAVNGHSLKVVEGTFVEEPGSGAVATVQNR  680

Query  1526  KVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVES  1347
              VS+GTLDWV+R GV     QE DD K QSVVYVG+D +LAG IY ED +REDARHVV++
Sbjct  681   IVSIGTLDWVQRQGVTVEDFQETDDLKAQSVVYVGIDNILAGCIYYEDGIREDARHVVDT  740

Query  1346  LSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVG  1167
             LS+QGI TY+LSGDK++ AEY+AS+VGIP+E V  GVKP EK KF+S LQ++  +VAMVG
Sbjct  741   LSRQGINTYMLSGDKRSNAEYIASLVGIPKEKVRSGVKPQEKKKFISELQENNNIVAMVG  800

Query  1166  DGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLW  987
             DGINDAAALA++ +G+A+GGGVGAAS+VS +VLM NRLSQ                    
Sbjct  801   DGINDAAALATADIGIAMGGGVGAASEVSPIVLMGNRLSQ--------------------  840

Query  986   WAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
                    VG+PVAAG+LLP TGT+LTPSIAGALMGLSS+GVM NSLLLR++F+  +K+
Sbjct  841   -------VGIPVAAGVLLPITGTILTPSIAGALMGLSSVGVMANSLLLRIRFSQNRKK  891



>ref|XP_004973751.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
isoform X1 [Setaria italica]
Length=963

 Score =  1004 bits (2597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/777 (70%), Positives = 655/777 (84%), Gaps = 4/777 (1%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM+CGGCAASVKRILE++P+V SA+VNL TE AVVW V E + V +W++QLGE+LA  L
Sbjct  155   GGMSCGGCAASVKRILENEPQVRSATVNLATEMAVVWAVPEDRDVQDWKEQLGEKLASQL  214

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CG+K+N+RD+ + +    FE+KM+ K  QL+ SGR L VSWALCAVCL+GH+SH FG 
Sbjct  215   TTCGYKSNLRDASKISSQAVFERKMHEKLEQLKQSGRELVVSWALCAVCLLGHISHLFGV  274

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
                 +H +HSTGFH+S+ +FT + PGR+LI+DG+KSL KG+PNMNTLVGLGALSSFAVSS
Sbjct  275   NVPLMHFIHSTGFHLSLSIFTFVGPGRRLILDGIKSLFKGSPNMNTLVGLGALSSFAVSS  334

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AAFIPKLGWK FFEEPVMLIAFVLLG+NLEQRAK+KATSDMTGLLN+LPSKARL+V++D
Sbjct  335   IAAFIPKLGWKTFFEEPVMLIAFVLLGKNLEQRAKLKATSDMTGLLNILPSKARLMVDND  394

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               E++S VEVPC  L+VGD ++VLPGDRIPADG+V+AGRSTVDESS TGEP+PVTK+ G 
Sbjct  395   -AEKSSLVEVPCDTLAVGDYVVVLPGDRIPADGVVKAGRSTVDESSLTGEPMPVTKIAGT  453

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             +V+AGSINLNG LTVEV+RPGGET + DI+ LVEEAQ+R APVQRLADKV+G+FTYGVMA
Sbjct  454   EVSAGSINLNGKLTVEVRRPGGETVMSDIIHLVEEAQTRAAPVQRLADKVAGNFTYGVMA  513

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAAT+MFW++FG++++PA +  GS  SLALQLSCSVLV+ACPCALGLATPTAV+VGTSL
Sbjct  514   LSAATYMFWSIFGSQLVPAAIQHGSAMSLALQLSCSVLVIACPCALGLATPTAVLVGTSL  573

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTC  1707
             GATRGLLLRGG VLE FS V+ +VFDKTGTLTIGRP VT+V+      + N K    +  
Sbjct  574   GATRGLLLRGGDVLEKFSDVDAVVFDKTGTLTIGRPVVTKVITSRGRGDANTKDFGDN--  631

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEK  1527
             +W+E ++L+ A+GVESNTNHP+GKAI+EAA + NC  +KA DG+F+EEPGSGA+A I EK
Sbjct  632   QWTEAEILSFAAGVESNTNHPLGKAIMEAAGAANCISMKANDGSFMEEPGSGAVATIGEK  691

Query  1526  KVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVES  1347
             +VSVGTLDW+RRHGV      E + F  QSV YV VDG LAGLI  ED+LRED+R V+ +
Sbjct  692   QVSVGTLDWIRRHGVVRNPFPEAEHF-GQSVAYVAVDGALAGLICFEDKLREDSRQVIST  750

Query  1346  LSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVG  1167
             LS+QGI+ Y+LSGDK++AA  VAS+VGI  + V   VKP EK KF+S LQK  ++VAMVG
Sbjct  751   LSEQGISVYMLSGDKESAAMNVASIVGIQADKVLAEVKPHEKKKFISELQKAHRLVAMVG  810

Query  1166  DGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLW  987
             DGIND AALAS+ VG+A+GGGVGAASDVSSVVLM NRLSQL+DALELS+ TMKTVKQNLW
Sbjct  811   DGINDTAALASADVGIAMGGGVGAASDVSSVVLMGNRLSQLVDALELSKETMKTVKQNLW  870

Query  986   WAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             WAF YNIVGLP+AAG LLP TGT+LTPSIAGALMG SS+GVM NSLLLR++ +S+QK
Sbjct  871   WAFLYNIVGLPIAAGALLPVTGTILTPSIAGALMGFSSVGVMANSLLLRVRLSSRQK  927



>ref|XP_004973752.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
isoform X2 [Setaria italica]
Length=807

 Score =  1002 bits (2591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/775 (70%), Positives = 653/775 (84%), Gaps = 4/775 (1%)
 Frame = -2

Query  3140  MTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLTS  2961
             M+CGGCAASVKRILE++P+V SA+VNL TE AVVW V E + V +W++QLGE+LA  LT+
Sbjct  1     MSCGGCAASVKRILENEPQVRSATVNLATEMAVVWAVPEDRDVQDWKEQLGEKLASQLTT  60

Query  2960  CGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAKA  2781
             CG+K+N+RD+ + +    FE+KM+ K  QL+ SGR L VSWALCAVCL+GH+SH FG   
Sbjct  61    CGYKSNLRDASKISSQAVFERKMHEKLEQLKQSGRELVVSWALCAVCLLGHISHLFGVNV  120

Query  2780  SWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMA  2601
               +H +HSTGFH+S+ +FT + PGR+LI+DG+KSL KG+PNMNTLVGLGALSSFAVSS+A
Sbjct  121   PLMHFIHSTGFHLSLSIFTFVGPGRRLILDGIKSLFKGSPNMNTLVGLGALSSFAVSSIA  180

Query  2600  AFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMG  2421
             AFIPKLGWK FFEEPVMLIAFVLLG+NLEQRAK+KATSDMTGLLN+LPSKARL+V++D  
Sbjct  181   AFIPKLGWKTFFEEPVMLIAFVLLGKNLEQRAKLKATSDMTGLLNILPSKARLMVDND-A  239

Query  2420  EQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQV  2241
             E++S VEVPC  L+VGD ++VLPGDRIPADG+V+AGRSTVDESS TGEP+PVTK+ G +V
Sbjct  240   EKSSLVEVPCDTLAVGDYVVVLPGDRIPADGVVKAGRSTVDESSLTGEPMPVTKIAGTEV  299

Query  2240  AAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALS  2061
             +AGSINLNG LTVEV+RPGGET + DI+ LVEEAQ+R APVQRLADKV+G+FTYGVMALS
Sbjct  300   SAGSINLNGKLTVEVRRPGGETVMSDIIHLVEEAQTRAAPVQRLADKVAGNFTYGVMALS  359

Query  2060  AATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslga  1881
             AAT+MFW++FG++++PA +  GS  SLALQLSCSVLV+ACPCALGLATPTAV+VGTSLGA
Sbjct  360   AATYMFWSIFGSQLVPAAIQHGSAMSLALQLSCSVLVIACPCALGLATPTAVLVGTSLGA  419

Query  1880  trglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEW  1701
             TRGLLLRGG VLE FS V+ +VFDKTGTLTIGRP VT+V+      + N K    +  +W
Sbjct  420   TRGLLLRGGDVLEKFSDVDAVVFDKTGTLTIGRPVVTKVITSRGRGDANTKDFGDN--QW  477

Query  1700  SEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKV  1521
             +E ++L+ A+GVESNTNHP+GKAI+EAA + NC  +KA DG+F+EEPGSGA+A I EK+V
Sbjct  478   TEAEILSFAAGVESNTNHPLGKAIMEAAGAANCISMKANDGSFMEEPGSGAVATIGEKQV  537

Query  1520  SVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLS  1341
             SVGTLDW+RRHGV      E + F  QSV YV VDG LAGLI  ED+LRED+R V+ +LS
Sbjct  538   SVGTLDWIRRHGVVRNPFPEAEHF-GQSVAYVAVDGALAGLICFEDKLREDSRQVISTLS  596

Query  1340  KQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDG  1161
             +QGI+ Y+LSGDK++AA  VAS+VGI  + V   VKP EK KF+S LQK  ++VAMVGDG
Sbjct  597   EQGISVYMLSGDKESAAMNVASIVGIQADKVLAEVKPHEKKKFISELQKAHRLVAMVGDG  656

Query  1160  INDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWA  981
             IND AALAS+ VG+A+GGGVGAASDVSSVVLM NRLSQL+DALELS+ TMKTVKQNLWWA
Sbjct  657   INDTAALASADVGIAMGGGVGAASDVSSVVLMGNRLSQLVDALELSKETMKTVKQNLWWA  716

Query  980   FGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             F YNIVGLP+AAG LLP TGT+LTPSIAGALMG SS+GVM NSLLLR++ +S+QK
Sbjct  717   FLYNIVGLPIAAGALLPVTGTILTPSIAGALMGFSSVGVMANSLLLRVRLSSRQK  771



>ref|XP_003574670.2| PREDICTED: copper-transporting ATPase PAA1, chloroplastic [Brachypodium 
distachyon]
Length=804

 Score =  1001 bits (2588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/778 (70%), Positives = 655/778 (84%), Gaps = 4/778 (1%)
 Frame = -2

Query  3140  MTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLTS  2961
             M+CGGCAASVKRILES+P+V SA+VNL TE AVVW V E + V +W+ QLGE+LA  LT+
Sbjct  1     MSCGGCAASVKRILESEPQVQSATVNLATEMAVVWAVPEDRAVQDWKLQLGEKLASQLTT  60

Query  2960  CGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAKA  2781
             CG+K+N RDS + +  + FE+KM+ K   L+ SGR LAVSWALCAVCL+GH+SH FG  A
Sbjct  61    CGYKSNHRDSSKVSSQKVFERKMDEKLQHLKQSGRDLAVSWALCAVCLLGHVSHLFGVNA  120

Query  2780  SWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMA  2601
              ++HL HSTGFH+S+ +FT + PGR+LI+DGLKSLLKG+PNMNTLVGLGALSSFAVSS+A
Sbjct  121   PFMHLFHSTGFHLSLSIFTFIGPGRRLILDGLKSLLKGSPNMNTLVGLGALSSFAVSSVA  180

Query  2600  AFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMG  2421
             AFIPKLGWK FFEEP+MLIAFVLLG+NLEQRAK+KA SDMTGLLN+LPSKARL+V+SD  
Sbjct  181   AFIPKLGWKTFFEEPIMLIAFVLLGKNLEQRAKLKAASDMTGLLNILPSKARLMVDSD-A  239

Query  2420  EQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQV  2241
             EQ+S  EVPC  L+VGD I+VLPGDRIPADG V+AGRSTVDESS TGEP+PVTK+ GA+V
Sbjct  240   EQSSFTEVPCGTLAVGDYIVVLPGDRIPADGAVKAGRSTVDESSLTGEPMPVTKIAGAEV  299

Query  2240  AAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALS  2061
             +AGSINLNG LTVEV+RPGGET + DI+ LVEEAQ+REAPVQRLADKV+G+FTYGVMALS
Sbjct  300   SAGSINLNGKLTVEVRRPGGETVMSDILNLVEEAQTREAPVQRLADKVAGNFTYGVMALS  359

Query  2060  AATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslga  1881
             AAT+MFW+LFG++++PA +  GS  SLALQLSCSVLV+ACPCALGLATPTAV+VGTSLGA
Sbjct  360   AATYMFWSLFGSQLVPAVIQHGSAMSLALQLSCSVLVIACPCALGLATPTAVLVGTSLGA  419

Query  1880  trglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEW  1701
             TRGLLLRGG VLE FS V  +VFDKTGTLTIG+P VT+V+      + N K       EW
Sbjct  420   TRGLLLRGGDVLEKFSEVGAVVFDKTGTLTIGKPVVTKVIASHTEGDVNTK--GCWNNEW  477

Query  1700  SEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKV  1521
             +E DVL+ A+GVESNTNHP+GKAI+EAA++ NC  +KA+DG+F+EEPGSGA+A I EK+V
Sbjct  478   TEGDVLSFAAGVESNTNHPLGKAIMEAAQAANCLNMKAKDGSFMEEPGSGAVATIGEKQV  537

Query  1520  SVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLS  1341
             SVGTLDW+RRHGV      E ++F  QSV YV VDG LAGLI  ED++RED+  V+++L+
Sbjct  538   SVGTLDWIRRHGVARDPFPEAENF-GQSVAYVAVDGTLAGLICFEDKIREDSHEVIDALT  596

Query  1340  KQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDG  1161
             KQGI  Y+LSGDK++AA  VAS+VGI  + V   VKP EK KF+S LQK+ K+VAMVGDG
Sbjct  597   KQGICVYMLSGDKESAAMNVASIVGIQADKVISEVKPHEKKKFISELQKEHKLVAMVGDG  656

Query  1160  INDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWA  981
             INDAAALA + VG+A+GGGVGAASDVSSVVLM NRLSQL+DALELS+ TM+TVKQNLWWA
Sbjct  657   INDAAALALADVGIAMGGGVGAASDVSSVVLMGNRLSQLVDALELSKETMRTVKQNLWWA  716

Query  980   FGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQ  807
             F YNIVGLP+AAG LLP TGT+LTPSIAGALMG SS+GVM NSLLLR + +S+Q+ I 
Sbjct  717   FLYNIVGLPIAAGALLPATGTILTPSIAGALMGFSSVGVMANSLLLRARMSSRQQSIH  774



>ref|XP_007042964.1| P-type ATP-ase 1 isoform 2 [Theobroma cacao]
 gb|EOX98795.1| P-type ATP-ase 1 isoform 2 [Theobroma cacao]
Length=846

 Score =   996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/714 (75%), Positives = 623/714 (87%), Gaps = 9/714 (1%)
 Frame = -2

Query  3104  ILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRR  2925
             IL+  P+VSSASVNLTTETA+VWPVSEA  VPNWQ++LGE LA+HLTSCGFK+N+RDS  
Sbjct  135   ILDVGPQVSSASVNLTTETAIVWPVSEAMDVPNWQKELGEALARHLTSCGFKSNLRDSGP  194

Query  2924  ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFH  2745
             +N F+ FE+KM  KR +L+ SGR LAVSWALCAVCL+GHL+H  GAKASW+H  HSTGFH
Sbjct  195   DNFFKVFERKMEEKRNRLKESGRELAVSWALCAVCLIGHLAHILGAKASWMHAFHSTGFH  254

Query  2744  MSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFF  2565
             +++ +FTLL PGRQLI++G+K+LLKGAPNMNTLVGLGALSSFAVSS+A  IPK GWKAFF
Sbjct  255   LTLSMFTLLGPGRQLILEGVKNLLKGAPNMNTLVGLGALSSFAVSSLAVLIPKWGWKAFF  314

Query  2564  EEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSN  2385
             EEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+++PSKARL+V+       S +EVPC++
Sbjct  315   EEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSIVPSKARLMVDD------SIIEVPCNS  368

Query  2384  LSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLT  2205
             LSVGDQI+VLPGDR+PADGIVRAGRST+DESSFTGEP+PVTK PG+QVAAGSINLNG LT
Sbjct  369   LSVGDQIVVLPGDRVPADGIVRAGRSTIDESSFTGEPMPVTKEPGSQVAAGSINLNGTLT  428

Query  2204  VEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGT  2025
             VEV+RPGGETA+GDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFG 
Sbjct  429   VEVRRPGGETAMGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGA  488

Query  2024  RVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVL  1845
             R+LPA   QG+  SLALQLSCSVLVVACPCALGLATPTA++VGTSLGATRGLLLRGG++L
Sbjct  489   RILPAAFSQGTAVSLALQLSCSVLVVACPCALGLATPTAMLVGTSLGATRGLLLRGGNIL  548

Query  1844  ESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGV  1665
             E FSMVN IVFDKTGTLTIGRP VT+VV  G  D ++++++  +    SE +VL LA+ V
Sbjct  549   EKFSMVNAIVFDKTGTLTIGRPVVTKVVTPGGMDHSDSRQNLENIL--SEGEVLKLAAAV  606

Query  1664  ESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHG  1485
             ESNT HP+GKAIVEAA+   C  +K  DGTFIEEPGSG +A+++ KKVSVGTL+WV+RHG
Sbjct  607   ESNTLHPVGKAIVEAARGVKCPNLKVVDGTFIEEPGSGVVAIVDNKKVSVGTLEWVQRHG  666

Query  1484  VGETRVQEFD-DFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSG  1308
             V E   QE D + +N+SVVYVGV+  LAGLIY EDQ+REDARH+V+SL +QGI  Y+LSG
Sbjct  667   VAENLFQEVDEELRNKSVVYVGVNNTLAGLIYFEDQIREDARHIVDSLHRQGIDVYMLSG  726

Query  1307  DKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALassh  1128
             DK++ AEYVAS+VGIP E V   VKP +K KFVS LQK+Q +VAMVGDGINDAAALAS+H
Sbjct  727   DKRSTAEYVASIVGIPEEKVLSEVKPADKRKFVSELQKNQNIVAMVGDGINDAAALASAH  786

Query  1127  vgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNI  966
             +GVA+GGGVGAAS+VSS+VLM NRLSQLLDALELSRLTMKTVKQNLWWAF YNI
Sbjct  787   IGVAVGGGVGAASEVSSIVLMGNRLSQLLDALELSRLTMKTVKQNLWWAFAYNI  840



>dbj|BAJ87066.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=803

 Score =   994 bits (2570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/786 (70%), Positives = 656/786 (83%), Gaps = 6/786 (1%)
 Frame = -2

Query  3140  MTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLTS  2961
             M+CGGCAASVKRILE++P+V SA+VNL TE AVVW V E + V +W+ QLGE+LA  LT+
Sbjct  1     MSCGGCAASVKRILENEPQVVSATVNLATEMAVVWAVPEDRAVQDWKLQLGEKLASQLTT  60

Query  2960  CGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAKA  2781
             CG+K++ RDS + +    FE+KM  K   L+ SGR LAVSWALCAVCL+GH+SH FG  A
Sbjct  61    CGYKSSQRDSSKVSSQNVFERKMGEKLQNLKQSGRELAVSWALCAVCLLGHISHLFGVNA  120

Query  2780  SWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMA  2601
               +HL HSTGFH+S+ +FT + PGR+LIIDGLKSL KG+PNMNTLVGLGALSSFAVSS+A
Sbjct  121   PLMHLFHSTGFHLSLSIFTFIGPGRRLIIDGLKSLFKGSPNMNTLVGLGALSSFAVSSVA  180

Query  2600  AFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMG  2421
             AFIPKLGWK FFEEP+MLIAFVLLG+NLEQRAK+KA SDMTGLLN+LPSKARL+V++D  
Sbjct  181   AFIPKLGWKTFFEEPIMLIAFVLLGKNLEQRAKLKAASDMTGLLNILPSKARLMVDND-A  239

Query  2420  EQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQV  2241
             EQ+S  EVPC  L+VGD I+VLPGDRIPADG+V+AGRSTVDESS TGEP+PVTK+ GA+V
Sbjct  240   EQSSFTEVPCGTLAVGDYILVLPGDRIPADGLVKAGRSTVDESSLTGEPMPVTKIAGAEV  299

Query  2240  AAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALS  2061
             +AGSINLNG LTVEV+RPGGET + DI+ LVEEAQ+REAPVQRLADKV+G+FTYGVMALS
Sbjct  300   SAGSINLNGKLTVEVRRPGGETVMSDILHLVEEAQTREAPVQRLADKVAGNFTYGVMALS  359

Query  2060  AATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslga  1881
             +ATFMFW++FG++++PA + QGS  SLALQLSCSVLV+ACPCALGLATPTAV+VGTSLGA
Sbjct  360   SATFMFWSIFGSQLVPAAIQQGSAMSLALQLSCSVLVIACPCALGLATPTAVLVGTSLGA  419

Query  1880  trglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEW  1701
             TRGLLLRGG VLE F+ V+ IVFDKTGTLTIG+P VT+V+        N K    +  EW
Sbjct  420   TRGLLLRGGDVLEKFAEVDAIVFDKTGTLTIGKPVVTKVIASHSEGGVNTKDYRNN--EW  477

Query  1700  SEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKV  1521
             +E DVL+LA+GVESNTNHP+GKAI+EAA++ NC  +KA+DG+F+EEPGSGA+A I EK+V
Sbjct  478   TEGDVLSLAAGVESNTNHPLGKAIMEAAQAANCINMKAKDGSFMEEPGSGAVATIGEKQV  537

Query  1520  SVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLS  1341
             SVGTLDW+RRHGV      E ++F  QSV YV VDG LAGLI  ED++RED+  V+ +LS
Sbjct  538   SVGTLDWIRRHGVVREPFPEAENF-GQSVAYVAVDGTLAGLICFEDKIREDSHQVINALS  596

Query  1340  KQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDG  1161
             KQGI+ Y+LSGDK++AA  VAS+VGI  + V   VKP EK KF+S LQK+ K+VAMVGDG
Sbjct  597   KQGISVYMLSGDKESAAMNVASIVGIQLDKVISEVKPHEKKKFISELQKEHKLVAMVGDG  656

Query  1160  INDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWA  981
             INDAAALA + VG+A+GGGVGAASDVSSVVLM NRLSQL+DALELS+ TM+TVKQNLWWA
Sbjct  657   INDAAALALADVGIAMGGGVGAASDVSSVVLMGNRLSQLVDALELSKETMRTVKQNLWWA  716

Query  980   FGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQ--KEIQ  807
             F YNIVGLPVAAG LLP TGTMLTPSIAGALMG SS+ VM NSLLLR + +SK   +  Q
Sbjct  717   FLYNIVGLPVAAGALLPVTGTMLTPSIAGALMGFSSVSVMANSLLLRARMSSKHHVQSRQ  776

Query  806   GPSVTI  789
              P  TI
Sbjct  777   KPHNTI  782



>gb|EYU18481.1| hypothetical protein MIMGU_mgv1a001648mg [Erythranthe guttata]
Length=778

 Score =   983 bits (2540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/634 (79%), Positives = 574/634 (91%), Gaps = 1/634 (0%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGCAASVKRILESQP+VSSASVNLTTETA+VWP SEAKVVPNW++ +GE LAKHL
Sbjct  140   GGMTCGGCAASVKRILESQPQVSSASVNLTTETAIVWPSSEAKVVPNWREDIGEALAKHL  199

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CGFK+N+RD RR N +E FEKK+N KR  L+ SGRGL VSW LCAVC+ GHLSHF GA
Sbjct  200   TNCGFKSNLRDLRRVNFYENFEKKINEKRELLKKSGRGLIVSWTLCAVCIFGHLSHFVGA  259

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
             KA+WIH LHSTGFH+S+ LFTLL PGRQLI+DG+KSLL+GAPNMNTLVGLGALSSFAVSS
Sbjct  260   KAAWIHALHSTGFHVSLSLFTLLGPGRQLIVDGMKSLLRGAPNMNTLVGLGALSSFAVSS  319

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA +PKLGWK FFEEPVMLIAFVLLGRNLEQRAKI+ATSDMTGLL++LPSKARL++N +
Sbjct  320   LAALMPKLGWKMFFEEPVMLIAFVLLGRNLEQRAKIRATSDMTGLLSILPSKARLLINGN  379

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               E +STVEVP S+L VGDQIIVLPGDRIPADGIV+AGRS+VDESSFTGEPLPVTKLPGA
Sbjct  380   AEELSSTVEVPSSSLIVGDQIIVLPGDRIPADGIVKAGRSSVDESSFTGEPLPVTKLPGA  439

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             +VAAGSINLNG +T+EV+RPGGETAIGDIVR+VE+AQ+REAPVQRLADKV+GHFTYGVMA
Sbjct  440   EVAAGSINLNGKITIEVRRPGGETAIGDIVRMVEDAQTREAPVQRLADKVAGHFTYGVMA  499

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATFMFWNLFG+R+LPA +HQGS  SLALQLSCSVLVVACPCALGLATPTAV+VGTSL
Sbjct  500   LSAATFMFWNLFGSRILPAAIHQGSSMSLALQLSCSVLVVACPCALGLATPTAVLVGTSL  559

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTC  1707
             GATRGLLLRGGS+LE FS VNTIVFDKTGTLTIG+PTVT+VV QG     N++ DS S  
Sbjct  560   GATRGLLLRGGSILEKFSTVNTIVFDKTGTLTIGKPTVTKVVIQGGQKYANSELDSNSRH  619

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEK  1527
              WSEV+VL LA+GVES+T HPIGKAIV AAK+ NC  VK  +GTF EEPGSGA+A ++EK
Sbjct  620   NWSEVEVLQLAAGVESSTIHPIGKAIVNAAKALNCPNVKVTEGTFTEEPGSGAVATVDEK  679

Query  1526  KVSVGTLDWVRRHG-VGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVE  1350
             KV+VGTL+WV+RHG VG++  QE ++FKNQSVVYVGVDGVLAG++YVEDQ+REDA+HV+E
Sbjct  680   KVAVGTLEWVQRHGVVGDSPFQEAEEFKNQSVVYVGVDGVLAGVVYVEDQIREDAKHVIE  739

Query  1349  SLSKQGITTYLLSGDKKNAAEYVASVVGIPRENV  1248
             SL++QGI TYLLSGDKK+AAEYVAS VGIPRE V
Sbjct  740   SLTRQGINTYLLSGDKKSAAEYVASAVGIPRERV  773



>ref|XP_010526998.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X3 [Tarenaya hassleriana]
Length=928

 Score =   978 bits (2528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/729 (73%), Positives = 619/729 (85%), Gaps = 9/729 (1%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGCAASVK+ILESQP+VS+ASVNLTTETA+VWPV EAK VPNW+++LGE LAKHL
Sbjct  168   GGMTCGGCAASVKKILESQPQVSTASVNLTTETAIVWPVLEAKSVPNWKEELGEMLAKHL  227

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             ++CGF++  R     N F  FE KM  K  +L+ SGR LAVSWALCAVC+VGHL+HF G 
Sbjct  228   SNCGFESTPRGLTNVNFFRVFESKMKEKHTRLKESGRELAVSWALCAVCVVGHLTHFLGV  287

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
             K  WIH  HSTGFH+S+ L TLL PGRQLIIDG+KSLLKGAPNMNTLVGLGALSSF VSS
Sbjct  288   KVPWIHAFHSTGFHVSLSLLTLLGPGRQLIIDGIKSLLKGAPNMNTLVGLGALSSFTVSS  347

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA IPKLGWK FFEEPVMLIAF+LLGRNLEQRAKIKATSDMTGLL+VLPSKARL+++ D
Sbjct  348   LAAMIPKLGWKTFFEEPVMLIAFILLGRNLEQRAKIKATSDMTGLLSVLPSKARLLLDGD  407

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
                 +STVEVPC++LSVGD +++LPGDR+PADGIVR+GRST+DESS TGEPLPVTK  G+
Sbjct  408   PQNPSSTVEVPCNSLSVGDLVVILPGDRVPADGIVRSGRSTIDESSLTGEPLPVTKESGS  467

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAG INLNG LTVEV+R GGETA+GDIVRLVEEAQSREAPVQRL DKV+G FTYGVMA
Sbjct  468   QVAAGCINLNGTLTVEVRRSGGETAVGDIVRLVEEAQSREAPVQRLVDKVAGRFTYGVMA  527

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATFMFWNLFG+ +LP+TLH GS ASLALQLSCSVLVVACPCALGLATPTA++VG SL
Sbjct  528   LSAATFMFWNLFGSYILPSTLHNGSPASLALQLSCSVLVVACPCALGLATPTAMLVGISL  587

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTC  1707
             GA RGLLLRGG +LE F+ V+T+VFDKTGTLT G P VT+VV   +     ++ +   T 
Sbjct  588   GARRGLLLRGGDILEKFASVDTVVFDKTGTLTRGHPVVTKVVIPEY-----SRYNLGDTL  642

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEK  1527
               SEV+VL LA+ VESNT+HP+GKAI+EAA++ NC+I+K EDGTF EEPGSGA+A++  K
Sbjct  643   --SEVEVLKLAASVESNTSHPVGKAIIEAARNHNCQIIKVEDGTFSEEPGSGAVAIVNNK  700

Query  1526  KVSVGTLDWVRRHGVGETRVQ--EFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVV  1353
             +V+VGTLDW++RHGV E  +   E  +FK+QS VY+GVD  LA LI  ED++REDA+ VV
Sbjct  701   RVTVGTLDWLQRHGVAENPLHAIEGHEFKSQSTVYIGVDNTLAALICFEDKVREDAQQVV  760

Query  1352  ESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAM  1173
             E+LS+QGI  Y+LSGDK+N A YVASVVGIP+E V  GVKP EK +F++ LQK +K VAM
Sbjct  761   ENLSRQGIDVYMLSGDKRNNANYVASVVGIPQERVIAGVKPGEKKRFINELQKTRKGVAM  820

Query  1172  VGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQN  993
             VGDGINDAAALASS VGVA+GGGVGAAS+VS +VLM NRLSQLL+ALELSR TMKTVKQN
Sbjct  821   VGDGINDAAALASSDVGVAMGGGVGAASEVSPIVLMSNRLSQLLEALELSRQTMKTVKQN  880

Query  992   LWWAFGYNI  966
             LWWAFGYNI
Sbjct  881   LWWAFGYNI  889



>gb|EMS52334.1| Putative copper-transporting ATPase PAA1 [Triticum urartu]
Length=973

 Score =   951 bits (2457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/869 (63%), Positives = 655/869 (75%), Gaps = 83/869 (10%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM+CGGCAASVKRILE++P+V SA+VNL TE AVVW V E + V +W+ QLGE+LA  LT
Sbjct  47    GMSCGGCAASVKRILENEPQVVSATVNLATEMAVVWAVPEDRAVQDWKLQLGEKLASQLT  106

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             +CG+K++ RDS + +    FE+KM  K   L+ SGR LAVSWALCAVCL+GH+SH FG  
Sbjct  107   TCGYKSSQRDSSKVSSQNVFERKMGEKLQNLKQSGRELAVSWALCAVCLLGHISHLFGVN  166

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
             A  +HL HSTGFH+S+ +FT + PGR+LIIDG+KSL KG+PNMNTLVGLGALSSFAVSS+
Sbjct  167   APLVHLFHSTGFHLSLSIFTFIGPGRRLIIDGIKSLFKGSPNMNTLVGLGALSSFAVSSV  226

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             AAFIPKLGWK FFEEP+MLIAFVLLG+NLEQRAK+KA SDMTGLLN+LPSKARL+V++D 
Sbjct  227   AAFIPKLGWKTFFEEPIMLIAFVLLGKNLEQRAKLKAASDMTGLLNILPSKARLMVDND-  285

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
              EQ+S  EVPC  L+VGD I+VLPGDRIPADG+V+AGRSTVDESS TGEP+PVTK+ GA+
Sbjct  286   AEQSSFTEVPCGTLAVGDYILVLPGDRIPADGLVKAGRSTVDESSLTGEPMPVTKIAGAE  345

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V+AGSINLNG LTVEV+RPGGET + DI+ LVEEAQ+REAPVQRLADKV+G+FTYGVMAL
Sbjct  346   VSAGSINLNGKLTVEVRRPGGETVMSDILHLVEEAQTREAPVQRLADKVAGNFTYGVMAL  405

Query  2063  SAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslg  1884
             S+ATFMFW++FG++ +PA + QGS  SLALQLSCSVLV+ACPCALGLATPTAV+VGTSLG
Sbjct  406   SSATFMFWSIFGSQFVPAAIQQGSAMSLALQLSCSVLVIACPCALGLATPTAVLVGTSLG  465

Query  1883  atrglllrggSVLESFSMVNTIVFDKTGTLTI----------------------------  1788
             ATRGLLLRGG VLE F+ V+ IVFDKTGTLTI                            
Sbjct  466   ATRGLLLRGGDVLEKFAEVDAIVFDKTGTLTIGKPVVTKVIASHSEGEFLCVTFYFPFNW  525

Query  1787  -----------GRPTVTEVVPQGHNDETNAKRDSTSTC----------------------  1707
                        G P +  V P       N   D  ++C                      
Sbjct  526   NSLQNIAAHRMGHPEICNVFPWIAFFFLNRMCDLCTSCTLSSRSEVYFPDLPVDKPYFVI  585

Query  1706  ------EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAM  1545
                   EW+E D+L+LA+GVESNTNHP+GKAI+EAA++ NC  +KA+DG+F+EEPGSGA+
Sbjct  586   RDYWNNEWTEGDILSLAAGVESNTNHPLGKAIMEAAQAANCINMKAKDGSFMEEPGSGAV  645

Query  1544  AVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDA  1365
             A I EK+VSVGTLDW+RRHGV      E + F  QSV YV VDG LAGLI  ED++RED+
Sbjct  646   ATIGEKQVSVGTLDWIRRHGVVRDPFHEAESF-GQSVAYVAVDGTLAGLICFEDKIREDS  704

Query  1364  RHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRE------------NVFYGVKPDEK  1221
               V+ +LSKQGI+ Y+LSGDK++AA  VASVVGI  +             V   VKP EK
Sbjct  705   HQVISALSKQGISVYMLSGDKESAAMNVASVVGIQLDKCDLLVYIIKWYQVISEVKPHEK  764

Query  1220  SKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLL  1041
              KF+S LQK+ K+VAMVGDGINDAAALA + VG+A+GGGVGAASDVSSVVLM NRLSQL+
Sbjct  765   KKFISELQKEHKLVAMVGDGINDAAALALADVGIAMGGGVGAASDVSSVVLMGNRLSQLV  824

Query  1040  DALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVM  861
             DALELS+ TM+TVKQNLWWAF YNIVGLPVAAG LLP TGTMLTPSIAGALMG SS+ VM
Sbjct  825   DALELSKETMRTVKQNLWWAFLYNIVGLPVAAGALLPVTGTMLTPSIAGALMGFSSVSVM  884

Query  860   TNSLLLRLKFASKQ--KEIQGPSVTIQIP  780
              NSLLLR + +S+   +  Q P  TI  P
Sbjct  885   ANSLLLRARMSSRHHVQSRQKPHNTISGP  913



>gb|KHN42741.1| Putative copper-transporting ATPase PAA1 [Glycine soja]
Length=719

 Score =   949 bits (2454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/704 (74%), Positives = 599/704 (85%), Gaps = 2/704 (0%)
 Frame = -2

Query  2894  MNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLV  2715
             M  +  QL+ SGR LAVSWALCAVCLVGH SHFF AKA WIH+ HS GFH+S+ LFTLL 
Sbjct  1     MEERHRQLRESGRELAVSWALCAVCLVGHFSHFFAAKAPWIHVFHSIGFHLSLSLFTLLG  60

Query  2714  PGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFV  2535
             PGRQLI+DGLKSLLK  PNMNTLVGLGALSSF VSS AA +P+LGWKAFFEEP+MLIAFV
Sbjct  61    PGRQLILDGLKSLLKRTPNMNTLVGLGALSSFTVSSFAALLPRLGWKAFFEEPIMLIAFV  120

Query  2534  LLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVL  2355
             LLGRNLEQRAKIKATSDMTGLL++LP KARL++N+   E  S VEVP  +LSVGDQIIVL
Sbjct  121   LLGRNLEQRAKIKATSDMTGLLSLLPPKARLLLNNRETEVGSVVEVPSDSLSVGDQIIVL  180

Query  2354  PGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGET  2175
             PGDRIPADGIVR+GRSTVDESSFTGEPLPVTK+ G++VAAGSINLNG LT+EVQRPGGET
Sbjct  181   PGDRIPADGIVRSGRSTVDESSFTGEPLPVTKVAGSEVAAGSINLNGTLTMEVQRPGGET  240

Query  2174  AIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQG  1995
             A+ +IVRLVEEAQSREAPVQRLADKV+GHFTYGVMA SAATF FW+L+GT +LP  L+QG
Sbjct  241   AMANIVRLVEEAQSREAPVQRLADKVAGHFTYGVMAASAATFTFWSLYGTHILPPALYQG  300

Query  1994  slaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIV  1815
             S  SLALQL+CSVLVVACPCALGLATPTAV+VGTSLGA RGLLLRGG++LE F+MVNTIV
Sbjct  301   SAVSLALQLACSVLVVACPCALGLATPTAVLVGTSLGAKRGLLLRGGNILEKFAMVNTIV  360

Query  1814  FDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGK  1635
             FDKTGTLT+GRP VT +V        NA    T     S+V+VL LA+ VESN+ HP+G+
Sbjct  361   FDKTGTLTVGRPVVTNIVIP--TCIKNAISSQTEENALSDVEVLRLAAAVESNSVHPVGQ  418

Query  1634  AIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFD  1455
             AIV AA++ NC   K +DGTF+EEPGSGA+A I+ KKVSVGTL+W+ RHGV  +  QE +
Sbjct  419   AIVNAAQAANCHDAKVKDGTFLEEPGSGAVATIDNKKVSVGTLEWITRHGVINSIHQEVE  478

Query  1454  DFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVAS  1275
                NQS VYVGVD  LAGLIY ED++REDAR VV+ LSKQ I  Y+LSGDK+NAAE+VAS
Sbjct  479   KSNNQSFVYVGVDDTLAGLIYFEDEIREDARDVVDRLSKQNIGVYMLSGDKRNAAEHVAS  538

Query  1274  VVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvga  1095
             +VGIP+E V   VKPDEK KF++ LQKD+ +VAMVGDGINDAAALASSHVG+A+GGGVGA
Sbjct  539   LVGIPKEKVLSQVKPDEKKKFINELQKDKNIVAMVGDGINDAAALASSHVGIALGGGVGA  598

Query  1094  asdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTM  915
             AS+VSS+VLM+N+LSQL+DALELSRLTM T+KQNLWWAF YNIVG+P+AAG+L P  GT+
Sbjct  599   ASEVSSIVLMRNQLSQLVDALELSRLTMNTIKQNLWWAFIYNIVGIPIAAGVLFPINGTV  658

Query  914   LTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQGPSVTIQI  783
             LTPSIAGALMGLSSIGVMTNSLLLR KF+SKQK+I G S   +I
Sbjct  659   LTPSIAGALMGLSSIGVMTNSLLLRFKFSSKQKQIHGTSPKTKI  702



>ref|XP_008455638.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X3 [Cucumis melo]
Length=853

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/701 (72%), Positives = 599/701 (85%), Gaps = 2/701 (0%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGCAASVKRILE+QP+VSSASVNLTTETAV+WPV E K  P+  +QLGE LA HL
Sbjct  143   GGMTCGGCAASVKRILENQPQVSSASVNLTTETAVIWPVPEVKDSPHRVKQLGETLASHL  202

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T CGF +++R+S R+N+F  FE+KM  KR +L+ SGR L  SWALCAVCL+GH+SHFFGA
Sbjct  203   TRCGFASSLRESGRDNIFMVFERKMEEKRNRLRESGRNLVFSWALCAVCLLGHISHFFGA  262

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
             KASWIH  H+T FH+S+CLFTLL PGRQLIIDG+KSL+KGAPNMNTLVGLGALSSF+VSS
Sbjct  263   KASWIHTCHTTQFHLSLCLFTLLGPGRQLIIDGMKSLVKGAPNMNTLVGLGALSSFSVSS  322

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA +PKLGWKAFFEEPVMLIAFVLLGRNLEQRAKI+A SDMTGLL++LPSKARLVV+  
Sbjct  323   LAALMPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIRAASDMTGLLSILPSKARLVVDGG  382

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               E +STVE+PCS+LSVGD++IVLPGDRIPADGIV++GRS VDESSFTGEPLPVTKLPG+
Sbjct  383   T-ELSSTVEIPCSSLSVGDEVIVLPGDRIPADGIVKSGRSIVDESSFTGEPLPVTKLPGS  441

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAG+INLNG LTVEV R GG++A+GDI+RLVEEAQSREAPVQRLADKVSGHFTYGVM 
Sbjct  442   QVAAGTINLNGTLTVEVHRHGGDSAMGDIIRLVEEAQSREAPVQRLADKVSGHFTYGVMG  501

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF+FW+ FG+R+LP   H GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  502   LSAATFIFWSQFGSRILPTAFHHGSSVSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  561

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTC  1707
             GAT+GLLLRGG++LE FSM +T+VFDKTGTLT+G+P VT+V       E N    + S  
Sbjct  562   GATKGLLLRGGNILEQFSMADTVVFDKTGTLTVGKPVVTKVFATSRY-ERNVDSQTNSHG  620

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEK  1527
              +SE ++L  A+ VESNT HP+GKAIVEAA++ N   +K  +GTF+EEPGSGA+A ++ +
Sbjct  621   NYSENEILKFAAAVESNTVHPVGKAIVEAARAVNGHSLKVVEGTFVEEPGSGAVATVQNR  680

Query  1526  KVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVES  1347
              VS+GTLDWV+R GV     QE DD K QSVVYVG+D +LAG IY ED +REDARHVV++
Sbjct  681   IVSIGTLDWVQRQGVTVEDFQETDDLKAQSVVYVGIDNILAGCIYYEDGIREDARHVVDT  740

Query  1346  LSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVG  1167
             LS+QGI TY+LSGDK++ AEY+AS+VGIP+E V  GVKP EK KF+S LQ++  +VAMVG
Sbjct  741   LSRQGINTYMLSGDKRSNAEYIASLVGIPKEKVRSGVKPQEKKKFISELQENNNIVAMVG  800

Query  1166  DGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQL  1044
             DGINDAAALA++ +G+A+GGGVGAAS+VS +VLM NRLSQL
Sbjct  801   DGINDAAALATADIGIAMGGGVGAASEVSPIVLMGNRLSQL  841



>gb|KFK29977.1| hypothetical protein AALP_AA7G201700 [Arabis alpina]
Length=735

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/707 (72%), Positives = 596/707 (84%), Gaps = 13/707 (2%)
 Frame = -2

Query  2924  ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFH  2745
             EN F+ FE K   K A+L+ SGR LAVSWALCAVCLVGHL+HF G  A W+H +HSTGFH
Sbjct  15    ENFFKVFETKTKDKEARLKQSGRELAVSWALCAVCLVGHLTHFLGINAPWLHAIHSTGFH  74

Query  2744  MSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFF  2565
             +S+CL TLL PGRQL++DG KSL+KG+PNMNTLVGLGA+SSF+VSS+AA IPKLGWK FF
Sbjct  75    VSLCLITLLGPGRQLVLDGFKSLIKGSPNMNTLVGLGAMSSFSVSSLAAMIPKLGWKTFF  134

Query  2564  EEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSN  2385
             EEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL+VLPSKARL+++ D   Q STVEVPC++
Sbjct  135   EEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLPSKARLLLDGD--RQNSTVEVPCNS  192

Query  2384  LSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLT  2205
             LSVGD +++LPGDR+PADGIV++GRS +DESSFTGEPLPVTK  G+QVAAGSINLNG LT
Sbjct  193   LSVGDLVVILPGDRVPADGIVKSGRSAIDESSFTGEPLPVTKEAGSQVAAGSINLNGTLT  252

Query  2204  VEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGT  2025
             VEV R GGETA+GDIVRLVEEAQSREAPVQ+L DKV+G FTYGVMALSAATF FWNLFG 
Sbjct  253   VEVHRSGGETAVGDIVRLVEEAQSREAPVQQLVDKVAGRFTYGVMALSAATFTFWNLFGA  312

Query  2024  RVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVL  1845
              +LP+ L  GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSLGA RGLLLRGG +L
Sbjct  313   HILPSALQNGSPVSLALQLSCSVLVVACPCALGLATPTAMLVGTSLGARRGLLLRGGDIL  372

Query  1844  ESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHNDETNAKRDSTSTCEWSEVDVLTLASG  1668
             E FS V+T+VFDKTGTLT G P VTEV +P+  +   N          WSEVDVL LA+ 
Sbjct  373   EKFSSVDTVVFDKTGTLTKGHPVVTEVIIPEYPSHSLNDT--------WSEVDVLMLAAA  424

Query  1667  VESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRH  1488
             VESNT HP+GKAIV+AA++RNC+ +KA+DGTF EEPGSGA+A++  K+V+VGTL+WV+RH
Sbjct  425   VESNTTHPVGKAIVKAARARNCQTMKADDGTFTEEPGSGAVAIVNNKRVTVGTLEWVQRH  484

Query  1487  GVGETRVQEFDDFK--NQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLL  1314
             G     +   ++ +  NQSVVY+GVD  LA +I  ED++REDA  VVE+L +QGI  Y+L
Sbjct  485   GATGNSLHAVEEHESNNQSVVYIGVDNTLAAIIRFEDKIREDAAQVVENLIRQGIDVYML  544

Query  1313  SGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALas  1134
             SGDK++AA YVASVVGIP+E V  GVKP EK  F++ LQK++ +VAMVGDGINDAAALAS
Sbjct  545   SGDKRSAANYVASVVGIPQERVIAGVKPAEKKNFINELQKNKNIVAMVGDGINDAAALAS  604

Query  1133  shvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLP  954
             S VGVA+GGG GAAS+VS +VLM NRL+QLLDALELSR TMKTVKQNLWWAFGYNIVG+P
Sbjct  605   SDVGVAMGGGAGAASEVSPIVLMGNRLTQLLDALELSRQTMKTVKQNLWWAFGYNIVGIP  664

Query  953   VAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             +AAG+LLP TGTMLTPS+AGALMG+SS+GVMTNSLLLR +F S + +
Sbjct  665   IAAGVLLPLTGTMLTPSMAGALMGVSSLGVMTNSLLLRYRFFSNRTD  711



>ref|XP_001770117.1| predicted protein [Physcomitrella patens]
 gb|EDQ65099.1| predicted protein [Physcomitrella patens]
Length=841

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/779 (60%), Positives = 593/779 (76%), Gaps = 15/779 (2%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQ---QLGEELA  2976
             GGM+CGGCA+SVKRILESQP+V+ A+VNL TETA+V   SE+ +   W++   QL E LA
Sbjct  27    GGMSCGGCASSVKRILESQPQVTGATVNLATETALVRVTSESVISSGWEKVKRQLAEALA  86

Query  2975  KHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHF  2796
             KHLT+ GFK+ VR      +     +K   + A+L+ SGR LAV+W L AVCLVGH  H 
Sbjct  87    KHLTNRGFKSTVRGISGGKVAPAALRKREERLARLKDSGRRLAVAWTLAAVCLVGHSHHL  146

Query  2795  FGAKA-SWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSF  2619
              G    SW+H+LHSTGFH ++ L  L+ PGR+L++DG KSL++G+PNMNTLVGLGA+SSF
Sbjct  147   IGHLGPSWLHMLHSTGFHAALSLAALVGPGRKLLVDGWKSLVRGSPNMNTLVGLGAISSF  206

Query  2618  AVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLV  2439
             AVS+ AA  P+LGW+AFFEEPVML+AFVLLGR +E+RAK++A+SDMT LLN LPSKARLV
Sbjct  207   AVSTAAALFPRLGWQAFFEEPVMLLAFVLLGRAVEERAKLQASSDMTALLNFLPSKARLV  266

Query  2438  VNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTK  2259
             +  D     +TV VPC +LSVGD ++VLPGDRIP DG+V++G+STVDESS TGEPL V K
Sbjct  267   MGFDNSGHPTTVTVPCDSLSVGDSVVVLPGDRIPVDGVVKSGKSTVDESSLTGEPLAVLK  326

Query  2258  LPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTY  2079
               G +V AG++N NG +TVE  R GG+T + DI+R+VE+AQ+REAPVQRLADKV+G F Y
Sbjct  327   QSGDEVTAGTVNYNGTMTVEAMRAGGDTVMSDIIRMVEDAQTREAPVQRLADKVAGRFCY  386

Query  2078  GVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMV  1899
             GVMALS ATF FW  FG  + PA +  G    L LQL+C+VLV+ACPCALGLATPTAV+V
Sbjct  387   GVMALSGATFAFWTTFGPALFPAVVPTGGPLLLGLQLACNVLVIACPCALGLATPTAVLV  446

Query  1898  gtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDS  1719
             GTSLGA RGLL+RGG +LE+ S V+TIVFDKTGTLT+GRP V  V+         +  D 
Sbjct  447   GTSLGARRGLLIRGGDILENVSSVDTIVFDKTGTLTVGRPVVKSVI--------CSNIDG  498

Query  1718  TSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAV  1539
               +  W+E D+LTLA+GVE   +HPI KA+V+AA S  CR    ++ TF +EPGSGA A+
Sbjct  499   QPSSTWTEKDLLTLAAGVERTASHPIAKALVQAATSAGCRQAVVQESTFEQEPGSGAKAI  558

Query  1538  IEEKKVSVGTLDWVRRHGVGETRVQEFDD--FKNQSVVYVGVDGVLAGLIYVEDQLREDA  1365
             +E K V+VGTL+W+RR GV E    E  D   + Q++VYVGVD  L G + + D+LR+DA
Sbjct  559   VEGKLVTVGTLEWLRRAGV-EGVAPEAPDATTQGQTIVYVGVDDKLVGAVTMIDELRDDA  617

Query  1364  RHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQK  1185
             +  V +L + G+ T +LSGDK+ AAE +A+ VGI R+ V+ GVKP  K+ F+  LQ + +
Sbjct  618   KASVAALHRMGMKTSMLSGDKQEAAEAIAAKVGIDRQQVYAGVKPSGKADFIRQLQSENR  677

Query  1184  VVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKT  1005
              VAMVGDG+NDAAALA + VG+A+ GGVGAAS+V+S+VLM ++LSQ++DALELSRLT+K 
Sbjct  678   HVAMVGDGVNDAAALAQAQVGIAMAGGVGAASEVASIVLMGDKLSQVVDALELSRLTLKK  737

Query  1004  VKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFA  828
             +KQNLWWAF YNIVGLP+AAG LLP T  MLTPSIAGALMG+SS+GVMTNSLLL+L+F+
Sbjct  738   IKQNLWWAFMYNIVGLPLAAGALLPSTNIMLTPSIAGALMGISSLGVMTNSLLLQLEFS  796



>ref|XP_009627777.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=674

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/511 (84%), Positives = 473/511 (93%), Gaps = 2/511 (0%)
 Frame = -2

Query  3224  KENPSVIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETA  3045
             KENPSV+A   ED S +SSDVIILDV GMTCGGCAASVKRILESQP+VSSA+VNLTTETA
Sbjct  128   KENPSVVAETSEDVSALSSDVIILDVTGMTCGGCAASVKRILESQPQVSSATVNLTTETA  187

Query  3044  VVWPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQA  2865
             +VWPVS+AKVVPNWQ+Q+GE LAKHLT+CGF +NVRDS REN FE FEKKMNAKR QL+ 
Sbjct  188   IVWPVSDAKVVPNWQKQIGEALAKHLTTCGFTSNVRDSGRENFFEIFEKKMNAKRIQLKE  247

Query  2864  SGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGL  2685
             SGRGLAVSWALCAVCLVGHLSHFFGAKASWIH +HSTGFHM++ LFTLLVPGRQLIIDGL
Sbjct  248   SGRGLAVSWALCAVCLVGHLSHFFGAKASWIHAIHSTGFHMTLSLFTLLVPGRQLIIDGL  307

Query  2684  KSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRA  2505
             KSL+KG+PNMNTLVGLGALSSFAVSSMAA IPKLGWK FFEEPVMLIAFVLLGRNLEQRA
Sbjct  308   KSLIKGSPNMNTLVGLGALSSFAVSSMAALIPKLGWKTFFEEPVMLIAFVLLGRNLEQRA  367

Query  2504  KIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGI  2325
             KIKATSDMTGLLNVLPSKARLVV+SD GE +STVEVP ++LSVGDQIIVLPGDR+PADGI
Sbjct  368   KIKATSDMTGLLNVLPSKARLVVSSDSGESSSTVEVPSNSLSVGDQIIVLPGDRVPADGI  427

Query  2324  VRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVE  2145
             VRAGRST+DESSFTGEPLPVTKLPGA+VAAGSINLNG LTVEV+RPGGETAIGDIV+LVE
Sbjct  428   VRAGRSTIDESSFTGEPLPVTKLPGAEVAAGSINLNGTLTVEVRRPGGETAIGDIVQLVE  487

Query  2144  EAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqls  1965
             EAQSREAPVQRLADKV+G+FTYGVM LSAATFMFWNLFG R+LP+TL+ GS+ SLALQLS
Sbjct  488   EAQSREAPVQRLADKVAGNFTYGVMTLSAATFMFWNLFGARILPSTLYHGSVVSLALQLS  547

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
             C+VLV+ACPCALGLATPTAVMVGTSLGAT+GLLLRGGSVLE FS VNT+VFDKTGTLTIG
Sbjct  548   CTVLVIACPCALGLATPTAVMVGTSLGATKGLLLRGGSVLERFSTVNTVVFDKTGTLTIG  607

Query  1784  RPTVTEVVP--QGHNDETNAKRDSTSTCEWS  1698
             RPTVT+VV   QG+ ++ +A+  +   C ++
Sbjct  608   RPTVTKVVSQGQGYQEDPDARLSANFKCIYT  638



>gb|KGN53711.1| hypothetical protein Csa_4G108510 [Cucumis sativus]
Length=702

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/553 (74%), Positives = 480/553 (87%), Gaps = 2/553 (0%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGCAASVKRILE+QP+VSSASVNLTTETAV+WPV E K  P+  ++LGE LA HL
Sbjct  143   GGMTCGGCAASVKRILENQPQVSSASVNLTTETAVIWPVPEVKDSPHRVKKLGETLANHL  202

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T CGF +++RDS R+N+F  FEKKM  KR +L+ SGR L  SWALCAVCL+GH+SHFFGA
Sbjct  203   TRCGFASSLRDSGRDNIFMVFEKKMEEKRNRLKESGRNLVFSWALCAVCLLGHISHFFGA  262

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
             KASWIH  H+T FH+S+CLFTLL PGRQLIIDG+KSL+KGAPNMNTLVGLGALSSF+VSS
Sbjct  263   KASWIHTFHTTQFHLSLCLFTLLGPGRQLIIDGMKSLVKGAPNMNTLVGLGALSSFSVSS  322

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA +PKLGWKAFFEEPVMLIAFVLLGRNLEQRAKI+A SDMTGLL++LPSKARLVV+ D
Sbjct  323   LAALMPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIRAASDMTGLLSILPSKARLVVDGD  382

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               E +STVE+PCS+LS+GD++IVLPGDRIPADGIV++GRS VDESSFTGEPLPVTKLPG+
Sbjct  383   T-ELSSTVEIPCSSLSIGDEVIVLPGDRIPADGIVKSGRSIVDESSFTGEPLPVTKLPGS  441

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAG+INLNG LTV+V R GG+TA+GDI+RLVEEAQSREAPVQRLADKVSGHFTYGVM 
Sbjct  442   QVAAGTINLNGTLTVKVHRQGGDTAMGDIIRLVEEAQSREAPVQRLADKVSGHFTYGVMV  501

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF+FW+ FG+R+LPA  + GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  502   LSAATFIFWSQFGSRILPAAFYHGSSVSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  561

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTC  1707
             GAT+GLLLRGG++LE FSMV+T+VFDKTGTLT+GRP VT+V       E N    + S  
Sbjct  562   GATKGLLLRGGNILEQFSMVDTVVFDKTGTLTVGRPVVTKVFATSRY-ERNVDTQTNSHG  620

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEK  1527
              +SE ++L  A+ VESNT HP+GKAIVEAA++ N   +K  +GTF+EEPGSGA+A +E +
Sbjct  621   NYSENEILKFAAAVESNTVHPVGKAIVEAARAVNGHSLKVVEGTFVEEPGSGAVATVENR  680

Query  1526  KVSVGTLDWVRRH  1488
              +S+GTLDWV+R+
Sbjct  681   IISIGTLDWVQRY  693



>ref|XP_002994064.1| hypothetical protein SELMODRAFT_138129 [Selaginella moellendorffii]
 gb|EFJ04851.1| hypothetical protein SELMODRAFT_138129 [Selaginella moellendorffii]
Length=910

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/776 (56%), Positives = 570/776 (73%), Gaps = 23/776 (3%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM+CGGCAASVKRILESQ +V+SA+VNL TETAV+    ++    N  +++ E LA HL
Sbjct  130   GGMSCGGCAASVKRILESQVQVASATVNLATETAVIHVKQDSPAASN--REIAEHLANHL  187

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQAS-GRGLAVSWALCAVCLVGHLSHFFG  2790
             T+CGFK++VR+   ++  +   K+   ++ +L+ S GR LA +W L ++ LVGH SHF G
Sbjct  188   TTCGFKSSVREQGSQSRLQAAYKRKEERKVRLKDSAGRRLAAAWTLFSLSLVGHASHF-G  246

Query  2789  AK--ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFA  2616
              K    W+H  HS  F MS+C+F+L+ PGR L++DG KS  + +PNMNTLVGLGALSSFA
Sbjct  247   LKYFPPWLHFFHSVSFQMSLCVFSLVGPGRSLLLDGWKSFRRRSPNMNTLVGLGALSSFA  306

Query  2615  VSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVV  2436
             VS +AA  PKLGW +FFEEPVML+AFVLLGR +E+RAK+KA+SDM  LL +LP  ARLV+
Sbjct  307   VSVIAALYPKLGWSSFFEEPVMLLAFVLLGRAVEERAKVKASSDMESLLGLLPKNARLVM  366

Query  2435  NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKL  2256
                + E  STV+VPC ++ +GD+++VLPGD IP DGIV+ GRSTVDESS TGEPLP+ K 
Sbjct  367   GKSLDEVPSTVDVPCDSIVLGDRVMVLPGDIIPVDGIVKEGRSTVDESSLTGEPLPILKK  426

Query  2255  PGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYG  2076
              G +V AG++N NG++ VE  R G ET +GDIVR+VE AQ REAP+QRLADKVSG F Y 
Sbjct  427   SGDEVNAGTVNHNGVILVEAVRSGDETVVGDIVRMVENAQLREAPIQRLADKVSGKFCYA  486

Query  2075  VMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVg  1896
             VMALS AT  FW++ G ++ P+ +  G    L LQL+C+VLV+ACPCALGLATPTAV+VG
Sbjct  487   VMALSVATLGFWSVLGPKLFPSVIPTGGGLLLGLQLACNVLVIACPCALGLATPTAVLVG  546

Query  1895  tslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDST  1716
             TSLGA  GLL+RGG +LE  S V+ +VFDKTGTLT+GRP V +VV   +           
Sbjct  547   TSLGARNGLLVRGGDILEKASAVDAVVFDKTGTLTLGRPVVVDVVLNKY-----------  595

Query  1715  STCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVI  1536
                 WS+ +VL  A GVE   +HP+ KAIV+ A++        +DG+F +EPGSGA AV+
Sbjct  596   ----WSKEEVLKFAHGVERTASHPLAKAIVQEAENVGSTGALVQDGSFEQEPGSGATAVV  651

Query  1535  EEKKVSVGTLDWVRRHG-VGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARH  1359
             + K+V+VGTLDWV+R G VGE   +   + + ++VV+VGVD  +A  I + D++R+DA  
Sbjct  652   DGKRVTVGTLDWVQRFGTVGEPP-RLLGNPEGRTVVFVGVDNSIAAAITLVDEIRDDAAE  710

Query  1358  VVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVV  1179
              V +L + G++TY+LSGDK+  AE V+  VGI R  VF GV+P  K++ +  LQK++K V
Sbjct  711   TVRALQRLGVSTYMLSGDKREVAELVSRNVGIDRNKVFSGVRPHGKAELIVQLQKEKKTV  770

Query  1178  AMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVK  999
             AMVGDGINDAAALA + VG+A+  G+GAAS+V+S+VLM+++L Q++DALELSR   + +K
Sbjct  771   AMVGDGINDAAALAQADVGIAMATGIGAASEVASIVLMRDKLLQVVDALELSRRIQRKIK  830

Query  998   QNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKF  831
             QNL WAF YNI+GLP+AAG L+P T  MLTPS+AGALMGLSS+GV+TNSLLL  ++
Sbjct  831   QNLCWAFMYNIIGLPIAAGALVPATRVMLTPSLAGALMGLSSLGVVTNSLLLHWEY  886



>ref|XP_001755832.1| predicted protein [Physcomitrella patens]
 gb|EDQ79505.1| predicted protein [Physcomitrella patens]
Length=902

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/779 (56%), Positives = 570/779 (73%), Gaps = 34/779 (4%)
 Frame = -2

Query  3113  VKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQ---QLGEELAKHLTSCGFKAN  2943
             VKRILE+QP+V+  +VNL TETA V   SE+     W++   +L E LA HLTSCG+K+ 
Sbjct  96    VKRILEAQPQVTGVAVNLATETAQVKVTSESVGKNGWEKIKRRLAESLANHLTSCGYKSC  155

Query  2942  VRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA-KASWIHL  2766
              R+           +K   + A+L+ SGR LAV+W L A CLVGH  HF G    SW+H+
Sbjct  156   PREGVA---LPAALRKREERLAKLKDSGRRLAVAWTLAAFCLVGHSHHFIGQLDPSWLHM  212

Query  2765  LHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPK  2586
             LHSTGFH ++ L  L+ PGR+L++DG KSL +G+PNMNTLVGLGA+SSFAVS+ A  +PK
Sbjct  213   LHSTGFHAALSLVALIGPGRKLLVDGWKSLWRGSPNMNTLVGLGAVSSFAVSTAATLLPK  272

Query  2585  LGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTST  2406
             LGW+AFFEEPVML+AFVLLGR +E+RAK++++SDMT LLNVLPS+ARL++  D     +T
Sbjct  273   LGWQAFFEEPVMLLAFVLLGRAVEERAKLQSSSDMTVLLNVLPSEARLLIGQDNDGHPTT  332

Query  2405  VEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSI  2226
             + VPC +LS+GD ++VLPGDRIP DG+V++G+STVDESS TGEPLPV K    +V AG++
Sbjct  333   MNVPCDSLSIGDAVVVLPGDRIPVDGVVKSGKSTVDESSLTGEPLPVLKQFRDEVTAGTV  392

Query  2225  NLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFM  2046
             N NG +TV+ +R GG+T + DI+R+VE+AQ+REAPVQRLADKV+G F YGVMALS ATF+
Sbjct  393   NHNGTITVQAKRAGGDTVMNDIIRMVEDAQTREAPVQRLADKVAGRFCYGVMALSGATFV  452

Query  2045  FWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrgll  1866
             FW +FG  + PA +  G    L  QL+C+VLV+ACPCALGLATPTAV+VGTSLGA RGLL
Sbjct  453   FWTMFGPVLFPAVVPTGGPLLLGFQLACNVLVIACPCALGLATPTAVLVGTSLGARRGLL  512

Query  1865  lrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDV  1686
             +RGG VLE  S ++TIVFDKTGTLT+GRP V  V+               ++  WSE ++
Sbjct  513   IRGGDVLEKVSSIDTIVFDKTGTLTVGRPVVKNVI--------------CNSSTWSEKEL  558

Query  1685  LTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTL  1506
             L  A+GVE  T+HPI KA+V+AA S  CR   AE+ TF +EPGSGA A+IE K VSVGTL
Sbjct  559   LAFAAGVERATSHPIAKALVQAATSYGCRQAVAEESTFEQEPGSGAKAIIEGKLVSVGTL  618

Query  1505  DWVRRHGVGETRVQEFDDFKNQSVVY------VGVDGVLAGLIYVEDQLREDARHVVESL  1344
             +W++R+         F +    S  +      +GVD  + G I + D++R+DA+  +E+L
Sbjct  619   EWLQRY-------VTFGNICMGSPTWLIMFFLIGVDDKVVGAITMIDEVRDDAKATIETL  671

Query  1343  SKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGD  1164
                GI T +LSGDK  AA+ VA+ VGI    V+ GVKP EK  F+  LQ +++ VAMVGD
Sbjct  672   HWMGIKTSILSGDKLEAAKAVAAKVGIDWNKVYAGVKPSEKEDFIRQLQSEKRFVAMVGD  731

Query  1163  GINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWW  984
             G+NDAAALA + VG+A+ GGVGAAS+V+S+VLM ++LSQ++DA+ELSRLT+K +KQNLWW
Sbjct  732   GVNDAAALAQAQVGIAMAGGVGAASEVASIVLMGDKLSQVVDAIELSRLTLKKIKQNLWW  791

Query  983   AFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQ  807
             AF YNIVGLP+AAG LLP    MLTPSIAGALMG+SS+GVM NSLLL+L+F+     ++
Sbjct  792   AFIYNIVGLPLAAGALLPSANIMLTPSIAGALMGISSLGVMANSLLLQLEFSRPSSNMK  850



>ref|XP_002299685.2| hypothetical protein POPTR_0001s21290g [Populus trichocarpa]
 gb|EEE84490.2| hypothetical protein POPTR_0001s21290g [Populus trichocarpa]
Length=569

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/535 (78%), Positives = 474/535 (89%), Gaps = 2/535 (0%)
 Frame = -2

Query  2582  GWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTV  2403
             GWKAFFEEP+MLIAFVLLGRNLEQRAKIKATSDMTGLL+VLP+KARLVVN D  +  S V
Sbjct  28    GWKAFFEEPIMLIAFVLLGRNLEQRAKIKATSDMTGLLSVLPTKARLVVNGDAKDLGSIV  87

Query  2402  EVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSIN  2223
             EVPCS+LSVGD+I+VLPGDR+PADG V AGRST+DESSFTGEPLPVTKLPG+QV+AGSIN
Sbjct  88    EVPCSSLSVGDKIVVLPGDRVPADGTVTAGRSTIDESSFTGEPLPVTKLPGSQVSAGSIN  147

Query  2222  LNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMF  2043
             LNG LT+EV+RPGGETA+GDIVRLVEEAQSREAPVQRLADKVSGHFTYGVM +SAATF+F
Sbjct  148   LNGTLTIEVKRPGGETAMGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMTISAATFVF  207

Query  2042  WNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglll  1863
             W++FGTR+LPA L+QG+  SLALQLSCSVLVVACPCALGLATPTAV+VGTSLGATRGLLL
Sbjct  208   WSMFGTRILPAALNQGNPISLALQLSCSVLVVACPCALGLATPTAVLVGTSLGATRGLLL  267

Query  1862  rggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVL  1683
             RGG+VLE FSMVN++VFDKTGTLTIGRP VT+VVP G    T+++ +  +T   SEV++L
Sbjct  268   RGGNVLEKFSMVNSVVFDKTGTLTIGRPAVTKVVPLGGMKITDSQLNPDAT--LSEVELL  325

Query  1682  TLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLD  1503
              LA+GVESNT HP+GKAIVEAA++  C+ VK  DGTF+EEPGSGA+A IE K VS+GTLD
Sbjct  326   KLAAGVESNTIHPVGKAIVEAAQAAGCQNVKVTDGTFMEEPGSGAVATIENKVVSIGTLD  385

Query  1502  WVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITT  1323
             W++RHGV E   QE +D KNQSVVYVGVD  LAGLIY EDQ+REDAR VVESLS QGI  
Sbjct  386   WIQRHGVDEKPFQEVEDLKNQSVVYVGVDNTLAGLIYFEDQIREDARQVVESLSSQGINV  445

Query  1322  YLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAA  1143
             Y+LSGDKK+ AE+VAS+VGIP+E V  GVKPDEK +F+S LQKDQ +VAMVGDGINDA A
Sbjct  446   YMLSGDKKSTAEHVASLVGIPKEKVLSGVKPDEKKRFISELQKDQSIVAMVGDGINDAGA  505

Query  1142  LasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAF  978
             LA SHVGVA+GGGVGAAS+VSS+VLM NRLSQ+LDALELSRLTMKTVKQNLW  F
Sbjct  506   LAESHVGVAMGGGVGAASEVSSIVLMGNRLSQVLDALELSRLTMKTVKQNLWLEF  560



>ref|XP_004170351.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like, 
partial [Cucumis sativus]
Length=659

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/514 (75%), Positives = 449/514 (87%), Gaps = 2/514 (0%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGMTCGGCAASVKRILE+QP+VSSASVNLTTETAV+WPV E K  P+  ++LGE LA HL
Sbjct  143   GGMTCGGCAASVKRILENQPQVSSASVNLTTETAVIWPVPEVKDSPHRVKKLGETLANHL  202

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T CGF +++RDS R+N+F  FEKKM  KR +L+ SGR L  SWALCAVCL+GH+SHFFGA
Sbjct  203   TRCGFASSLRDSGRDNIFMVFEKKMEEKRNRLKESGRNLVFSWALCAVCLLGHISHFFGA  262

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
             KASWIH  H+T FH+S+CLFTLL PGRQLIIDG+KSL+KGAPNMNTLVGLGALSSF+VSS
Sbjct  263   KASWIHTFHTTQFHLSLCLFTLLGPGRQLIIDGMKSLVKGAPNMNTLVGLGALSSFSVSS  322

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AA +PKLGWKAFFEEPVMLIAFVLLGRNLEQRAKI+A SDMTGLL++LPSKARLVV+ D
Sbjct  323   LAALMPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIRAASDMTGLLSILPSKARLVVDGD  382

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               E +STVE+PCS+LS+GD++IVLPGDRIPADGIV++GRS VDESSFTGEPLPVTKLPG+
Sbjct  383   T-ELSSTVEIPCSSLSIGDEVIVLPGDRIPADGIVKSGRSIVDESSFTGEPLPVTKLPGS  441

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             QVAAG+INLNG LTV+V R GG+TA+GDI+RLVEEAQSREAPVQRLADKVSGHFTYGVM 
Sbjct  442   QVAAGTINLNGTLTVKVHRQGGDTAMGDIIRLVEEAQSREAPVQRLADKVSGHFTYGVMV  501

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             LSAATF+FW+ FG+R+LPA  + GS  SLALQLSCSVLVVACPCALGLATPTA++VGTSL
Sbjct  502   LSAATFIFWSQFGSRILPAAFYHGSSVSLALQLSCSVLVVACPCALGLATPTAMLVGTSL  561

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTC  1707
             GAT+GLLLRGG++LE FSMV+T+VFDKTGTLT+GRP VT+V       E N    + S  
Sbjct  562   GATKGLLLRGGNILEQFSMVDTVVFDKTGTLTVGRPVVTKVFATSRY-ERNVDTQTNSHG  620

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRN  1605
              +SE ++L  A+ VESNT HP+GKAIVEAA++ N
Sbjct  621   NYSENEILKFAAAVESNTVHPVGKAIVEAARAVN  654



>ref|XP_009627778.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=581

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/441 (87%), Positives = 416/441 (94%), Gaps = 0/441 (0%)
 Frame = -2

Query  3224  KENPSVIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETA  3045
             KENPSV+A   ED S +SSDVIILDV GMTCGGCAASVKRILESQP+VSSA+VNLTTETA
Sbjct  128   KENPSVVAETSEDVSALSSDVIILDVTGMTCGGCAASVKRILESQPQVSSATVNLTTETA  187

Query  3044  VVWPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQA  2865
             +VWPVS+AKVVPNWQ+Q+GE LAKHLT+CGF +NVRDS REN FE FEKKMNAKR QL+ 
Sbjct  188   IVWPVSDAKVVPNWQKQIGEALAKHLTTCGFTSNVRDSGRENFFEIFEKKMNAKRIQLKE  247

Query  2864  SGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGL  2685
             SGRGLAVSWALCAVCLVGHLSHFFGAKASWIH +HSTGFHM++ LFTLLVPGRQLIIDGL
Sbjct  248   SGRGLAVSWALCAVCLVGHLSHFFGAKASWIHAIHSTGFHMTLSLFTLLVPGRQLIIDGL  307

Query  2684  KSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRA  2505
             KSL+KG+PNMNTLVGLGALSSFAVSSMAA IPKLGWK FFEEPVMLIAFVLLGRNLEQRA
Sbjct  308   KSLIKGSPNMNTLVGLGALSSFAVSSMAALIPKLGWKTFFEEPVMLIAFVLLGRNLEQRA  367

Query  2504  KIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGI  2325
             KIKATSDMTGLLNVLPSKARLVV+SD GE +STVEVP ++LSVGDQIIVLPGDR+PADGI
Sbjct  368   KIKATSDMTGLLNVLPSKARLVVSSDSGESSSTVEVPSNSLSVGDQIIVLPGDRVPADGI  427

Query  2324  VRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVE  2145
             VRAGRST+DESSFTGEPLPVTKLPGA+VAAGSINLNG LTVEV+RPGGETAIGDIV+LVE
Sbjct  428   VRAGRSTIDESSFTGEPLPVTKLPGAEVAAGSINLNGTLTVEVRRPGGETAIGDIVQLVE  487

Query  2144  EAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqls  1965
             EAQSREAPVQRLADKV+G+FTYGVM LSAATFMFWNLFG R+LP+TL+ GS+ SLALQLS
Sbjct  488   EAQSREAPVQRLADKVAGNFTYGVMTLSAATFMFWNLFGARILPSTLYHGSVVSLALQLS  547

Query  1964  csvlvvaCPCALGLATPTAVM  1902
             C+VLV+ACPCALGLATPTAVM
Sbjct  548   CTVLVIACPCALGLATPTAVM  568



>gb|EPS61648.1| hypothetical protein M569_13146, partial [Genlisea aurea]
Length=644

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/540 (72%), Positives = 465/540 (86%), Gaps = 14/540 (3%)
 Frame = -2

Query  3218  NPSVIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQ-PRVSSASVNLTTETAV  3042
              PSV+A    D   +SS+VIIL+VGGMTCGGCAASVKRILESQ P+VSSASVNLTTETA+
Sbjct  113   KPSVVA----DGPGLSSEVIILEVGGMTCGGCAASVKRILESQQPQVSSASVNLTTETAI  168

Query  3041  VWPVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQAS  2862
             VWPVSEAK++P+W+  +GE LAKHLT+CGFK+N++D ++   ++TF+KKM  K+A L+ S
Sbjct  169   VWPVSEAKILPDWRNTVGEALAKHLTNCGFKSNLKDFKKAKFYQTFQKKMQEKQALLRGS  228

Query  2861  GRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLK  2682
             GR LA SWALC VC++GHLSHFFG KA+WIH LHSTGF MS+ LFTLL PGRQLI+DGLK
Sbjct  229   GRRLAFSWALCTVCVIGHLSHFFGIKATWIHALHSTGFQMSLSLFTLLGPGRQLILDGLK  288

Query  2681  SLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAK  2502
             SLL+G+PNMNTLVGLGALSSF+VS++AAF+PKLGWK FFEEPVMLIAFVLLG+NLEQRA+
Sbjct  289   SLLRGSPNMNTLVGLGALSSFSVSALAAFLPKLGWKTFFEEPVMLIAFVLLGKNLEQRAQ  348

Query  2501  IKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIV  2322
             I+A+SDM GLL++LPSKARL+VN D    +S VEVP  +LSVGD+I+VLPGDR+PADGI+
Sbjct  349   IRASSDMAGLLSILPSKARLLVNKDSDGTSSVVEVPSDSLSVGDRIVVLPGDRLPADGII  408

Query  2321  RAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEE  2142
               GRS+VDESSFTGEPLPVTKLPGA+V+AGSINLNG +TVEV+RPGGETAIGDIVRLVEE
Sbjct  409   SQGRSSVDESSFTGEPLPVTKLPGAEVSAGSINLNGRITVEVRRPGGETAIGDIVRLVEE  468

Query  2141  AQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlsc  1962
             AQ+RE PV+RLADKV+G+FTYGVMA SAATF+FWNLF  +++PA L  GS  SLALQLSC
Sbjct  469   AQTREPPVKRLADKVAGNFTYGVMAFSAATFLFWNLFSRQLIPAALQHGSPISLALQLSC  528

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
             SVLVVACPCALGLATPTAV+VGTSLGA RGLL+RGGS+LE F+ V+ +VFDKTGTLT G+
Sbjct  529   SVLVVACPCALGLATPTAVLVGTSLGARRGLLVRGGSILEKFAAVDAVVFDKTGTLTAGK  588

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             PTV +VV          + D ++   WSE +VL LA+GVESNT HPIGKAIVEAA++ NC
Sbjct  589   PTVMKVV---------TRADESADRGWSETEVLRLAAGVESNTIHPIGKAIVEAARASNC  639



>ref|XP_010526999.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X4 [Tarenaya hassleriana]
Length=648

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/488 (76%), Positives = 422/488 (86%), Gaps = 1/488 (0%)
 Frame = -2

Query  3203  AAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSE  3024
             A AG+     SSDVIILDVGGMTCGGCAASVK+ILESQP+VS+ASVNLTTETA+VWPV E
Sbjct  149   AGAGDGVPSPSSDVIILDVGGMTCGGCAASVKKILESQPQVSTASVNLTTETAIVWPVLE  208

Query  3023  AKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAV  2844
             AK VPNW+++LGE LAKHL++CGF++  R     N F  FE KM  K  +L+ SGR LAV
Sbjct  209   AKSVPNWKEELGEMLAKHLSNCGFESTPRGLTNVNFFRVFESKMKEKHTRLKESGRELAV  268

Query  2843  SWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGA  2664
             SWALCAVC+VGHL+HF G K  WIH  HSTGFH+S+ L TLL PGRQLIIDG+KSLLKGA
Sbjct  269   SWALCAVCVVGHLTHFLGVKVPWIHAFHSTGFHVSLSLLTLLGPGRQLIIDGIKSLLKGA  328

Query  2663  PNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSD  2484
             PNMNTLVGLGALSSF VSS+AA IPKLGWK FFEEPVMLIAF+LLGRNLEQRAKIKATSD
Sbjct  329   PNMNTLVGLGALSSFTVSSLAAMIPKLGWKTFFEEPVMLIAFILLGRNLEQRAKIKATSD  388

Query  2483  MTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             MTGLL+VLPSKARL+++ D    +STVEVPC++LSVGD +++LPGDR+PADGIVR+GRST
Sbjct  389   MTGLLSVLPSKARLLLDGDPQNPSSTVEVPCNSLSVGDLVVILPGDRVPADGIVRSGRST  448

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             +DESS TGEPLPVTK  G+QVAAG INLNG LTVEV+R GGETA+GDIVRLVEEAQSREA
Sbjct  449   IDESSLTGEPLPVTKESGSQVAAGCINLNGTLTVEVRRSGGETAVGDIVRLVEEAQSREA  508

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvva  1944
             PVQRL DKV+G FTYGVMALSAATFMFWNLFG+ +LP+TLH GS ASLALQLSCSVLVVA
Sbjct  509   PVQRLVDKVAGRFTYGVMALSAATFMFWNLFGSYILPSTLHNGSPASLALQLSCSVLVVA  568

Query  1943  CPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV  1764
             CPCALGLATPTA++VG SLGA RGLLLRGG +LE F+ V+T+VFDKTGTLT G P VT+V
Sbjct  569   CPCALGLATPTAMLVGISLGARRGLLLRGGDILEKFASVDTVVFDKTGTLTRGHPVVTKV  628

Query  1763  V-PQGHND  1743
             V P+  +D
Sbjct  629   VIPEYSSD  636



>ref|XP_002989060.1| hypothetical protein SELMODRAFT_129166 [Selaginella moellendorffii]
 gb|EFJ09854.1| hypothetical protein SELMODRAFT_129166 [Selaginella moellendorffii]
Length=904

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/777 (50%), Positives = 527/777 (68%), Gaps = 31/777 (4%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM+CGGCAASVKRILESQ +V+SA+VNL TETAV+    ++    N  +++ E LA HL
Sbjct  130   GGMSCGGCAASVKRILESQVQVASATVNLATETAVIHVKQDSPAASN--REIAEHLANHL  187

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQAS-GRGLAVSWALCAVCLVGHLSHFFG  2790
             T+CGFK++VR+   ++  +   K+   ++ +L+ S GR LA +W L ++ LVGH SHF G
Sbjct  188   TTCGFKSSVREQGSQSRLQAAYKRKEERKVRLKDSAGRRLAAAWTLFSLSLVGHASHF-G  246

Query  2789  AK--ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFA  2616
              K    W+H  HS  F MS+C+F+L+ PGR L++DG KS  + +PNMNTLVGLGA+SSFA
Sbjct  247   LKYFPPWLHFFHSVSFQMSLCVFSLVGPGRSLLLDGWKSFRRRSPNMNTLVGLGAVSSFA  306

Query  2615  VSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVV  2436
             VS +AA  PKLGW +FFEEPVML+AFVLLGR +E+RAK+KA+SDM  LL +LP  ARLV+
Sbjct  307   VSVIAALYPKLGWSSFFEEPVMLLAFVLLGRAVEERAKVKASSDMESLLGLLPKNARLVM  366

Query  2435  NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKL  2256
                + E  STV+VPC ++ +GD+++VLPGD IP DGIV+ GRSTVDESS TGEPLP+ K 
Sbjct  367   GKSLDEVPSTVDVPCDSIVLGDRVMVLPGDIIPVDGIVKEGRSTVDESSLTGEPLPILKK  426

Query  2255  PGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYG  2076
              G +V AG++N NG++ VE  R G ET +GDIVR+VE AQ REAP+QRLADKVSG F Y 
Sbjct  427   SGDEVNAGTVNHNGVILVEAVRSGDETVVGDIVRMVENAQLREAPIQRLADKVSGKFCYA  486

Query  2075  VMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVg  1896
             VMALS AT  FW++ G ++ P+ +  G    L LQL+C+VLV+ACPCALGLATPTAV+VG
Sbjct  487   VMALSVATLGFWSVLGPKLFPSVIPTGGGLLLGLQLACNVLVIACPCALGLATPTAVLVG  546

Query  1895  tslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDST  1716
             TSLGA  GLL+RGG +LE  S V+ +VFDKTGTLT+GRP V +VV   +           
Sbjct  547   TSLGARNGLLVRGGDILEKASAVDAVVFDKTGTLTLGRPVVVDVVLNKY-----------  595

Query  1715  STCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVI  1536
                 WS+ +VL  A GVE   +HP+ KAIV+ A++        +DG+F +EPGSGA AV+
Sbjct  596   ----WSKEEVLKFAHGVERTASHPLAKAIVQEAENVGSTGALVQDGSFEQEPGSGATAVV  651

Query  1535  EEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHV  1356
             + K+V+VGTLDWV+R G      +   + + ++VV+VG+D  +A  I + D++R+DA   
Sbjct  652   DGKRVTVGTLDWVQRFGTVGEPPRLLGNPEGRTVVFVGLDNSIAAAITLVDEIRDDAAET  711

Query  1355  VESLSKQGIT-TYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVV  1179
             V +L    IT TY  +    N  E++ASV     + +     P+ KS     L     + 
Sbjct  712   VRAL----ITFTYPFTASFLN-WEHLASV---DSQRLGRARGPNNKSHRSLLLCVISTLT  763

Query  1178  AM-VGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTV  1002
             A  +  GI+      S    ++  GG+ +    S  +++     Q++DALELSR   + +
Sbjct  764   APGLTPGISTTITYESGRFHMSKKGGMTSKKMDSDFLIVLKIWFQVVDALELSRRIQRKI  823

Query  1001  KQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKF  831
             KQNL WAF YNI+GLP+AAG L+P T  MLTPS+AGALMGLSS+GV+TNSLLL  ++
Sbjct  824   KQNLCWAFMYNIIGLPIAAGALVPATRVMLTPSLAGALMGLSSLGVVTNSLLLHWEY  880



>ref|XP_001420345.1| P-ATPase family transporter: copper ion; heavy metal transporting 
P-type ATPase-like protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98638.1| P-ATPase family transporter: copper ion; heavy metal transporting 
P-type ATPase-like protein [Ostreococcus lucimarinus CCE9901]
Length=763

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/782 (49%), Positives = 531/782 (68%), Gaps = 47/782 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGCAASV++ILE    V SASVNL  E+A+                    LA+ +T
Sbjct  6     GMHCGGCAASVRKILEGDDAVRSASVNLANESAM--------------------LAELVT  45

Query  2963  SCGFKANVRDSRRENLF-----ETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSH  2799
             + GF  ++RD+    +      E  + K + +  +++ S + + V+WAL + CL+GH+SH
Sbjct  46    AAGFPTSLRDAGGVAVAGVTGAEATKLKRDERLRRIKESTQRVIVAWALASACLLGHVSH  105

Query  2798  FFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSF  2619
             FF A A W+ +LHS   H+++ LF +  PGRQ++IDG +SL +G PNMNTLV LGA++SF
Sbjct  106   FFHASAPWLRVLHSNPVHITLSLFAMAGPGRQILIDGWQSLRRGGPNMNTLVSLGAMASF  165

Query  2618  AVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLV  2439
             ++S+ A  +P LGW  FFEEPVML+AFVLLGR +E+RAK++ATSDM+ LLN++P  ARLV
Sbjct  166   SMSTAAMMLPGLGWPTFFEEPVMLLAFVLLGRAVEERAKLQATSDMSALLNLVPETARLV  225

Query  2438  VNSDM--GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPV  2265
              ++    G++     VP S + V D+IIVLPGDRIP DG V +G STVDE++ TGEP+P 
Sbjct  226   SSTSTANGDEPYYRTVPTSVIEVKDKIIVLPGDRIPIDGTVVSGCSTVDEAAITGEPIPR  285

Query  2264  TKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHF  2085
              K  G  VAAG++N +G+LT+EV   G ET +  IVR+VE AQ REAPVQRLAD+VSG F
Sbjct  286   PKKAGDTVAAGTVNCDGVLTIEVVSSGEETQVAGIVRMVESAQQREAPVQRLADQVSGKF  345

Query  2084  TYGVMALSAATFMFWNLFGTRVLPATLHQGslas-----lalqlscsvlvvaCPCALGLA  1920
              YGVMA SAATF FW+  GT+V P  L   + A+     +ALQ++ SVLVVACPCALGLA
Sbjct  346   VYGVMAASAATFTFWSTVGTKVFPGVLATAASATNAPILIALQMTASVLVVACPCALGLA  405

Query  1919  TPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDE  1740
             TPTAV+VGT+LGA  GLL+RGG +LE  + ++T++FDKTGTLTIG+P +TE    G    
Sbjct  406   TPTAVLVGTALGARHGLLIRGGDILEKANNLDTVIFDKTGTLTIGKPVLTETRTSGG---  462

Query  1739  TNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEP  1560
                         +S+ +++ LA  VE N  HP+  AI EAA  +       ++GTF +EP
Sbjct  463   ------------FSDAEIIALAGAVERNCRHPLALAITEAADKQGIPRHSVDEGTFKQEP  510

Query  1559  GSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQ  1380
             G+GA AV+ +K VSVGT  +++ +      +    D   ++ VYVG+DG + G++ ++D+
Sbjct  511   GAGASAVVNKKLVSVGTTFYIQGNNTVPMELINAVDNPGRTPVYVGIDGKIVGVLEMQDE  570

Query  1379  LREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGL  1200
             +R+DA   ++ L  + I T ++SGD+   A+ V  +VGI  + V+  V+P+ K++ V   
Sbjct  571   IRKDAAETIKRLHAKNIQTIMISGDRLETAQAVGKLVGIDEKYVYGDVRPEGKAELVQDF  630

Query  1199  QKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSR  1020
             Q   K VAMVGDGINDAAALA + +G+A+ GGVGAAS+V+S+VL+ +RL Q+ DA++LSR
Sbjct  631   QSKGKCVAMVGDGINDAAALAQADIGIAMAGGVGAASEVASIVLLGDRLPQVGDAIDLSR  690

Query  1019  LTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLR  840
              T   +KQNL WAFGYN++G+P+AAG LLP  G  LTPS+AGA+MG SS+GVM NSLLL+
Sbjct  691   ATFNKIKQNLCWAFGYNLIGIPIAAGALLPAYGLSLTPSVAGAIMGFSSLGVMGNSLLLK  750

Query  839   LK  834
             LK
Sbjct  751   LK  752



>ref|XP_003082050.1| putative potential copper-transporting ATPase (ISS) [Ostreococcus 
tauri]
 emb|CAL55853.1| P-type ATPase, phosphorylation site [Ostreococcus tauri]
Length=861

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/793 (48%), Positives = 532/793 (67%), Gaps = 38/793 (5%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEA---------KVVPNWQQQL  2991
             GM CG CAA V++ILE    V +ASVNL  E+AVV    +            +    + +
Sbjct  70    GMHCGSCAARVRKILEGHGDVRTASVNLANESAVVRVTLDVPQVAGSDFENAIKEAAKLV  129

Query  2990  GEELAKHLTSCGFKANVRDSRRENLF-----ETFEKKMNAKRAQLQASGRGLAVSWALCA  2826
             G +LA  +T+ GF  ++RD+    +      E    K   +  +++ S + + V+WAL +
Sbjct  130   GTKLAALVTAAGFPTSLRDAGGVAVAGVTGAEAARIKREERLKRIKESTQRVIVAWALAS  189

Query  2825  VCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTL  2646
              CL+GHLSHFF + A W+ +LHS   H+++ +F +  PGRQ+++DG +SL +G PNMNTL
Sbjct  190   ACLLGHLSHFFHSSAPWLRVLHSNPVHITLSIFAMAGPGRQILVDGWQSLRRGGPNMNTL  249

Query  2645  VGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLN  2466
             V LGA++SF++S+ A  +P LGW  FFEEPVML+AFVLLGR +E+RAK++ATSDM+ LLN
Sbjct  250   VSLGAIASFSMSTAAMLLPSLGWPTFFEEPVMLLAFVLLGRAVEERAKLQATSDMSALLN  309

Query  2465  VLPSKARLV--VNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDES  2292
             ++P  ARLV    S   +Q     VP S +   D+IIVLPGDRIP DG V +G STVDE+
Sbjct  310   LVPETARLVSTTGSADSDQPYYRTVPTSVIGPKDKIIVLPGDRIPIDGTVVSGCSTVDEA  369

Query  2291  SFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQR  2112
             + TGEP+P  K  G  V+AG++N +G+LT+EV   G ET +  IVR+VE AQ REAPVQR
Sbjct  370   AITGEPIPRPKSMGDSVSAGTVNCDGVLTIEVVSSGDETQVAGIVRMVESAQQREAPVQR  429

Query  2111  LADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslasl-----alqlscsvlvv  1947
             LAD+VSG F YGVMA SA TF FW+  GT++ P+ L   + A+      ALQ++ SVLVV
Sbjct  430   LADQVSGKFVYGVMAASAVTFTFWSTVGTKLFPSVLATAATAANAPILIALQMTASVLVV  489

Query  1946  aCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTE  1767
             ACPCALGLATPTAV+VGTS+GA  GLL+RGG +LE  S ++T++FDKTGTLTIG+P +T 
Sbjct  490   ACPCALGLATPTAVLVGTSVGARHGLLIRGGDILEKASSLDTVIFDKTGTLTIGKPVLT-  548

Query  1766  VVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKA  1587
                           D+ +   +++ +++ LA  VE N  HP+  AI +AA     +    
Sbjct  549   --------------DTRAVAGFNDDEIIALAGAVERNCRHPLALAISDAADKGGLQRYDV  594

Query  1586  EDGTFIEEPGSGAMAVIEEKKVSVGTLDWV--RRHGVGETRVQEFDDFKNQSVVYVGVDG  1413
             E+GTFI+ PG+GA A++ ++ VSVGT  +V   +H      +   +D   ++ V+VG+DG
Sbjct  595   EEGTFIQVPGAGAKAMVNKRLVSVGTKAFVEDEKHQDVPAELLNSNDNPGRTPVFVGIDG  654

Query  1412  VLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVK  1233
              + G++ +ED++R+DA   ++ L  + I T ++SGD+   A+ V  +VGI    +F GVK
Sbjct  655   KIVGVLEMEDEIRKDAMDTIKRLHDKNIQTIMISGDRLETAQAVGKLVGIDERFIFGGVK  714

Query  1232  PDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRL  1053
             P  K++ V   Q++ K VAMVGDGINDAAALA + VG+A+  GVGAAS+V+S+VL+ +RL
Sbjct  715   PAGKAELVEEFQREGKRVAMVGDGINDAAALAQADVGIAMASGVGAASEVASIVLLGDRL  774

Query  1052  SQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSS  873
              Q+ DA++LSR T+  +KQNL WAFGYN+VG+P+AAG LLP  G  LTPS+AGA+MG SS
Sbjct  775   PQVSDAIDLSRATLNKIKQNLGWAFGYNLVGIPIAAGALLPAYGLSLTPSVAGAIMGFSS  834

Query  872   IGVMTNSLLLRLK  834
             +GVM NSLLLR+K
Sbjct  835   LGVMGNSLLLRMK  847



>ref|XP_007201115.1| hypothetical protein PRUPE_ppa022526mg [Prunus persica]
 gb|EMJ02314.1| hypothetical protein PRUPE_ppa022526mg [Prunus persica]
Length=501

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/370 (81%), Positives = 335/370 (91%), Gaps = 0/370 (0%)
 Frame = -2

Query  3209  VIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPV  3030
             V+AA  ++ S VS+DVI+LDVGGMTCGGCAASVKRILESQP+VSSASVNLTTETAVVWPV
Sbjct  123   VVAAGCDEISAVSTDVIVLDVGGMTCGGCAASVKRILESQPQVSSASVNLTTETAVVWPV  182

Query  3029  SEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGL  2850
             SEAKV PNWQ+QLGE LAKHLT+CGFK+N+RDS R+N  + FE+KM  KR +L+ SG  L
Sbjct  183   SEAKVTPNWQKQLGETLAKHLTNCGFKSNLRDSGRDNFLKVFERKMEEKRKRLKESGNEL  242

Query  2849  AVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLK  2670
             A SWALCAVCLVGHLSHFFGAK SWIH LHSTGFH+S+CLFTLL PGR+LIIDGL+SL++
Sbjct  243   AFSWALCAVCLVGHLSHFFGAKVSWIHALHSTGFHLSLCLFTLLGPGRRLIIDGLRSLVR  302

Query  2669  GAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKAT  2490
             GAPNMNTLVGLGALSSF VSS+AAFIPKLGWK FFEEP+MLIAFVLLGRNLEQRAKIKAT
Sbjct  303   GAPNMNTLVGLGALSSFTVSSIAAFIPKLGWKTFFEEPIMLIAFVLLGRNLEQRAKIKAT  362

Query  2489  SDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGR  2310
             SDMT LL+++PSKARL+VN    E  S VEVP ++LSVGDQI+VLPG+R+P DGIV+AGR
Sbjct  363   SDMTELLSIIPSKARLLVNDGAKELESIVEVPSNSLSVGDQIVVLPGERVPVDGIVKAGR  422

Query  2309  STVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSR  2130
             S +DESSFTGEPLPVTKLPG+QVAAGSINLNG LTVEVQRPGGETA+ DIVRLVEEAQSR
Sbjct  423   SIIDESSFTGEPLPVTKLPGSQVAAGSINLNGTLTVEVQRPGGETAMADIVRLVEEAQSR  482

Query  2129  EAPVQRLADK  2100
             EAPVQRLADK
Sbjct  483   EAPVQRLADK  492



>gb|EEC83773.1| hypothetical protein OsI_29667 [Oryza sativa Indica Group]
Length=918

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/520 (69%), Positives = 438/520 (84%), Gaps = 4/520 (1%)
 Frame = -2

Query  2348  DRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAI  2169
             DR+PADG+V++GRSTVDESS TGEP+PVTK+ G +V+AGSINLNG +TVEV+RPGGETA+
Sbjct  383   DRVPADGVVKSGRSTVDESSLTGEPMPVTKIAGTEVSAGSINLNGKITVEVRRPGGETAM  442

Query  2168  GDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGsl  1989
              DI+RLVEEAQ+REAPVQRLADKV+G+FTYGVMALSAAT+ FW++FG++++PA +  GS 
Sbjct  443   SDILRLVEEAQTREAPVQRLADKVAGNFTYGVMALSAATYTFWSIFGSQLVPAAIQHGSA  502

Query  1988  aslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFD  1809
              +LALQLSCSVLV+ACPCALGLATPTAV+VGTSLGATRGLLLRGG +LE FS V+ IVFD
Sbjct  503   MALALQLSCSVLVIACPCALGLATPTAVLVGTSLGATRGLLLRGGDILEKFSEVDAIVFD  562

Query  1808  KTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAI  1629
             KTGTLTIG+P VT+V+      + N K DS +  EW+  ++L+LA+GVESNT HP+GKAI
Sbjct  563   KTGTLTIGKPVVTKVIASHREGDENTK-DSCNN-EWTG-EILSLAAGVESNTTHPLGKAI  619

Query  1628  VEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDF  1449
             +EAA++ NC  ++A+DG+F+EEPGSGA+A I EK+VSVGTLDW+RRHGV      + ++F
Sbjct  620   MEAAQAANCLYLQAKDGSFMEEPGSGAVATIGEKQVSVGTLDWIRRHGVLHNPFADGENF  679

Query  1448  KNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVV  1269
               QSV YV VDG LAGLI  ED+LRED+  +++ LSKQGI+ Y+LSGDKK+AA  VAS+V
Sbjct  680   -GQSVAYVAVDGTLAGLICFEDKLREDSHQIIDILSKQGISVYMLSGDKKSAAMNVASLV  738

Query  1268  GIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaas  1089
             GI  + V   VKP EK  F+S LQK+ K+VAMVGDGINDAAALAS+ VG+A+GGGVGAAS
Sbjct  739   GIQADKVIAEVKPHEKKSFISELQKEHKLVAMVGDGINDAAALASADVGIAMGGGVGAAS  798

Query  1088  dvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLT  909
             DVSSVVLM NRLSQL+DALELS+ TM+TVKQNLWWAF YNIVGLP+AAG LLP TGT+LT
Sbjct  799   DVSSVVLMGNRLSQLVDALELSKETMRTVKQNLWWAFLYNIVGLPIAAGALLPVTGTVLT  858

Query  908   PSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQGPSVTI  789
             PSIAGALMG SS+GVM NSL LR++ +S+Q+ I  P  TI
Sbjct  859   PSIAGALMGFSSVGVMANSLFLRMRLSSRQQPIHKPQATI  898


 Score =   126 bits (317),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 94/132 (71%), Gaps = 2/132 (2%)
 Frame = -2

Query  3200  AAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEA  3021
             A  E+AS   +DVIILDVGGM+CGGCAASVKRILES+P+V SA+VNL TE AVVW V E 
Sbjct  141   AVAEEASGQEADVIILDVGGMSCGGCAASVKRILESEPQVRSANVNLATEMAVVWAVPED  200

Query  3020  KVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVS  2841
             +   NW+ QLGE+LA  LT+CG+K+N+RDS + +    FE+KM+ K  QL+ S  GL V 
Sbjct  201   EDAKNWKLQLGEKLANQLTTCGYKSNLRDSSKASSQTVFERKMDEKLQQLKQS--GLLVC  258

Query  2840  WALCAVCLVGHL  2805
             +       +G+L
Sbjct  259   FVFIPFIFIGNL  270



>ref|XP_002508977.1| p-type ATPase superfamily [Micromonas sp. RCC299]
 gb|ACO70235.1| p-type ATPase superfamily [Micromonas sp. RCC299]
Length=866

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/821 (48%), Positives = 527/821 (64%), Gaps = 65/821 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVW-----PVSE-----AKVVPNWQQQ  2994
             GM CGGCAA+V+R LE+   V SASVNL  E+A+V      P ++     A    N++ +
Sbjct  53    GMHCGGCAANVRRTLEADGSVVSASVNLANESALVRIGVDVPATDEGLTRADTFTNFEDK  112

Query  2993  L-------GEELAKHLTSCGFKANVRDS---RRENLFET---FEKKMNAKRAQLQASGRG  2853
             +       GE+LA  +T  GF  +VR++      N+  T     K+ +  R +++ S + 
Sbjct  113   VVTAVRAVGEKLASAVTERGFPTSVREACGVAVSNVSATDAALSKREDRLR-RIRESTKR  171

Query  2852  LAVSWALCAVCLVGHLSHFFGA--KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKS  2679
             + V+WAL A CL+GH +H        +++ +  ST  H  + +F +L PGR++ +DG  S
Sbjct  172   VVVAWALAATCLIGHAAHMLQGCCPPAFLKVFCSTPVHAGLSVFAMLGPGREIFVDGWNS  231

Query  2678  LLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKI  2499
             L  G PNMNTLV LGAL+SF +S+ A  +PKLGW  FFEEPVML+AFVLLGR +E+RAK+
Sbjct  232   LKSGGPNMNTLVSLGALASFGMSTAAVMLPKLGWPTFFEEPVMLLAFVLLGRAVEERAKL  291

Query  2498  KATSDMTGLLNVLPSKARLVVN-----SDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPA  2334
             +ATSDM+ LLN+LP  ARLV        + GE   TV  P + +   D I+VLPGDRIP 
Sbjct  292   RATSDMSALLNLLPPTARLVPKGVDEVKEGGEYYRTV--PTAVIRPEDTILVLPGDRIPV  349

Query  2333  DGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVR  2154
             DG+V  G S VDE++  GEP+P  K  G +V+AG++N +G +TV V   G ET +  IVR
Sbjct  350   DGVVVKGVSQVDEAAINGEPIPRAKRVGDEVSAGTVNCDGAITVRVLSSGEETQVAGIVR  409

Query  2153  LVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslaslal  1974
             +VE AQ REAPVQRLAD+VSG FTYGVM +SAATF FW+  GT++ P  L   +      
Sbjct  410   MVEAAQQREAPVQRLADEVSGKFTYGVMGVSAATFAFWSTIGTKIFPKVLASAAATGANA  469

Query  1973  ------qlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVF  1812
                   Q++ SVLVVACPCALGLATPTAV+VGTSLGA  GLL+RGG VLE    ++T+VF
Sbjct  470   PLLLGLQMAASVLVVACPCALGLATPTAVLVGTSLGARHGLLIRGGDVLERTHELDTVVF  529

Query  1811  DKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKA  1632
             DKTGTLT+GRP V +V          A RD        E DV+  A+ VE N+ HP+  A
Sbjct  530   DKTGTLTVGRPVVRKV----------AVRDG-----LKEADVIASAAAVEKNSRHPLALA  574

Query  1631  IVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVR-RHGVGETRVQEFD  1455
             +V AA      +   +DG+F +EPG+GA+  +  + V VGTL +V      G T   E  
Sbjct  575   VVAAAPGAVPDV---DDGSFRQEPGAGAVGAVRGRTVKVGTLAFVTGGESAGVTIPPEVA  631

Query  1454  DFKNQS-----VVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAA  1290
                + S      V+V +DG++AG++ +ED++R DA   V  L ++G+ T LLSGD++  A
Sbjct  632   SIASNSNPGRTPVFVAIDGIVAGVLEMEDEVRADAASAVARLQRRGLRTVLLSGDRQETA  691

Query  1289  EYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaig  1110
             E V   +GI RE+++  V+P+ K++ V  LQK    VAMVGDGINDAAALA + VGVA+ 
Sbjct  692   ESVGMSLGIAREDIYGDVRPEGKAQLVEKLQKGGATVAMVGDGINDAAALAQADVGVAMA  751

Query  1109  ggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLP  930
             GGVGAAS+V+S+VL+ +  SQ++D++ELS+ T   +KQNL WAF YN VG+P+AAG LLP
Sbjct  752   GGVGAASEVASIVLLGDSPSQVVDSIELSKATFAKIKQNLGWAFAYNAVGIPIAAGALLP  811

Query  929   FTGTMLTPSIAGALMGLSSIGVMTNSLLLRL--KFASKQKE  813
             FTG  LTPS+AG LMG SSIGVM NSLLL+L  K  SK  E
Sbjct  812   FTGLALTPSVAGGLMGFSSIGVMANSLLLQLTGKKLSKMPE  852



>ref|XP_002954184.1| hypothetical protein VOLCADRAFT_64450 [Volvox carteri f. nagariensis]
 gb|EFJ44901.1| hypothetical protein VOLCADRAFT_64450 [Volvox carteri f. nagariensis]
Length=1028

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/793 (50%), Positives = 526/793 (66%), Gaps = 29/793 (4%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWP-VSEAKVVPNWQQQLGEELAKH  2970
             GGM CGGC   VK+ILESQP V +ASVNLTTETA+V   V  +         LGE+L + 
Sbjct  134   GGMKCGGCVGHVKKILESQPGVIAASVNLTTETALVRVLVPRSSSGAAALAALGEKLTQA  193

Query  2969  LTSCGFKANVRD--SRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHF  2796
             LT+ GF +  RD  +    L      K  AK A+L+A+   L  +W L AVC + HL+H 
Sbjct  194   LTAAGFPSKPRDPSTSSSALAAALAAKRAAKVARLRAATLDLLTAWGLAAVCGLSHLAHA  253

Query  2795  FGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFA  2616
               +  +W+H  HS   + ++ +  LL PGR++++ GLK+L  G P+MNTLVGLGA +SF 
Sbjct  254   LPSAPAWMHTFHSVPLNAALSVAALLGPGREILVSGLKALAAGRPDMNTLVGLGAGASFG  313

Query  2615  VSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVV  2436
             VS +AA +PKLGWK FFEEP ML+ FVL+GR LE+RAK++A++DM  L  ++P++ARL++
Sbjct  314   VSCVAAALPKLGWKTFFEEPAMLLGFVLIGRALEERAKLQASADMAALQELVPTRARLLL  373

Query  2435  NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKL  2256
             +   G      EVP   +  GD ++VLPGDR+P DG+V  GRS+VDES+ TGEPLP+TK 
Sbjct  374   S---GGGDKHAEVPAEAVGPGDLLLVLPGDRVPVDGVVVGGRSSVDESALTGEPLPLTKA  430

Query  2255  PGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYG  2076
             PG +VAAG++N +G LTV  +  G +T I DIVRLVE AQ+R AP+QRLAD V+G F YG
Sbjct  431   PGDRVAAGTVNCDGALTVRAEHSGQQTVIADIVRLVEVAQARTAPIQRLADTVAGKFAYG  490

Query  2075  VMALSAATFMFWNLFGTRVLPATLH-QGslaslalqlscsvlvvaCPCALGLATPTAVMV  1899
             VM LSAATF FW   GTRVL ++         L+LQ++CSVLV ACPCALGLATPTAV+V
Sbjct  491   VMGLSAATFAFWAAVGTRVLSSSASGPAGALLLSLQMACSVLVTACPCALGLATPTAVLV  550

Query  1898  gtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV---VPQGHNDETNAK  1728
             GTS GA RGLL+RGG +LE+ S V+T+V DKTGTLT+G+P VT V   +P          
Sbjct  551   GTSAGARRGLLIRGGDILEAASHVDTVVLDKTGTLTVGKPQVTHVHSLLPLESLTGPGGG  610

Query  1727  RDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRN----CRIVKAEDGTFIEEP  1560
                +S  +     VL LA+  E  T HP+ +A+V AA   +        +A +G+F++EP
Sbjct  611   GGGSSAAD----AVLQLAAAAERRTTHPVAQALVRAADQLHPPATAAAERACNGSFVQEP  666

Query  1559  GSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDF-----------KNQSVVYVGVDG  1413
             GSG  A +  ++V+VGTL+W++R G                        + S VYV VDG
Sbjct  667   GSGVAATVGGRRVAVGTLEWLQRQGADPPPPPAAAATSIATAAVHGVGNSHSRVYVAVDG  726

Query  1412  VLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVK  1233
              +AG+I V D +R DAR  VE L +QGI T +LSGDK  AA  VAS VGI   +VF  VK
Sbjct  727   AVAGVIDVADAVRPDARETVERLHQQGIRTVMLSGDKSAAAAEVASAVGIAAADVFADVK  786

Query  1232  PDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRL  1053
             P  K   V  L+   +VVAMVGDGIND AALA++ VG+A+GGGV AAS+V+ VVL+ ++L
Sbjct  787   PAGKKAVVEELRAAGRVVAMVGDGINDTAALAAADVGIAMGGGVDAASEVAKVVLLGDQL  846

Query  1052  SQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSS  873
             SQ+ D + L+R T+  + QNL WAFGYN++ +P+AAG+LLP  G  LTPS++GALMG SS
Sbjct  847   SQVADTVHLARRTLAKINQNLMWAFGYNLIAIPLAAGVLLPTAGICLTPSVSGALMGFSS  906

Query  872   IGVMTNSLLLRLK  834
             + V++NSLLL+L+
Sbjct  907   LAVVSNSLLLQLE  919



>ref|XP_003061782.1| p-type ATPase superfamily [Micromonas pusilla CCMP1545]
 gb|EEH54412.1| p-type ATPase superfamily [Micromonas pusilla CCMP1545]
Length=1061

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/828 (47%), Positives = 519/828 (63%), Gaps = 69/828 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVV--------------WPVSEAKVVPN  3006
             GM CGGCAA+V+RILE    V +ASVNL  E+A+V                V E KVV  
Sbjct  225   GMHCGGCAANVRRILEEDGNVRAASVNLANESALVRVGVDVGDDGNGPPGAVFEDKVV-R  283

Query  3005  WQQQLGEELAKHLTSCGFKANVRDS-----RRENLFETFEKKMNAKRAQLQASGRGLAVS  2841
               +++G+ LA+ +T+ GF  +VR++                K   +  +++ S + + V+
Sbjct  284   AVRKIGDALAELVTAKGFPTSVREACGVAVSGVTAAAAASSKREERLRRIEESTKRVVVA  343

Query  2840  WALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAP  2661
             WAL   CL+GH SH F A A W+ +  ST  H  + +F LL PGR+ + DG ++L  G P
Sbjct  344   WALAGACLIGHASHMFHASAPWLRVFCSTPVHAGLSVFALLGPGRETLTDGWRALRAGGP  403

Query  2660  NMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDM  2481
             NMNTLV LGAL+SF +S+ A  +P+L W  FFEEPVML+AFVLLGR +E+RAK++ATSDM
Sbjct  404   NMNTLVSLGALASFGMSTAAVLLPRLRWPTFFEEPVMLLAFVLLGRAVEERAKLRATSDM  463

Query  2480  TGLLNVLPSKARLV-VNSDMGEQTSTVE-----------VPCSNLSVGDQIIVLPGDRIP  2337
             + LLN+LP  ARLV   +  G+                 VP S +  GD I+VLPGDR+P
Sbjct  464   SALLNLLPPTARLVPAGTADGKDGRGGGGGGGGGEYYRTVPTSVIQPGDHIVVLPGDRVP  523

Query  2336  ADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIV  2157
              DG+V  G S VDE++  GEP+P  K  G  VAAG++NL+G + V+V   G ET+I  IV
Sbjct  524   VDGVVVEGASQVDEAAINGEPIPRAKRAGDDVAAGTVNLDGAIVVKVINSGEETSIAGIV  583

Query  2156  RLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslasla  1977
             R+VE AQ REAPVQRLAD++SG F YGVM  SAATF FW+  GT++ PATL    +A   
Sbjct  584   RMVEAAQQREAPVQRLADEISGKFVYGVMGASAATFAFWSTVGTKLFPATLASAVVAGAN  643

Query  1976  ------lqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIV  1815
                   LQL+ SVLVVACPCALGLATPTAV+VGTSLGA  GLL+RGG VLE  + V+ +V
Sbjct  644   GPLLLGLQLAASVLVVACPCALGLATPTAVLVGTSLGARHGLLIRGGDVLERANEVDAVV  703

Query  1814  FDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHP---  1644
             FDKTGTLT+GRP V  V+             +T   + SE DVL LA+ VE N  HP   
Sbjct  704   FDKTGTLTLGRPVVKRVI-------------TTEGGDLSEDDVLALAAAVEKNCRHPLAL  750

Query  1643  -------IGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHG  1485
                       A  +    R  R  + E+G+F + PGSGA AV++ K V+VGT  +     
Sbjct  751   AVVAADAAANANDDGGAKRRRRRREPEEGSFEQTPGSGATAVVDGKTVAVGTRAFAATSS  810

Query  1484  VG-ETRVQEFDDF--KNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLL  1314
                   VQ   D     ++ V+V VDG + G++ +EDQ+R DA+  +  L K+G+   LL
Sbjct  811   APLPADVQRAMDAVSPGRTPVFVSVDGAVVGVMEMEDQIRADAKSTIARLKKRGMRALLL  870

Query  1313  SGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQ---KVVAMVGDGINDAAA  1143
             SGD++  AE V + +GI  E+++  V+P+ K+  +  LQ      + VAMVGDGINDAAA
Sbjct  871   SGDRQETAESVGAAIGIAPEDIYGDVRPEGKAALIERLQSAAGGGRKVAMVGDGINDAAA  930

Query  1142  LasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIV  963
             LA + VG+A+GGGVGAAS+V+S+VL+ +  +Q+ DA+ELS+ T   +KQNL WAF YN+V
Sbjct  931   LAMADVGIAMGGGVGAASEVASIVLLGDNPAQVCDAIELSKATFAKIKQNLGWAFAYNLV  990

Query  962   GLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQ  819
             G+P+AAG LLP  G  LTPS+AG LMG SS+GVM NSL L+L  ASK+
Sbjct  991   GIPIAAGALLPAMGVALTPSVAGGLMGFSSLGVMANSLALQL--ASKR  1036



>ref|XP_007509526.1| copper-translocating P-type ATPase [Bathycoccus prasinos]
 emb|CCO19329.1| copper-translocating P-type ATPase [Bathycoccus prasinos]
Length=923

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/849 (43%), Positives = 536/849 (63%), Gaps = 89/849 (10%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVW--------PVSEAKV---------  3015
             GM CGGCAA+V+++LE+   V SA+VNL  E+AVV          + EA+          
Sbjct  89    GMHCGGCAANVRKVLENVASVQSANVNLANESAVVRIAVRLDEKDLQEARSAGVRNAPDS  148

Query  3014  -------------------------VPNWQQQLGEELAKHLTSCGFKANVRDS-------  2931
                                      + N  +  G++LA+ +T+ GF   +RD+       
Sbjct  149   SSSSSAAASVEVVSGDVGVQIMIASIKNKAKIEGDKLAELVTASGFPTTLRDNSSSDESS  208

Query  2930  -RRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHST  2754
                +   +  ++K   +  +++ S + +A++W L +VC++GH +H+   K   +  L  T
Sbjct  209   GEYDQGMQRAKEKREERIKRIRESTKKVALAWGLASVCILGHAAHYL--KIHSLGFLCKT  266

Query  2753  GFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWK  2574
               H+++ LF ++ PGR ++ DG  +  +G PNMN+LV +GA++SF +SS+AA +PKL W 
Sbjct  267   QTHVALSLFAMVGPGRDILTDGFNAFRRGGPNMNSLVSMGAIASFGMSSVAALVPKLMWP  326

Query  2573  AFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVE--  2400
              FFEEPVML+AFVLLGR +E RAK+KA+SDM+ L+N++PS  RL+V+       S +   
Sbjct  327   TFFEEPVMLLAFVLLGRAVEDRAKLKASSDMSDLMNLVPSTCRLLVSESSSSSKSPLSKM  386

Query  2399  VPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINL  2220
             +    +   D+I++LPGD+IP DG++  G S+VDE++ TGEP+P  K  G  V+AG+IN 
Sbjct  387   ISVEAIKPTDKILILPGDKIPVDGVIVNGTSSVDEAALTGEPIPKAKRKGDLVSAGTINC  446

Query  2219  NGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFW  2040
             +G+LTVEV + G ET +  IVR+VE AQ+R+APVQRLAD +SG FTYGVMA SAATF FW
Sbjct  447   DGVLTVEVSKSGSETTVAGIVRMVESAQNRQAPVQRLADDISGVFTYGVMATSAATFAFW  506

Query  2039  NLFGTRVLPATLHQ--------GslaslalqlscsvlvvaCPCALGLATPTAVMVgtslg  1884
             +  GT++ P+             +   +A QL+ SVLVVACPCALGLATPTAV+VGT+LG
Sbjct  507   STIGTKIFPSVAAALGASAATVNAPVLIAAQLAASVLVVACPCALGLATPTAVLVGTALG  566

Query  1883  atrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCE  1704
             A  GLL+RGG VLE  + ++ IVFDKTGTLT+G+PTV ++               T++  
Sbjct  567   ARNGLLIRGGDVLERANDLDVIVFDKTGTLTVGKPTVEKL---------------TTSNL  611

Query  1703  WSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKK  1524
              SE +VL+LA+ VE N+ HP+  A+ + A     +  +  + +F +EPG GA   +  KK
Sbjct  612   TSEDEVLSLAAAVERNSTHPLAVAVNKRASQNGNKTYECAEDSFKQEPGLGAFGTVNGKK  671

Query  1523  VSVGTLDWVRRHGVGETRVQEFDD-FKN-----QSVVYVGVDGVLAGLIYVEDQLREDAR  1362
             + +GT ++V           E +D FK       + V V VDG +AG+  + D+LR +A+
Sbjct  672   IVIGTKEFVESSLKSSAFPPELEDAFKRSNENGSTTVCVSVDGKMAGVFEIRDKLRSNAK  731

Query  1361  HVVESLSK---QGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKD  1191
               +E L K   +     +LSGD++  A+ +A  +GI  +NV+  V+P++K++FV  LQK 
Sbjct  732   MTIERLRKSKNKNFEIIILSGDRQETADAIAKSIGIDPKNVYGNVRPEQKAEFVENLQKS  791

Query  1190  QKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTM  1011
              K VAMVGDGIND AALA+++VG+A+  GVGAAS+V+S+VL+ NRL Q++DA++LS  T 
Sbjct  792   GKCVAMVGDGINDTAALAAANVGIAMASGVGAASEVASIVLLGNRLPQVVDAIDLSAKTF  851

Query  1010  KTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL--  837
               +KQNL WAFGYNIVG+P+AAG LLP  G  LTPS+AGA+MG+SSIGVM NSLLL+L  
Sbjct  852   GKIKQNLAWAFGYNIVGIPIAAGALLPAYGLALTPSVAGAVMGVSSIGVMVNSLLLQLEG  911

Query  836   -KFASKQKE  813
              KF+ ++ E
Sbjct  912   RKFSKEEDE  920



>ref|XP_005645490.1| heavy metal translocatin [Coccomyxa subellipsoidea C-169]
 gb|EIE20946.1| heavy metal translocatin [Coccomyxa subellipsoidea C-169]
Length=885

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/815 (46%), Positives = 506/815 (62%), Gaps = 54/815 (7%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVV-----------WPVSEA--KVVPN  3006
             GGM C  C+  V+R+LE+QP V+SASV+LTTETA+V            P   A      +
Sbjct  84    GGMHCASCSGRVRRLLEAQPHVTSASVSLTTETALVRIGIPALPLTGGPAGGALEAARSS  143

Query  3005  WQQQLGEELAKHLTSCGFKANVRDSRRENLF---ETFEKKMNAKRAQLQASGRGLAVSWA  2835
             +  +    LAK L   GF+A +RD          E    K   +RAQL+ + R L V+  
Sbjct  144   FVAETVAHLAKVLREGGFQAGLRDGASMAAGAADEVVAAKQAERRAQLREATRRLIVAGL  203

Query  2834  LCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNM  2655
             L + C  GH++HFF +   W+ LL +   H  M    LL PGR++++ G +S   G+P+M
Sbjct  204   LASACFTGHIAHFFPSVPGWVRLLGTPQVHGLMSAAALLGPGREVLVAGWRSAAAGSPDM  263

Query  2654  NTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTG  2475
             NTLVGLGA ++F VS +AA +P LGW+ FFEEP ML+  VLLGR LE+RAK++A++DM  
Sbjct  264   NTLVGLGASAAFGVSCVAAALPALGWRTFFEEPAMLLGVVLLGRTLERRAKLQASADMAA  323

Query  2474  LLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDE  2295
             L  +LP+  RL V +  G  T    VP   +  G  ++VLPGDR+P DG+V  G ST+DE
Sbjct  324   LRGLLPATVRLAVGNRQGWST----VPAEAVQPGALLVVLPGDRLPVDGVVVEGTSTLDE  379

Query  2294  SSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQ  2115
             S+ TGEPLPVT+ PG+ VAAG++N  G +TV   R G  TA+ DIVR VE AQ+R APVQ
Sbjct  380   SALTGEPLPVTRGPGSAVAAGAVNCEGRITVRAVRCGNATAVADIVRAVEAAQARAAPVQ  439

Query  2114  RLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQ---------Gslaslalqlsc  1962
             RLAD V+G F  GV+ LSAATF FW L   R +P  + +         G+   LA QL+C
Sbjct  440   RLADIVAGRFAVGVLGLSAATFAFWALAAPRYMPQVIARHASTAAGGSGAALLLAAQLAC  499

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
             +VLVVACPCALGLA PTAV+VGTS GA RGLL+RGG VLE+ S +++++FDKTGTLT G+
Sbjct  500   NVLVVACPCALGLAAPTAVLVGTSQGARRGLLIRGGDVLEAASRIDSVIFDKTGTLTRGQ  559

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P VTEV                  C      VL+LA+ +E  ++HPI +AI EAA +   
Sbjct  560   PVVTEV-------------QLAPGCALEPAHVLSLAAALERESSHPIARAITEAASTSGV  606

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRH-----------GVGETRVQEFD  1455
                +AEDG+ ++E G G    ++ ++V++G   WV +H           G G        
Sbjct  607   AEARAEDGSVVQEIGGGITGTVDGRRVALGNWTWVTQHLQEPTPQPPDAGPGMPLRDAHS  666

Query  1454  DFKNQSV-VYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVA  1278
                 Q + V+V VD  LAG++ + D +R +A   V +L ++G  T+LL+GD    AE VA
Sbjct  667   TGAQQKLQVFVAVDKELAGMLSLSDTVRPEAAATVAALQREGFKTFLLTGDGAWNAEAVA  726

Query  1277  SVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvg  1098
               VGIPR  V   VKP  K+  V  LQ   + VAMVGDG+NDA+ALA++ VG+A+GGGV 
Sbjct  727   DAVGIPRSQVHSSVKPGGKAALVRELQARGRCVAMVGDGVNDASALAAADVGIAMGGGVD  786

Query  1097  aasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGT  918
             AAS+ +++VL++++L Q++DAL+LSR T   ++QNL WAF YN + LP+AAG LLP  G 
Sbjct  787   AASEAAAIVLLRDQLPQVVDALQLSRRTFSKIRQNLGWAFAYNAISLPLAAGALLPGLGI  846

Query  917   MLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
              LTPSI+GALMG SS+ VM NSLLL+  F S  K+
Sbjct  847   ALTPSISGALMGCSSLAVMANSLLLQRDFPSLVKK  881



>ref|XP_010937451.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=486

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/454 (73%), Positives = 396/454 (87%), Gaps = 4/454 (1%)
 Frame = -2

Query  2171  IGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGs  1992
             +GDIVRLVEEAQ+REAPVQRLADKV+GHFTYGVMA SAATFMFW+LFG+R++PA +HQGS
Sbjct  1     MGDIVRLVEEAQTREAPVQRLADKVAGHFTYGVMAFSAATFMFWSLFGSRLVPAAIHQGS  60

Query  1991  laslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVF  1812
               SLALQLSCSVLVVACPCALGLATPTAV+VGTSLGATRGLLLRGG+VLE F+ V+T+VF
Sbjct  61    PLSLALQLSCSVLVVACPCALGLATPTAVLVGTSLGATRGLLLRGGNVLEKFAEVDTVVF  120

Query  1811  DKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKA  1632
             DKTGTLTIG+P VT+++   ++ + ++K  ++   +W+EVD+L LA+GVESNTNHP+GKA
Sbjct  121   DKTGTLTIGKPVVTKIIASQNDGDWDSK--NSFDYKWTEVDILRLAAGVESNTNHPVGKA  178

Query  1631  IVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDD  1452
             IVEAA + +C  VKA DGTF EEPGSGA+A +E KKV+VGTL W+RRHGV      + + 
Sbjct  179   IVEAASAASCLNVKATDGTFREEPGSGAVATVENKKVAVGTLSWLRRHGVVHNPFPDAE-  237

Query  1451  FKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASV  1272
             F +QSVVYVGVDGVLAG+IY ED+LR+DA  VVE LSKQGI+TY+LSGDK++ AE+VAS+
Sbjct  238   FIDQSVVYVGVDGVLAGIIYFEDKLRDDACEVVEILSKQGISTYMLSGDKRSTAEHVASM  297

Query  1271  VGIPRENVFYGVKPDEKSKFVSGLQKDQK-VVAMVGDGINDAAALasshvgvaigggvga  1095
             VGI ++ VF GVKPDEK KF++ LQKDQK VVAMVGDGINDAAALASS +G+A+G GVGA
Sbjct  298   VGIHKDKVFSGVKPDEKKKFIADLQKDQKKVVAMVGDGINDAAALASSDIGIAMGEGVGA  357

Query  1094  asdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTM  915
             ASDVS +VLM NRLSQL+DAL+LS+ TM+TVKQNLWWAF YN+VGLP+AAGILLP TGTM
Sbjct  358   ASDVSCIVLMGNRLSQLIDALDLSKQTMRTVKQNLWWAFAYNMVGLPIAAGILLPVTGTM  417

Query  914   LTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             LTPSIAGALMGLSS+ VMTNSLLLRL+  SK KE
Sbjct  418   LTPSIAGALMGLSSVAVMTNSLLLRLRLGSKHKE  451



>ref|XP_001775850.1| predicted protein [Physcomitrella patens]
 gb|EDQ59389.1| predicted protein [Physcomitrella patens]
Length=893

 Score =   561 bits (1445),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 370/822 (45%), Positives = 517/822 (63%), Gaps = 66/822 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVV-WPVSEAKVVPNWQQQLGEELAKHL  2967
             GM CGGC A V+ +L S+  V +A+VN+ TETA +   V   + V    + L  ELA HL
Sbjct  92    GMMCGGCVARVRNLLTSREFVETAAVNMLTETAAIRCRVGTGRRV----ESLASELATHL  147

Query  2966  TSCGFKANVRDSRRE--NLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             T+CGF + +RD+  E  ++ E  +     ++  L  S   +A +W+L A+C   H  H  
Sbjct  148   TTCGFPSKIRDASVEEGSIGEKRDGIARKRQESLTKSTAQVAFAWSLVALCCGSHAIHLL  207

Query  2792  GAKASWIH-----LLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGAL  2628
              +    +H     LLH+  +  ++   TLL P R L++DGLK++++ +PNMNTLVG+GA 
Sbjct  208   HSLGIHLHGPYLSLLHNPLWKCAIASITLLGPARDLVLDGLKAMVRRSPNMNTLVGIGAS  267

Query  2627  SSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSK  2451
             ++FA+SS++   P L W A FF+EPVML+AFVLLGR+LE RA+ KA+SDM  LL+++PSK
Sbjct  268   AAFAISSISLANPSLNWDASFFDEPVMLLAFVLLGRSLEARARAKASSDMQELLSLVPSK  327

Query  2450  ARLVVNSDM---GEQTS------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVD  2298
             +RL+++ D    G++         ++V    +  GD ++VLPG+ IP DG V +G+S V+
Sbjct  328   SRLILSEDSVGGGDEDDELSDELQLQVETEKIRPGDCVLVLPGESIPVDGRVVSGKSAVE  387

Query  2297  ESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPV  2118
             E+  TGEPLPV K  G  V+AG+IN  G + V+    G ++A+  I++LVEEAQ+REAPV
Sbjct  388   EAMLTGEPLPVPKSKGDSVSAGTINWEGPIKVQAITTGAKSAVASIIKLVEEAQAREAPV  447

Query  2117  QRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscsv  1956
             QR AD ++G F + +MALS +TF FW   GT + P  L        G    L+L+L+  V
Sbjct  448   QRFADAIAGPFAFTIMALSGSTFAFWYFLGTNLYPDVLLNDAAGPDGDALLLSLKLAIDV  507

Query  1955  lvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPT  1776
             LVVACPCALGLATPTAV+VGTSLGA RGLLLRGG VLE  + V+++VFDKTGTLT G P+
Sbjct  508   LVVACPCALGLATPTAVLVGTSLGAKRGLLLRGGDVLERLASVDSVVFDKTGTLTEGCPS  567

Query  1775  VTEVVP-QGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
             V  V   QG                +SE ++L LA+ VE +T HPIG AIV  A+++  +
Sbjct  568   VAGVATVQG----------------FSEEEILGLAAAVEKHTVHPIGSAIVSQAETKGIK  611

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV----RRHGVGETRVQEFDDF------  1449
             I   E    + EPG GA+A ++ +  +VG  +WV    +   + E R  +  +F      
Sbjct  612   ISPTEGQ--LTEPGYGALAEVDGRIAAVGLFEWVCGCCKEDPLTE-RSSQLREFLHERCS  668

Query  1448  -----KNQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAE  1287
                  K+Q+VV+VG++G  + G I V D LR DA+  V +L  +G+ T++LSGDK++AA 
Sbjct  669   TSCFDKSQTVVFVGLEGHGVIGAIAVTDNLRHDAKATVANLKAKGLRTFVLSGDKEDAAA  728

Query  1286  YVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALassh--vgvai  1113
              VAS+VGI +E V  G+KP +K  FV+ L+ +   VAMVGDG+NDA ALA ++  + +  
Sbjct  729   NVASLVGIAKEEVKGGLKPQDKLNFVTQLRNNGAAVAMVGDGVNDAPALACANVGMALKT  788

Query  1112  gggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILL  933
                V AASD +SV+L+ NRLSQ++D +ELSR TM  V QNL WA  YN V LP+AAG LL
Sbjct  789   QARVDAASDAASVILLGNRLSQVIDTIELSRATMNKVYQNLAWALAYNAVSLPLAAGFLL  848

Query  932   PFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQ  807
             P     LTPSIAG +M +SSI V+TNSLLLR        EI+
Sbjct  849   PSQDFALTPSIAGGMMAMSSIIVVTNSLLLRFHCFPSLAEIK  890



>ref|WP_011611218.1| ATPase [Trichodesmium erythraeum]
 ref|YP_721315.1| heavy metal translocating P-type ATPase [Trichodesmium erythraeum 
IMS101]
 gb|ABG50842.1| heavy metal translocating P-type ATPase [Trichodesmium erythraeum 
IMS101]
Length=773

 Score =   553 bits (1426),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 336/779 (43%), Positives = 488/779 (63%), Gaps = 45/779 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L  Q  V SA VNL TE A V    + ++ PN        LA+ LT
Sbjct  25    GMKCAGCVKAVERQLNQQIGVISARVNLATEVATV-ECEKDQIDPNI-------LAQKLT  76

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF    R    +N     +K+    R +++     +A++  L  +  +GHL HF G++
Sbjct  77    DNGFPTQPRLDNSKNY--AAQKQTERHRQEIKQQIWRIAIASLLLILSSIGHLGHFIGSE  134

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +L +  FH  +    LLVPGR++IIDG +SL + APNMNTLVGLGA++++  S +
Sbjct  135   ---IPILGNIWFHAVLASLALLVPGREIIIDGARSLSRNAPNMNTLVGLGAVTAYTTSIV  191

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A  +P+LGW+ FF+EPVM++ F+LLG+ LEQ+A+ +A S +  L+ + P+ ARLV     
Sbjct  192   ALLVPELGWECFFDEPVMILGFILLGKTLEQQARYRAASTLHSLIALQPATARLVSAPKC  251

Query  2423  GEQTST-VEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
                +S  +E+P S + VG+ + VLPG++ P DG +  G++TVDES  TGE +PV K  G+
Sbjct  252   NNNSSEPLEIPASQVKVGEYLQVLPGEKFPVDGKICDGKTTVDESMLTGESIPVVKEFGS  311

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
              VAAG+IN +  + ++    G ET +  I++LVE AQ+R+AP+Q LAD V+G+FTYGVM 
Sbjct  312   NVAAGTINKSSTIVMQTTHTGSETTLAQIIKLVETAQTRKAPIQNLADTVAGYFTYGVMT  371

Query  2066  LSAATFMFWNLFGT----RVLPATLHQGslaslal------qlscsvlvvaCPCALGLAT  1917
             ++A TF+FW   GT     VL  + HQG +           +L+ +VLV+ACPCALGLAT
Sbjct  372   IAAITFLFWYFVGTNIWSEVLQTSSHQGIMTYSTSPLLLSLKLAIAVLVIACPCALGLAT  431

Query  1916  PTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDET  1737
             PTA++VG+S+GA RGLL++GG VLE    ++TIVFDKTGTLT G PTVT +V  G+N E 
Sbjct  432   PTAILVGSSVGAQRGLLIKGGDVLEKVHELDTIVFDKTGTLTTGHPTVTNIV--GNNPEL  489

Query  1736  NAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPG  1557
                             +L +A+ VES T+HP+ +AI++ A+  N  ++ A D  F  EPG
Sbjct  490   ----------------LLRVAATVESGTSHPLAEAILQKAQEENVELLSATD--FYTEPG  531

Query  1556  SGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQL  1377
              GA A+++ K   VG L+W++ + +     +      +++ VYV  D  L GLI V D L
Sbjct  532   LGASAIVDGKLALVGNLEWLKNYQI-VVEPENVPTLTDKTAVYVSFDRALLGLIEVSDTL  590

Query  1376  REDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQ  1197
             R+DA   V+SL   G+   LL+GD+   A+ +A  +G+  EN+   V P+ K++ ++ LQ
Sbjct  591   RDDALVTVKSLQDVGLKVMLLTGDRACVAKVIAQQLGLTAENMLAEVPPEGKAEAIAALQ  650

Query  1196  KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRL  1017
                + V MVGDGINDA ALA ++VG+ +  G   A + + +VLMQN+L  ++++++LSR 
Sbjct  651   SKGEKVGMVGDGINDAPALAQANVGIGMQTGTDVAMETADIVLMQNKLMDVVESIKLSRA  710

Query  1016  TMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLR  840
             T   ++QNL+WAF YNIVG+PVA G+LLP  G +L PS AGALM  SS+ V+TNSLLLR
Sbjct  711   TFNKIRQNLFWAFAYNIVGIPVAMGVLLPSLGIILNPSAAGALMAFSSVSVVTNSLLLR  769



>ref|WP_017660200.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=783

 Score =   552 bits (1423),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 354/801 (44%), Positives = 489/801 (61%), Gaps = 66/801 (8%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC  +V+R L   P V SA VNL TE A V      +V PN        LA+ L
Sbjct  19    GGMKCAGCVKAVERKLSQIPGVKSACVNLATEMATV-EYEPNRVEPN-------HLAQTL  70

Query  2966  TSCGFKANVRDS---RRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHF  2796
             T  GF +  R +     E+L  T E+  +A R Q Q     L V+ AL  + +VGHL   
Sbjct  71    TEAGFPSQPRTATGLSVEDLEATEERHRDAAREQQQQ----LMVAIALIVLSVVGHL-QM  125

Query  2795  FGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFA  2616
              G  A  I  L + GFH ++    LLVPGR L++DG + L   APNMNTLVGLG  +++ 
Sbjct  126   LGLPA--IPGLSNIGFHFTLATAALLVPGRPLLLDGWRGLTHNAPNMNTLVGLGVTTAYV  183

Query  2615  VSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVV  2436
              S  A   P LGW  FFEEPVML+ FVLLGR+LE+RA+ +A + +  L+ + P   RLV 
Sbjct  184   ASCAALLFPNLGWDCFFEEPVMLLGFVLLGRSLEKRARNRAAASLKSLVGLQPKTVRLVT  243

Query  2435  NSDMGEQ---TSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPV  2265
             N D        S +++P + + VG+ + V  G++IP DG + AG++ ++ES  TGEP+PV
Sbjct  244   NPDKIHHLDGNSLLDLPANQVRVGEFLQVRAGEKIPVDGEIVAGQTAINESMLTGEPMPV  303

Query  2264  TKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHF  2085
              K  G  V  G++N +G + V+ QR G +T +  IVRLV+EAQ+R+APVQRLAD V+G+F
Sbjct  304   LKQVGDTVTTGTLNQSGSIVVQTQRTGKDTTLAHIVRLVQEAQTRKAPVQRLADTVAGYF  363

Query  2084  TYGVMALSAATFMFWNLFGTRVLPATL------------HQ-----Gslaslalqlscsv  1956
             TYG+MA++A TF+FW  FGT   P  L            H+      S   L+L+L+  V
Sbjct  364   TYGIMAIAALTFLFWYGFGTDWFPQVLSVSREFPNLGPVHEMFDRPTSPVLLSLKLTIDV  423

Query  1955  lvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPT  1776
             L +ACPCALGLATPTA++VGT +GA RGLL+RGG VLE+   ++T+VFDKTGTLT G PT
Sbjct  424   LAIACPCALGLATPTAILVGTGIGAERGLLIRGGDVLENVHKLDTVVFDKTGTLTRGEPT  483

Query  1775  VTEVVPQGHNDETNAKRDSTSTCEWS--EVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             VTEV                    W+   V  L++A+ VE NT+HP+ +AIV  AK+   
Sbjct  484   VTEV--------------------WNVQSVSALSMAASVEQNTSHPLAEAIVRHAKNTGV  523

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETR--VQEFDDF--KNQSV  1434
              +   E+     EPG G  A++E + V VG   W+ +HGV  T    Q  + F  +  + 
Sbjct  524   SLHPVEN--VHTEPGLGVSAIVENRDVLVGNRLWLEKHGVSVTDEVSQHAESFVRRGNTA  581

Query  1433  VYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRE  1254
             VYV VDG +AG+I V D+LR DA   V  L K G+   LL+GD++ AA+ +A  VG+  E
Sbjct  582   VYVAVDGAVAGVIAVRDELRSDAAETVRHLQKLGLRVKLLTGDRREAADAIAREVGLLGE  641

Query  1253  NVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssv  1074
             +VF  V PD+K++ +  LQ+    VA+VGDG+NDA ALA ++VG+++ GG   A + + +
Sbjct  642   DVFAEVSPDDKARAIVELQEQGYNVALVGDGMNDAPALAKANVGISLHGGTDVAVETAQI  701

Query  1073  VLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAG  894
             VLM++RL  +L ++ LSR T   ++QNL WAF YN +G+PVAAG+LLP  G +L P++A 
Sbjct  702   VLMRDRLDDILQSIRLSRATFNKIRQNLIWAFAYNTIGIPVAAGVLLPSFGILLDPAVAA  761

Query  893   ALMGLSSIGVMTNSLLLRLKF  831
             A M +SS+ V+TNSLLLR +F
Sbjct  762   AFMAMSSVSVVTNSLLLRRQF  782



>ref|WP_008188329.1| ATPase [Moorea producens]
 gb|EGJ30106.1| copper/silver-translocating P-type ATPase [Moorea producens 3L]
Length=799

 Score =   551 bits (1421),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 349/789 (44%), Positives = 503/789 (64%), Gaps = 38/789 (5%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEE----LA  2976
             GM C GC   V+R L S P VS A VNL T  AVV            + Q GE     LA
Sbjct  29    GMKCAGCVGVVERQLSSNPGVSKACVNLVTGVAVV------------EYQAGEVEPTVLA  76

Query  2975  KHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASG--RGLAVSWALCAVCLVGHLS  2802
             + LTS GF +  R    E   ++ ++   A+R Q +A    + L ++  L     VGH+ 
Sbjct  77    ELLTSKGFPSQPRLPETEQGTKSQDRLTPAQRHQQEARAYRQQLVIAAVLIVFSTVGHIG  136

Query  2801  HFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSS  2622
             H+F      + +L +  FH  +    LL+PGR +I++G + L  GAPNMNTL+GLGA+++
Sbjct  137   HWF--HGPMLPVLSTLWFHWGLATLALLLPGRSIIVEGGRGLWHGAPNMNTLIGLGAVTA  194

Query  2621  FAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARL  2442
             +  S +A   P LGW+ FF+EPVML+ F+LLGR LEQ A+ +AT+D   LL++ P  ARL
Sbjct  195   YTTSCVALLFPNLGWECFFDEPVMLLGFILLGRTLEQGARYQATADFESLLSLQPQVARL  254

Query  2441  V--VNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLP  2268
             +  ++S  G+QT  +E+P   + VG+ + +LPG+++P DG V  G S++DES  TGE  P
Sbjct  255   IGTLDSTEGDQTG-IEIPVEQVRVGECLRILPGEKVPVDGEVITGVSSIDESMLTGESRP  313

Query  2267  VTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGH  2088
             V K PG  V  G++N +G+L V+  R G ET +  IV LVEEAQ+R+APVQ+LAD V+G+
Sbjct  314   VLKQPGDMVTGGTLNQSGVLVVKAIRTGRETTLAQIVALVEEAQTRKAPVQQLADLVAGY  373

Query  2087  FTYGVMALSAATFMFWNLFGTRVLPA--TLHQGslaslalqlscsvlvvaCPCALGLATP  1914
             FTYGVMA++  TF+FW + GT++ P   +    S   L+L+L+ +VLV+ACPCALGLATP
Sbjct  374   FTYGVMAIAFLTFLFWYVAGTKIWPEVWSTMAASPLLLSLKLAIAVLVIACPCALGLATP  433

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVV---PQGHND  1743
             TA++VGTSLGA RGLL++GG +LE    ++T+VFDKTGTLT G+PTVT+ +   P+  ND
Sbjct  434   TAILVGTSLGAKRGLLIKGGDILEQVHRLDTVVFDKTGTLTQGQPTVTDCLLIQPETEND  493

Query  1742  ETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEE  1563
             + +A    T     S   +L LA+  ES T+HP+G AI+  A+ +   ++ A+D  F  E
Sbjct  494   QQSAIGTKTIALS-SASQLLQLAAAAESGTSHPLGSAILTEAQQQQLPMLGAQD--FYTE  550

Query  1562  PGSGAMAVIEEKKVSVGTLDWVRRHGV-----GETRVQEFDDFKNQSVVYVGVDGVLAGL  1398
             PG G  A++E++ V +G+ DW+ + G+      +  V+   D   ++VVYV VDG+L GL
Sbjct  551   PGLGVSALVEKQLVVLGSADWLSKQGITISDTAQGEVKALAD-GGKTVVYVAVDGLLVGL  609

Query  1397  IYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKS  1218
             I V D  R +A+  VE L   G+   +L+GD+   A  VA  + I  E+V  GV PD K+
Sbjct  610   IAVNDIPRVEAKQTVEHLKDLGLRVMMLTGDRPVVAAAVAKTLSIEPEDVIAGVLPDGKA  669

Query  1217  KFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLD  1038
               ++ LQ     VAMVGDGIND+ ALA + VG+A+ GG   A++ + ++L++N L  ++ 
Sbjct  670   NAIANLQDQGHCVAMVGDGINDSPALAQADVGIALHGGTDVAAETAGIILIRNNLLDVVK  729

Query  1037  ALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMT  858
             +++LSR T   ++QNL+WAFGYNI+G+P+AAG LLP  G +L+P+ AGALM  SS+ V+T
Sbjct  730   SIDLSRATFNKIRQNLFWAFGYNILGIPMAAGGLLPGFGMVLSPAAAGALMAFSSVSVVT  789

Query  857   NSLLL-RLK  834
             NSLLL RL+
Sbjct  790   NSLLLTRLR  798



>emb|CBI32958.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   538 bits (1386),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 314/413 (76%), Positives = 361/413 (87%), Gaps = 2/413 (0%)
 Frame = -2

Query  2048  MFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrgl  1869
             MFWNLFG R+LPA  HQGS  SLALQLSCSVLVVACPCALGLATPTA++VGTSLGAT+GL
Sbjct  1     MFWNLFGARILPAAFHQGSSVSLALQLSCSVLVVACPCALGLATPTAILVGTSLGATKGL  60

Query  1868  llrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVD  1689
             LLRGG++LE FS +NTIVFDKTGTLTIGRP VT+VV  G   +T++++ S S   WSEV+
Sbjct  61    LLRGGNILEKFSEMNTIVFDKTGTLTIGRPVVTKVVTPGCEKDTDSRKSSKSI--WSEVE  118

Query  1688  VLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGT  1509
             VL LA+GVESNT HP+GKAIVEAA++ NC+ VK  DGTF+EEPGSGA+A +E KKVSVGT
Sbjct  119   VLKLAAGVESNTIHPVGKAIVEAARAVNCQNVKVVDGTFVEEPGSGAVATVENKKVSVGT  178

Query  1508  LDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGI  1329
              DWV+RHGV E   QE D+ KNQSVVYVGVDG LAGLIY EDQ+R+DARHVVESLS+QGI
Sbjct  179   FDWVQRHGVQENPFQEVDELKNQSVVYVGVDGTLAGLIYFEDQIRDDARHVVESLSRQGI  238

Query  1328  TTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDA  1149
             + Y+LSGDK+NAAE+VAS VGIP++ V  GVKP+EKSKF+  LQK    VAMVGDGINDA
Sbjct  239   SVYMLSGDKRNAAEHVASSVGIPKDKVLSGVKPNEKSKFIRELQKAHNTVAMVGDGINDA  298

Query  1148  AALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYN  969
             AALASS +G+A+GGGVGAAS+VSS+VLM NRLSQLLDA ELSRLTMKTVKQNLWWAF YN
Sbjct  299   AALASSDIGIAMGGGVGAASEVSSIVLMGNRLSQLLDAFELSRLTMKTVKQNLWWAFAYN  358

Query  968   IVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEI  810
             IVG+P+AAG+LLP TGTMLTPSIAGALMGLSS+GVMTNSLLLR KF++KQK+I
Sbjct  359   IVGIPIAAGMLLPITGTMLTPSIAGALMGLSSVGVMTNSLLLRSKFSAKQKQI  411



>ref|XP_010261895.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Nelumbo 
nucifera]
Length=889

 Score =   553 bits (1424),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 352/821 (43%), Positives = 502/821 (61%), Gaps = 63/821 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CG C + VK IL S  RV S  VN+ TETA +   ++          + E+LA+ LT
Sbjct  87    GMMCGACVSRVKSILASDERVDSVVVNMLTETAAIRLKTDGVENGTIPVSVAEDLARRLT  146

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
              CGF +  R+S     +N+   +++    K+A L  S   +A +W L A+C   H SH  
Sbjct  147   ECGFPSKRRNSGFGIGDNV-RKWKEMAEKKKAMLAKSRTRVAFAWTLVALCCGSHASHIL  205

Query  2792  G------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGA  2631
                    A  S+  +LH++     + L  LL PGR+L++DGL+S  KG+PNMN+LVG G+
Sbjct  206   HSLGIHLAHGSFWDILHNSYVKGGLALSALLGPGRELLLDGLESFAKGSPNMNSLVGFGS  265

Query  2630  LSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPS  2454
             +++F +S+++   P L W A FF+EPVML+ FVLLGR+LE+RA+I+A+SDM  LL+++ S
Sbjct  266   IAAFIISAVSLLNPGLEWDASFFDEPVMLLGFVLLGRSLEERARIRASSDMKELLSLVSS  325

Query  2453  KARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
              +RLV+ +  G+ +           +EVP  ++ VGD ++V PG+ IP DG+V AGRS V
Sbjct  326   HSRLVITASEGDASVDNVLESDAICLEVPTDDIRVGDSVLVFPGETIPVDGMVLAGRSVV  385

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DES  TGE LPV K  G  V+AG+IN +G L +E   PG  + I  IVR+VE+AQ  EAP
Sbjct  386   DESMLTGESLPVFKERGLTVSAGTINWDGPLRIEASTPGSMSTISKIVRMVEDAQGHEAP  445

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscs  1959
             +QRLAD ++G F YGVM LSAATF FW   GT + P  L        G+   L+L+L+  
Sbjct  446   IQRLADAIAGPFVYGVMTLSAATFAFWYYIGTHIFPDVLLNNIAGPNGNPLVLSLKLAVD  505

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVV+CPCALGLATPTA++VGTS GA +GLL+RGG VLE  + ++ +  DKTGTLT G+P
Sbjct  506   VLVVSCPCALGLATPTAILVGTSHGAKQGLLVRGGDVLERLASIDFVALDKTGTLTEGKP  565

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
              V+ V                S+  + E ++L +A+ VE   +HPI KAIV  A+S N +
Sbjct  566   AVSAV----------------SSLIYEESEILRVAAAVERTASHPIAKAIVNKAESLNLK  609

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN--------  1443
             I        + EPG G +A ++   V+VG ++WV      ++   +  D ++        
Sbjct  610   IPSTRGQ--LTEPGFGCLAEVDGSLVAVGAMEWVSERFQKKSTTSDVMDLEDILMHLSSK  667

Query  1442  --------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAA  1290
                     ++ VYVG +G  + G I + D+LR DAR  +  L K+G+ T LLSGD++ A 
Sbjct  668   SISSSDDSKTFVYVGREGEGIIGAIAISDRLRHDARSTITRLQKKGVKTILLSGDREEAV  727

Query  1289  EYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgva  1116
             E +A  VGI  E+V   + P +KS  +S LQ     +AMVGDGINDA   ALA   + + 
Sbjct  728   ETIARTVGIGSESVNASLTPQQKSGVISSLQTKGHCIAMVGDGINDAPSLALADVGIALQ  787

Query  1115  igggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGIL  936
             I G   AASD +SV+L+ N+LSQ++DAL+L++ TM  V QNL WA  YN+V +P+AAG+L
Sbjct  788   IEGKENAASDAASVILLGNKLSQVVDALDLAQATMAKVHQNLSWAVAYNVVAIPIAAGVL  847

Query  935   LPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             LP     +TPS++G LM LSSI V+TNSLLL+L+ ++ +++
Sbjct  848   LPNFDFAMTPSLSGGLMALSSIFVVTNSLLLQLRGSTTKRK  888



>ref|XP_005849927.1| hypothetical protein CHLNCDRAFT_21268 [Chlorella variabilis]
 gb|EFN57825.1| hypothetical protein CHLNCDRAFT_21268 [Chlorella variabilis]
Length=912

 Score =   553 bits (1425),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 387/804 (48%), Positives = 517/804 (64%), Gaps = 53/804 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQ--QLGEELAKH  2970
             GM C GC + VK +LE +  V +ASVNL TETAVV  + EA + P+ +Q   +G  LA+ 
Sbjct  74    GMRCAGCVSRVKVLLEREQPVQAASVNLATETAVVRDL-EAGLSPHERQLASMGASLARM  132

Query  2969  LTSCGFKANVRD----SRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLS  2802
             LT  G+ A +R     S   N  +    K   +  +L+ + R L V+W L + CL+ HL+
Sbjct  133   LTEAGYAATMRQQGGGSSASN--KVVAAKREERLRRLRDTTRRLGVAWLLASACLLHHLT  190

Query  2801  HFFGAKA-SWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALS  2625
             H+ G  A  W+H L ST  H ++    LL PGR +I +G + L KGAP+MN+LVGLGA +
Sbjct  191   HWLGGSAPRWLHALSSTPVHAALAALALLGPGRGIISEGFRGLAKGAPDMNSLVGLGATA  250

Query  2624  SFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKAR  2445
             SFAVS++AA +PKLGW+ FFEEP ML+  VL+GR LE+RAK++A++DM  L  +LP KAR
Sbjct  251   SFAVSAVAALLPKLGWRTFFEEPAMLLGVVLVGRALEERAKLQASADMAALQGLLPPKAR  310

Query  2444  LVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPV  2265
             L++        S  EVP  +++ GD + VLPGDR+P DG+V  GRSTVDES+ TGEPLPV
Sbjct  311   LLLGDG-----SWREVPSESVAAGDVLTVLPGDRVPVDGVVVGGRSTVDESALTGEPLPV  365

Query  2264  TKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHF  2085
             TK  G +V AG++N +G ++V     GG+TA+ DIVRLVE AQSR APVQR AD V+G F
Sbjct  366   TKAQGDKVTAGTVNYDGQISVRAVHSGGDTAVADIVRLVEAAQSRTAPVQRFADVVAGKF  425

Query  2084  TYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAV  1905
             TYGVMA +AATF+FW   GTRV P      + A L+LQ++C+VLVVACPCALGLA PTAV
Sbjct  426   TYGVMAAAAATFLFWAGIGTRVFP---QAAATALLSLQMACNVLVVACPCALGLAAPTAV  482

Query  1904  MVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQ--GHNDETNA  1731
             +VGTS GA RGLL+RGG +LE+ S V+T+VFDKTGTLT+G+PTV EV P       +  A
Sbjct  483   LVGTSAGARRGLLIRGGDILEAASHVDTVVFDKTGTLTVGKPTVVEVRPLHVAAGSKPQA  542

Query  1730  KRDSTSTCEWSEVDVLTLASGVESNTNHP-------------------------IGKAIV  1626
             K    S        +L LA+ VE  + HP                          G A V
Sbjct  543   KGRHGSPPADDPALLLALAAAVERGSTHPIAKAIAKAAAQAAQAGSGSGHGSNGSGSAHV  602

Query  1625  EAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFK  1446
              +  S    +  AEDG+F++EPGSG  A +  ++V+VG  +                   
Sbjct  603   TSNGSGGAYV--AEDGSFVQEPGSGVTATVAGRRVAVGARE------WAAAAEAAAASRP  654

Query  1445  NQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVG  1266
                +VYVG+DG LA  + + D+LR DA   V+ L + G+   +LSGD+   A  +A  VG
Sbjct  655   GHILVYVGIDGRLAAAVEIADELRPDAASTVQRLQRLGVRVVMLSGDQPATAHAMAQAVG  714

Query  1265  IPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasd  1086
             I  ++V+ GVKP  K+  V  LQ   + VAMVGDG+NDAAALA + VG+A+GGGV AAS+
Sbjct  715   IKPQDVYAGVKPAGKAALVQQLQGQGRRVAMVGDGVNDAAALAQADVGIAMGGGVDAASE  774

Query  1085  vssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTP  906
             V+ VVL+ +R+ Q+LD L LSR T++ V+QN+WWA GYN+VG+P+AAG LLP TG  LTP
Sbjct  775   VADVVLLGDRVPQVLDVLALSRATLRKVQQNMWWAAGYNLVGIPLAAGALLPVTGLALTP  834

Query  905   SIAGALMGLSSIGVMTNSLLLRLK  834
             S++GA+MG+SS+ VM NSLLL+ +
Sbjct  835   SLSGAMMGISSLAVMANSLLLQFE  858



>ref|XP_008452788.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Cucumis 
melo]
Length=898

 Score =   550 bits (1416),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 362/822 (44%), Positives = 495/822 (60%), Gaps = 65/822 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVV-WPVSEAKVVPNWQQQLGEELAKHL  2967
             GM CG C + VK IL S  RV S  VN+ TETA +    SE     +    + E LA+ L
Sbjct  95    GMMCGACVSRVKSILSSDDRVDSVVVNMLTETAAIRLRSSEVVAEADSAVNVAESLARRL  154

Query  2966  TSCGFKANVRDSR---RENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHF  2796
             T CGF  ++R+S     EN+   ++  +  KR  L  S   +AV+W L A+C   H SH 
Sbjct  155   TDCGFPTSLRNSELGVAENV-RKWKDMVEKKRRMLIKSRNRVAVAWTLVALCCGSHASHI  213

Query  2795  FGAKASWIH------LLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
                    IH      +LH++       L  LL PGR+L+ DGL++L KG+PNMN+LVG G
Sbjct  214   LHPLGIHIHNGPLMEILHNSYVKGCFALVALLGPGRELLFDGLRALRKGSPNMNSLVGFG  273

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             A+++F +S+++   P L W A FF+EPVML+AFVLLGR LE+RA++KA+SDM  LL+++ 
Sbjct  274   AVAAFIISAVSLLNPALDWDASFFDEPVMLLAFVLLGRTLEERARVKASSDMNELLSLIS  333

Query  2456  SKARLVVNSDMGEQTSTVEVPCSN----------LSVGDQIIVLPGDRIPADGIVRAGRS  2307
             S +RLV+    G  +ST +V CS+          + VGD ++VLPG+ +P DG V AGRS
Sbjct  334   SHSRLVITPSEG-NSSTNDVLCSDAMCIKVSTDDIRVGDSVLVLPGETVPVDGKVLAGRS  392

Query  2306  TVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSRE  2127
              VDES  TGE LPV K  G  V+AG++N +G L +E    G  + I  IVR+VE+AQ  E
Sbjct  393   VVDESMLTGESLPVFKEAGLMVSAGTVNWDGPLRIEASSTGLNSTISKIVRMVEDAQGHE  452

Query  2126  APVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqls  1965
             AP+QRLAD ++G F Y V+ LSAATF FW  FGT + P  L        G    L+L+LS
Sbjct  453   APIQRLADSIAGPFVYTVLTLSAATFTFWYCFGTHIFPDVLINDIAGPDGDPLLLSLKLS  512

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
               VLVV+CPCALGLATPTA++VGTSLGA RGLL+RGG VLE  + ++ +  DKTGTLT G
Sbjct  513   VDVLVVSCPCALGLATPTAILVGTSLGARRGLLIRGGDVLERLANIDCVALDKTGTLTEG  572

Query  1784  RPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRN  1605
             +PTV+ V+                +  + E ++L +A+ VE   +HPI KAI++ A+S N
Sbjct  573   KPTVSSVI----------------SFVYGEEEILQVAAAVEKTASHPIAKAIIDKAESLN  616

Query  1604  CRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN------  1443
               I     G  + EPG G+ A +  + V+VG+L+WV      +    +  + ++      
Sbjct  617   LTI-PVTRGQLV-EPGFGSFANVNGRLVAVGSLEWVNDRFEKKANTSDLKNLEHSVYRSL  674

Query  1442  ---------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
                      ++VVYVG +G  + G I + DQLR DA   V  L K+GI T LLSGD++ A
Sbjct  675   EGISSSNNSKTVVYVGSEGEGIIGAIVISDQLRYDAESTVNRLQKKGIRTVLLSGDREEA  734

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--gv  1119
                VA  VGI  E V   + P  KS  +S L+     VAMVGDGINDA +LASS V   +
Sbjct  735   VASVAKTVGIEEEFVHSSLTPQGKSDLISTLKTAGHRVAMVGDGINDAPSLASSDVGIAL  794

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
              +     AAS+ +S++L+ NR+SQL+DA+EL++ TM  V QNL WA  YN V +P+AAG+
Sbjct  795   QLESHENAASNAASILLLGNRISQLVDAMELAQATMSKVYQNLSWAIAYNAVAIPIAAGV  854

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             LLP     +TPS++G LM LSSI V+TNSLLL++      K+
Sbjct  855   LLPGFDFAMTPSLSGGLMALSSIFVVTNSLLLQIHAPGDAKK  896



>ref|XP_004141342.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
isoform 2 [Cucumis sativus]
 gb|KGN55380.1| hypothetical protein Csa_4G648020 [Cucumis sativus]
Length=898

 Score =   549 bits (1415),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 368/829 (44%), Positives = 495/829 (60%), Gaps = 79/829 (10%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVW-----PVSEAKVVPNWQQQLGEEL  2979
             GM CG C + VK IL S  RV S  VN+ TETA +       V+EA    N    + E L
Sbjct  95    GMMCGACVSRVKSILSSDDRVDSVVVNMLTETAAIRLRSGEVVAEADSAVN----VAESL  150

Query  2978  AKHLTSCGFKANVRDSR---RENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGH  2808
             A+ LT CGF  ++R+S     EN+   ++  +  KR  L  S   +A++W L A+C   H
Sbjct  151   ARRLTDCGFPTSLRNSELGVAENV-RKWKDMVEKKRELLIKSRNRVAIAWTLVALCCGSH  209

Query  2807  LSHFFGAKASWIH------LLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTL  2646
              SH        IH      +LH++       L  LL PGR L+ DGL++  KG+PNMN+L
Sbjct  210   ASHILHPLGIHIHNGPLMEILHNSYVKGCFALVALLGPGRDLLFDGLRAFRKGSPNMNSL  269

Query  2645  VGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLL  2469
             VG GA+++F +S+++   P L W A FF+EPVML+AFVLLGR LE+RA++KA+SDM  LL
Sbjct  270   VGFGAVAAFIISAVSLLNPALDWDASFFDEPVMLLAFVLLGRTLEERARVKASSDMNELL  329

Query  2468  NVLPSKARLVVNSDMGEQTSTVEVPCSN----------LSVGDQIIVLPGDRIPADGIVR  2319
             +++ S +RLV+    G  +ST +V CS+          + VGD ++V PG+ +P DG V 
Sbjct  330   SLISSHSRLVITPSEG-NSSTTDVLCSDAMCIKVSTDDIRVGDSVLVFPGETVPVDGKVL  388

Query  2318  AGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEA  2139
             AGRS VDES  TGE LPV K  G  V+AG++N +G L +E    G  + I  IVR+VE+A
Sbjct  389   AGRSVVDESMLTGESLPVFKEAGLMVSAGTVNWDGPLRIEASSTGLNSTISKIVRMVEDA  448

Query  2138  QSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslasla  1977
             Q  EAP+QRLAD ++G F Y V+ LS ATF FW  FGTR+ P  L        G    L+
Sbjct  449   QGHEAPIQRLADSIAGPFVYTVLTLSVATFTFWYCFGTRIFPDVLINDIAGPDGDPLLLS  508

Query  1976  lqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGT  1797
             L+LS  VLVV+CPCALGLATPTA++VGTSLGA RGLL+RGG VLE  + ++ +  DKTGT
Sbjct  509   LKLSVDVLVVSCPCALGLATPTAILVGTSLGARRGLLIRGGDVLERLANIDCVALDKTGT  568

Query  1796  LTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAA  1617
             LT G+PTV+ VV                +  + E D+L +A+ VE   +HPI KAI++ A
Sbjct  569   LTEGKPTVSSVV----------------SFVYGEEDILQVAAAVEKTASHPIAKAIIDKA  612

Query  1616  KSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN--  1443
             +S N  I     G  + EPG G+ A +  + V+VG+L+WV      E +   F D KN  
Sbjct  613   ESLNLTI-PVTRGQLV-EPGFGSFANVNGRLVAVGSLEWVNDR--FEKKASTF-DLKNLE  667

Query  1442  ----------------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLL  1314
                             ++VVYVG +G  + G I + DQLR DA   V  L K+GI T LL
Sbjct  668   HSVYRSLKGISSSNNSKTVVYVGSEGEGIIGAIVISDQLRYDAESTVNRLQKKGIRTVLL  727

Query  1313  SGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALas  1134
             SGD++ A   VA  VGI  E V   + P  KS  +S L+     VAMVGDGINDA +LAS
Sbjct  728   SGDREEAVASVAKTVGIEEEFVHSSLTPQGKSDLISTLKSAGHRVAMVGDGINDAPSLAS  787

Query  1133  shv--gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVG  960
             S V   + +     AAS+ +S++L+ NR+SQL+DA+EL++ TM  V QNL WA  YN V 
Sbjct  788   SDVGIALQLESHENAASNAASILLLGNRISQLVDAMELAQATMSKVYQNLSWAIAYNAVA  847

Query  959   LPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             +P+AAG+LLP     +TPS++G LM LSSI V+TNSLLL++    + K 
Sbjct  848   IPIAAGVLLPGFDFAMTPSLSGGLMALSSIFVVTNSLLLQIHAPKEAKR  896



>ref|XP_010229103.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Brachypodium 
distachyon]
Length=891

 Score =   547 bits (1410),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 365/838 (44%), Positives = 494/838 (59%), Gaps = 74/838 (9%)
 Frame = -2

Query  3215  PSVIAAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVW  3036
             P  ++ AGE A       +     GM CGGCAA V+ IL +  RV + +VNL  E+A V 
Sbjct  67    PDAVSVAGEGAGASVLLDVS----GMMCGGCAARVRSILAADARVENVAVNLLAESAAVR  122

Query  3035  PVSEAKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFE---KKMNAKRAQLQA  2865
               S A          GEELA  LT CGF +  R               K M A++A+L  
Sbjct  123   LRSPAP-------GAGEELAVRLTECGFPSEARRGGAAAGAAESARKWKDMAARKAELLT  175

Query  2864  SGRG-LAVSWALCAVCLVGHLSHF---FG---AKASWIHLLHSTGFHMSMCLFTLLVPGR  2706
               RG +A +W L A+C   H SH    FG   A  +++ LLH++     + +  L  PGR
Sbjct  176   RSRGRVAFAWTLVALCCGSHASHLLHSFGIHIAHGTFLDLLHNSYVKCGIAMVALFGPGR  235

Query  2705  QLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLL  2529
              ++ DGL++  +G+PNMN+LVG G+ ++FA+S+++   P+L W + FF+EPVML+ FVLL
Sbjct  236   DILFDGLRAFKQGSPNMNSLVGFGSAAAFAISAVSLLNPELAWNSTFFDEPVMLLGFVLL  295

Query  2528  GRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTS---------TVEVPCSNLSV  2376
             GR+LE+ A++KA+SDM  L+++L  ++RLV+ S   E +S         TVEVP  ++ V
Sbjct  296   GRSLEESARLKASSDMNELISLLSPQSRLVITSSSDEPSSDGILNSSAITVEVPVEDVRV  355

Query  2375  GDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEV  2196
             GD I+VLPG+ IP DG V  G S VDES  TGE LPV K  G  V +G++N +G L +  
Sbjct  356   GDSILVLPGETIPVDGNVVGGSSFVDESMLTGESLPVAKEIGCVVFSGTVNWDGPLKINA  415

Query  2195  QRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVL  2016
                G  + I  IVR+VE+AQ+REAPVQRLAD ++G F Y VM LSAATF FW   GT + 
Sbjct  416   TTTGPSSTIAKIVRMVEDAQAREAPVQRLADSIAGPFVYTVMTLSAATFSFWYFMGTHIF  475

Query  2015  PATL------HQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrgg  1854
             P  L        G    L+L+L+  VLVV+CPCALGLATPTA+++GTS+GA RGLL+RGG
Sbjct  476   PEVLLNDISGPDGDSLLLSLKLAVDVLVVSCPCALGLATPTAILIGTSMGAKRGLLIRGG  535

Query  1853  SVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLA  1674
              VLE  + ++ IV DKTGTLT G+P VT                S ++  + E+++L LA
Sbjct  536   DVLERLAGIDAIVLDKTGTLTKGKPVVT----------------SIASLAYKEMEILRLA  579

Query  1673  SGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVR  1494
             + VE    HPI  AI + A+     I        + EPG G +A ++E  V+VGTLDWV 
Sbjct  580   AAVEKTALHPIANAITKEAEQLKLDIPPTSGQ--LTEPGFGCLAEVDECLVAVGTLDWVH  637

Query  1493  RHGVGETRVQEFDDFKNQ----------------SVVYVGVDGV-LAGLIYVEDQLREDA  1365
                  +    E  D  N+                S+ Y+G +G  + G I + D LR+DA
Sbjct  638   NRFQVKASPTELRDLGNRLEFLSCSQASSSKQSKSIAYIGREGEGIIGAIAISDVLRDDA  697

Query  1364  RHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQK  1185
             +  V+ L K+GITTY+LSGD+K A E +   VGI  EN    + P EK+  +S LQ +  
Sbjct  698   KSTVDRLQKEGITTYILSGDRKEAVESIGITVGIRTENRKSSLSPQEKAGIISTLQGEGH  757

Query  1184  VVAMVGDGINDAAALasshv--gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTM  1011
              VAMVGDGINDA +LA++ V   +       AA D +SVVL+ NRLSQ++DAL LS+ TM
Sbjct  758   RVAMVGDGINDAPSLAAADVGIAMRTHSKENAACDAASVVLLGNRLSQVVDALSLSKATM  817

Query  1010  KTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
               V QNL WA  YNIV +PVAAG LLP     +TPS++G LM LSSI V++NSLLL+ 
Sbjct  818   AKVHQNLAWAVAYNIVAIPVAAGALLPQFDFAMTPSLSGGLMALSSIFVVSNSLLLQF  875



>ref|WP_009784297.1| ATPase [Lyngbya sp. PCC 8106]
 gb|EAW37057.1| Copper-translocating P-type ATPase [Lyngbya sp. PCC 8106]
Length=780

 Score =   542 bits (1397),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 325/785 (41%), Positives = 477/785 (61%), Gaps = 44/785 (6%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC  +V+R L  Q  V SA VNL TE A V    EA  V        EELA+ L
Sbjct  28    GGMKCAGCVNAVERQLTQQTGVISARVNLATEVATVE--CEANTVE------AEELAQKL  79

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T  GF +  R   R+   E  E      R +++   R +     L  +  +GHL HF   
Sbjct  80    TDTGFPSQPRSGSRQTA-EASENLAQRHRQEIRQQIRRVVTCGLLILLSGIGHLHHF---  135

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
                 + +L++  FH  +    LL PGR +IIDG++SLL+ APNMNTLVGLG ++++  S 
Sbjct  136   GIGHLPILNNMWFHWGLATIALLFPGRAIIIDGIRSLLRNAPNMNTLVGLGTITAYTTSF  195

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVV---  2436
             +A   P+LGW+ FF+EPVML+ F+LLG+ LEQ+A+ +AT+ +  L+ + P+ ARLV    
Sbjct  196   VALLFPQLGWECFFDEPVMLLGFILLGKTLEQQARHRATNALQSLIALQPTMARLVPQPQ  255

Query  2435  -NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTK  2259
              N +       VE+P   + VG+ + VLPG++IP DG + +G++TV+ES  TGE +PV K
Sbjct  256   PNQEDKNIEQAVEIPAEQVRVGEWLKVLPGEKIPVDGEIFSGKTTVNESMLTGESMPVVK  315

Query  2258  LPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTY  2079
               G  VAAG+IN +G++ ++  R    T +  IV LVE AQ+R+AP+Q LADKV+G+FTY
Sbjct  316   QSGESVAAGTINQSGVIIIQAIRTAENTTLAHIVSLVENAQTRKAPIQNLADKVAGYFTY  375

Query  2078  GVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaC-------PCALGLA  1920
             GVM+++  TF+FW   GT++ P  ++ G+            + +A        PCALGLA
Sbjct  376   GVMSIATITFLFWYGIGTQIWPDVINFGASEMATHASLLLSMKLAIAVLVIACPCALGLA  435

Query  1919  TPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVP-QGHND  1743
             TPTA++VG+ +GA RGLL++GG +LE    ++T+VFDKTGTLT G PTVT+ +  +  N 
Sbjct  436   TPTAILVGSGIGAERGLLIKGGDILERVHQLDTVVFDKTGTLTTGHPTVTDCISIENSNS  495

Query  1742  ETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEE  1563
             +T                +L LA+ VE  ++HPI KAI+  A+ +   ++ AED  F  E
Sbjct  496   DT----------------ILQLAATVEQGSDHPIAKAIINQAQQQELSLLPAED--FQTE  537

Query  1562  PGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVED  1383
              G G  A++  ++V VG    + + G+    ++   +   ++ VYV V+  L GLI V D
Sbjct  538   VGFGVSAMVNNQRVWVGNQQGLIQQGI--EFLENTPNVTGKTAVYVAVEKQLVGLIAVSD  595

Query  1382  QLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSG  1203
              L+EDA+  V+ L K G+   +L+GD+ + A  +A  + +  ENV   V+PD K K ++ 
Sbjct  596   PLKEDAKSTVKQLQKMGLRVIILTGDRADVATSIAQQLDLEPENVLAEVRPDGKVKAITD  655

Query  1202  LQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELS  1023
             LQ+  + VAMVGDGINDA ALA + VG+ +  G   A + + +VLM++ L  +++++ LS
Sbjct  656   LQQQGQRVAMVGDGINDAPALAQADVGIGLHTGTDVAMETADIVLMRDSLMDVVESIRLS  715

Query  1022  RLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLL  843
             R T   ++QNL+WAFGYN +G+PVAAG+LLP  G +L+P+ AGA M  SS+ V+TNSLLL
Sbjct  716   RSTFNKIRQNLFWAFGYNTLGIPVAAGLLLPSFGIILSPAAAGAFMAFSSVSVVTNSLLL  775

Query  842   RLKFA  828
             R KF+
Sbjct  776   RRKFS  780



>ref|XP_002516143.1| copper-transporting atpase paa1, putative [Ricinus communis]
 gb|EEF46145.1| copper-transporting atpase paa1, putative [Ricinus communis]
Length=880

 Score =   543 bits (1399),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 361/828 (44%), Positives = 497/828 (60%), Gaps = 80/828 (10%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC + VK +L S  RV S  VN+ TETA V    +  V  +   ++ +  AK LT
Sbjct  81    GMMCGGCVSRVKSLLSSDERVESVVVNMLTETAAVRLKRDFAV--DSTAEIADSFAKRLT  138

Query  2963  SCGFKANVRD---SRRENLFETFEKKMNAKRAQLQASGRGLAV-SWALCAVCLVGHLSHF  2796
              CGF+   R+      EN+ +   ++M  K+ +L    R   V +W L A+C   HLSH 
Sbjct  139   DCGFETKKRELGIGVAENVKKW--REMVKKKEELIVRSRNRVVFAWTLVALCCGSHLSHI  196

Query  2795  FG-------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGL  2637
                      A   +  +LH++     + +  LL PGR L+ DGLK+  KGAPNMN+LVG 
Sbjct  197   LHSLGIHTFAHGPFWEVLHNSYVKGGLSMAALLGPGRDLLFDGLKAFKKGAPNMNSLVGF  256

Query  2636  GALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVL  2460
             G+L++F +S+++   P+L W A FF+EPVML+ FVLLGR+LE+RA+I+A+SDM  LL+++
Sbjct  257   GSLAAFVISAVSLLNPELKWDASFFDEPVMLLGFVLLGRSLEERARIRASSDMNELLSLI  316

Query  2459  PSKARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRS  2307
               ++RLV+NS  G+  +          VEVP  ++ VGD ++VLPG+ IP DG V AGRS
Sbjct  317   SMQSRLVINSSDGKSPADTVLCSDAICVEVPTDDVRVGDTVLVLPGETIPVDGRVIAGRS  376

Query  2306  TVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSRE  2127
              VDES  TGE LPV K  G +V+AG+IN +G L +E    G  + I  I R+VE+AQ RE
Sbjct  377   VVDESMLTGESLPVFKEEGLKVSAGTINWDGPLRIEASSTGSNSTISRIFRMVEDAQGRE  436

Query  2126  APVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqls  1965
             AP+QRL D ++G F Y +M +SAATF FW   G++V P  L        G    L+L+LS
Sbjct  437   APIQRLVDSIAGPFVYSIMTISAATFAFWYYIGSQVFPDVLLNDIAGPDGDALLLSLKLS  496

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
               VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + ++ I  DKTGTLT G
Sbjct  497   VDVLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLARIDYIALDKTGTLTEG  556

Query  1784  RPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRN  1605
             +P V+ V                ++  + E ++L +A+ VE    HPI KAIV  A+S  
Sbjct  557   KPVVSAV----------------ASTSYKESEILRIAAAVEKTALHPIAKAIVNEAESLE  600

Query  1604  CRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV--RRHGVGETRVQEFDDFKN----  1443
               I  A  G  + EPG G +A ++ + V+VGTLDWV  R H     R  +  D +N    
Sbjct  601   LTI-PATRGQ-LTEPGFGTLAEVDGRLVAVGTLDWVQERFH-----RTADLSDLRNLEAA  653

Query  1442  ---------------QSVVYVGV--DGVLAGLIYVEDQLREDARHVVESLSKQGITTYLL  1314
                            ++VVYVG   +G++ G I + D+LR DA   V  L  +GI T L+
Sbjct  654   VSFQLSKGTSSSNYSKTVVYVGREEEGII-GAIAISDRLRHDAESTVNRLQMKGINTVLV  712

Query  1313  SGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--AL  1140
             SGD++ A   +A+ VGI  E +   + P +KS  +S LQ     VAMVGDGINDA   AL
Sbjct  713   SGDREEAVANIANRVGIGSEFINASLTPQQKSGVISTLQAAGHCVAMVGDGINDAPSLAL  772

Query  1139  asshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVG  960
             A   + +       AASDV+S+VL+ NR+SQ++DAL+L+R TM  V QNL WA  YN+V 
Sbjct  773   AEVGIALQNEAQENAASDVASIVLLGNRISQVVDALDLARATMAKVYQNLSWAIAYNVVA  832

Query  959   LPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             +P+AAG+LLP     +TPS++G LM LSSI V+TNSLLL+L    + +
Sbjct  833   IPIAAGVLLPQYDFAMTPSVSGGLMALSSIFVVTNSLLLQLHEPERSR  880



>ref|XP_010936926.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Elaeis 
guineensis]
Length=889

 Score =   543 bits (1399),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 355/822 (43%), Positives = 498/822 (61%), Gaps = 65/822 (8%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM CG CAA V+ IL +  RV SA VN+ TETA V  +    +      ++ EELA  L
Sbjct  86    GGMICGACAARVRSILSADGRVESAVVNMLTETAAVR-LGPGGLEDGDAGRVAEELAGRL  144

Query  2966  TSCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSH  2799
             T CGF A  R S     EN+ +   ++M  ++ +L    R  +A +W L A+C   H SH
Sbjct  145   TECGFPAKRRRSGMGVGENVRKW--REMVERKEELLVRNRNRVAFAWTLVALCCGSHASH  202

Query  2798  FFG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGL  2637
                      A  S   +LH++ F     + +LL PGR L+ DG ++  KG+PNMN+LVG 
Sbjct  203   ILHSLGIHVAHGSLWEILHNSYFKCGTAMVSLLGPGRDLLFDGFRAFAKGSPNMNSLVGF  262

Query  2636  GALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVL  2460
             G++++F +S+++   P L W+A FFEEP+ML+ FVLLGR+LE+RA++KA+SDM  LL+++
Sbjct  263   GSIAAFLLSAVSLLNPGLEWEASFFEEPIMLLGFVLLGRSLEERARLKASSDMNELLSLV  322

Query  2459  PSKARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRS  2307
              S++RLV+ S   + +S         ++EVP  ++ VGD I+VLPG+ IP DG V  GRS
Sbjct  323   SSESRLVITSSEEDPSSDNALNGDAISIEVPVDDVRVGDSILVLPGETIPVDGKVLGGRS  382

Query  2306  TVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSRE  2127
              VDES  TGE LPV K  G  V+AG++N +G L +E    G  + I  I+++VE+AQ++E
Sbjct  383   VVDESMLTGESLPVFKERGLHVSAGTVNWDGPLRIEAATTGAMSTISKIIQMVEDAQAQE  442

Query  2126  APVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLH------QGslaslalqls  1965
             AP+QRLAD ++G F Y VM LSAATF FW   G+ + P  L        G+   L+L+LS
Sbjct  443   APIQRLADSIAGPFVYSVMTLSAATFAFWYYIGSHIFPEVLFNDIAGPHGNSLLLSLKLS  502

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
               VLVV+CPCALGLATPTA++VGTSLGA RGLL+RGG VLE  + ++ +  DKTGTLT G
Sbjct  503   TDVLVVSCPCALGLATPTAILVGTSLGAKRGLLIRGGDVLERLAGIDVVALDKTGTLTEG  562

Query  1784  RPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRN  1605
             RP V  V                ++  + E ++L LA+ VE  T+HPI KAI+  A+  N
Sbjct  563   RPVVMAV----------------ASLAYEESEILCLAAAVEKTTSHPIAKAIITKAELLN  606

Query  1604  CRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQ-----  1440
               +   +    +  PG G +A I+   V+VGT++WV      +    E  D +N+     
Sbjct  607   LELPSTKGQLTV--PGFGTLAEIDGCLVAVGTMNWVHERFQNKASHAELMDLENRIACLS  664

Query  1439  ----------SVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
                       S+++VG +G  + G I + D LR DA+  V+ L ++GI T LLSGD++ A
Sbjct  665   STVTSSDHSTSIIFVGREGEGIIGAIAISDILRHDAKSTVDRLQERGIKTVLLSGDREEA  724

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgv  1119
                V  +VGI  +N+   + P++KS  +S LQ +   VAMVGDGINDA   ALA   V +
Sbjct  725   VASVGKMVGIGHQNIKACLTPEQKSSIISSLQTEGHRVAMVGDGINDAPSLALADVGVAL  784

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
              I     AASD +SV+L+ NRL Q++DAL L++ TM  V QNL WA  YNIV +P+AAG+
Sbjct  785   QIEAKDNAASDAASVILLGNRLGQIVDALSLAQATMAKVHQNLAWAVAYNIVAIPIAAGV  844

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             LLP     +TPS++G LM LSSI V++NSL LRL  +  + E
Sbjct  845   LLPQFDFAMTPSLSGGLMALSSIFVVSNSLFLRLHGSFTKSE  886



>ref|WP_010997923.1| ATPase [Nostoc sp. PCC 7120]
 ref|NP_487822.1| cation-transporting P-type ATPase [Nostoc sp. PCC 7120]
 dbj|BAB75481.1| cation-transporting P-type ATPase [Nostoc sp. PCC 7120]
Length=815

 Score =   539 bits (1389),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 350/799 (44%), Positives = 495/799 (62%), Gaps = 43/799 (5%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC  +V+R L     V +A VNL TE AVV   SE  +V        + LA+ L
Sbjct  25    GGMKCAGCVKAVERQLTQYSGVKNACVNLATEVAVV--ESEVGLVDP------DMLAQRL  76

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             TS GF    R +  +    T E     +R Q+Q + R L ++  L     +GHL +    
Sbjct  77    TSAGFPTQPRKANSKASESTIEDSAARQRQQMQTAFRQLMIAAVLLVFSGIGHLGNI---  133

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
               S + +L++  FH  +    LL+PGR +++DG     + APNMNTLVGLG L+++  S 
Sbjct  134   GNSILPILNNIWFHFGLATVALLIPGRPILVDGWLGWRRNAPNMNTLVGLGTLTAYTASV  193

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +A   P++GW+ FF+EPVM++ F+LLGR LEQ+A+ KA +    LL + P  ARL+ N D
Sbjct  194   VALLFPQMGWECFFDEPVMMLGFILLGRTLEQQARGKAAAAFRQLLALQPQVARLIANPD  253

Query  2426  ---MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKL  2256
                MG  T+TVE+P   + VG+ + VLPGD+IP DG VR G++T+DES  TGE +PV K 
Sbjct  254   LEKMGLGTNTVEIPAEQVRVGEWLQVLPGDKIPVDGEVRFGQTTLDESMLTGEAVPVMKQ  313

Query  2255  PGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYG  2076
             PG  V AG+IN +G + ++  R G +T +  IV LVE AQ+R+AP+Q+LAD V+G+FTYG
Sbjct  314   PGDIVTAGTINQSGAIAIQATRTGNDTTLAHIVALVEAAQTRKAPIQKLADTVAGYFTYG  373

Query  2075  VMALSAATFMFWNLFGTRVLP----------------ATLHQGslaslalqlscsvlvva  1944
             ++  S  TF+FW  FGT + P                A +   S   ++L+L+ +V+VVA
Sbjct  374   ILTASLLTFIFWYCFGTHIWPDITVSGGDMEMMMNHAAHITNNSPLLISLKLAIAVMVVA  433

Query  1943  CPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTE-  1767
             CPCALGLATPTA++VGT +GA RGLL++GG VLE    ++T+VFDKTGTLT G P VT+ 
Sbjct  434   CPCALGLATPTAILVGTGIGAERGLLIKGGDVLEKAHQLDTVVFDKTGTLTTGNPVVTDC  493

Query  1766  -VVPQGHNDETN--AKRDST--STCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
              V  +G  DE +  AK++ +   T       ++ LA+ VES T+HP+ +AI +AA+ +  
Sbjct  494   LVFAEGSPDEISFTAKQERSLFPTPLHPSHSLIQLAAAVESGTHHPLARAIQQAAQQQQL  553

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGV--GETRVQEFDDFKNQ--SV  1434
              I +A D  F  EPG G  AV++ + V +G  DW+  HG+   ET  QE      Q  +V
Sbjct  554   SIPEAVD--FHTEPGMGVSAVVDGQTVLLGNGDWLSWHGITWSETAQQEAQKLATQGKTV  611

Query  1433  VYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRE  1254
             V V +   LAGLI V+D  R DA+  V+ L + G+   LLSGD+  AA  +A  +GI R 
Sbjct  612   VGVAIGESLAGLIGVQDTTRPDAQTTVDKLRQMGLRVILLSGDRPEAAHAIAQQLGIDRA  671

Query  1253  NVFYGVKPDEKSKFVSGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvss  1077
             +V  GV P +K+ F+  LQ K    VAMVGDGINDA AL+ + VG+A+  G   A + + 
Sbjct  672   DVMAGVPPAKKAAFIQELQTKSGAKVAMVGDGINDAPALSQADVGIALHSGTDVAMETAQ  731

Query  1076  vVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIA  897
             +VLM++R+S +++++ LSR T   ++QNL+WAF YN +G+P+AAG+LLP  G +L+PS A
Sbjct  732   IVLMRDRISDVVESIHLSRATFNKIRQNLFWAFAYNTIGIPLAAGVLLPNWGFVLSPSGA  791

Query  896   GALMGLSSIGVMTNSLLLR  840
              ALM  SS+ V+TNSLLLR
Sbjct  792   AALMAFSSVSVVTNSLLLR  810



>ref|XP_008797345.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Phoenix 
dactylifera]
Length=889

 Score =   541 bits (1395),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 354/827 (43%), Positives = 501/827 (61%), Gaps = 75/827 (9%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQ-----QLGEE  2982
             GGM CG CAA V+ IL +  RV SA VN+ TETA V      ++ P   +     ++ EE
Sbjct  86    GGMMCGACAARVRSILSADERVESAVVNMLTETAAV------RLGPGGLEDVDAGRVAEE  139

Query  2981  LAKHLTSCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLV  2814
             LA  LT CGF A +R S     EN+ +   ++M  ++ +L    R  +A +W L A+C  
Sbjct  140   LAGRLTECGFPAKMRRSGLGVGENVRKW--REMAERKEELLVRSRNRVAFAWTLVALCCG  197

Query  2813  GHLSHFFG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMN  2652
              H SH         A  S   +LH++       + +LL PGR L+ DGL++  KG+PNMN
Sbjct  198   SHASHILHSLGIHVAHGSLWEILHNSYVKCGTAVVSLLGPGRDLLFDGLRAFAKGSPNMN  257

Query  2651  TLVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTG  2475
             +LVG G++++F +S+++   P L W+A FF+EP+ML+ FVLLGR+LE+RA++KA+SDM  
Sbjct  258   SLVGFGSIAAFLLSAVSLLNPGLEWEASFFDEPIMLLGFVLLGRSLEERARLKASSDMND  317

Query  2474  LLNVLPSKARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPADGIV  2322
             LL+++ S++RLV+ S   + +S         ++EVP  ++ VGD I+VLPG+ IP DG V
Sbjct  318   LLSLVSSQSRLVITSSEEDPSSDNALSTDAISIEVPVDDVRVGDSILVLPGETIPVDGKV  377

Query  2321  RAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEE  2142
               GRS VDES  TGE LPV K  G  V+AG++N +G L +E    G  + I  I+++VE+
Sbjct  378   LGGRSVVDESMLTGESLPVFKERGLLVSAGTVNWDGPLRIEATTTGAMSTISKIIQMVED  437

Query  2141  AQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslasl  1980
             AQ++EAP+QRLAD ++G F Y VM LS ATF FW   G+ + P  L        G+   L
Sbjct  438   AQAQEAPIQRLADSIAGPFVYSVMTLSTATFAFWYYIGSHIFPEVLLNDIAGPHGNSLLL  497

Query  1979  alqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTG  1800
             +L+LS  VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + ++ +  DKTG
Sbjct  498   SLKLSTDVLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLAGIDVVALDKTG  557

Query  1799  TLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEA  1620
             TLT G+P V  V                ++  + E ++L LA+ VE  T+HPI KAI+  
Sbjct  558   TLTEGKPVVMAV----------------ASLAYKESEILRLAAAVEKTTSHPIAKAIITK  601

Query  1619  AKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQ  1440
             A+  N  +   +    + EPG G +A I+   V+VGT++WV      +    E  D +N+
Sbjct  602   AELLNLELPSTKGQ--LTEPGFGTLAEIDGCLVAVGTMNWVHERFQNKASHSELMDLENR  659

Query  1439  ---------------SVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSG  1308
                            S+V+VG +G  + G I + D LR DA+  V+ L ++GI T LLSG
Sbjct  660   IACLSSPVTSSNHSTSIVFVGREGEGIIGAIAISDILRHDAKSTVDRLQEKGIKTVLLSG  719

Query  1307  DKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALas  1134
             D++ A   V  +VGI  +N+   + P +KS  +S LQ +   VAMVGDGINDA   ALA 
Sbjct  720   DREEAVASVGEMVGIGHQNIRASLTPKKKSSIISSLQTEGHRVAMVGDGINDAPSLALAD  779

Query  1133  shvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLP  954
               V + I     AASD +SV+L+ NRL Q++DAL L++ TM  V QNL WA  YNIV +P
Sbjct  780   VGVALQIEAKENAASDAASVILLGNRLGQMVDALSLAQATMAKVHQNLAWAIAYNIVAIP  839

Query  953   VAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             +AAG+LLP     +TPS++G LM LSSI V++NSL LRL  +  ++E
Sbjct  840   IAAGVLLPQFDFAMTPSLSGGLMALSSIFVVSNSLFLRLHGSFTKRE  886



>ref|WP_023066882.1| copper-translocating P-type ATPase [Lyngbya aestuarii]
 gb|ERT06845.1| copper-translocating P-type ATPase [Lyngbya aestuarii BL J]
Length=781

 Score =   537 bits (1384),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 329/789 (42%), Positives = 487/789 (62%), Gaps = 51/789 (6%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC ++V+R L  Q  V SA VNL TE A V    EA  V        EELA+ L
Sbjct  28    GGMKCAGCVSAVERQLTQQTGVISARVNLATEVATVE--CEANTVE------AEELAQKL  79

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQL-QASGRGLAVSWALCAVCLVGHLSHFFG  2790
             T  GF +  R   R+   E  E      R ++ Q  GR +     L  +  +GHL HF  
Sbjct  80    TDTGFPSQPRSGSRQTA-EASENLAQRHRQEIRQQIGRVITCGL-LILLSGIGHLHHF--  135

Query  2789  AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
                  + +L++  FH  +    LL PGR +IIDG++SLL+ APNMNTLVGLG ++++  S
Sbjct  136   -GIGHLPILNNMWFHWGLATIALLFPGRAIIIDGIRSLLRNAPNMNTLVGLGTITAYTTS  194

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
              +A   P+LGW+ FF+EPVML+ F+LLG+ LEQ+A+ +AT+ +  L+ + P+ ARLV   
Sbjct  195   FVALLFPQLGWECFFDEPVMLLGFILLGKTLEQQARHRATNALQSLIALQPTMARLVPQP  254

Query  2429  DMGEQTS----TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVT  2262
                ++       VE+P   + VG+ + VLPG++IP DG + +G++TV+ES  TGE +PV 
Sbjct  255   QADQENQKIEQAVEIPAEQVRVGEWLKVLPGEKIPVDGEIFSGKTTVNESMLTGESMPVV  314

Query  2261  KLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFT  2082
             K  G +VAAG+IN +G++ ++  R    T +  IV LVE AQ+R+AP+Q LAD+V+G+FT
Sbjct  315   KESGEKVAAGTINQSGVIIIQATRTAENTTLAHIVSLVENAQTRKAPIQNLADQVAGYFT  374

Query  2081  YGVMALSAATFMFWNLFGTRVLPATLHQGslaslalql-------scsvlvvaCPCALGL  1923
             YGV++L+  TF+FW   GT++ P  +  G+               + +VLV+ACPCALGL
Sbjct  375   YGVISLATFTFLFWYGIGTKIWPDVIDFGASEMATHASLLLSMKLAIAVLVIACPCALGL  434

Query  1922  ATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHND  1743
             ATPTA++VG+ +GA RGLL++GG +LE    ++T+VFDKTGTLT G PTVT+ +    +D
Sbjct  435   ATPTAILVGSGIGAERGLLIKGGDILERVHQLDTVVFDKTGTLTTGHPTVTDCL--SISD  492

Query  1742  ETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEE  1563
               N++            ++L L + VE  ++HPI KAI+  A+ +   ++ A+D  F  E
Sbjct  493   HYNSE------------NLLQLVATVEQGSDHPIAKAIINQAQKQELSLLSADD--FQTE  538

Query  1562  PGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEF----DDFKNQSVVYVGVDGVLAGLI  1395
              G G  A +  K+V VG  +W+ + G+      EF     D   ++ VYV ++  L GLI
Sbjct  539   AGLGVSANVNGKRVWVGNQNWLIQQGI------EFPENTPDVAGKTAVYVALEKQLVGLI  592

Query  1394  YVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSK  1215
              V D L++DA+  V+ L K G+   +L+GD+ + A+ +A  + +  ENV   V+PD K K
Sbjct  593   AVSDPLKKDAKSTVKQLQKIGLKVIILTGDRADVAKSIAEQLDLSPENVLAEVRPDGKVK  652

Query  1214  FVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDA  1035
              ++ LQ+  + VAMVGDGINDA ALA ++VG+ +  G   A + + +VLM++ L  ++++
Sbjct  653   AITDLQQQGQQVAMVGDGINDAPALAQANVGIGLHTGTDVAMETADIVLMRDSLMDVVES  712

Query  1034  LELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTN  855
             + LSR T   ++QNL+WAFGYN +G+PVAAG+LLP  G +L+P+ A A M  SS+ V+TN
Sbjct  713   ISLSRSTFNKIRQNLFWAFGYNTLGIPVAAGLLLPGFGIILSPATAAAFMAFSSVSVVTN  772

Query  854   SLLLRLKFA  828
             SLLLR KF+
Sbjct  773   SLLLRRKFS  781



>ref|XP_010047398.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Eucalyptus 
grandis]
 gb|KCW79309.1| hypothetical protein EUGRSUZ_C00731 [Eucalyptus grandis]
Length=894

 Score =   540 bits (1391),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 358/815 (44%), Positives = 495/815 (61%), Gaps = 67/815 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC + VK +L +  RV SA VN+ T+TA V    EA    +    + E LA  LT
Sbjct  92    GMMCGGCVSRVKSVLSADARVESAVVNMLTQTAAVKLSPEALGGGDSAAGVAESLAGRLT  151

Query  2963  SCGFKANVRDSR---RENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
              CGF +  R S+    EN+ + +E     K   L  S   +A +W L A+C   H SH  
Sbjct  152   ECGFPSKRRSSKIGVAENV-KKWEDMAKKKEELLTKSRNRVAFAWTLVALCCGSHASHIL  210

Query  2792  G------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGA  2631
                    A  S+   LH++     + L  LL PGR L+ DGLK+  KG+PNMN+LVG G+
Sbjct  211   HSLGIHIAHGSFWEFLHNSYVKGGLALGALLGPGRDLLFDGLKAFKKGSPNMNSLVGFGS  270

Query  2630  LSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPS  2454
             L++F +SS++   P L W A FF+EPVML+ FVLLGR+LE++A++ A+SDM  LL+++ +
Sbjct  271   LAAFLISSVSLLNPGLDWDASFFDEPVMLLGFVLLGRSLEEKARVSASSDMNELLSLIST  330

Query  2453  KARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             ++RLV+ S   + ++          +EVP  ++  GD ++VLPG+ IP DG V AGRS V
Sbjct  331   QSRLVITSSESDLSADSVLCSEALCIEVPTDDIRAGDSVLVLPGETIPVDGKVLAGRSVV  390

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DES  TGE LPV K  G +V+AG+IN +G L +E    G  + I  I R+VE+AQ+REAP
Sbjct  391   DESMLTGESLPVFKEKGLRVSAGTINWDGPLRIEATTTGSNSTISKIFRMVEDAQAREAP  450

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscs  1959
             +QRLAD ++G F Y +M LSAATF FW   GT + P  L        G    L+L+LS  
Sbjct  451   IQRLADAIAGPFVYTIMTLSAATFAFWYYIGTHIFPDVLLNDIAGPDGDPLLLSLKLSVD  510

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVV+CPCALGLATPTA++VGTSLGA  GLL+RGG VLE  + V+ + FDKTGTLT G+P
Sbjct  511   VLVVSCPCALGLATPTAILVGTSLGAREGLLVRGGDVLERLASVDYVAFDKTGTLTEGKP  570

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
             TV+ V                ++  +SE +VL +A  VE    HP+ KAIV  A++ N  
Sbjct  571   TVSAV----------------ASLSYSESEVLRMAYAVERTALHPVAKAIVNEAEAMNMS  614

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV-----RRHGVGE-------------T  1473
             +        + EPG G +A ++   V+VG+LDWV     RR  + +              
Sbjct  615   LPVTRGQ--LSEPGYGTLAEVDGHLVAVGSLDWVHERFHRRPDLSDILNLEKAVMRQLSK  672

Query  1472  RVQEFDDFKNQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKN  1296
             RV    D  +Q+VVYVG +G  + G I + D+LR+DA+  V  L ++GI T LLSGD++ 
Sbjct  673   RVSPSKD--SQTVVYVGREGEGIIGAIAISDRLRQDAKSTVARLQEKGIKTILLSGDREE  730

Query  1295  AAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--g  1122
             A   +A  VGI  E++   + P +KS  +  LQ     VAMVGDGINDA +LAS+ V   
Sbjct  731   AVAKIAQTVGIGHESINASLTPQQKSDVILALQAAGNRVAMVGDGINDAPSLASADVGIA  790

Query  1121  vaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAG  942
             + I     AASD +S++L++++LSQ+++AL+L++ TM  V QNL WA  YN+V +P+AAG
Sbjct  791   LPIEAQETAASDAASIILLRSKLSQVVEALDLAQATMGKVYQNLSWAVAYNVVAVPIAAG  850

Query  941   ILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             +LLP     +TPS++G LM LSSI V+TNSLLLRL
Sbjct  851   VLLPQFDIAMTPSLSGGLMALSSIFVVTNSLLLRL  885



>ref|XP_010098373.1| Putative copper-transporting ATPase PAA1 [Morus notabilis]
 gb|EXB74897.1| Putative copper-transporting ATPase PAA1 [Morus notabilis]
Length=896

 Score =   539 bits (1389),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 352/820 (43%), Positives = 501/820 (61%), Gaps = 65/820 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQ-QLGEELAKHL  2967
             GM CGGC + V+ +L S  R+ SA+VN+ TETA +    E      +    + + LA+ L
Sbjct  96    GMMCGGCVSRVRSVLSSDERIESAAVNMLTETAAIKLKPEVAAEAGFSAANVADSLARRL  155

Query  2966  TSCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSH  2799
             T CGF +  R S     EN+ +   K+M  K+ +L    R  +A +W L A+C   H SH
Sbjct  156   TECGFSSKRRVSGAGVAENVRKW--KEMQKKKEELLVRSRNRVAFAWTLVALCCGSHASH  213

Query  2798  F---FG---AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGL  2637
                 FG   A  S+  +LH++     + L  LL PGR L+ DGL++L KG+PNMN+LVG 
Sbjct  214   LLHSFGIHVAHGSFFEVLHNSYLKGGLALSALLGPGRDLLFDGLRALRKGSPNMNSLVGF  273

Query  2636  GALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVL  2460
             G+L++FA+S+++   P+L W A FF+EPVML+ FVLLGR+LE+RA+++A+SDM  LL+++
Sbjct  274   GSLAAFAISAVSLLNPELQWDASFFDEPVMLLGFVLLGRSLEERARLRASSDMNELLSLI  333

Query  2459  PSKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRS  2307
              +++RLV+ S          +   +  VEV   ++ VGD ++VLPG+ IP DG V AGRS
Sbjct  334   STRSRLVITSSESESSTKNVLCSDSVCVEVLTDDIRVGDSVLVLPGETIPVDGKVLAGRS  393

Query  2306  TVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSRE  2127
              VDES  TGE LPV K  G  V+AG+IN +G L +E    G  + I  IVR+VE+AQ  E
Sbjct  394   VVDESMLTGESLPVFKEEGLSVSAGTINWDGPLRIEATSTGTNSTIAKIVRMVEDAQGHE  453

Query  2126  APVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqls  1965
             AP+QRLADK++G F Y VM LSAATF FW   G+   P  L        G    L+L+L+
Sbjct  454   APIQRLADKIAGPFVYSVMTLSAATFAFWYYIGSNAFPDVLLNNIAGPDGDPLLLSLKLA  513

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
               VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + ++ I  DKTGTLT G
Sbjct  514   VDVLVVSCPCALGLATPTAILVGTSLGARQGLLIRGGDVLERLAGIDYIALDKTGTLTEG  573

Query  1784  RPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRN  1605
             +P V+                S ++  + + ++L +A+ VE+  +HPI KAI   A+S  
Sbjct  574   KPAVS----------------SIASFVYEDSEILRIAAAVENTASHPIAKAITNKAESLG  617

Query  1604  CRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVR---------------RHGVGETR  1470
                     G  + EPG G +A ++   V+VG+L+WVR                H + ++ 
Sbjct  618   LS-TPVTTGQLV-EPGFGTLAEVDGCLVAVGSLEWVRDRFQTRTNTSDIMNLEHAIHQSS  675

Query  1469  VQEFDDFKNQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
             +       ++++VYVG +G  + G I V D LR DA+  +  L ++GI T LLSGD++ A
Sbjct  676   IGVAYSNYSKTIVYVGREGEGIIGAIAVSDSLRHDAKFTLNRLQQKGIKTVLLSGDREEA  735

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgv  1119
                VA VVGI +E++   + P +KS+ +S L+     +AMVGDGINDA   ALA   + +
Sbjct  736   VASVAEVVGIGKESIKSSLAPQKKSEVISSLKAGGYHIAMVGDGINDAPSLALADVGIAL  795

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
              I     AAS+ +S++L+ N+LSQ++DALEL++ TM  V QNL WA  YN+V +P+AAG 
Sbjct  796   RIEAQENAASNAASIILLGNKLSQVVDALELAQATMSKVYQNLAWAIAYNVVTIPIAAGA  855

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQ  819
             LLP     +TPS++G LM LSSI V+TNSLLL+L  + K+
Sbjct  856   LLPKFDFAMTPSLSGGLMALSSIFVVTNSLLLQLHGSDKR  895



>ref|WP_027254507.1| ATPase [Planktothrix agardhii]
Length=777

 Score =   535 bits (1378),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 329/784 (42%), Positives = 479/784 (61%), Gaps = 45/784 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L  Q  V S SVNL TE A        +V     Q   E LA+ LT
Sbjct  20    GMQCAGCVKAVERQLLQQQGVISVSVNLATEVA--------RVECTANQLNPENLAEILT  71

Query  2963  SCGFKANVRD---SRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             + GF   +R+   S  E L E  E+       Q+Q     +     L  +  +GHL HF 
Sbjct  72    NSGFPTQLRNLTSSATEKLKELQERHRQDMGKQIQR----IVTCGLLLLLSSIGHLHHFG  127

Query  2792  GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAV  2613
              A    IHLL +  FH  +    LL P R +IIDG +SL+  +PNMNTLVGLG L+++  
Sbjct  128   FAH---IHLLSNIWFHWGLATIALLFPARSIIIDGGRSLINNSPNMNTLVGLGTLTAYLT  184

Query  2612  SSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVV-  2436
             S +A   P+LGW+ FF+EPVML+ F+LLG+ LEQ A+ +A +    L+ + P+ ARLV  
Sbjct  185   SFVALLFPQLGWECFFDEPVMLLGFILLGKTLEQHARQRAATAFQSLIALQPTTARLVAP  244

Query  2435  NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKL  2256
              S      ++VE+P   + VG+ + VLPG++I  DG +R G++TVDES  TGE +P+ K 
Sbjct  245   QSQDNAILNSVEIPAEQVKVGEWLQVLPGEKIAVDGEIRFGKTTVDESMLTGESMPILKQ  304

Query  2255  PGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYG  2076
              G  ++AG+IN  G++ +E  R G +T +  IV+LVE AQ+R+AP+Q+LAD V+G+FTY 
Sbjct  305   IGDDISAGTINQTGVILIEATRTGSDTILAQIVQLVETAQTRKAPIQKLADIVAGYFTYF  364

Query  2075  VMALSAATFMFWNLFGTRVLPAT-------LHQGslaslalqlscsvlvvaCPCALGLAT  1917
             VM+L+  TF+FW   GTR+ P         +   +   L+L+L+ +VLV+ACPCALGLAT
Sbjct  365   VMSLAGLTFLFWYGLGTRIWPDVIPLAGIEIATNAPLLLSLKLAIAVLVIACPCALGLAT  424

Query  1916  PTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDET  1737
             PTA++VG+ +GA RGLL++GG +LE    +NT+VFDKTGTLT G P VT           
Sbjct  425   PTAILVGSGMGAERGLLIKGGDILERVHQLNTVVFDKTGTLTTGSPRVT-----------  473

Query  1736  NAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPG  1557
                 D  +  E S   ++ LA+ VE  +NHPI +AI+  AK +N  ++ A D  F  EPG
Sbjct  474   ----DCMTISELSPQQIVQLAATVEQGSNHPISEAILREAKEQNLSLLMASD--FQTEPG  527

Query  1556  SGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQL  1377
              G  A+IE + + VG L  +  H +     +   +F  +++VYV +DG + GL+ + D L
Sbjct  528   LGVSAIIENQTIFVGNLAGLIEHKINYP--ETLPEFLGKTIVYVTIDGKVVGLMAMSDPL  585

Query  1376  REDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQ  1197
             + DA+  V  L   G+   LL+GD+++ A  +A  + +  E++F  V+P+ K   +  LQ
Sbjct  586   KTDAKSTVSQLQNLGLRVILLTGDRQSVANAIAIELNLKSEDIFAEVRPEGKVNLIQTLQ  645

Query  1196  KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRL  1017
             +  +VVAMVGDGINDA ALA + +G+ +  G   A++ + +VL +N L  ++D+++LSR 
Sbjct  646   QQNQVVAMVGDGINDAPALAQADIGIGLQTGTDVANETADIVLTRNSLIDIVDSIQLSRA  705

Query  1016  TMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             T   ++QNL+WAFGYN++ +P+AAG+L P  G +L+PS AGALM LSS+ V+TNSLLLR 
Sbjct  706   TFNKIRQNLFWAFGYNVLAIPLAAGLLFPQFGILLSPSTAGALMALSSVTVVTNSLLLRR  765

Query  836   KFAS  825
             +  S
Sbjct  766   QLKS  769



>ref|XP_004141341.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
isoform 1 [Cucumis sativus]
Length=912

 Score =   540 bits (1390),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 368/843 (44%), Positives = 495/843 (59%), Gaps = 93/843 (11%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVW-----PVSEAKVVPNWQQQLGEEL  2979
             GM CG C + VK IL S  RV S  VN+ TETA +       V+EA    N    + E L
Sbjct  95    GMMCGACVSRVKSILSSDDRVDSVVVNMLTETAAIRLRSGEVVAEADSAVN----VAESL  150

Query  2978  AKHLTSCGFKANVRDSR---RENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGH  2808
             A+ LT CGF  ++R+S     EN+   ++  +  KR  L  S   +A++W L A+C   H
Sbjct  151   ARRLTDCGFPTSLRNSELGVAENV-RKWKDMVEKKRELLIKSRNRVAIAWTLVALCCGSH  209

Query  2807  LSHFFGAKASWIH------LLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTL  2646
              SH        IH      +LH++       L  LL PGR L+ DGL++  KG+PNMN+L
Sbjct  210   ASHILHPLGIHIHNGPLMEILHNSYVKGCFALVALLGPGRDLLFDGLRAFRKGSPNMNSL  269

Query  2645  VGLGALSSFAVSSMAAFIPKLGWKA-FFEEPV--------------MLIAFVLLGRNLEQ  2511
             VG GA+++F +S+++   P L W A FF+EPV              ML+AFVLLGR LE+
Sbjct  270   VGFGAVAAFIISAVSLLNPALDWDASFFDEPVTCSTFSCIIVIQLVMLLAFVLLGRTLEE  329

Query  2510  RAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSN----------LSVGDQII  2361
             RA++KA+SDM  LL+++ S +RLV+    G  +ST +V CS+          + VGD ++
Sbjct  330   RARVKASSDMNELLSLISSHSRLVITPSEG-NSSTTDVLCSDAMCIKVSTDDIRVGDSVL  388

Query  2360  VLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGG  2181
             V PG+ +P DG V AGRS VDES  TGE LPV K  G  V+AG++N +G L +E    G 
Sbjct  389   VFPGETVPVDGKVLAGRSVVDESMLTGESLPVFKEAGLMVSAGTVNWDGPLRIEASSTGL  448

Query  2180  ETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL-  2004
              + I  IVR+VE+AQ  EAP+QRLAD ++G F Y V+ LS ATF FW  FGTR+ P  L 
Sbjct  449   NSTISKIVRMVEDAQGHEAPIQRLADSIAGPFVYTVLTLSVATFTFWYCFGTRIFPDVLI  508

Query  2003  -----HQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLES  1839
                    G    L+L+LS  VLVV+CPCALGLATPTA++VGTSLGA RGLL+RGG VLE 
Sbjct  509   NDIAGPDGDPLLLSLKLSVDVLVVSCPCALGLATPTAILVGTSLGARRGLLIRGGDVLER  568

Query  1838  FSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVES  1659
              + ++ +  DKTGTLT G+PTV+ VV   + +E                D+L +A+ VE 
Sbjct  569   LANIDCVALDKTGTLTEGKPTVSSVVSFVYGEE----------------DILQVAAAVEK  612

Query  1658  NTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVG  1479
               +HPI KAI++ A+S N  I     G  + EPG G+ A +  + V+VG+L+WV      
Sbjct  613   TASHPIAKAIIDKAESLNLTI-PVTRGQLV-EPGFGSFANVNGRLVAVGSLEWVNDR--F  668

Query  1478  ETRVQEFDDFKN------------------QSVVYVGVDGV-LAGLIYVEDQLREDARHV  1356
             E +   F D KN                  ++VVYVG +G  + G I + DQLR DA   
Sbjct  669   EKKASTF-DLKNLEHSVYRSLKGISSSNNSKTVVYVGSEGEGIIGAIVISDQLRYDAEST  727

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             V  L K+GI T LLSGD++ A   VA  VGI  E V   + P  KS  +S L+     VA
Sbjct  728   VNRLQKKGIRTVLLSGDREEAVASVAKTVGIEEEFVHSSLTPQGKSDLISTLKSAGHRVA  787

Query  1175  MVGDGINDAAALasshv--gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTV  1002
             MVGDGINDA +LASS V   + +     AAS+ +S++L+ NR+SQL+DA+EL++ TM  V
Sbjct  788   MVGDGINDAPSLASSDVGIALQLESHENAASNAASILLLGNRISQLVDAMELAQATMSKV  847

Query  1001  KQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASK  822
              QNL WA  YN V +P+AAG+LLP     +TPS++G LM LSSI V+TNSLLL++    +
Sbjct  848   YQNLSWAIAYNAVAIPIAAGVLLPGFDFAMTPSLSGGLMALSSIFVVTNSLLLQIHAPKE  907

Query  821   QKE  813
              K 
Sbjct  908   AKR  910



>gb|AFW65111.1| hypothetical protein ZEAMMB73_571389 [Zea mays]
Length=537

 Score =   526 bits (1356),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 256/384 (67%), Positives = 314/384 (82%), Gaps = 21/384 (5%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM+CGGCAASVKRILES+P+V SA+VNL TE AVVW V E  VV +W++QLGE+LA  L
Sbjct  135   GGMSCGGCAASVKRILESEPQVRSATVNLATEMAVVWAVPEDSVVQDWKEQLGEKLANQL  194

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+CG+K+N+RDS +      FE+KM  K  QL+ SGR LAVSWALCAVCLVGH+SH FG 
Sbjct  195   TTCGYKSNLRDSSKVGSQTVFERKMQDKLEQLKQSGRELAVSWALCAVCLVGHISHLFGV  254

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
                 +H++HSTGFH+S+ +FT + PGR+LI+DGLKSLLKG+PNMNTLVGLGALSSFAVSS
Sbjct  255   NMPLMHVIHSTGFHLSLSIFTFVGPGRRLILDGLKSLLKGSPNMNTLVGLGALSSFAVSS  314

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +AAFIPKL                    NLEQRAK+KATSDMTGLL++LPSKARL+V++D
Sbjct  315   IAAFIPKL--------------------NLEQRAKLKATSDMTGLLSILPSKARLMVDND  354

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               E++S +EVPC  L+VGD ++VLPGD IPADGIV+AGRSTVDESS TGEP+PVTK+ GA
Sbjct  355   -AEKSSLIEVPCDTLAVGDYVVVLPGDHIPADGIVKAGRSTVDESSLTGEPMPVTKITGA  413

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             +V+AGSINLNG LTVEV+RPGGET + DI+ LVEEAQ+R APVQRLADKV+G+FTYGVMA
Sbjct  414   EVSAGSINLNGKLTVEVRRPGGETVMSDILHLVEEAQTRAAPVQRLADKVAGNFTYGVMA  473

Query  2066  LSAATFMFWNLFGTRVLPATLHQG  1995
             LSAAT+MFW++ G++++PA +  G
Sbjct  474   LSAATYMFWSILGSQLVPAAIQHG  497



>ref|WP_026794855.1| MULTISPECIES: ATPase [Planktothrix]
Length=784

 Score =   535 bits (1378),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 331/784 (42%), Positives = 480/784 (61%), Gaps = 45/784 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L  Q  V S SVNL T  A V   +  ++ P       E LA+ LT
Sbjct  27    GMQCAGCVKAVERQLLQQQGVISVSVNLATAVARV-ECAANQINP-------ESLAEILT  78

Query  2963  SCGFKANVRD---SRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             + GF   +R+   S  E L E  E+       Q+Q     +     L  +  +GHL HF 
Sbjct  79    NTGFPTQLRNLTSSATEKLKELQERHRQDMGKQIQR----IVTCGLLLLLSSIGHLHHFG  134

Query  2792  GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAV  2613
              A    IHLL +  FH  +    LL P R +IIDG +SLL  APNMNTLVGLG L+++  
Sbjct  135   FAH---IHLLSNIWFHWGLATIALLFPARSIIIDGGRSLLNNAPNMNTLVGLGTLTAYLT  191

Query  2612  SSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVV-  2436
             S +A   P+LGW+ FF+EPVML+ F+LLG+ LEQ A+ +A +    L+ + P+ ARLV  
Sbjct  192   SFVALLFPQLGWECFFDEPVMLLGFILLGKTLEQHARQRAATAFQSLIALQPTTARLVAP  251

Query  2435  NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKL  2256
              S      ++VE+P   + VG+ + VLPG++I  DG +R G++TVDES  TGE +P+ K 
Sbjct  252   QSQDNAILNSVEIPAEQVKVGEWLQVLPGEKIAVDGEIRFGKTTVDESMLTGESMPILKQ  311

Query  2255  PGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYG  2076
              G  ++AG+IN  G++ +E  R G +T +  IV+LVE AQ+R+AP+Q+LAD V+G+FTY 
Sbjct  312   IGDDISAGTINQTGVILIEATRTGSDTILAQIVQLVETAQTRKAPIQKLADIVAGYFTYF  371

Query  2075  VMALSAATFMFWNLFGTRVLPAT-------LHQGslaslalqlscsvlvvaCPCALGLAT  1917
             VM+L+  TF+FW   GTR+ P         +   +   L+L+L+ +VLV+ACPCALGLAT
Sbjct  372   VMSLAGLTFLFWYGLGTRIWPDVIPLAGIEIATNAPLLLSLKLAIAVLVIACPCALGLAT  431

Query  1916  PTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDET  1737
             PTA++VG+ +GA RGLL++GG +LE    +NT+VFDKTGTLT G P VT           
Sbjct  432   PTAILVGSGIGAERGLLIKGGDILERVHQLNTVVFDKTGTLTTGSPMVT-----------  480

Query  1736  NAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPG  1557
                 D  +  E S   +L LA+ VE  +NHPI +AI+  AK +N  ++ A D  F  EPG
Sbjct  481   ----DCITISELSPQQILQLAATVEQGSNHPISEAILREAKEQNLSLLMASD--FQTEPG  534

Query  1556  SGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQL  1377
              G  A+IE + + VG L  +  H +     +   +F  +++VYV +DG + GL+ + D L
Sbjct  535   LGVSAIIENQTIFVGNLAGLIEHKINYP--ETLPEFLGKTIVYVTIDGKVVGLMAMSDPL  592

Query  1376  REDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQ  1197
             + DA+  V  L   G+   LL+GD+++ A  +A  + +  E++F  V+P+ K   +  LQ
Sbjct  593   KTDAKLTVSQLQNLGLRVILLTGDRQSVANAIAIELNLKSEDIFAEVRPEGKVNLIQTLQ  652

Query  1196  KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRL  1017
             +  +VVAMVGDGINDA ALA + +G+ +  G   A++ + +VL +N L  ++D+++LSR 
Sbjct  653   QQNQVVAMVGDGINDAPALAQADIGIGLQTGTDVANETADIVLTRNSLIDIVDSIQLSRA  712

Query  1016  TMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             T   ++QNL+WAFGYN++ +P+AAG+L P  G +L+PS AGALM LSS+ V+TNSLLLR 
Sbjct  713   TFNKIRQNLFWAFGYNVLAIPLAAGLLFPQFGILLSPSTAGALMALSSVTVVTNSLLLRR  772

Query  836   KFAS  825
             +  S
Sbjct  773   QLKS  776



>gb|EEE58431.1| hypothetical protein OsJ_09636 [Oryza sativa Japonica Group]
Length=916

 Score =   539 bits (1389),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 365/843 (43%), Positives = 499/843 (59%), Gaps = 97/843 (12%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGCAA V+ IL +  RV +A+VNL  E+A V   S        +   G+ELA  LT
Sbjct  96    GMMCGGCAARVRTILAADERVETAAVNLLAESAAVRLRSP-------EPAAGKELAARLT  148

Query  2963  SCGFKANVR---------DSRRENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLV  2814
              CGF +  R         DS R+       ++M A++A+L    RG +A +W L A+C  
Sbjct  149   ECGFPSVARRGGAASGASDSARK------WREMAARKAELLTRSRGRVAFAWTLVALCCG  202

Query  2813  GHLSHFFGA------KASWIHLLHSTGFHMSMCLFTLLVPGR--------------QLII  2694
              H +HF  +        +++ LLH++     + +  L  PGR               ++ 
Sbjct  203   SHATHFLHSLGIHVGHGTFLDLLHNSYVKCGIAIAALFGPGRGFLSFSQNVFNVTPDILF  262

Query  2693  DGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNL  2517
             DGL++  +G+PNMN+LVG G+ ++FA+SS++   P+L W + FF+EPVML+ FVLLGR+L
Sbjct  263   DGLRAFKQGSPNMNSLVGFGSAAAFAISSVSLLNPELEWNSTFFDEPVMLLGFVLLGRSL  322

Query  2516  EQRAKIKATSDMTGLLNVLPSKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQI  2364
             E+ A++KA+SDM  L+++L  ++RLVV S          +     TVEVP  ++ VGD I
Sbjct  323   EESARLKASSDMNELVSLLSPQSRLVVTSSSDDPSSDGVLNSDAITVEVPVDDVRVGDFI  382

Query  2363  IVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPG  2184
             +VLPG+ IP DG V  G S VDES  TGE LPV K  G  V AG++N +G L ++    G
Sbjct  383   LVLPGETIPVDGNVLGGSSFVDESMLTGESLPVPKEKGFPVFAGTVNWDGPLKIKATTTG  442

Query  2183  GETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL  2004
               + I  IVR+VE+AQ+REAPVQRLAD ++G F Y VM LSAATF FW   GT + P  L
Sbjct  443   PSSTIAKIVRMVEDAQAREAPVQRLADSIAGPFVYTVMTLSAATFSFWYYIGTHIFPEVL  502

Query  2003  ------HQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLE  1842
                     G    L+L+L+  VLVV+CPCALGLATPTA+++GTSLGA RGLL+RGG VLE
Sbjct  503   LNDISGPDGDSLLLSLKLAVDVLVVSCPCALGLATPTAILIGTSLGAKRGLLIRGGDVLE  562

Query  1841  SFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVE  1662
               + ++ IV DKTGTLT GRP VT                S ++  + E ++L LA+ VE
Sbjct  563   RLAGIDAIVLDKTGTLTKGRPVVT----------------SIASLAYEEAEILRLAAAVE  606

Query  1661  SNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGV  1482
                 HPI  AI+E A+     I  A  G  + EPG G +A ++   V+VGTLDWV     
Sbjct  607   KTALHPIANAIMEEAELLKLDI-PATSGQ-LTEPGFGCLAEVDGCLVAVGTLDWVHNRFE  664

Query  1481  GETRVQEFDDFKN---------------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVE  1350
              +    E  D  N               +S+ YVG +G  + G I V D LR+DA+  V+
Sbjct  665   TKASSTELTDLGNHLEFVSSSEASSNHSKSIAYVGREGEGIIGAIAVSDVLRDDAKATVD  724

Query  1349  SLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMV  1170
              L ++ I T+LLSGD+K A E +   VGI  EN+   + P EK+  ++ LQ + + VAMV
Sbjct  725   RLQQEEILTFLLSGDRKEAVESIGRTVGIRSENIKSSLTPHEKAGIITALQGEGRRVAMV  784

Query  1169  GDGINDAAALassh--vgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             GDGINDA +LA++   V +       AASD +SVVL+ NRLSQ++DAL LS+ TM  V Q
Sbjct  785   GDGINDAPSLAAADVGVAMRTNSKESAASDAASVVLLGNRLSQVMDALSLSKATMAKVHQ  844

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL--KFASK  822
             NL WA  YNIV +P+AAG+LLP     +TPS++G LM LSSI V++NSLLL+L   F S 
Sbjct  845   NLAWAVAYNIVAIPIAAGVLLPQFDFAMTPSLSGGLMALSSIFVVSNSLLLQLHGSFQST  904

Query  821   QKE  813
             +K+
Sbjct  905   EKQ  907



>gb|EEC74624.1| hypothetical protein OsI_10243 [Oryza sativa Indica Group]
Length=916

 Score =   539 bits (1389),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 365/843 (43%), Positives = 499/843 (59%), Gaps = 97/843 (12%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGCAA V+ IL +  RV +A+VNL  E+A V   S        +   G+ELA  LT
Sbjct  96    GMMCGGCAARVRTILAADERVETAAVNLLAESAAVRLRSP-------EPAAGKELAARLT  148

Query  2963  SCGFKANVR---------DSRRENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLV  2814
              CGF +  R         DS R+       ++M A++A+L    RG +A +W L A+C  
Sbjct  149   ECGFPSVARRGGAASGASDSARK------WREMAARKAELLTRSRGRVAFAWTLVALCCG  202

Query  2813  GHLSHFFGA------KASWIHLLHSTGFHMSMCLFTLLVPGR--------------QLII  2694
              H +HF  +        +++ LLH++     + +  L  PGR               ++ 
Sbjct  203   SHATHFLHSLGIHVGHGTFLDLLHNSYVKCGIAIAALFGPGRGFLSFSQNVFNVTPDILF  262

Query  2693  DGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNL  2517
             DGL++  +G+PNMN+LVG G+ ++FA+SS++   P+L W + FF+EPVML+ FVLLGR+L
Sbjct  263   DGLRAFKQGSPNMNSLVGFGSAAAFAISSVSLLNPELEWNSTFFDEPVMLLGFVLLGRSL  322

Query  2516  EQRAKIKATSDMTGLLNVLPSKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQI  2364
             E+ A++KA+SDM  L+++L  ++RLVV S          +     TVEVP  ++ VGD I
Sbjct  323   EESARLKASSDMNELVSLLSPQSRLVVTSSSDDPSSDGVLNSDAITVEVPVDDVRVGDFI  382

Query  2363  IVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPG  2184
             +VLPG+ IP DG V  G S VDES  TGE LPV K  G  V AG++N +G L ++    G
Sbjct  383   LVLPGETIPVDGNVLGGSSFVDESMLTGESLPVPKEKGFPVFAGTVNWDGPLKIKATTTG  442

Query  2183  GETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL  2004
               + I  IVR+VE+AQ+REAPVQRLAD ++G F Y VM LSAATF FW   GT + P  L
Sbjct  443   PSSTIAKIVRMVEDAQAREAPVQRLADSIAGPFVYTVMTLSAATFSFWYYIGTHIFPEVL  502

Query  2003  ------HQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLE  1842
                     G    L+L+L+  VLVV+CPCALGLATPTA+++GTSLGA RGLL+RGG VLE
Sbjct  503   LNDISGPDGDSLLLSLKLAVDVLVVSCPCALGLATPTAILIGTSLGAKRGLLIRGGDVLE  562

Query  1841  SFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVE  1662
               + ++ IV DKTGTLT GRP VT                S ++  + E ++L LA+ VE
Sbjct  563   RLAGIDAIVLDKTGTLTKGRPVVT----------------SIASLAYQEAEILRLAAAVE  606

Query  1661  SNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGV  1482
                 HPI  AI+E A+     I  A  G  + EPG G +A ++   V+VGTLDWV     
Sbjct  607   KTALHPIANAIMEEAELLKLDI-PATSGQ-LTEPGFGCLAEVDGCLVAVGTLDWVHNRFE  664

Query  1481  GETRVQEFDDFKN---------------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVE  1350
              +    E  D  N               +S+ YVG +G  + G I V D LR+DA+  V+
Sbjct  665   TKASSTELTDLGNHLEFVSSSEASSNHSKSIAYVGREGEGIIGAIAVSDVLRDDAKATVD  724

Query  1349  SLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMV  1170
              L ++ I T+LLSGD+K A E +   VGI  EN+   + P EK+  ++ LQ + + VAMV
Sbjct  725   RLQQEEILTFLLSGDRKEAVESIGRTVGIRSENIKSSLTPHEKAGIITALQGEGRRVAMV  784

Query  1169  GDGINDAAALassh--vgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             GDGINDA +LA++   V +       AASD +SVVL+ NRLSQ++DAL LS+ TM  V Q
Sbjct  785   GDGINDAPSLAAADVGVAMRTNSKESAASDAASVVLLGNRLSQVMDALSLSKATMAKVHQ  844

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL--KFASK  822
             NL WA  YNIV +P+AAG+LLP     +TPS++G LM LSSI V++NSLLL+L   F S 
Sbjct  845   NLAWAVAYNIVAIPIAAGVLLPQFDFAMTPSLSGGLMALSSIFVVSNSLLLQLHGSFQST  904

Query  821   QKE  813
             +K+
Sbjct  905   EKQ  907



>emb|CDY16605.1| BnaC09g36680D [Brassica napus]
Length=885

 Score =   538 bits (1386),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 357/817 (44%), Positives = 497/817 (61%), Gaps = 74/817 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLG---EELAK  2973
             GM CGGC A VK +L S  RV+SA VN+ TETA V      ++ P  ++ +    E LAK
Sbjct  86    GMMCGGCVARVKSVLMSDDRVASAVVNMLTETAAV------RLKPEVEEAMADAAESLAK  139

Query  2972  HLTSCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHL  2805
              LT  GF+A  R S     EN+ +   K+M +K+ +L    R  +A +W L A+C   H 
Sbjct  140   RLTESGFEAKRRVSGMGVAENVKKW--KEMVSKKEELLVKSRNRVAFAWTLVALCCGSHT  197

Query  2804  SHFFG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLV  2643
             SH         A   +  LLH++     + +  LL PGR+L+ DG+K+  K +PNMN+LV
Sbjct  198   SHILHSVGIHIAHGGFWDLLHNSYVKGGLAVGALLGPGRELLFDGIKAFGKRSPNMNSLV  257

Query  2642  GLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLN  2466
             GLG++++FA+S ++   P L W A FFEEPVML+ FVLLGR+LE+RAK+KA+SDM  LL+
Sbjct  258   GLGSMAAFAISLISLVNPDLEWDASFFEEPVMLLGFVLLGRSLEERAKLKASSDMNELLS  317

Query  2465  VLPSKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAG  2313
             ++ +++RLV+ S          +   +  + VP   + VGD ++VLPG+  P DG V AG
Sbjct  318   LISTQSRLVITSSDNNTAADSVLSSDSICINVPVDEIRVGDSLLVLPGETFPVDGNVLAG  377

Query  2312  RSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQS  2133
             RS VDES  TGE LPV K  G  V+AG+IN +G L +E    G  + I  IV++VEEAQ 
Sbjct  378   RSVVDESMLTGESLPVYKEEGCSVSAGTINWDGPLRIEASSTGSNSTISKIVKMVEEAQG  437

Query  2132  REAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalq  1971
               APVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+L+
Sbjct  438   NAAPVQRLADAIAGPFVYTIMSLSAVTFAFWYYIGSHIFPDVLLNDIAGPDGDPLALSLK  497

Query  1970  lscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLT  1791
             L+  VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + ++ +  DKTGTLT
Sbjct  498   LAVDVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASIDCVALDKTGTLT  557

Query  1790  IGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKS  1611
              GRP V+ V                 +  + E +VL LA+ VE    HPI KAIV  A++
Sbjct  558   EGRPIVSGV----------------GSLIYEEQEVLKLAAAVEKTATHPIAKAIVNEAEA  601

Query  1610  RNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV--RRHGVGET----RVQEFDDF  1449
              N      E    + EPG G +A I+ + V+VG L+WV  R H   ++    +++ + D 
Sbjct  602   LNLE--TPETRGQLTEPGFGTLAEIDGRLVAVGALEWVANRFHKKNDSSDVVKLENYLDR  659

Query  1448  K----------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDK  1302
             K          +++VVYVG +G  + G I + D LR+DA   V  L ++GI T LLSGD+
Sbjct  660   KLSSTSLTSRYSKTVVYVGREGEGIIGAIAISDCLRKDAEFTVARLQEKGIKTILLSGDR  719

Query  1301  KNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv-  1125
             + A   VA  VGI  E+  Y + PD+K +F+S LQ     VAMVGDGINDA +LA + V 
Sbjct  720   EGAVATVAKNVGIETESTNYSLSPDKKFEFISNLQSSGHRVAMVGDGINDAPSLAQADVG  779

Query  1124  -gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVA  948
               + I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P+A
Sbjct  780   IALKIEAQENAASNAASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIPIA  839

Query  947   AGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             AG+LLP     +TPS++G LM LSSI V++NSLLL+L
Sbjct  840   AGVLLPRYDFAMTPSLSGGLMALSSIFVVSNSLLLQL  876



>ref|XP_009414814.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=882

 Score =   538 bits (1386),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 353/822 (43%), Positives = 503/822 (61%), Gaps = 71/822 (9%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM CG CAA V+ IL +  RV SA+VN+ TETA V   +      +  +++ EELA+ L
Sbjct  77    GGMMCGACAARVRSILSADDRVDSAAVNMLTETAAVRLGTSG----DEPERVAEELAERL  132

Query  2966  TSCGFKANVRDSR---RENLFETFEKKMNAKRAQLQASGRGLAV-SWALCAVCLVGHLSH  2799
               CGF +  R +    +EN+ +   ++M  ++ +L A+ R   V +W L A+C   H +H
Sbjct  133   AQCGFPSKRRRTGLGVQENVRKW--REMAERKEKLLAASRNRVVFAWTLVALCCGSHGTH  190

Query  2798  FFG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGL  2637
                      A  S++ +LH++     + L +LL PGR+L++DGL++    +PNMN+LVG 
Sbjct  191   LLHSLGIHVAHGSFLDILHNSYVKCGIALGSLLGPGRELLLDGLRAFANASPNMNSLVGF  250

Query  2636  GALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVL  2460
             G++++F +S+M+   P L W+A FF+EPVML+ FVLLGR+LE+RA+++A+SDM  LL+++
Sbjct  251   GSIAAFLISAMSLLNPGLQWEASFFDEPVMLLGFVLLGRSLEERARLQASSDMNELLSLV  310

Query  2459  PSKARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRS  2307
              S++RL+++S     TS         ++EVP  ++ +GD I+VLPG+ IP DG V  GRS
Sbjct  311   SSQSRLIISSPEENPTSDSFLSADAISIEVPTDDVRIGDTILVLPGETIPVDGKVLGGRS  370

Query  2306  TVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSRE  2127
              VDES  TGE LPV K  G  V+AG++N +G L +E  + G  + I  IVR+VEEAQ+ +
Sbjct  371   VVDESMLTGESLPVFKEHGHSVSAGTVNWDGPLRIEAVKTGAMSTISKIVRMVEEAQAHQ  430

Query  2126  APVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqls  1965
             AP+QRLAD ++G F Y VM LSAATF FW   GT + P  L             L+L+LS
Sbjct  431   APIQRLADSIAGPFVYSVMTLSAATFAFWYYIGTHIFPDVLLNDIAGPDADPLLLSLKLS  490

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
               VLVV+CPCALGLATPTA++VGTS+GA +GLL+RGG+VLE  + ++ I  DKTGTLT G
Sbjct  491   VDVLVVSCPCALGLATPTAILVGTSMGAKQGLLIRGGNVLERLAGIDVIALDKTGTLTEG  550

Query  1784  RPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRN  1605
             +P VT +                ++ ++ E ++L LA+ VE   +HPI KAI++ A+S N
Sbjct  551   KPVVTAI----------------ASLDYEESEILRLAAAVEKTASHPIAKAILDKAESLN  594

Query  1604  CRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN------  1443
                V +  G  + EPG G++A ++   V+VG LDWV      +    E  D +N      
Sbjct  595   FG-VPSTSGQ-LTEPGFGSLAEVDGSLVAVGRLDWVHERFQKKASTSELLDLENRVGCLS  652

Query  1442  ----------QSVVYVGV-DGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKN  1296
                       +SVVYVG  D  + G I + D LR DA+  V  L   GI + L+SGD++ 
Sbjct  653   SSMATSSKQSKSVVYVGKEDEGIIGAIAISDVLRYDAKSTVSKLQGMGIKSVLVSGDREE  712

Query  1295  AAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvg  1122
             A   V  +VGI   N    + P +KS  +S LQ +   VAMVGDGINDA   ALA   V 
Sbjct  713   AVTSVGEMVGIGTINA--ALTPQQKSSIISSLQAEGHSVAMVGDGINDAPSLALADVGVA  770

Query  1121  vaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAG  942
             + I     AASD +SV+L+ NRLSQ++DA+ L++ TM  V QNL WA  YN V +P+AAG
Sbjct  771   LQIEAKENAASDAASVILLGNRLSQIVDAISLAQATMAKVHQNLAWAVAYNAVAIPIAAG  830

Query  941   ILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             +LLP     +TPS++G LM LSSI V++NSLLL+L  +  +K
Sbjct  831   VLLPNFDFAMTPSLSGGLMALSSIFVVSNSLLLQLHGSFPKK  872



>ref|XP_004157377.1| PREDICTED: LOW QUALITY PROTEIN: copper-transporting ATPase PAA2, 
chloroplastic-like [Cucumis sativus]
Length=912

 Score =   538 bits (1387),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 368/843 (44%), Positives = 494/843 (59%), Gaps = 93/843 (11%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVW-----PVSEAKVVPNWQQQLGEEL  2979
             GM CG C + VK IL S  RV S  VN+ TETA +       V+EA    N    + E L
Sbjct  95    GMMCGACVSRVKSILSSDDRVDSVVVNMLTETAAIRLRSGEVVAEADSAVN----VAESL  150

Query  2978  AKHLTSCGFKANVRDSR---RENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGH  2808
             A+ LT CGF  ++R+S     EN+   ++  +  KR  L  S   +A++W L A+C   H
Sbjct  151   ARRLTDCGFPTSLRNSELGVAENV-RKWKDMVEKKRELLIKSRNRVAIAWTLVALCCGSH  209

Query  2807  LSHFFGAKASWIH------LLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTL  2646
              SH        IH      +LH++       L  LL PGR L+ DGL++  KG+PNMN+L
Sbjct  210   ASHILHPLGIHIHNGPLMEILHNSYVKGCFALVALLGPGRDLLFDGLRAFRKGSPNMNSL  269

Query  2645  VGLGALSSFAVSSMAAFIPKLGWKA-FFEEPV--------------MLIAFVLLGRNLEQ  2511
             VG GA+++F +S+++   P L W A FF+EPV              ML+AFVLLGR LE+
Sbjct  270   VGFGAVAAFIISAVSLLNPALDWDASFFDEPVTCSTFSCIIVIQLVMLLAFVLLGRTLEE  329

Query  2510  RAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSN----------LSVGDQII  2361
             RA++KA+SDM  LL+++ S +RLV+    G  +ST +V CS+          + VGD ++
Sbjct  330   RARVKASSDMNELLSLISSHSRLVITPSEG-NSSTTDVLCSDAMCIKVSTDDIRVGDSVL  388

Query  2360  VLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGG  2181
             V PG+ +P DG V AGRS VDES  TGE LPV K  G  V+AG++N +G L +E    G 
Sbjct  389   VFPGETVPVDGKVLAGRSVVDESMLTGESLPVFKEAGLMVSAGTVNWDGPLRIEASSTGL  448

Query  2180  ETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL-  2004
              + I  IVR+VE+AQ  EAP+QRLAD ++G F Y V+ LS ATF FW  FGTR+ P  L 
Sbjct  449   NSTISKIVRMVEDAQGHEAPIQRLADSIAGPFVYTVLTLSVATFTFWYCFGTRIFPDVLI  508

Query  2003  -----HQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLES  1839
                    G    L+L+LS  VLVV+CPCALGLATPTA++VGTSLGA RGLL+RGG VLE 
Sbjct  509   NDIAGPDGDPLLLSLKLSVDVLVVSCPCALGLATPTAILVGTSLGARRGLLIRGGDVLER  568

Query  1838  FSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVES  1659
              + ++ +  DKTGTLT G+PTV+ VV   + +E                D+L +A+ VE 
Sbjct  569   LANIDCVALDKTGTLTEGKPTVSSVVSFVYGEE----------------DILQVAAAVEK  612

Query  1658  NTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVG  1479
               +HPI KAI++ A+S N  I     G  + EPG G+ A +  + V+VG+L+WV      
Sbjct  613   TASHPIAKAIIDKAESLNLTI-PVTRGQLV-EPGFGSFANVNGRLVAVGSLEWVNDR--F  668

Query  1478  ETRVQEFDDFKN------------------QSVVYVGVDGV-LAGLIYVEDQLREDARHV  1356
             E     F D KN                  ++VVYVG +G  + G I + DQLR DA   
Sbjct  669   EKXASTF-DLKNLEHSVYRSLKGISSSNNSKTVVYVGSEGEGIIGAIVISDQLRYDAEST  727

Query  1355  VESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVA  1176
             V  L K+GI T LLSGD++ A   VA  VGI  E V   + P  KS  +S L+     VA
Sbjct  728   VNRLQKKGIRTVLLSGDREEAVASVAKTVGIEEEFVHSSLTPQGKSDLISTLKSAGHRVA  787

Query  1175  MVGDGINDAAALasshv--gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTV  1002
             MVGDGINDA +LASS V   + +     AAS+ +S++L+ NR+SQL+DA+EL++ TM  V
Sbjct  788   MVGDGINDAPSLASSDVGIALQLESHENAASNAASILLLGNRISQLVDAMELAQATMSKV  847

Query  1001  KQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASK  822
              QNL WA  YN V +P+AAG+LLP     +TPS++G LM LSSI V+TNSLLL++    +
Sbjct  848   YQNLSWAIAYNAVAIPIAAGVLLPGFDFAMTPSLSGGLMALSSIFVVTNSLLLQIHAPKE  907

Query  821   QKE  813
              K 
Sbjct  908   AKR  910



>ref|XP_004245045.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Solanum 
lycopersicum]
Length=894

 Score =   538 bits (1385),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 352/822 (43%), Positives = 492/822 (60%), Gaps = 71/822 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CG C + VK IL +  RV SA VN+ TETA V   ++A       Q    ELAK LT
Sbjct  87    GMMCGACVSRVKAILSADDRVDSAVVNMLTETAAVKLKADAAETGLAAQ----ELAKRLT  142

Query  2963  SCGFKANVR------DSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLS  2802
              CGF    R      D++     ET +KK     A L  S   +A +W L A+C   H +
Sbjct  143   ECGFPTKKRSSGLGIDAKVNKWKETVKKK----EALLIESRNRVAFAWTLVALCCGTHAA  198

Query  2801  HFFGAKASWIH-----LLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGL  2637
             H   +    IH     +LH++     + +  LL PGR L+ DGL++  KG+PNMN+LVG 
Sbjct  199   HILHSLGIHIHGSMLDILHNSYVKAGLAVGALLGPGRDLLFDGLRAFTKGSPNMNSLVGF  258

Query  2636  GALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVL  2460
             G++++FA+SS++    +L W+A FF+EPVML+ FVLLGR+LE+RA++KA+SDM  LL+++
Sbjct  259   GSIAAFAISSVSLLNSELQWEASFFDEPVMLLGFVLLGRSLEERARLKASSDMNELLSLI  318

Query  2459  PSKARLVVNSD--------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
              +++RLV+ S         +G     +EVP  ++ VGD ++V PG+ IP DG V AGRS 
Sbjct  319   STQSRLVITSSGSDSSTDVVGSDAICIEVPTDDIRVGDSLLVFPGETIPVDGRVVAGRSV  378

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V+AG+IN +  L +E    G  + I  IV +VE+AQ REA
Sbjct  379   VDESMLTGESLPVFKEKGVSVSAGTINWDSPLRIEASSTGSNSTISKIVNMVEDAQGREA  438

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             P+QRLAD ++G F Y VM LSAATF FW   G+ + P  L       +G    L+L+L+ 
Sbjct  439   PIQRLADTIAGPFVYSVMTLSAATFGFWYYVGSNIFPDVLLNDIAGPEGDPLLLSLKLAV  498

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + V+ ++ DKTGTLT G+
Sbjct  499   DVLVVSCPCALGLATPTAILVGTSLGARQGLLIRGGDVLERLASVDHVMLDKTGTLTEGK  558

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V+ +   GH                 E+++L +A+ VE  T+HPI  AI+  A+S N 
Sbjct  559   PAVSAITSLGHE----------------ELEILQIAAAVEKTTSHPIAHAIISKAESLNL  602

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETR------------VQEF  1458
               V    G  + EPGSG M  +    V++G L WV+     +T             ++  
Sbjct  603   S-VPVTRGQ-LAEPGSGTMGEVNGLLVAIGKLKWVQERFQQKTERSDLMALEQSVMLKSL  660

Query  1457  DDFKNQ----SVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
              D ++     +VVYVG +G  + G I + D+LREDA   +  L  +GI T LLSGD++ A
Sbjct  661   QDSQSSNHSTTVVYVGREGEGVIGAIAISDKLREDAESTISRLQHKGIETVLLSGDREEA  720

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgv  1119
                VA  VGI  + V   + P +KS  +SGLQ     VAMVGDGINDA   ALA   + +
Sbjct  721   VATVAKTVGIKDKFVNASLTPQQKSAAISGLQASGHRVAMVGDGINDAPSLALADVGIAL  780

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
              +     AAS+ +S++L+ NRLSQ+L+AL+L++ TM  V QNL WA  YN++ +P+AAG+
Sbjct  781   QVEAQETAASNAASIILLGNRLSQVLEALDLAQATMAKVHQNLSWAVAYNVIAIPIAAGV  840

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             LLP     +TPS++G LM +SSI V++NSLLL+   + K ++
Sbjct  841   LLPNFDFAMTPSLSGGLMAMSSIFVVSNSLLLQFHGSQKNRK  882



>ref|XP_002974620.1| hypothetical protein SELMODRAFT_50799, partial [Selaginella moellendorffii]
 gb|EFJ24140.1| hypothetical protein SELMODRAFT_50799, partial [Selaginella moellendorffii]
Length=790

 Score =   534 bits (1375),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 356/804 (44%), Positives = 500/804 (62%), Gaps = 57/804 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A V+  L    RV SA+VNL TETA V      K+ P   +Q+G ELA  LT
Sbjct  7     GMMCGGCVARVRGQLMQDYRVESAAVNLLTETAAV------KLRPGCGKQVGSELADLLT  60

Query  2963  SCGFKANVRDSR--RENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCL---VGHLSH  2799
               GF A++R  +   +N     E+    ++  L+ S + +A +W L A+C      HL H
Sbjct  61    GSGFPASLRSGKGQDDNAGRKIEELSKKRKESLRKSTQKVAFAWTLVALCCGTHATHLLH  120

Query  2798  FFGAKASWIH-----LLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
             F+     ++H     + H   F   + L TLL P R L++DG K+ LK APNMNTLVG G
Sbjct  121   FYPFIHDFMHSPVMEVAHDPLFKCVVALTTLLGPARDLVVDGGKAFLKRAPNMNTLVGFG  180

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             A ++F++S+M+  IP+L W A FF+EPVML+ FVLLGR+LE+RA+I+A+SDM  LL+++P
Sbjct  181   AWAAFSISAMSLTIPELNWGAPFFDEPVMLLGFVLLGRSLEERARIQASSDMQRLLSLIP  240

Query  2456  SKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGE  2277
             +K+RL V+    ++  TV+V    +  GD+++VLPG+ IP DG V  GRS+VDES+ TGE
Sbjct  241   AKSRLQVSEQANDENLTVDVATEQVRAGDRVLVLPGEVIPIDGTVVIGRSSVDESTVTGE  300

Query  2276  PLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKV  2097
             P+ +TK  G  V+AG++N +G + V     G  ++I  I+++VEEAQ REAPVQRLAD +
Sbjct  301   PMLMTKTVGDTVSAGTVNWDGPIQVTATCTGASSSISSIIKMVEEAQGREAPVQRLADTI  360

Query  2096  SGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscsvlvvaCPC  1935
             +G F + +MALSA+TF FW   GT + P  L       +G+   L+L+L+  VLVVACPC
Sbjct  361   AGPFAFAIMALSASTFSFWYFLGTHIFPDVLLNDAAGPEGNSLLLSLKLAIDVLVVACPC  420

Query  1934  ALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQ  1755
             ALGLATPTAV+VGTSLGA +GLLLRGG VLE  + VN +VFDKTGTLT G P V+ V+  
Sbjct  421   ALGLATPTAVLVGTSLGAKQGLLLRGGDVLERLASVNAVVFDKTGTLTQGHPNVSTVM-S  479

Query  1754  GHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGT  1575
             G ND             + +  +L LA+ VE ++ HPI  AIVE A ++   ++ +E   
Sbjct  480   GSND-------------FDKDRILQLAATVEEHSVHPIASAIVEQANTQKLEMLVSEGQ-  525

Query  1574  FIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQ---------------  1440
              + EPG GA+A I+ K V+VG   WV+   +    ++  D+ +++               
Sbjct  526   -LTEPGYGALARIDGKVVAVGQPRWVQECCLKLDSMESTDEGESKLGNLLADRQSMEQSS  584

Query  1439  -SVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGI  1263
              +V        + G I + D LR D++  V  L    I T +LSGD+K A   +   +GI
Sbjct  585   TTVYVGVEGVGIVGAIALSDTLRADSKVTVSRLRDMKIRTLILSGDRKEAVASIGRTLGI  644

Query  1262  PRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--gvaigggvgaas  1089
               +++F  ++P +KSKF++ L+    +VAM+GDGINDA ALAS+ V   + +   + AAS
Sbjct  645   EGDSLFAQLRPSDKSKFIAKLRDGGSIVAMIGDGINDAPALASADVGIALKLQNKIDAAS  704

Query  1088  dvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLT  909
             D +SV+L+ NRLSQ+LDAL LS+ TM  V QNL  A  YN++ +PVAAG+LLP     L+
Sbjct  705   DAASVILLGNRLSQVLDALSLSKATMSKVYQNLGCALAYNLIAVPVAAGVLLPGYDFALS  764

Query  908   PSIAGALMGLSSIGVMTNSLLLRL  837
             PS AG +M LSSI V++NSLLLRL
Sbjct  765   PSAAGGMMALSSIFVVSNSLLLRL  788



>ref|XP_003603218.1| Copper-exporting P-type ATPase A [Medicago truncatula]
 gb|AES73469.1| copper-transporting ATPase PAA1, putative [Medicago truncatula]
Length=892

 Score =   537 bits (1383),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 358/815 (44%), Positives = 496/815 (61%), Gaps = 72/815 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC + VK IL S  RV S  VN+ TETA V    + K +      + + LA+ LT
Sbjct  93    GMMCGGCVSRVKTILSSDDRVDSVVVNMLTETAAV----KLKKLEEESTSVADGLARRLT  148

Query  2963  SCGFKANVRDS---RRENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
              CGF    R+S     EN+ +   K++  K+ +L A  R  +A +W L A+C   H SH 
Sbjct  149   GCGFPTKRRESGLGVSENVRKW--KELVKKKEELLAKSRNRVAFAWTLVALCCGSHASHI  206

Query  2795  FG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
             F       A   +   LH++     + L  LL PG+ L+ DGL +  KG+PNMN+LVG G
Sbjct  207   FHSLGIHIAHGPFWEFLHNSYVKGGLALGALLGPGKDLLFDGLLAFKKGSPNMNSLVGFG  266

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F +SS++   P+L W A FF+EPVML+ FVLLGR+LE++A+I+A+SDM  LL+++ 
Sbjct  267   SIAAFIISSISLLNPELAWDASFFDEPVMLLGFVLLGRSLEEKARIQASSDMNELLSLIS  326

Query  2456  SKARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+ S  G  ++          VEVP  ++ VGD ++VLPG+ IP DG V AGRS 
Sbjct  327   TQSRLVITSSEGSPSTDSVLSSDAICVEVPTDDIRVGDSVLVLPGETIPIDGRVIAGRSV  386

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V+AG+IN +G L +E    G  T I  IVR+VE+AQSREA
Sbjct  387   VDESMLTGESLPVFKEEGLTVSAGTINWDGPLRIESSSTGSNTMISKIVRMVEDAQSREA  446

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F + +MALSAATF FW   GT + P  L       +G    L+L+LS 
Sbjct  447   PVQRLADSIAGPFVFSIMALSAATFAFWYFAGTHIFPDVLLNDIAGPEGDPLLLSLKLSV  506

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + VN I  DKTGTLT G+
Sbjct  507   DVLVVSCPCALGLATPTAILVGTSLGAKKGLLIRGGDVLERLAGVNYIALDKTGTLTRGK  566

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V+ +                 +  + E ++L +A+ VE   +HPI KAI+  A+S   
Sbjct  567   PVVSAI----------------GSIHYGESEILHIAAAVEKTASHPIAKAIINKAES--L  608

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQ------  1440
              +V       I EPG G +A I+ + V+VG+L+WV  H    TR+   D    +      
Sbjct  609   ELVLPPTKGQIVEPGFGTLAEIDGRLVAVGSLEWV--HERFNTRMNPSDLMNLERALMNH  666

Query  1439  -----------SVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKN  1296
                        +VVYVG +G  + G I + D +REDA   V  L K+GI T LLSGD++ 
Sbjct  667   SSSTSSSKYSKTVVYVGREGEGIIGAIAISDIVREDAESTVMRLKKKGIKTVLLSGDREE  726

Query  1295  AAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--g  1122
             A   +A  VGI  + V   + P +KS F+S L+     VAMVGDGINDA +LA++ V   
Sbjct  727   AVATIAETVGIENDFVKASLSPQQKSAFISSLKAAGHHVAMVGDGINDAPSLAAADVGIA  786

Query  1121  vaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAG  942
             +       AASD +S++L+ N++SQ++DAL+L++ TM  V QNL WA  YN++ +P+AAG
Sbjct  787   LQNEAQENAASDAASIILLGNKISQVIDALDLAQATMAKVYQNLSWAVAYNVIAIPIAAG  846

Query  941   ILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             +LLP     +TPS++G LM +SSI V++NSLLL+L
Sbjct  847   VLLPQFDFAMTPSLSGGLMAMSSILVVSNSLLLKL  881



>ref|WP_022606549.1| copper-(or silver)-translocating P-type ATPase [Rubidibacter 
lacunae]
 gb|ERN41666.1| copper-(or silver)-translocating P-type ATPase [Rubidibacter 
lacunae KORDI 51-2]
Length=784

 Score =   533 bits (1374),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 343/781 (44%), Positives = 479/781 (61%), Gaps = 44/781 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLG--EELAKH  2970
             GM C GC ++V+R +  QP V SA+VNL T +AVV           +   LG  +++A  
Sbjct  27    GMKCAGCVSAVERQIAQQPGVVSAAVNLVTASAVV----------QYDSHLGNPQQIADK  76

Query  2969  LTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
             LT+ GF    R S   +       +  A+R Q     R LA++ AL  +  +GHL H+ G
Sbjct  77    LTATGFTTQPRRSDGSDERTDPAVRRAAERRQ---QARQLAIAAALIGLSAIGHLKHWGG  133

Query  2789  AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
              +   I +L +   H  +     L PGR +++DG +SL  G PNMN LVGLG  S++  S
Sbjct  134   PE---IPVLSNIWAHWGLATLAFLGPGRAIVVDGARSLWHGLPNMNALVGLGTTSAYLAS  190

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
              +A  +P LGW  FF+EPVML+ F+LLGR LE RA+ +A++ +  LL++ P  A+LV   
Sbjct  191   CVALVLPGLGWDCFFDEPVMLLGFILLGRTLESRARGRASAALEALLSLQPPAAQLVNQP  250

Query  2429  DMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPG  2250
             D       + VP   +  GD + +LPG++IP DG + +G++TVDES  TGEP+P+ K PG
Sbjct  251   D--PSVPALPVPVGQVRAGDWVRILPGEKIPVDGDLASGQTTVDESMLTGEPMPIAKGPG  308

Query  2249  AQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVM  2070
              ++AAG++N +G + V   + GG+T +  IV  VE+AQ R+APVQ+LAD V+G+F YGVM
Sbjct  309   DRLAAGTLNQSGAIVVRATQVGGDTTLAKIVAAVEDAQVRKAPVQQLADAVAGYFAYGVM  368

Query  2069  ALSAATFMFWNLFGTRVLPATLHQGslaslal------qlscsvlvvaCPCALGLATPTA  1908
             A++A TF FW LFGTRV    +  G LA +A       +L+ +VLVVACPCALGLATPTA
Sbjct  369   AIAALTFGFWYLFGTRVWSDAIAAGPLADVASPLLLSLRLAIAVLVVACPCALGLATPTA  428

Query  1907  VMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAK  1728
             ++VGTSLGA RGLL++GG VLE    +N+I FDKTGTLT GRPTVT+VV  G     NA+
Sbjct  429   ILVGTSLGAQRGLLIKGGDVLERVRHLNSIAFDKTGTLTEGRPTVTDVVVDGMEIGDNAE  488

Query  1727  RDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGA  1548
             RD           VL LA+  ES T+HP+  AIV AA  RN +I    +  F  E G+G 
Sbjct  489   RDR----------VLQLAAIAESGTHHPLAAAIVAAATERNLKISGGAE--FYTEAGAGV  536

Query  1547  MAVIEEKKVSVGTLDWVRRHGVG-----ETRVQEFDDFKNQSVVYVGVDGVLAGLIYVED  1383
              A   +++  VGT DW++  G+      E RV+E      +++ YV  DG   G I +ED
Sbjct  537   AATASDQRACVGTADWLQSRGIPIAPHLEARVREL-AAAGKTIAYVAADGEAIGAIALED  595

Query  1382  QLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSG  1203
             +LR DA+  +  L   G+ T LL+GD   AA  +A+  GI  EN   G++P EK++ +  
Sbjct  596   RLRPDAKATIARLQAAGLKTLLLTGDTPAAARMIAAQAGIDPENTIAGLRPAEKAEHIRN  655

Query  1202  LQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELS  1023
              Q D   VAMVGDGINDA ALA + +G+A+  G   A + +++VLM++RL+ ++ A+ELS
Sbjct  656   WQADGTTVAMVGDGINDAPALAQAEIGIALKNGTDVAIETAAIVLMRDRLTDVVAAIELS  715

Query  1022  RLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLL  843
             R T+  ++QNL+WA GYN + +P AAG+ LP     L P+ AG  M  SS+ V+TNSLLL
Sbjct  716   RATLGKIRQNLFWALGYNAIAIPAAAGVFLPQFHIALGPAAAGGFMAFSSVMVVTNSLLL  775

Query  842   R  840
             R
Sbjct  776   R  776



>ref|NP_001289916.1| copper-transporting ATPase PAA2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010420982.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
[Camelina sativa]
 gb|AID81888.1| heavy metal ATPase transporter 8 [Camelina sativa]
Length=884

 Score =   536 bits (1382),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 357/815 (44%), Positives = 496/815 (61%), Gaps = 70/815 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A VK +L S  RV+SA VN+ TETA V   SE +VV +    + E LAK LT
Sbjct  84    GMMCGGCVARVKSVLMSDDRVASAVVNMLTETAAVRLKSEFEVVVD----VAESLAKRLT  139

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
               GF+A  R S     EN+ +   K+M +K+ +L    R  +A +W L A+C   H SH 
Sbjct  140   ESGFEAKRRVSGMGVAENVKKW--KEMVSKKEELLVKSRNRVAFAWTLVALCCGSHTSHI  197

Query  2795  FGAKASWI------HLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
               +    I       LLH++     + +  LL PGR+L+ DG+K+  K +PNMN+LVGLG
Sbjct  198   LHSLGIHIAHGGIWDLLHNSYVKGGLAVGALLGPGRELLFDGIKAFGKRSPNMNSLVGLG  257

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F +S ++   P+L W A FFEEPVML+ FVLLGR+LE+RAK+KA+SDM  LL+++ 
Sbjct  258   SMAAFTISLISLVNPELEWDASFFEEPVMLLGFVLLGRSLEERAKLKASSDMNELLSLIS  317

Query  2456  SKARLVVNSDMGEQTST----------VEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRS  2307
             +++RLV+ S     T+           V VP  ++ VGD ++VLPG+  P DG V AGRS
Sbjct  318   TQSRLVITSSDNNNTAADSVLSSDSICVNVPVDDIRVGDSLLVLPGETFPVDGSVLAGRS  377

Query  2306  TVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSRE  2127
              VDES  TGE LPV K  G  V+AG+IN +G L ++    G  + I  IVR+VE+AQ   
Sbjct  378   VVDESMLTGESLPVFKEGGCSVSAGTINWDGPLRIKASSTGSNSTISKIVRMVEDAQGNA  437

Query  2126  APVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqls  1965
             APVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+L+L+
Sbjct  438   APVQRLADAIAGPFVYTIMSLSAVTFAFWYYIGSHIFPDVLLNDIAGPDGDPLALSLKLA  497

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
               VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + V+ +  DKTGTLT G
Sbjct  498   VDVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASVDYVALDKTGTLTEG  557

Query  1784  RPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRN  1605
             RP V+ +                ++  + E +VL LA+ VE    HPI KAIV  A++ N
Sbjct  558   RPVVSGI----------------ASLRYEEQEVLKLAAAVEKTATHPIAKAIVNEAETLN  601

Query  1604  CRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV------RRHGVGETRVQEFDDFK-  1446
                   E    + EPG G +A I+ + V+VG+L+WV      +       +++ F D K 
Sbjct  602   LE--TPETRGQLTEPGFGTLAEIDGRLVAVGSLEWVSDRFLKKNDSSDMVKLESFLDTKL  659

Query  1445  ---------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKN  1296
                      +++VVYVG +G  + G I + D LR+DA   V  L ++GI T LLSGD++ 
Sbjct  660   SSTSSTPGYSKTVVYVGREGEGIIGAIAISDCLRQDAEFTVARLQEKGIKTVLLSGDREG  719

Query  1295  AAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--g  1122
             A   VA  VGI  E+  Y + P+ K +F+  LQ     VAMVGDGINDA +LA + V   
Sbjct  720   AVATVAKNVGIESESTNYSLSPEMKFEFIYNLQSSGHRVAMVGDGINDAPSLAQADVGIA  779

Query  1121  vaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAG  942
             + I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P+AAG
Sbjct  780   LKIEAQENAASNTASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIPIAAG  839

Query  941   ILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             +LLP     +TPS++G LM LSSI V++NSLLL+L
Sbjct  840   VLLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQL  874



>ref|WP_036481007.1| ATPase [Myxosarcina sp. GI1]
Length=788

 Score =   533 bits (1373),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 332/791 (42%), Positives = 483/791 (61%), Gaps = 50/791 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+  LE    V SA VNL TE AVV    EAK V        E LA+ LT
Sbjct  33    GMKCAGCVKAVENQLEQNSGVVSAQVNLITEVAVVE--YEAKTVKP------ESLAEKLT  84

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF   +R S R ++ +      N ++ Q Q   R L  +  L     +GHL HF    
Sbjct  85    ATGFPTQLRQSDR-SIRQAANDARNKRQEQQQQQVRQLITAAILLVFSSIGHLKHF---G  140

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
               +I +L +  FH  +    + +PGR LIIDG + L++  PNMNTLVGLG +S++  S +
Sbjct  141   LPYIPVLSNVWFHWGLATLAIFIPGRSLIIDGWRGLVRAMPNMNTLVGLGTVSAYVASCI  200

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P+LGW+ FF+EPVML+ F+LLGR +E++A+ +A+  +  L+ + P  ARLV   D 
Sbjct  201   ALVFPQLGWECFFDEPVMLLGFILLGRTIEKKARNRASQALEKLVFLQPPVARLVSKDD-  259

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                 + +E+P   + +G+ + VLPG++IP DG +  G + +DES  TGE LPV K     
Sbjct  260   --SETAIEIPVEQVKIGEWLRVLPGEKIPVDGEIVLGETAIDESMLTGESLPVEKRASDM  317

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AG+IN +G++T+E+ + G  T +  I+ LVE+AQ+ +APVQ+LAD ++G+F YGVMA+
Sbjct  318   VKAGTINQSGVITLEITKIGDRTTLAKIISLVEDAQTHKAPVQQLADTIAGYFAYGVMAI  377

Query  2063  SAATFMFWNLFGT----RVLPATLH-------QGslaslalqlscsvlvvaCPCALGLAT  1917
             +  TF+FW   GT     VL  T H         S   L+L+L+ SVLV+ACPCALGLAT
Sbjct  378   ATLTFLFWYFIGTTVWTEVLVTTSHTMGGMVMNTSPLLLSLKLAISVLVIACPCALGLAT  437

Query  1916  PTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDET  1737
             PTA++VGTS+GA RG+L++GG +LE    ++T+VFDKTGTLTIG P VT+ +P G  D  
Sbjct  438   PTAILVGTSIGAERGILIKGGDILERVQQLDTVVFDKTGTLTIGHPQVTDCIPYGELDSN  497

Query  1736  NAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPG  1557
                             +L LA+ VE+ +NHP+ KAI++ AK +   ++KA+D  F  E G
Sbjct  498   R---------------LLQLAAAVENGSNHPLAKAIIDYAKKQQLSMLKAQD--FQSESG  540

Query  1556  SGAMAVIEEKKVSVGTLDWVRRHGV----GETRVQEFDDFKNQSVVYVGVDGVLAGLIYV  1389
              G +A + +KKV +G  DW+ +H +       R  E      ++V+YVGV+  L GLI +
Sbjct  541   LGILATVADKKVYLGNKDWLVKHNIKLDDDSQRRAESLLRSGKTVIYVGVEEKLGGLIAL  600

Query  1388  EDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFV  1209
             +D LR DA   V  L   G+   LL+GD++  A+ VA  + I R  V   VKP++K++ +
Sbjct  601   QDTLRPDAAQTVRELQSMGLEVVLLTGDRQEVADTVAKELKINR--VLAEVKPEQKAEAI  658

Query  1208  SGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALE  1029
               LQK Q  VA++GDGINDA ALA + VG+++      A + + +VLMQN+L+  + ++E
Sbjct  659   KSLQKSQ-TVAIIGDGINDAPALAVADVGISLQESTDVAIETADIVLMQNKLADAIASIE  717

Query  1028  LSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSL  849
             LSR T+  ++QNL WA  YN++ +P+AAGILLP +G +L+P +A   M  SS+ V+ NSL
Sbjct  718   LSRATVNKIRQNLLWALAYNVLAIPLAAGILLPSSGILLSPGLAAGAMAFSSVIVVCNSL  777

Query  848   LLRLKFASKQK  816
             LL L F+S ++
Sbjct  778   LLNLHFSSTKR  788



>ref|XP_008360948.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
[Malus domestica]
Length=887

 Score =   536 bits (1382),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 350/812 (43%), Positives = 485/812 (60%), Gaps = 67/812 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLG-EELAKHL  2967
             GM CGGC + VK +L +  RV S +VNL TETA +      K+ P     +  E LA  L
Sbjct  91    GMMCGGCVSRVKSVLSADDRVDSVAVNLLTETAAI------KLRPEVAADVAAESLAGRL  144

Query  2966  TSCGFKANVRDSRR--ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             T CGF +  R S          +++ +  K   L  S   + ++W L A+C   H SH  
Sbjct  145   TECGFASKRRASGMGVAESVRKWKETVRKKEEMLVKSRNRVILAWTLVALCCGSHASHIL  204

Query  2792  ------GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGA  2631
                    A  S+  LLH++     +    LL PGR L+ DGL++  KGAPNMN+LVG G+
Sbjct  205   HSLGIHAAHGSFWELLHNSYVKAGLATGALLGPGRDLLFDGLRAFKKGAPNMNSLVGFGS  264

Query  2630  LSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPS  2454
             L++F +S+++   P L W A FF+EPVML+ FVLLGR+LE+RA+IKA+SDM  LL+++ +
Sbjct  265   LAAFTISAVSLLNPGLQWDAAFFDEPVMLLGFVLLGRSLEERARIKASSDMNELLSLINT  324

Query  2453  KARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             +ARLV+ S          +      VEVP  ++ VGD ++VLPG+ IP DG V AGRS V
Sbjct  325   QARLVIGSSENDSSSNSVLFSDAICVEVPTDDIRVGDSVLVLPGETIPVDGRVVAGRSVV  384

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DES  TGE LPV K     V+AG+IN +G L VE    G  + I  IVR+VE+AQ  EAP
Sbjct  385   DESMLTGESLPVFKEKDLTVSAGTINWDGPLRVEASSTGSNSMISKIVRMVEDAQGHEAP  444

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscs  1959
             +QRLAD ++G F Y +M LSA TF FW  FGT++ P  L        G    L+L+L+  
Sbjct  445   IQRLADSIAGPFVYSIMTLSATTFAFWYYFGTQIFPDVLLNDIAGPDGDPLLLSLKLAVD  504

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVV+CPCALGLATPTA++VGTSLGA +GLL+RG  VLE  + V+ I  DKTGTLT G+P
Sbjct  505   VLVVSCPCALGLATPTAILVGTSLGARQGLLVRGADVLERLANVDYIALDKTGTLTEGKP  564

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
             TV+ +                ++  + E+++L +A+ VE+  +HPI KAI+  AKS N  
Sbjct  565   TVSGI----------------ASFMYEELEILQIAAAVENTASHPIAKAILNKAKSLNMS  608

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN--------  1443
             I        + EPG G +A ++ + V+VG+L+WVR     +  V +  + ++        
Sbjct  609   IPVTRRQ--LTEPGFGTLAEVDGRLVAVGSLEWVRERFQAKANVSDLLNLEHTVRQSSEG  666

Query  1442  -------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAE  1287
                    +++VYVG +G  + G I + D LR DA   V  L ++GI T L+SGD++ A  
Sbjct  667   ITPSSYSKTIVYVGREGEGIIGAIAISDSLRHDAEFTVNRLQQKGIQTVLVSGDREEAVA  726

Query  1286  YVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgvai  1113
              +A  VGI  E V   + P  KS  +S L+     VAMVGDGINDA   ALA   + + I
Sbjct  727   TIAKAVGIENEFVKSSLTPQGKSGAISSLKDAGHHVAMVGDGINDAPSLALADVGIALQI  786

Query  1112  gggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILL  933
              G   AAS+ +S++L+ N+LSQ++DALELS+ TM  V QNL WA  YN+  +P+AAG+LL
Sbjct  787   EGQENAASNAASIILLGNKLSQVVDALELSQATMAKVYQNLSWAIAYNLFAIPIAAGVLL  846

Query  932   PFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             P     +TPS++G +M LSSI V++NSLLL+L
Sbjct  847   PQYDFAMTPSLSGGMMALSSIFVVSNSLLLQL  878



>ref|XP_002963330.1| hypothetical protein SELMODRAFT_60775, partial [Selaginella moellendorffii]
 gb|EFJ35201.1| hypothetical protein SELMODRAFT_60775, partial [Selaginella moellendorffii]
Length=790

 Score =   533 bits (1373),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 355/804 (44%), Positives = 497/804 (62%), Gaps = 57/804 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A V+  L    RV SA+VNL TETA V      K+ P   +++G ELA  LT
Sbjct  7     GMMCGGCVARVRGQLMQDYRVESAAVNLLTETAAV------KLRPGCGKEVGSELADLLT  60

Query  2963  SCGFKANVRDSR--RENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCL---VGHLSH  2799
               GF A++R  +   +N     E+    ++  L+ S + +A +W L A+C      HL H
Sbjct  61    GSGFPASLRSGKGQDDNAGRKIEELSKKRKESLRKSTQKVAFAWTLVALCCGTHATHLLH  120

Query  2798  FFGAKASWIH-----LLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
             F+     ++H     + H   F   + L TLL P R L++DG K+ LK APNMNTLVG G
Sbjct  121   FYPFIHDFMHSPVMEVAHDPVFKCVVALTTLLGPARDLVVDGGKAFLKRAPNMNTLVGFG  180

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             A ++F++S+M+  IP+L W A FF+EPVML+ FVLLGR+LE+RA+I+A+SDM  LL+++P
Sbjct  181   AWAAFSISAMSLTIPELNWGAPFFDEPVMLLGFVLLGRSLEERARIQASSDMQRLLSLIP  240

Query  2456  SKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGE  2277
             +K+RL V+    ++  TV+V    +  GD+++VLPG+ IP DG V  GRS+VDES+ TGE
Sbjct  241   AKSRLQVSEQANDENLTVDVATEQVRAGDRVLVLPGEVIPIDGTVVIGRSSVDESTVTGE  300

Query  2276  PLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKV  2097
             P+ +TK  G  V+AG++N +G + V     G  ++I  I+++VEEAQ REAPVQRLAD +
Sbjct  301   PMLMTKTVGDTVSAGTVNWDGPIQVTATCTGASSSISSIIKMVEEAQGREAPVQRLADTI  360

Query  2096  SGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscsvlvvaCPC  1935
             +G F + +MALSA+TF FW   GT + P  L       +G+   L+L+L+  VLVVACPC
Sbjct  361   AGPFAFAIMALSASTFSFWYFLGTHIFPDVLLNDAAGPEGNSLLLSLKLAIDVLVVACPC  420

Query  1934  ALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQ  1755
             ALGLATPTAV+VGTSLGA +GLLLRGG VLE    VN +VFDKTGTLT G P V+ V   
Sbjct  421   ALGLATPTAVLVGTSLGAKQGLLLRGGDVLERLQSVNAVVFDKTGTLTQGHPNVSTVT-S  479

Query  1754  GHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGT  1575
             G ND             + +  +L LA+ VE ++ HPI  AIVE A ++   ++ +E   
Sbjct  480   GSND-------------FDKDRILQLAATVEQHSVHPIASAIVEQANTQKLEMLVSEGQ-  525

Query  1574  FIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQ---------------  1440
              + EPG GA+A I+ K V+VG   WV+   +    ++  D+ + +               
Sbjct  526   -LTEPGYGALARIDGKVVAVGQPRWVQECCLKLDSMESTDEVERKLGNLLADRQSMEQSS  584

Query  1439  -SVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGI  1263
              +V        + G I + D LR DA+  V  L    I T +LSGD+K A   +   +GI
Sbjct  585   TTVYVGVEGVGIVGAIALSDTLRADAKVTVSRLRDMKIRTLILSGDRKEAVASIGRTLGI  644

Query  1262  PRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--gvaigggvgaas  1089
               +++F  ++P +KSKF++ L+    +VAM+GDG+NDA ALAS+ V   + +   + AAS
Sbjct  645   EGDSLFAQLRPSDKSKFIAKLRDGGSIVAMIGDGVNDAPALASADVGIALKLQNKIDAAS  704

Query  1088  dvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLT  909
             D +SV+L+ NRLSQ+LDAL LS+ TM  V QNL  A  YN++ +PVAAG+LLP     L+
Sbjct  705   DAASVILLGNRLSQVLDALSLSKATMSKVYQNLGCALAYNLIAVPVAAGVLLPGYDFALS  764

Query  908   PSIAGALMGLSSIGVMTNSLLLRL  837
             PS AG +M LSSI V++NSLLLRL
Sbjct  765   PSAAGGMMALSSIFVVSNSLLLRL  788



>ref|WP_026796971.1| ATPase [Planktothrix prolifica]
Length=784

 Score =   532 bits (1371),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 330/784 (42%), Positives = 478/784 (61%), Gaps = 45/784 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L  Q  V S SVNL TE A V   +  ++ P       E LA+ LT
Sbjct  27    GMQCAGCVKAVERQLLQQSGVISVSVNLATEVARV-ECAANQINP-------ESLAEILT  78

Query  2963  SCGFKANVRD---SRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             + GF   +R+   S  E L E  E+       Q+Q     +     L  +  +GHL HF 
Sbjct  79    NTGFPTQLRNLTSSATEKLKELQERHRQDMGKQIQR----IVTCGLLLLLSSIGHLHHF-  133

Query  2792  GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAV  2613
                   IHLL +  FH  +    LL P R +IIDG +SLL  APNMNTLVGLG L+++  
Sbjct  134   --GFPHIHLLSNIWFHWGLATIALLFPARSIIIDGGRSLLNNAPNMNTLVGLGTLTAYLT  191

Query  2612  SSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVV-  2436
             S +A   P+LGW+ FF+EPVML+ F+LLG+ LEQ A+ +A +    L+ + P+ ARLV  
Sbjct  192   SFVALLFPQLGWECFFDEPVMLLGFILLGKTLEQYARQRAATAFQSLIALQPTTARLVAP  251

Query  2435  NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKL  2256
              S      ++VE+P   + VG+ + VLPG++I  DG +R G++TVDES  TGE +P+ K 
Sbjct  252   QSQDNAILNSVEIPAEQVKVGEWLQVLPGEKIAVDGEIRFGKTTVDESMLTGESMPILKQ  311

Query  2255  PGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYG  2076
              G  ++AG+IN  G++ +E  R G +T +  IV+LVE AQ+R+AP+Q+LAD V+G+FTY 
Sbjct  312   IGDDISAGTINQTGVILIEATRTGFDTTLAQIVQLVETAQTRKAPIQKLADIVAGYFTYF  371

Query  2075  VMALSAATFMFWNLFGTRVLPAT-------LHQGslaslalqlscsvlvvaCPCALGLAT  1917
             VM+L+  TF+FW   GTR+ P         +   +   L+L+L+ +VLV+ACPCALGLAT
Sbjct  372   VMSLAGLTFLFWYGLGTRIWPDVIPLAGIEIATNAPLLLSLKLAIAVLVIACPCALGLAT  431

Query  1916  PTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDET  1737
             PTA++VG+ +GA RGLL++GG +LE    +N +VFDKTGTLT G P VT           
Sbjct  432   PTAILVGSGIGAERGLLIKGGDILERVHQLNIVVFDKTGTLTTGSPMVT-----------  480

Query  1736  NAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPG  1557
                 D  +  E S   +L LA+ VE  +NHPI +AI+  AK +N  ++ A D  F  EPG
Sbjct  481   ----DCITISELSPQQILQLAATVEQGSNHPISEAILREAKEQNLSLLMASD--FQTEPG  534

Query  1556  SGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQL  1377
              G  A+IE + + VG L  +  H +     +   +F  +++VYV +DG + GL+ + D L
Sbjct  535   LGVSAIIENQTIFVGNLAGLIEHKINYP--ETLPEFLGKTIVYVTIDGKVVGLMAMSDPL  592

Query  1376  REDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQ  1197
             + DA+  V  L   G+   LL+GD+++ A  +A  + +  E++F  V+P+ K   +  LQ
Sbjct  593   KTDAKLTVSQLQNLGLRVILLTGDRQSVANAIAIELNLKSEDIFAEVRPEGKVNLIQTLQ  652

Query  1196  KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRL  1017
             +  +VVAMVGDGINDA ALA + +G+ +  G   A++ + +VL +N L  ++D+++LSR 
Sbjct  653   QQNQVVAMVGDGINDAPALAQADIGIGLQTGTDVANETADIVLTRNSLIDIVDSIQLSRA  712

Query  1016  TMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             T   ++QNL+WAFGYN++ +P+AAG L P  G +L+PS AGALM LSS+ V+TNSLLLR 
Sbjct  713   TFNKIRQNLFWAFGYNVLAIPLAAGFLFPQFGILLSPSTAGALMALSSVTVVTNSLLLRR  772

Query  836   KFAS  825
             +  S
Sbjct  773   QLKS  776



>ref|WP_019504084.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=793

 Score =   532 bits (1371),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 323/790 (41%), Positives = 481/790 (61%), Gaps = 53/790 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R LE    V SA VNL TE AVV     A + P       E LA+ LT
Sbjct  33    GMKCAGCVKAVERQLEQNAGVISACVNLITEVAVV-EYEAASIAP-------ETLAEKLT  84

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF   +R S R ++F+   +    ++ Q Q   R L  +  L     +GHL H     
Sbjct  85    KTGFPTQLRQSDR-SIFQAGIESQEKQKQQEQQRVRQLVTAAILLFFSSIGHLHHL---G  140

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
               +I +L +   H  +    LL+PGR L++DG +SL++G PNMNTLVGLG +S++  S  
Sbjct  141   LPYIPILSNIWVHFGLATLALLIPGRSLLLDGWRSLVQGMPNMNTLVGLGTVSAYLASCF  200

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A F+P+LGW+ FF+EPVML+ F+LLGR LE +A+ +A++ +T L+++ P  ARL+   D 
Sbjct  201   ALFLPQLGWECFFDEPVMLLGFILLGRTLEGKARNRASAALTQLVSLQPPIARLISKQD-  259

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                T T+E+P   +  G+ + VLPG++IP DG V  G +TVDES  TGE + V K     
Sbjct  260   --STETIEIPVEQVKPGEWLRVLPGEKIPVDGTVVVGETTVDESMLTGESVAVAKTSADI  317

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AG+IN +G++T+EV   G +T +  I+ LVE+AQ+R+APVQ+LAD ++G+F YGVMA+
Sbjct  318   VRAGTINQSGVITIEVTGIGQDTILAKIISLVEDAQTRKAPVQKLADTIAGYFAYGVMAI  377

Query  2063  SAATFMFWNLFGTRVLPATLHQGslasl---------------alqlscsvlvvaCPCAL  1929
             +  TF FW  +GT++ P+ L   S +                 +L+L+ +VLV+ACPCAL
Sbjct  378   ATLTFCFWYFYGTKIWPSVLMTASHSMSMPMGQMEVETSPLLLSLKLAIAVLVIACPCAL  437

Query  1928  GLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGH  1749
             GLATPTA++VGTS+GA  G+L++GG +LE    ++T+VFDKTGTLT G P VT  +P G 
Sbjct  438   GLATPTAILVGTSIGAETGILIKGGDILEQVYQLDTVVFDKTGTLTSGMPQVTNCIPLG-  496

Query  1748  NDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFI  1569
                           + ++ ++L +A+ VESN+NHP+ + I+ AA+ +N  +++A D  F 
Sbjct  497   --------------DITQKELLQIAASVESNSNHPLAQGIITAAQQQNLSLLEASD--FQ  540

Query  1568  EEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFD-DFKNQS---VVYVGVDGVLAG  1401
                G G  A++  +++ +G  +W+    V  +  QE    +  QS   VVY+ + G+L G
Sbjct  541   SVLGQGISAIVAGQRIYLGNQEWLTNQAVEISADQELKVQYLAQSGKTVVYLAISGILQG  600

Query  1400  LIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEK  1221
             LI +ED LR DA   +E L K G+ T LL+GD+   A+ +A  + + +   F  VKP++K
Sbjct  601   LIAIEDSLRPDATQTIEQLQKLGLNTVLLTGDRSEVAQAIADKLNLAQ--TFSEVKPEDK  658

Query  1220  SKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLL  1041
             ++ +  LQ+  + VAM+GDGINDA ALA + VG+++      A   + +VLMQN+L  ++
Sbjct  659   AQIIRSLQQQGQTVAMIGDGINDAPALAQADVGISLQDSTDVAIASADIVLMQNQLEDVI  718

Query  1040  DALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVM  861
              +++LSR T+  +KQNL WA  YN+  +P+AAGILLP  G +L+P +A   M  SS+ V+
Sbjct  719   KSIQLSRATVSKIKQNLIWALTYNVFAIPIAAGILLPQYGLLLSPVLAAVAMASSSLIVV  778

Query  860   TNSLLLRLKF  831
             TNSLLL    
Sbjct  779   TNSLLLNFNL  788



>emb|CDX92394.1| BnaA10g14330D [Brassica napus]
Length=885

 Score =   535 bits (1378),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 358/819 (44%), Positives = 498/819 (61%), Gaps = 78/819 (10%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLG---EELAK  2973
             GM CGGC A VK +L S  RV+SA VN+ TETA V      ++ P  ++ +    E LAK
Sbjct  86    GMMCGGCVARVKSVLMSDDRVASAVVNMLTETAAV------RLKPEVEEAVADAAESLAK  139

Query  2972  HLTSCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHL  2805
              LT  GF+A  R S     EN+ +   K+M +K+ +L    R  +A +W L A+C   H 
Sbjct  140   RLTESGFEAKRRVSGMGVAENVKKW--KEMVSKKEELLVKSRNRVAFAWTLVALCCGSHT  197

Query  2804  SHFFGAKASWIH--------LLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNT  2649
             SH   +    IH        LLH++     + +  LL PGR+L+ DG+K+  K +PNMN+
Sbjct  198   SHILHSVG--IHVAHGGVWDLLHNSYVKGGLAVGALLGPGRELLFDGIKAFGKRSPNMNS  255

Query  2648  LVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGL  2472
             LVGLG++++FA+S ++   P L W A FFEEPVML+ FVLLGR+LE+RAK+KA+SDM  L
Sbjct  256   LVGLGSMAAFAISLISLVNPDLEWDASFFEEPVMLLGFVLLGRSLEERAKLKASSDMNEL  315

Query  2471  LNVLPSKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVR  2319
             L+++ +++RLV+ S          +   +  + VP   + VGD ++VLPG+  P DG V 
Sbjct  316   LSLISTQSRLVITSSENNTAADSVLSSDSICINVPVDEIRVGDSLLVLPGETFPVDGNVL  375

Query  2318  AGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEA  2139
             AGRS VDES  TGE LPV K  G  V+AG+IN +G L +E    G  + I  IV++VEEA
Sbjct  376   AGRSVVDESMLTGESLPVYKEEGCSVSAGTINWDGPLRIEASSTGSNSTISKIVKMVEEA  435

Query  2138  QSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslasla  1977
             Q   APVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+
Sbjct  436   QGNAAPVQRLADAIAGPFVYTIMSLSAVTFAFWYYIGSHIFPDVLLNDIAGPDGDPLALS  495

Query  1976  lqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGT  1797
             L+L+  VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + ++ +  DKTGT
Sbjct  496   LKLAVDVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASIDCVALDKTGT  555

Query  1796  LTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAA  1617
             LT GRP V+ V                 +  + E +VL LA+ VE    HPI KAIV  A
Sbjct  556   LTEGRPIVSGV----------------GSLIYEEQEVLKLAAAVEKTATHPIAKAIVNEA  599

Query  1616  KSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV--RRHGVGET----RVQEFD  1455
             ++ N      E    + EPG G +A I+ + V+VG L+WV  R H   ++    +++ + 
Sbjct  600   EALNLE--TPETRGQLTEPGFGTLAEIDGRLVAVGALEWVANRFHKKNDSSDVVKLENYL  657

Query  1454  DFK----------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSG  1308
             D K          +++VVYVG +G  + G I + D LR+DA   V  L ++GI T LLSG
Sbjct  658   DRKLSRTSLTSRYSKTVVYVGREGEGIIGAIAISDCLRKDAEFTVARLQEKGIKTILLSG  717

Query  1307  DKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALassh  1128
             D++ A   VA  VGI  E+  Y + PD+K +F+S LQ     VAMVGDGINDA +LA + 
Sbjct  718   DREGAVATVAKNVGIESESTNYSLSPDKKFEFISNLQSSGHRVAMVGDGINDAPSLAQAD  777

Query  1127  v--gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLP  954
             V   + I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P
Sbjct  778   VGIALKIEAQENAASNAASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIP  837

Query  953   VAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             +AAG+LLP     +TPS++G LM LSSI V++NSLLL+L
Sbjct  838   IAAGVLLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQL  876



>ref|XP_006849689.1| hypothetical protein AMTR_s00024p00238030 [Amborella trichopoda]
 gb|ERN11270.1| hypothetical protein AMTR_s00024p00238030 [Amborella trichopoda]
Length=900

 Score =   535 bits (1379),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 367/827 (44%), Positives = 493/827 (60%), Gaps = 87/827 (11%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTET-AVVWPVSEAKVVPNW---QQQLGEELA  2976
             GM CG C + VK IL S  RV S +VNL TET AV     E +  P      + L EEL 
Sbjct  86    GMMCGACVSRVKTILLSDERVESVAVNLVTETVAVRLRRGERRETPELGETLEMLAEELG  145

Query  2975  KHLTSCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHL  2805
               L+ CGF +  RD      +N+   +   +  K A L  S   +A +WAL A+C   H 
Sbjct  146   LRLSECGFPSKRRDLNLGLGQNV-RKWRDVVEKKEASLVKSRVKVAFAWALVALCCGTH-  203

Query  2804  SHFFGAKASWIHLLHSTGFHMS----------------MCLFTLLVPGRQLIIDGLKSLL  2673
                 GA     H LHS G H++                M    L  PGR+L++DGL +  
Sbjct  204   ----GA-----HSLHSVGIHIAHGWFWELLENSFVKCGMASIALFGPGRELLLDGLGAFA  254

Query  2672  KGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIK  2496
             K +PNMN+LVG G+L++F +S+++   P L W A FF+EPVML+ FVLLGR+LE++A+++
Sbjct  255   KRSPNMNSLVGFGSLAAFIISAVSLLNPGLQWDASFFDEPVMLLGFVLLGRSLEEKARLE  314

Query  2495  ATSDMTGLLNVLPSKARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDR  2343
             A+SDM  LL+++ S++RLVV+S  G+ ++          +EVP  ++ VGD ++VLPG+ 
Sbjct  315   ASSDMNELLSLVSSQSRLVVSSSEGDLSADKVLSADSICLEVPTDDIRVGDSVLVLPGET  374

Query  2342  IPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGD  2163
             IP DG V AGRS VDES  TGE LPV K  G  V+AG+IN +G L +E    G  + I  
Sbjct  375   IPIDGRVLAGRSLVDESMLTGESLPVLKESGLTVSAGTINWDGPLKIEASTAGSMSTIAK  434

Query  2162  IVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGsl--  1989
             I+ +VE+AQ REAP+QRLAD ++G+F Y VMALSA TF  W   GT + P  L       
Sbjct  435   IIHMVEDAQGREAPIQRLADSIAGYFVYSVMALSAMTFCSWYYIGTHIFPDVLLNDIAGS  494

Query  1988  ----aslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNT  1821
                   L+L+LS  VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + V+ 
Sbjct  495   EGSSLLLSLKLSVDVLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLAGVDV  554

Query  1820  IVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPI  1641
             +  DKTGTLT GRP VT                S ++ ++ E +++ LA+ VE   +HPI
Sbjct  555   VALDKTGTLTEGRPVVT----------------SVASLKYKEEEIIRLAAAVEKTASHPI  598

Query  1640  GKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQE  1461
              KAIV+ A+  N  I        + EPG GA+A +E K V+VGT  WV       TR  +
Sbjct  599   AKAIVKNAEFLNLEIPLTRGQ--LTEPGFGALAEVEGKLVAVGTRKWVHESFQKITRQSD  656

Query  1460  FDDFKN----------------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQG  1332
               + +N                 +VVYVG+ G  + G + V D LR DA+ +V  L + G
Sbjct  657   LSELENGIRELSPNGSSTCYNPSTVVYVGLQGEGIIGAVAVSDTLRRDAKSMVGRLQQMG  716

Query  1331  ITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGIND  1152
             I T LLSGD++ A   VA +VGI  ENV   + P EK+  +S LQ   + VAMVGDGIND
Sbjct  717   IRTILLSGDREEAVASVAKIVGIDSENVNACLTPSEKACAISTLQTQGQCVAMVGDGIND  776

Query  1151  AAALasshv--gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAF  978
             A +LA++ V   + I     AASD +SV+L+ NRLSQ++DAL+L+R T+  V+QNL WA 
Sbjct  777   APSLATADVGLAMRIQDKDNAASDAASVILLGNRLSQVVDALDLARATIGKVRQNLAWAV  836

Query  977   GYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
              YNIV +PVAAG+LLP     +TPS++G LM LSSI V+TNSLLLR 
Sbjct  837   LYNIVAIPVAAGVLLPHFDLAMTPSLSGGLMALSSILVVTNSLLLRF  883



>gb|KEI68167.1| CtaA [Planktothrix agardhii NIVA-CYA 126/8]
Length=784

 Score =   531 bits (1368),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 329/784 (42%), Positives = 480/784 (61%), Gaps = 45/784 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L  Q  V S SVNL TE A V   +  ++ P       E LA+ LT
Sbjct  27    GMQCAGCVKAVERQLLQQHGVISVSVNLATEVARV-ECAANQINP-------ESLAEILT  78

Query  2963  SCGFKANVRD---SRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             + GF   +R+   S  E L E  E+       Q+Q     +     L  +  +GHL HF 
Sbjct  79    NTGFPTQLRNLTSSATEKLKELQERHRQDMGKQIQR----IVTCGLLLLLSSIGHLHHF-  133

Query  2792  GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAV  2613
                   IHLL +  FH  +    LL P R +IIDG +SL+  +PNMNTLVGLG L+++  
Sbjct  134   --GFPHIHLLSNIWFHWGLATIALLFPARSIIIDGGRSLINNSPNMNTLVGLGTLTAYLT  191

Query  2612  SSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVV-  2436
             S +A   P+LGW+ FF+EPVML+ F+LLG+ LEQ A+ +A +    L+ + P+ ARLV  
Sbjct  192   SFVALLFPQLGWECFFDEPVMLLGFILLGKTLEQHARQRAATAFQSLIALQPTTARLVAP  251

Query  2435  NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKL  2256
              S      ++VE+P   + VG+ + VLPG++I  DG +R G++TVDES  TGE +P+ K 
Sbjct  252   QSQDNAILNSVEIPAEQVKVGEWLQVLPGEKIAVDGEIRFGKTTVDESMLTGESMPILKQ  311

Query  2255  PGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYG  2076
              G  ++AG+IN  G++ +E  R G +T +  IV+LVE AQ+R+AP+Q+LAD V+G+FTY 
Sbjct  312   IGDDISAGTINQTGVILIEATRTGSDTILAQIVQLVETAQTRKAPIQKLADIVAGYFTYF  371

Query  2075  VMALSAATFMFWNLFGTRVLPAT-------LHQGslaslalqlscsvlvvaCPCALGLAT  1917
             VM+L++ TF+FW   GTR+ P         +   +   L+L+L+ +VLV+ACPCALGLAT
Sbjct  372   VMSLASLTFLFWYGLGTRIWPDVIPLAGIEIATNAPLLLSLKLAIAVLVIACPCALGLAT  431

Query  1916  PTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDET  1737
             PTA++VG+ +GA RGLL++GG +LE    +NT+VFDKTGTLT G P VT           
Sbjct  432   PTAILVGSGMGAERGLLIKGGDILERVHQLNTVVFDKTGTLTTGSPRVT-----------  480

Query  1736  NAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPG  1557
                 D  +  E S   ++ LA+ VE  +NHPI +AI+  AK +N  ++ A D  F  EPG
Sbjct  481   ----DCITISELSPQQIVQLAATVEQGSNHPISEAILTEAKDQNLSLLMASD--FQTEPG  534

Query  1556  SGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQL  1377
              G  A+IE + + VG L  +  H +     +   +F  +++VYV +D  + GL+ + D L
Sbjct  535   LGVSAIIENQTIFVGNLAGLIEHKINCP--ETLPEFSGKTLVYVTIDSKVVGLMAMSDPL  592

Query  1376  REDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQ  1197
             + DA+  V  L   G+   LL+GD+++ A  +A  + +  E++F  V+P+ K   +  LQ
Sbjct  593   KTDAKSTVSQLQNLGLRVILLTGDRQSVANAIAIELNLKSEDIFAEVRPEGKVNLIQSLQ  652

Query  1196  KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRL  1017
             +  +VVAMVGDGINDA ALA + +G+ +  G   A++ + +VLM+N L  ++D+++LSR 
Sbjct  653   QLGQVVAMVGDGINDAPALAQADIGIGLQTGTDVANETADIVLMRNSLISIVDSIQLSRA  712

Query  1016  TMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             T   ++QNL+WAFGYNI+ +P+AAG L P  G +L+PS AGALM LSS+ V+TNSLLLR 
Sbjct  713   TFNKIRQNLFWAFGYNILAIPLAAGFLFPQFGILLSPSTAGALMALSSVTVVTNSLLLRR  772

Query  836   KFAS  825
             +  S
Sbjct  773   QLQS  776



>ref|WP_011318364.1| ATPase [Anabaena variabilis]
 ref|YP_322066.1| copper-translocating P-type ATPase [Anabaena variabilis ATCC 
29413]
 gb|ABA21171.1| Copper-translocating P-type ATPase [Anabaena variabilis ATCC 
29413]
Length=813

 Score =   532 bits (1370),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 343/797 (43%), Positives = 488/797 (61%), Gaps = 41/797 (5%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC  +V+R L     V +A VNL TE AVV   SE   V        E LA+ L
Sbjct  25    GGMKCAGCVKAVERQLTQYSGVKNACVNLATEVAVV--ESEVGTVDP------EMLAQRL  76

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             TS GF    R +  +    T E     +R Q+Q + + L ++  L     +GHL +    
Sbjct  77    TSAGFPTQPRTASSKASESTIEDSAARQRQQMQTAFQQLIIAAVLLVFSGIGHLGNI---  133

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
              +S + +L++  FH  +    LL+PGR +++DG     + APNMNTLVGLG L+++  S 
Sbjct  134   GSSILPILNNIWFHFGLATVALLIPGRPILVDGWLGWRRNAPNMNTLVGLGTLTAYTASV  193

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +A   P++GW+ FF+EPVM++ F+LLGR LEQ+A+ KA +    LL + P  ARL+ N D
Sbjct  194   VALLFPQMGWECFFDEPVMMLGFILLGRTLEQQARGKAAAAFRQLLALQPQIARLIANPD  253

Query  2426  ---MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKL  2256
                +G   +TVE+P   + VG+ + VLPGD+IP DG VR G++T+DES  TGE +PV K 
Sbjct  254   PENIGLGANTVEIPAEQVKVGEWLQVLPGDKIPVDGEVRFGQTTLDESMLTGEAVPVMKQ  313

Query  2255  PGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYG  2076
             PG  V AG+IN +G + ++  R G +T +  IV LVE AQ+R+AP+Q+LAD V+G+FTYG
Sbjct  314   PGDIVTAGTINQSGAIAIQATRTGNDTTLAHIVALVEAAQTRKAPIQKLADTVAGYFTYG  373

Query  2075  VMALSAATFMFWNLFGTRVLP----------------ATLHQGslaslalqlscsvlvva  1944
             ++  S  TF+FW  FGT + P                A +   S   ++L+L+ +V+VVA
Sbjct  374   ILTASVLTFIFWYCFGTHIWPDITVSGGGMEMMMNHAAHITNNSPLLISLKLAIAVMVVA  433

Query  1943  CPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV  1764
             CPCALGLATPTA++VGT +GA RGLL++GG VLE    ++T+VFDKTGTLT G P VT+ 
Sbjct  434   CPCALGLATPTAILVGTGIGAERGLLIKGGDVLEKAHQLDTVVFDKTGTLTTGNPVVTDC  493

Query  1763  VPQGHNDETNAKRDS----TSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRI  1596
             +    +        S    T T       ++ LA+ VES T+HP+ +AI +AA+ +   I
Sbjct  494   LVFAEDTPNEISFTSLHLHTPTPLHPSHSLIQLAAAVESGTHHPLARAIQQAAQQQQLSI  553

Query  1595  VKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGV--GETRVQEFDDF--KNQSVVY  1428
              +A D  F  EPG G  AV++ + V +G  DW+  HG+   ET  QE      + ++VV 
Sbjct  554   PEATD--FHTEPGMGVSAVVDGQTVLLGNGDWLSWHGITWSETAQQEAQKLATEGKTVVG  611

Query  1427  VGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENV  1248
             V V   LAGLI V+D  R DA+  V+ L + G+   LLSGD+  AA  +A  +GI R +V
Sbjct  612   VAVGESLAGLIGVQDTTRPDAQTTVDKLRQMGLRVMLLSGDRPEAANAIAQQLGIDRADV  671

Query  1247  FYGVKPDEKSKFVSGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvV  1071
               G+ P +K+ F+  LQ K    VAMVGDGINDA AL+ + VG+A+  G   A + + +V
Sbjct  672   MAGIPPAKKATFIQELQTKSGAKVAMVGDGINDAPALSQADVGIALHSGTDVAMETAQIV  731

Query  1070  LMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGA  891
             LM++R+S +++++ LSR T   ++QNL+WAF YN +G+P+AAG+LLP  G +L+PS A A
Sbjct  732   LMRDRISDVVESIHLSRATFNKIRQNLFWAFAYNTIGIPLAAGVLLPNWGFVLSPSGAAA  791

Query  890   LMGLSSIGVMTNSLLLR  840
             LM  SS+ V+TNSLLLR
Sbjct  792   LMAFSSVSVVTNSLLLR  808



>ref|XP_006400698.1| hypothetical protein EUTSA_v10012640mg [Eutrema salsugineum]
 gb|ESQ42151.1| hypothetical protein EUTSA_v10012640mg [Eutrema salsugineum]
Length=886

 Score =   534 bits (1376),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 358/827 (43%), Positives = 504/827 (61%), Gaps = 73/827 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A VK +L S  RV+SA VN+ TETA V    E +VV +      E LAK LT
Sbjct  88    GMICGGCVARVKSVLMSDDRVASAVVNMLTETAAVRLKPEVEVVAD----AAESLAKRLT  143

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
               GF+A  R S     EN+ +   K+M +K+ +L    R  +A +W L A+C   H SH 
Sbjct  144   ESGFEAKRRVSGMGVAENVKKW--KEMVSKKEELLVKSRNRVAFAWTLVALCCGSHTSHI  201

Query  2795  FG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
                     A   +  LLH++     + +  LL PGR+L+ DG+K+  K +PNMN+LVGLG
Sbjct  202   LHSLGIHIAHGGFWDLLHNSYVKGGLAVGALLGPGRELLFDGIKAFGKRSPNMNSLVGLG  261

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F++S ++   P+L W A FFEEPVML+ FVLLGR+LE+RAK++A+SDM  LL+++ 
Sbjct  262   SMAAFSISLISLVNPELDWDASFFEEPVMLLGFVLLGRSLEERAKLRASSDMNELLSLIS  321

Query  2456  SKARLVV---------NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+         +S +   +  ++VP   + VGD ++VLPG+  P DG V AGRS 
Sbjct  322   TQSRLVITASDNNTATDSVLSSDSICIDVPVDEIRVGDSLLVLPGETFPVDGSVLAGRSV  381

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V+AG+IN +G L ++    G  + I  IVR+VE+AQ   A
Sbjct  382   VDESMLTGESLPVFKEEGCSVSAGTINWDGPLRIKASSTGSNSTISKIVRMVEDAQGNAA  441

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+L+L+ 
Sbjct  442   PVQRLADAIAGPFVYTIMSLSAVTFAFWYYVGSHIFPDVLLNDIAGPDGDPLALSLKLAV  501

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + V+ +  DKTGTLT GR
Sbjct  502   DVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASVDCVALDKTGTLTEGR  561

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V+ V                ++  + E +VL LA+ VE    HPI KAIV  +++ N 
Sbjct  562   PVVSGV----------------ASLIYGEQEVLKLAAAVEKTAIHPIAKAIVNESEALNL  605

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV--RRHGVGET----RVQEFDDFK--  1446
                  E    + EPG G +A I  + V+VG L+WV  R   + ++    +++++ D K  
Sbjct  606   E--TPETRGQLTEPGFGTLAEIYGRLVAVGALEWVSGRFQKINDSSDVVKLEKYLDHKLS  663

Query  1445  --------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
                     +++VVYVG +G  + G I + D LR+DA   V  L ++GI T LLSGD++ A
Sbjct  664   STSSTSRYSKTVVYVGREGEGIIGAIAISDCLRQDAESTVTRLQEKGIKTVLLSGDREGA  723

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--gv  1119
                VA  VGI  E+  Y + P++K +F+S LQ     VAMVGDGINDA +LA + V   +
Sbjct  724   VATVAKNVGIESESTNYSLSPEKKFEFISNLQSSGLRVAMVGDGINDAPSLAQADVGIAL  783

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
              I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P+AAG+
Sbjct  784   KIEAQENAASNAASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIPIAAGV  843

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEIQGPS  798
             LLP     +TPS++G LM LSSI V++NSLLL+L     Q E  G S
Sbjct  844   LLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQL----HQSETSGNS  886



>ref|WP_026788593.1| ATPase [Planktothrix rubescens]
Length=791

 Score =   531 bits (1367),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 329/784 (42%), Positives = 478/784 (61%), Gaps = 45/784 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L  Q  V S SVNL TE A V   +  ++ P       E LA+ LT
Sbjct  27    GMQCAGCVKAVERQLLQQSGVISVSVNLATEVARV-ECAANQINP-------ESLAEILT  78

Query  2963  SCGFKANVRD---SRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             + GF   +R+   S  E L E  E+       Q+Q     +     L  +  +GHL HF 
Sbjct  79    NTGFPTQLRNLTSSATEKLKELQERHRQDMGKQIQR----IVTCGLLLLLSSIGHLHHF-  133

Query  2792  GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAV  2613
                   IHLL +  FH  +    LL P R +IIDG +SLL  APNMNTLVGLG L+++  
Sbjct  134   --GFPHIHLLSNIWFHWGLATIALLFPARSIIIDGGRSLLNNAPNMNTLVGLGTLTAYLT  191

Query  2612  SSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVV-  2436
             S +A   P+LGW+ FF+EPVML+ F+LLG+ LEQ A+ +A +    L+ + P+ ARLV  
Sbjct  192   SFVALLFPQLGWECFFDEPVMLLGFILLGKTLEQYARQRAATAFQSLIALQPTTARLVAP  251

Query  2435  NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKL  2256
              S      ++VE+P   + VG+ + VLPG++I  DG +R G++TVDES  TGE +P+ K 
Sbjct  252   QSQDNAILNSVEIPAEQVKVGEWLQVLPGEKIAVDGEIRFGKTTVDESMLTGESMPILKQ  311

Query  2255  PGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYG  2076
              G  ++AG+IN  G++ +E  R G +T +  IV+LVE AQ+R+AP+Q+LAD V+G+FTY 
Sbjct  312   IGDDISAGTINQTGVILIEATRTGSDTILAQIVQLVETAQTRKAPIQKLADIVAGYFTYF  371

Query  2075  VMALSAATFMFWNLFGTRVLPAT-------LHQGslaslalqlscsvlvvaCPCALGLAT  1917
             VM+L+  TF+FW   GTR+ P         +   +   L+L+L+ +VLV+ACPCALGLAT
Sbjct  372   VMSLAGLTFLFWYGLGTRIWPDVIPLAGIEIATNAPLLLSLKLAIAVLVIACPCALGLAT  431

Query  1916  PTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDET  1737
             PTA++VG+ +GA RGLL++GG +LE    +N +VFDKTGTLT G P VT           
Sbjct  432   PTAILVGSGIGAERGLLIKGGDILERVHQLNIVVFDKTGTLTTGSPMVT-----------  480

Query  1736  NAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPG  1557
                 D  +  E S   +L LA+ VE  +NHPI +AI+  AK +N  ++ A +  F  EPG
Sbjct  481   ----DCITISELSPQQILQLAATVEQGSNHPISEAILREAKEQNLSLLMASN--FQTEPG  534

Query  1556  SGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQL  1377
              G  A+IE + + VG L  +  H +     +   +F  +++VYV +DG + GL+ + D L
Sbjct  535   LGVSAIIENQTIFVGNLAGLIEHKINYP--ETLPEFLGKTIVYVTIDGKVVGLMAMSDPL  592

Query  1376  REDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQ  1197
             + DA+  V  L   G+   LL+GD+++ A  +A  + +  E++F  V+P+ K   +  LQ
Sbjct  593   KTDAKLTVSQLQNLGLRVILLTGDRQSVANAIAIELNLKSEDIFAEVRPEGKVNLIQTLQ  652

Query  1196  KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRL  1017
             +  +VVAMVGDGINDA ALA + +G+ +  G   A++ + +VL +N L  ++D+++LSR 
Sbjct  653   QQNQVVAMVGDGINDAPALAQADIGIGLQTGTDVANETADIVLTRNSLIDIVDSIQLSRA  712

Query  1016  TMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             T   ++QNL+WAFGYN++ +P+AAG L P  G +L+PS AGALM LSS+ V+TNSLLLR 
Sbjct  713   TFNKIRQNLFWAFGYNVLAIPLAAGFLFPQFGILLSPSTAGALMALSSVTVVTNSLLLRR  772

Query  836   KFAS  825
             +  S
Sbjct  773   QVKS  776



>ref|XP_010669315.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=894

 Score =   534 bits (1375),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 356/822 (43%), Positives = 504/822 (61%), Gaps = 68/822 (8%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM CG CA  VK++L +  RV SA VN+ TETA V   SE     +    + EELAK L
Sbjct  87    GGMMCGACAIRVKKLLTADDRVESAVVNMLTETAAVRLKSEV----SGGGFVAEELAKRL  142

Query  2966  TSCGFKANVRDSRRENLFETFEK--KMNAKRAQL-QASGRGLAVSWALCAVCLVGHLSHF  2796
               CGF+A  R +    + E  +K  +M AK+ +L + S   +  +W L A+C   H SH 
Sbjct  143   NECGFEAKKRVAG-SGVGERVKKWKEMAAKKEELVEKSKNRVIFAWTLVALCCGSHASHI  201

Query  2795  FG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
                     A   +  +LH++     + L  LL PGR L+ DGL++  KG+PNMN+LVG G
Sbjct  202   MHSVGIHVAHGGFWDVLHNSYVKGGLALGALLGPGRDLLYDGLRAFFKGSPNMNSLVGFG  261

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F +S+++   P+L W A FF+EPVML+ FVLLGR+LE+RA+IKA+SDM  LL+++ 
Sbjct  262   SIAAFILSAVSLVNPELEWNASFFDEPVMLLGFVLLGRSLEERARIKASSDMNELLSLVS  321

Query  2456  SKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             ++ARLV+ S          +      +EVP  ++ VGD ++VLPG+ IP DG V AGRS 
Sbjct  322   TQARLVITSSESESASNELLASDAICIEVPTDDIRVGDTVLVLPGETIPVDGKVLAGRSV  381

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V+AG+IN +G + +E    G  + I  I+ +VE+AQS EA
Sbjct  382   VDESMLTGESLPVFKEAGLLVSAGTINWDGPIRIEATSTGSNSTISKIIHMVEDAQSNEA  441

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             P+QRLAD ++G F Y VM LS  TF FW+  GT++ P  L        GS   L+L+L+ 
Sbjct  442   PIQRLADSIAGPFVYSVMTLSLITFAFWSSIGTKIFPDVLLNDIAGPDGSPLILSLKLAV  501

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA++VGTS+GA +GLLLRGG VLE  + +N + FDKTGTLT G+
Sbjct  502   DVLVVSCPCALGLATPTAILVGTSIGARQGLLLRGGDVLERLAGINYMAFDKTGTLTEGK  561

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             PTV+ V                ++  +   ++L LA+ VE  T+HP+  AI+  +K+ +C
Sbjct  562   PTVSAV----------------ASLAYDISEILQLAAAVEKTTSHPLANAIL--SKAESC  603

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV--RRHGVGETRVQEFDDF-------  1449
              +        + EPG G +A ++ + V+VG+L+WV  R     ++ ++  +         
Sbjct  604   GLQIPATSRQLTEPGFGTLAEVDGRLVAVGSLEWVCQRFETKNQSDIEHLERALMLESAK  663

Query  1448  ------KNQSVVYVGV--DGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
                   K+++VVYVG   +GV+ G I + D LR DA   V  L + GI   LLSGD++ A
Sbjct  664   PTSSLDKSETVVYVGREEEGVI-GAIAISDALRHDAEATVARLKRMGIKPILLSGDREEA  722

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgv  1119
                VA ++GI  E+V   + P  KS F+S +Q     VAMVGDGINDA   ALA   + +
Sbjct  723   VAKVAKIIGINDEHVQPSLNPQRKSHFISDIQASGHRVAMVGDGINDAPSLALADVGIAL  782

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
               G    AASD +S+VL+ NRLSQ+++A++L+R TM  V QNL WA  YN++ +PVAAG+
Sbjct  783   KTGMQENAASDAASIVLLGNRLSQVVEAVDLARATMSKVHQNLLWAVAYNVITIPVAAGV  842

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             LLP     +TPS++G LM LSSI V++NSLLL+L  ++K+KE
Sbjct  843   LLPHFDFAMTPSLSGGLMALSSIFVVSNSLLLQLHGSNKEKE  884



>ref|WP_027249736.1| ATPase [Planktothrix agardhii]
Length=784

 Score =   530 bits (1366),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 328/784 (42%), Positives = 478/784 (61%), Gaps = 45/784 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L  Q  V S SVNL TE A V   +  ++ P       E LA+ LT
Sbjct  27    GMQCAGCVKAVERQLLQQSGVISVSVNLATEVARV-ECAANQINP-------ENLAEILT  78

Query  2963  SCGFKANVRD---SRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             + GF   +R+   S  E L E  E+       Q+Q     +     L  +  +GHL HF 
Sbjct  79    NTGFPTQLRNLTSSATEKLKELQERHRQDMGKQIQR----IVTCGLLLLLSSIGHLHHF-  133

Query  2792  GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAV  2613
                   IHLL +  FH  +    LL P R +IIDG +SLL  APNMNTLVGLG L+++  
Sbjct  134   --GFPHIHLLSNIWFHWGLATIALLFPARSIIIDGGRSLLNNAPNMNTLVGLGTLTAYLT  191

Query  2612  SSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVV-  2436
             S +A   P+LGW+ FF+EPVML+ F+LLG+ LEQ A+ +A +    L+ + P+ ARLV  
Sbjct  192   SFVALLFPQLGWECFFDEPVMLLGFILLGKTLEQYARQRAATAFQSLIALQPTTARLVAP  251

Query  2435  NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKL  2256
              S      ++VE+P   + VG+ + VLPG++I  DG +R G++TVDES  TGE +P+ K 
Sbjct  252   QSQDNAILNSVEIPAEQVKVGEWLQVLPGEKIAVDGEIRFGKTTVDESMLTGESMPILKQ  311

Query  2255  PGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYG  2076
              G  ++AG+IN  G++ +E  R G +T +  IV+LVE AQ+R+AP+Q+LAD V+G+FTY 
Sbjct  312   IGDDISAGTINQTGVILIEATRTGSDTILAQIVQLVETAQTRKAPIQKLADIVAGYFTYF  371

Query  2075  VMALSAATFMFWNLFGTRVLPAT-------LHQGslaslalqlscsvlvvaCPCALGLAT  1917
             VM+L+  TF+FW   GTR+ P         +   +   L+L+L+ +VLV+ACPCALGLAT
Sbjct  372   VMSLAGLTFLFWYGLGTRIWPDVIPLAGIEIATNAPLLLSLKLAIAVLVIACPCALGLAT  431

Query  1916  PTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDET  1737
             PTA++VG+ +GA RGLL++GG +LE    +N +VFDKTGTLT G P VT           
Sbjct  432   PTAILVGSGIGAERGLLIKGGDILERVHQLNIVVFDKTGTLTTGSPMVT-----------  480

Query  1736  NAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPG  1557
                 D  +  E S   +L LA+ VE  +NHPI +AI+  AK +N  ++ A +  F  EPG
Sbjct  481   ----DCITISELSPQQILQLAATVEQGSNHPISEAILREAKEQNLSLLMASN--FQTEPG  534

Query  1556  SGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQL  1377
              G  A+I+ + + VG L  +  H +     +   +F  +++VYV +DG + GL+ + D L
Sbjct  535   LGVSAIIDNQTIFVGNLAGLIEHKINYP--ETLPEFLGKTIVYVTIDGKVVGLMAMSDPL  592

Query  1376  REDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQ  1197
             + DA+  V  L   G+   LL+GD+++ A  +A  + +  E++F  V+P+ K   +  LQ
Sbjct  593   KTDAKLTVSQLQNLGLRVILLTGDRQSVANAIAIELNLKSEDIFAEVRPEGKVNLIQTLQ  652

Query  1196  KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRL  1017
             +  +VVAMVGDGINDA ALA + +G+ +  G   A++ + +VL +N L  ++D+++LSR 
Sbjct  653   QQNQVVAMVGDGINDAPALAQADIGIGLQTGTDVANETADIVLTRNSLIDIVDSIQLSRA  712

Query  1016  TMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             T   ++QNL+WAFGYN++ +P+AAG L P  G +L+PS AGALM LSS+ V+TNSLLLR 
Sbjct  713   TFNKIRQNLFWAFGYNVLAIPLAAGFLFPQFGILLSPSTAGALMALSSVTVVTNSLLLRR  772

Query  836   KFAS  825
             +  S
Sbjct  773   QLKS  776



>gb|ABD64063.1| copper P1B-ATPase [Glycine max]
Length=908

 Score =   534 bits (1375),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 357/823 (43%), Positives = 501/823 (61%), Gaps = 68/823 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVW--PVSEAKVVPNWQQQLGEELAKH  2970
             GM CG C + VK+IL +  RV SA VN+ T+TA V   P+ EA+V       + E LA+ 
Sbjct  90    GMMCGACISRVKKILSADDRVDSAVVNMLTDTAAVKLKPL-EAEVD---SASVAESLARR  145

Query  2969  LTSCGFKANVRDSRRENLFETFEK--KMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSH  2799
             L+ CGF A  R S    + E+  K  +M  K+  L A  R  +A +W L A+C   H SH
Sbjct  146   LSDCGFPAKRRASG-SGVAESVRKWKEMVKKKEDLVAKSRNRVAFAWTLVALCCGSHASH  204

Query  2798  FFG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGL  2637
              F       A    + +LHS+     + L +LL PGR+L+ DGL +  KG+PNMN+LVG 
Sbjct  205   IFHSLGIHIAHGPLMEILHSSYLKGGLALGSLLGPGRELLFDGLNAFKKGSPNMNSLVGF  264

Query  2636  GALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVL  2460
             G++++F +SS++   P L W A FF+EPVML+ FVLLGR+LE++A+I+A+SDM  LL+++
Sbjct  265   GSVAAFIISSISLLNPGLAWDASFFDEPVMLLGFVLLGRSLEEKARIQASSDMNELLSLI  324

Query  2459  PSKARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRS  2307
              +++RLV+ S  G  ++          VEVP  ++ VGD ++VLPG+ IP DG V +GRS
Sbjct  325   STQSRLVITSTEGSPSTDTVLCSDAICVEVPTDDIRVGDSVLVLPGETIPIDGTVISGRS  384

Query  2306  TVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSRE  2127
              +DES  TGE LPV K  G  V+AG+IN +G L +E    G  T I  IVR+VE+AQSRE
Sbjct  385   VIDESMLTGESLPVFKEKGLTVSAGTINWDGPLRIEASSTGSNTMISKIVRMVEDAQSRE  444

Query  2126  APVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqls  1965
             APVQRLAD ++G F Y VM LSAATF FW   G+ + P  L       +G    L+L+LS
Sbjct  445   APVQRLADSIAGPFVYSVMTLSAATFAFWYFVGSHIFPDVLLNDIAGPEGDPLLLSLKLS  504

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
               VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + +N I  DKTGTLT G
Sbjct  505   VDVLVVSCPCALGLATPTAILVGTSLGARKGLLIRGGDVLERLAGINYIALDKTGTLTKG  564

Query  1784  RPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRN  1605
             +P V+ +                S+  + E ++L LA+ VE   +HPI KAIV  A+S  
Sbjct  565   KPVVSAI----------------SSILYGESEILRLAAAVEKTASHPIAKAIVNKAESLE  608

Query  1604  CRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN------  1443
               ++    G  + EPG G +A ++   ++VG+L+WV           +  + +N      
Sbjct  609   L-VLPVTKGQLV-EPGFGTLAEVDGHLIAVGSLEWVHERLQTRANPSDLTNLENSLMNHS  666

Query  1442  ---------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
                      ++VVYVG +G  + G I + D +REDA   +  L ++GI T LLSGD++ A
Sbjct  667   LNTTSSKYSKTVVYVGREGEGIIGAIAISDTVREDAESTITRLKQKGIKTVLLSGDREEA  726

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--gv  1119
                VA  VGI  + V   + P +KS F+S L+     VAMVGDGINDA +LA + V   +
Sbjct  727   VATVADTVGIENDFVKASLSPQQKSGFISSLKAAGHHVAMVGDGINDAPSLAVADVGIAL  786

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
                    AASD +S++L+ N++SQ++DAL+L++ TM  V QNL WA  YN+V +P+AAG+
Sbjct  787   QNEAQENAASDAASIILLGNKISQVVDALDLAQATMGKVYQNLCWAVAYNVVAIPIAAGV  846

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEI  810
             LLP     +TPS++G LM LSSI V+ NSLLL+L  +   +++
Sbjct  847   LLPHFDFAMTPSLSGGLMALSSIFVVGNSLLLQLHGSQISRKV  889



>ref|WP_006104082.1| ATPase [Coleofasciculus chthonoplastes]
 gb|EDX72919.1| copper-translocating P-type ATPase [Coleofasciculus chthonoplastes 
PCC 7420]
Length=843

 Score =   532 bits (1370),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 344/828 (42%), Positives = 480/828 (58%), Gaps = 76/828 (9%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVV-WPVSEAKVVPNWQQQLGEELAKH  2970
             GGM C GC ++V+R L+ QP V SA VNL TE AVV + VS+A             LA+ 
Sbjct  24    GGMKCAGCVSAVERQLKQQPGVISAQVNLVTEVAVVEYEVSQADPA---------TLAEK  74

Query  2969  LTSCGFKANVRDSR----RENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLS  2802
             LT+ GF +  R S+     E      ++     R QLQ     L ++  L  +  +GH+ 
Sbjct  75    LTATGFPSQPRYSQAGETSEERLTPTQRHEQEAREQLQQ----LIIASVLVILSTIGHIG  130

Query  2801  HFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSS  2622
             H+F      + +  +  FH  +    LL PGR +I DG + L    PNMNTLVGLG L++
Sbjct  131   HWF--NGPMLPVFSTIWFHWGLATLALLGPGRPIISDGWRGLRHQTPNMNTLVGLGTLAA  188

Query  2621  FAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARL  2442
             +  S  A   P+LGW+ FF+EPVML+ F+LLGR LEQRA+ +A++    LL + P  ARL
Sbjct  189   YWASCAALLFPQLGWECFFDEPVMLLGFILLGRTLEQRARRQASAAYESLLALKPKVARL  248

Query  2441  VVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVT  2262
             +  S        +E+P   + VG+ + VLPG++IP DG V  G+S+VDES  TGEPLPV 
Sbjct  249   IGKSTPTATELGIEIPVEQVRVGEWLRVLPGEKIPVDGEVVTGQSSVDESMLTGEPLPVL  308

Query  2261  KLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFT  2082
             K PG  V AG++N +G + ++  R G ET +  IV LVEEAQ+R+APVQ LADKV+G+FT
Sbjct  309   KQPGDPVTAGTLNQSGAIAIQATRIGQETTLAQIVALVEEAQTRKAPVQNLADKVAGYFT  368

Query  2081  YGVMALSAATFMFWNLFGTRVLPATLHQGslaslalql--------scsvlvvaCPCALG  1926
             YGV+ ++  TF+FW L GT++    L +G                 + +VLV+ACPCALG
Sbjct  369   YGVLTIATFTFLFWELVGTKIWTQVLGEGDSLIGDSTSPLLLSLKLAIAVLVIACPCALG  428

Query  1925  LATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGH-  1749
             LATPTA++VGTSLGA RGLL++GG +LE    ++TIVFDKTGTLT G+PTVT+ +  G  
Sbjct  429   LATPTAILVGTSLGAERGLLIKGGDILERVHQLDTIVFDKTGTLTQGKPTVTDCLSIGEW  488

Query  1748  NDETNAKRDSTSTCEWSEVDV---------------------------------LTLASG  1668
              +E + +   T    +SE  V                                 L LA+ 
Sbjct  489   AEEEDGETGGTGAEVYSESSVRAGFEQSLSSIAGANFLNPPLQTNNGISGNSKLLQLAAA  548

Query  1667  VESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRH  1488
              E  T HP+G+AI  AA  +   ++ A+D  F  E G G  A+++ + V +G  DW+R+ 
Sbjct  549   AERGTTHPLGEAICTAAAQQELPLLAAKD--FYTEAGLGISALVDNQSVLLGNEDWLRQQ  606

Query  1487  GV--GETRVQEFDDFK--NQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTY  1320
             GV   +T   +        ++VVY+ VDG LAGLI + D  + DA+  VE L   G+   
Sbjct  607   GVTISDTTQAQAQTLAAVGKTVVYLAVDGELAGLIALTDLPKPDAKTTVEQLQAMGLRVM  666

Query  1319  LLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAAL  1140
             LL+GD+ NAA  VA  + I   NV  G++PD K+  ++ LQ     +AMVGDGIND  AL
Sbjct  667   LLTGDQPNAAVKVAQHLAIDPANVMAGIRPDGKAAAIAQLQTQGNCIAMVGDGINDGPAL  726

Query  1139  asshvgvaigggvgaasdvssvVLMQNR--------LSQLLDALELSRLTMKTVKQNLWW  984
             A + VG+A+  G   A + + ++LMQ          L  ++ A++LSR T   ++QNL+W
Sbjct  727   AQADVGIALQAGTDVARETAGIILMQPSANSPQAGGLLDIVQAIQLSRATFNKIRQNLFW  786

Query  983   AFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLR  840
             A GYN +G+PVAAG+LLP  G  L P++AGALM  SS+ V++NSLLLR
Sbjct  787   ALGYNTLGIPVAAGVLLPGFGIALNPAVAGALMAFSSVTVVSNSLLLR  834



>gb|KDP34025.1| hypothetical protein JCGZ_07596 [Jatropha curcas]
Length=884

 Score =   533 bits (1373),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 351/813 (43%), Positives = 492/813 (61%), Gaps = 64/813 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CG C + VK +L +  RV S  VN+ TETA +    EA V      ++ + LA+ LT
Sbjct  85    GMMCGSCVSRVKSLLSADERVDSVVVNMLTETAAIKLKPEA-VESGLSAEIADGLARGLT  143

Query  2963  SCGFKANVRDS---RRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
              CGF+A  R S     EN+   +++ +  K   L  S   +A++W L A+C   H SH  
Sbjct  144   DCGFEAKRRVSGLGVAENV-RKWQEMVQKKEELLVKSRNRVAIAWTLVALCCGSHASHIL  202

Query  2792  G------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGA  2631
                    A   +  +LH++     + L  LL PGR L+ DG+++  KG+PNMN+LVG G+
Sbjct  203   HSLGIHVAHGFFWEMLHNSYVKGGLSLAALLGPGRDLLFDGIRAFKKGSPNMNSLVGFGS  262

Query  2630  LSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPS  2454
             +++F +S+++   P+L W A FF+EPVML+ FVLLGR+LE++A+IKA+SDM  LL+++ +
Sbjct  263   VAAFFISAVSLLNPELKWDASFFDEPVMLLGFVLLGRSLEEKARIKASSDMNELLSLIST  322

Query  2453  KARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             ++RLV+ S          +      VEVP  ++ +GD ++VLPG+ IP DG V AGRS V
Sbjct  323   QSRLVITSSDGNSSGDSVLCSDAICVEVPTDDVRIGDSVLVLPGETIPVDGRVLAGRSVV  382

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DES  TGE LPV K  G +V+AG++N +G L +E    G  + I  IVR+VE+AQ  EAP
Sbjct  383   DESMLTGESLPVFKEEGLKVSAGTMNWDGPLRIEASSTGSNSTISRIVRMVEDAQGHEAP  442

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscs  1959
             +QRLAD ++G F Y VM++SAATF FW   G+ + P  L        G    L+L+LS  
Sbjct  443   IQRLADSIAGPFVYSVMSISAATFAFWYYIGSHIFPDVLLNDIAGPDGDSLLLSLKLSVD  502

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + +  I  DKTGTLT G+P
Sbjct  503   VLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLASIKYIALDKTGTLTEGKP  562

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
              V+ V                ++  + E +VL +A+ VE    HPI KAIV  A+     
Sbjct  563   AVSAV----------------ASITYKESEVLQIAAAVEKTALHPIAKAIVNEAELLKLT  606

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFK---------  1446
             I  A  G  + EPG GA+A ++ + V+VGTLDWV      +T + +  + +         
Sbjct  607   I-PATRGQ-LTEPGFGALAEVDGRLVAVGTLDWVHERFQRKTNLSDIRNLETAVTFQPSE  664

Query  1445  -------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAA  1290
                    +++VVYVG +G  + G I + D LR DA   V  L ++GI+T L+SGD++ A 
Sbjct  665   VGSLSNYSKTVVYVGREGEGIIGAISISDSLRNDAELTVSRLQQKGISTVLVSGDREEAV  724

Query  1289  EYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgva  1116
               +A+ VGI  E V   + P +KS  +S LQ     VAMVGDGINDA   ALA   + + 
Sbjct  725   ANIANRVGIGSEFVNASLAPQQKSAVISTLQAAGHRVAMVGDGINDAPSLALADVGIALQ  784

Query  1115  igggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGIL  936
                   AASD +S++L+ NRLSQ++DAL+L+R TM  V QNL WA  YN+V +P+AAG+L
Sbjct  785   NEAQENAASDAASIILLGNRLSQVVDALDLARATMAKVYQNLSWAIAYNVVAIPIAAGVL  844

Query  935   LPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             LP     +TPS++G LM LSSI V+TNSLLL+L
Sbjct  845   LPQYDFAMTPSLSGGLMALSSIFVVTNSLLLQL  877



>ref|XP_007136888.1| hypothetical protein PHAVU_009G082400g [Phaseolus vulgaris]
 gb|ESW08882.1| hypothetical protein PHAVU_009G082400g [Phaseolus vulgaris]
Length=884

 Score =   533 bits (1373),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 359/816 (44%), Positives = 488/816 (60%), Gaps = 74/816 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CG C + VK IL +  RV S  VN+ TETA V        V      + E LA+ L 
Sbjct  87    GMMCGACVSRVKNILSADERVDSVVVNMLTETAAV----NLHRVEEEPASVAESLARRLG  142

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
              CGF    R S     EN+ +   K++  K+ +L A  RG +A +W L A+C   H SH 
Sbjct  143   DCGFPTKRRASSSGVTENVRKW--KELVKKKEELVAKSRGRVAFAWTLVALCCGSHASHI  200

Query  2795  FG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
             F       A  S   +LHS+     + L  LL PGR+L+ DGL +  KG+PNMN+LVG G
Sbjct  201   FHSLGIHIAHGSLWEILHSSYVKGGLALAALLGPGRELLFDGLNAFKKGSPNMNSLVGFG  260

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F +SS+    P L W A FF+EPVML+  VLLGR+LE++A+I+A+SDM  LL+++ 
Sbjct  261   SIAAFIISSIPLLNPGLAWDASFFDEPVMLLGIVLLGRSLEEKARIQASSDMNELLSLVS  320

Query  2456  SKARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+ S  G  ++          VEVP  ++ VGD ++VLPG+ IP DG V +GRS 
Sbjct  321   TQSRLVITSTEGSPSTDTVLCSDAICVEVPTDDIRVGDSVLVLPGETIPIDGKVISGRSV  380

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDE+  TGE LPV K  G  V+AG+IN +G L +E    G  T I  IVR+VEEAQSREA
Sbjct  381   VDEAMLTGESLPVFKEKGLTVSAGTINWDGPLRIEASSTGSNTTISKIVRMVEEAQSREA  440

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F Y VM LSAATF FW   G+ + P  L       +G    L+L+LS 
Sbjct  441   PVQRLADSIAGPFVYSVMTLSAATFAFWYFVGSHIFPDVLLNDIAGPEGDPLLLSLKLSV  500

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + VN I  DKTGTLT G+
Sbjct  501   DVLVVSCPCALGLATPTAILVGTSLGARKGLLIRGGDVLERLAKVNYIALDKTGTLTKGK  560

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V  +                 +  + E ++L +A+ VE   +HPI KAIV  A+S   
Sbjct  561   PVVLAI----------------GSIHYGESEILRIAAAVEKTASHPIAKAIVNKAES--L  602

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN-------  1443
              ++       + EPG G +A ++   ++VG+L+WV  H   +TRV    D KN       
Sbjct  603   ELILPVTKRQLVEPGFGTLAEVDGHLIAVGSLEWV--HQRFQTRVNP-SDLKNLEHSLMN  659

Query  1442  -----------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKK  1299
                        ++VVYVG +G  + G I + D +REDA   V  L ++GI T LLSGD++
Sbjct  660   HSSNTTSSKYSKTVVYVGREGEGIIGAIAISDTVREDAESTVMRLKQKGIKTVLLSGDRE  719

Query  1298  NAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--  1125
              A   VA  VGI  + V   + P +KS F+S L+     +AMVGDGINDA +LA + V  
Sbjct  720   EAVATVADTVGIENDFVKASLSPQQKSSFISSLKAAGHHIAMVGDGINDAPSLAVADVGI  779

Query  1124  gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAA  945
              +       AASD +S++L+ N++SQ++DAL+L++ TM  V QNL WA  YN V +P+AA
Sbjct  780   ALQNEAQENAASDAASIILLGNKISQVVDALDLAQATMAKVYQNLSWAVAYNAVAIPIAA  839

Query  944   GILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             G+LLP     +TPS++G LM LSSI V+ NSLLL+L
Sbjct  840   GVLLPQFDFAMTPSLSGGLMALSSIFVVGNSLLLQL  875



>ref|XP_009624550.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Nicotiana 
tomentosiformis]
Length=898

 Score =   533 bits (1374),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 350/821 (43%), Positives = 495/821 (60%), Gaps = 68/821 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLG--EELAKH  2970
             GM CG C   VK IL +  RV SA VN+ TETA V      K+ P   +     EELA+ 
Sbjct  90    GMMCGACVTRVKSILSADDRVDSAVVNMLTETAAV------KLKPEAGESFAAAEELAQR  143

Query  2969  LTSCGFKANVRDSRR--ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSH-  2799
             LT CGF    R S    +   + +++ +  K A L  S   +  +W+L A+C   H +H 
Sbjct  144   LTGCGFPTKKRSSGLGVDEKVKKWKEMVEKKEALLVESRNRVFFAWSLVALCCGTHATHI  203

Query  2798  -----FFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
                  F     S + +LH++     + +  LL PGR L+ DG+++  KG+PNMN+LVG G
Sbjct  204   LHSLGFHIGHGSMLDVLHNSYVKAGLAIGALLGPGRDLLFDGIRAFTKGSPNMNSLVGFG  263

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++FA+SS++   P L W+A FF+EPVML+ FVLLGR+LE+RA++KA+SDM  LL+++ 
Sbjct  264   SIAAFAISSVSLLNPALQWEATFFDEPVMLLGFVLLGRSLEERARLKASSDMNELLSLIS  323

Query  2456  SKARLVVNSD--------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             +++RLVV S         +G     +EVP  ++ VGD ++VLPG+ IP DG V AGRS V
Sbjct  324   TQSRLVVTSSGSGSSADVVGADAICIEVPTDDIRVGDSLLVLPGETIPVDGRVVAGRSVV  383

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DES  TGE LPV K  G  V+AG+IN +  L +E    G  + I  IV +VE+AQ REAP
Sbjct  384   DESMLTGESLPVFKEKGFSVSAGTINWDSPLRIEASSTGSNSTISKIVNMVEDAQGREAP  443

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscs  1959
             +QRLADK++G F Y VM LSAATF FW   G+ +    L       +G    L+L+L+  
Sbjct  444   IQRLADKIAGPFVYSVMTLSAATFGFWYYLGSHIFQDVLLNDIAGPEGDPLLLSLKLAVD  503

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + V+ ++ DKTGTLT G+P
Sbjct  504   VLVVSCPCALGLATPTAILVGTSLGARKGLLIRGGDVLERLAGVDHVMLDKTGTLTEGKP  563

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
              V  +   GH                 E+++L +A+ VE   +HPI  AI+  A+S N  
Sbjct  564   AVCAIASLGHE----------------ELEILQIAAAVEKTASHPIAHAIISKAESLNLS  607

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV-----RRHGVGETRVQE-------FD  1455
             I        + EPGSG MA +    V++G L WV     ++  + + R  E        +
Sbjct  608   IPVTRGQ--LAEPGSGTMAEVNGLLVAIGKLKWVQERFQQKADLSDLRTLEQSVMHKSLE  665

Query  1454  DFKNQ----SVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAA  1290
             D ++     +VVYVG +G  + G I + D+LREDA   +  L  +GI T LLSGD++ A 
Sbjct  666   DSQSSNHSTTVVYVGQEGEGVIGAIAISDKLREDAESTIRRLQDKGIETVLLSGDREEAV  725

Query  1289  EYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgva  1116
               VA  VGI  + V   + P++KS  +S LQ     VAMVGDGINDA   ALA   + + 
Sbjct  726   ATVAKTVGIKDKFVNASLTPEQKSAAISVLQASGHHVAMVGDGINDAPSLALADVGIALQ  785

Query  1115  igggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGIL  936
             + G   AAS+ +S++L+ N+LSQ+++AL+L+R TM  V QNL WA  YN+V +P+AAG+L
Sbjct  786   VEGQETAASNAASIILLGNKLSQVVEALDLARATMAKVHQNLSWAVAYNVVAIPIAAGVL  845

Query  935   LPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             LP     +TPS++G LM LSSI V++NSLLL+   + ++++
Sbjct  846   LPNFDFAMTPSLSGGLMALSSIFVVSNSLLLQFHGSQRKRK  886



>ref|XP_002280050.2| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Vitis 
vinifera]
 emb|CBI20726.3| unnamed protein product [Vitis vinifera]
Length=888

 Score =   533 bits (1372),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 357/824 (43%), Positives = 495/824 (60%), Gaps = 74/824 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNW-QQQLGEELAKHL  2967
             GM CG C A VK +L +  RV SA VN+ TETA V      ++ P   ++ +GE LA+ L
Sbjct  91    GMVCGACVARVKSVLSADERVESAVVNMLTETAAV------RIRPEVVEETVGESLARRL  144

Query  2966  TSCGF--KANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             T CGF  K  V  +  E   + + +    K A L  S   +AV+W L A+C   H SH  
Sbjct  145   TECGFPTKERVSGTGVEENVKKWREMGEKKEALLVKSRNRVAVAWTLVALCCGSHASHIL  204

Query  2792  GA------KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGA  2631
              +        S+  LLH++     + L  LL PGR+L+ DGL++  KG+PNMN+LVG G+
Sbjct  205   HSLGIHVDHGSFWELLHNSYVKGGLALGALLGPGRELLFDGLRAFSKGSPNMNSLVGFGS  264

Query  2630  LSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPS  2454
             +++F +S ++ F P L W A FF+EPVML+ FVLLGR+LE++A+I+A+SDM  LL+++ +
Sbjct  265   VAAFGISMVSLFNPGLQWDASFFDEPVMLLGFVLLGRSLEEKARIRASSDMNKLLSLIST  324

Query  2453  KARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             ++RLV+ S          +      +EVP  ++ VGD ++VLPG+ IP DG V AGRS V
Sbjct  325   RSRLVITSSESDSSTNSILCSDAMCIEVPTDDIRVGDSVLVLPGETIPVDGRVLAGRSVV  384

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DES  TGE LPV K  G  V+AG+IN  G L +E    G  + I  IV +VE+AQ R AP
Sbjct  385   DESMLTGESLPVFKEEGFVVSAGTINWGGPLRIEASSNGSNSTISKIVSMVEDAQGRAAP  444

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQ------Gslaslalqlscs  1959
             +QRLAD ++G F Y VM LSAATF FW   GT + P  L        G+   L+L+LS  
Sbjct  445   IQRLADSIAGPFVYIVMTLSAATFTFWYYLGTHIFPDVLFNDIAGPDGNPLLLSLKLSVD  504

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + V+ + FDKTGTLT G+P
Sbjct  505   VLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLASVDHVAFDKTGTLTKGKP  564

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
              V+ V                ++  + E ++L +A+ VE    HPI KAIV  A+S N  
Sbjct  565   AVSAV----------------ASLAYEEQEILRIAAAVEKTAVHPIAKAIVNKAESLNLT  608

Query  1598  --IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN------  1443
               I  A+    + EPG G++A ++ + V+VG+L+WV+      T   +  + +N      
Sbjct  609   IPITTAQ----LVEPGFGSLAEVDGRLVAVGSLEWVQDRFQRRTNHSDLMNLENAMMHHL  664

Query  1442  ----------QSVVYVGV--DGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKK  1299
                       ++VVYVG   DGV+ G I V D LR DA   V  L ++GI T LLSGD++
Sbjct  665   SNEVSLSNHSRTVVYVGREGDGVI-GAIAVCDSLRHDANSAVTRLQEKGIKTILLSGDRE  723

Query  1298  NAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshv  1125
              A   +A  VGI  E +   + P +KS  +  LQ     VAMVGDGINDA   ALA   +
Sbjct  724   EAVATIAKTVGIESEFINSSLTPQQKSGVIKSLQTAGHRVAMVGDGINDAPSLALADVGI  783

Query  1124  gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAA  945
              + +     AASD +S++L+ N++SQ+ DAL+L++ TM  V QNL WA  YN+V +P+AA
Sbjct  784   ALQVESQQSAASDAASIILLGNKISQVADALDLAQATMAKVYQNLSWAVAYNVVAVPIAA  843

Query  944   GILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             G+LLP     +TPS+AG LM LSSI V+TNS+LL+L  + K ++
Sbjct  844   GVLLPRFDLAMTPSLAGGLMALSSIFVVTNSVLLQLHGSDKNRK  887



>ref|XP_009120707.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Brassica 
rapa]
Length=885

 Score =   533 bits (1372),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 357/819 (44%), Positives = 497/819 (61%), Gaps = 78/819 (10%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLG---EELAK  2973
             GM CGGC A VK +L S  RV+SA VN+ TETA V      ++ P  ++ +    E LAK
Sbjct  86    GMMCGGCVARVKSVLMSDDRVASAVVNMLTETAAV------RLKPEVEEAVADAAESLAK  139

Query  2972  HLTSCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHL  2805
              LT  GF+A  R S     EN+ +   K+M +K+ +L    R  +A +W L A+C   H 
Sbjct  140   RLTESGFEAKRRVSGMGVAENVKKW--KEMVSKKEELLVKSRNRVAFAWTLVALCCGSHT  197

Query  2804  SHFFGAKASWIH--------LLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNT  2649
             SH   +    IH        LLH++     + +  LL PGR+L+ DG+K+  K +PNMN+
Sbjct  198   SHILHSVG--IHVAHGGVWDLLHNSYVKGGLAVGALLGPGRELLFDGIKAFGKRSPNMNS  255

Query  2648  LVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGL  2472
             LVGLG++++FA+S ++   P L W A FFEEPVML+ FVLLGR+LE+RAK+KA+SDM  L
Sbjct  256   LVGLGSMAAFAISLISLVNPDLEWDASFFEEPVMLLGFVLLGRSLEERAKLKASSDMNEL  315

Query  2471  LNVLPSKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVR  2319
             L+++ +++RLV+ S          +   +  + VP   + VGD ++VLPG+  P DG V 
Sbjct  316   LSLISTQSRLVITSSDNNTAADSVLSSDSICINVPVDEIRVGDSLLVLPGETFPVDGNVL  375

Query  2318  AGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEA  2139
             AGRS VDES  TGE LPV K  G  V+AG+IN +G L +E    G  + I  IV++VEEA
Sbjct  376   AGRSVVDESMLTGESLPVYKEEGCSVSAGTINWDGPLRIEASSTGSNSTISKIVKMVEEA  435

Query  2138  QSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslasla  1977
             Q   APVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+
Sbjct  436   QGNAAPVQRLADAIAGPFVYTIMSLSAVTFAFWYYIGSHIFPDVLLNDIAGPDGDPLALS  495

Query  1976  lqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGT  1797
             L+L+  VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + ++ +  DKTGT
Sbjct  496   LKLAVDVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASIDCVALDKTGT  555

Query  1796  LTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAA  1617
             LT GRP V+ V                 +  + E +VL LA+ VE    HPI KAIV  A
Sbjct  556   LTEGRPIVSGV----------------GSLIYEEQEVLKLAAAVEKTATHPIAKAIVNEA  599

Query  1616  KSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV--RRHGVGET----RVQEFD  1455
             ++ N      E    + EPG G +A I+ + V+VG L+WV  R H   ++    +++ + 
Sbjct  600   EALNLE--TPETRGQLTEPGFGTLAEIDGRLVAVGALEWVANRFHKKNDSSDVVKLENYL  657

Query  1454  DFK----------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSG  1308
             D K          +++VVYVG +G  + G I + D LR+DA   V  L ++GI T LLSG
Sbjct  658   DRKLSRTSLTSRYSKTVVYVGREGEGIIGAIAISDCLRKDAEFTVARLQEKGIKTILLSG  717

Query  1307  DKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALassh  1128
             D++ A   VA  VGI  E+  Y + PD+K + +S LQ     VAMVGDGINDA +LA + 
Sbjct  718   DREGAVATVAKNVGIESESTNYSLSPDKKFEVISNLQSSGHRVAMVGDGINDAPSLAQAD  777

Query  1127  v--gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLP  954
             V   + I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P
Sbjct  778   VGIALKIEAQENAASNAASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIP  837

Query  953   VAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             +AAG+LLP     +TPS++G LM LSSI V++NSLLL+L
Sbjct  838   IAAGVLLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQL  876



>ref|XP_006353854.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=897

 Score =   533 bits (1373),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 351/818 (43%), Positives = 493/818 (60%), Gaps = 63/818 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CG C + VK IL +  RV SA VN+ TETA V   ++A       Q    ELAK LT
Sbjct  90    GMMCGACVSRVKAILSADDRVDSAVVNMLTETAAVKLKADAAETGLAAQ----ELAKRLT  145

Query  2963  SCGFKANVRDSRR--ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
              CGF    R SR   +   + +++ +  K A L  S   +A +W L A+C   H +H   
Sbjct  146   ECGFPTKKRSSRLGIDAKVKKWKETVKKKEALLVESRNRVAFAWTLVALCCGTHATHILH  205

Query  2789  AKASWIH-----LLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALS  2625
             +    IH     +LH++     + +  LL PGR L+ DGL +  KG+PNMN+LVG G+++
Sbjct  206   SLGIHIHGSMLDILHNSYVKAGLAVGALLGPGRDLLFDGLWAFTKGSPNMNSLVGFGSIA  265

Query  2624  SFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKA  2448
             +FA+SS++   P+L W+A FF+EPVML+ FVLLGR+LE+RA++KA+SDM  LL ++ +++
Sbjct  266   AFAISSVSLLNPELQWEASFFDEPVMLLGFVLLGRSLEERARLKASSDMNELLLLISTQS  325

Query  2447  RLVVNSDMGEQTST--------VEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDES  2292
             RLV+ S   + ++         +EVP  ++ VGD ++V PG+ IP DG V AGRS VDES
Sbjct  326   RLVITSSGSDSSTDVVSSDAICIEVPTDDIRVGDSLLVFPGETIPVDGRVVAGRSVVDES  385

Query  2291  SFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQR  2112
               TGE LPV K  G  V+AG+IN +  L +E    G  + I  IV +VE+AQ REAP+QR
Sbjct  386   MLTGESLPVFKEKGVSVSAGTINWDSPLRIEASSTGSNSTISKIVNMVEDAQGREAPIQR  445

Query  2111  LADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscsvlv  1950
             LAD ++G F Y VM LSAATF FW   G+ + P  L       +G    L+L+L+  VLV
Sbjct  446   LADTIAGPFVYSVMTLSAATFGFWYYVGSNIFPDVLLNDIAGPEGDPLLLSLKLAVDVLV  505

Query  1949  vaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVT  1770
             V+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + V+ ++ DKTGTLT G+P V+
Sbjct  506   VSCPCALGLATPTAILVGTSLGARQGLLIRGGDVLERLASVDHVMLDKTGTLTEGKPAVS  565

Query  1769  EVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVK  1590
              +   GH                 E+++L +A+ VE  T+HPI  AI+  A+S N  I  
Sbjct  566   AITSLGHE----------------ELEILQIAAAVEKTTSHPIAHAIISKAESLNLSIPV  609

Query  1589  AEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQ----------  1440
                   + EPGSG MA +    V++G L WV+     +T + +    +            
Sbjct  610   TRGQ--LAEPGSGTMAEVNGLLVAIGKLKWVQERFQQKTDLSDLMTLEQSVMHKSLQDSQ  667

Query  1439  ------SVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYV  1281
                   +VVYVG +G  + G I + D+LREDA   +  L  +GI T LLSGD++ A   V
Sbjct  668   SSNHSTTVVYVGREGEGVIGAIAISDKLREDAESTIRRLQHKGIETVLLSGDREEAVATV  727

Query  1280  ASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgvaigg  1107
             A  VGI  + V   + P +KS  +SGLQ     VAMVGDGINDA   ALA   + + + G
Sbjct  728   AKTVGIKDKFVNASLTPQQKSAAISGLQASGHRVAMVGDGINDAPSLALADVGIALQVEG  787

Query  1106  gvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPF  927
                AAS+ +S++L+ NRLSQ+L+AL+L++ TM  V QNL WA  YN+V +P+AAG+LLP 
Sbjct  788   QETAASNAASIILLGNRLSQVLEALDLAQATMAKVHQNLSWAVAYNVVAIPIAAGVLLPN  847

Query  926   TGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
                 +TPS++G LM +SSI V++NSLLL+   + K+++
Sbjct  848   FDFAMTPSLSGGLMAMSSIFVVSNSLLLQFHGSQKKRK  885



>ref|XP_009362794.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Pyrus 
x bretschneideri]
Length=888

 Score =   533 bits (1372),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 348/820 (42%), Positives = 486/820 (59%), Gaps = 67/820 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLG-EELAKHL  2967
             GM CGGC + VK IL +  RV S +VNL TETA +      K+ P     +  E  A  L
Sbjct  92    GMMCGGCVSRVKSILSADDRVDSVAVNLLTETAAI------KLRPEVAADVAAESWAGRL  145

Query  2966  TSCGFKANVRDSRR--ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             T CGF +  R S          +++ +N K   L  S   + ++W L A+C   H SH  
Sbjct  146   TECGFASKRRASGMGVSESVRKWKETVNKKEEMLVKSRNRVILAWTLVALCCGSHASHIL  205

Query  2792  ------GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGA  2631
                    A  S+  LLH++     +    LL PGR L+ DGL++L KG+PNMN+LVG G+
Sbjct  206   HSLGIHAAHGSFWELLHNSYVKAGLATGALLGPGRDLLFDGLRALKKGSPNMNSLVGFGS  265

Query  2630  LSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPS  2454
             L++F +S+++   P L W A FF+EPVML+ FVLLGR+LE+RA+I A+SDM  LL+++ +
Sbjct  266   LAAFTISAVSLLNPGLQWDAAFFDEPVMLLGFVLLGRSLEERARIMASSDMNELLSLINT  325

Query  2453  KARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             +ARLV+ S          +      VEVP  ++ VGD ++VLPG+ IP DG V AGRS V
Sbjct  326   QARLVIGSSENDSSSNSVLFSDAICVEVPTDDILVGDSVLVLPGETIPVDGRVVAGRSVV  385

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DES  TGE LPV K     V+AG+IN +G L VE    G  + I  IVR+VE+AQ  EAP
Sbjct  386   DESMLTGESLPVFKEKDLTVSAGTINWDGPLRVEASSTGSNSMISKIVRMVEDAQGHEAP  445

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscs  1959
             +QRLAD ++G F Y +M LSA TF FW  FGT++ P  L        G    L+L+L+  
Sbjct  446   IQRLADSIAGPFVYSIMTLSATTFAFWYYFGTQIFPDVLLNDIAGPDGDPLLLSLKLAVD  505

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVV+CPCALGLATPTA++VGTSLGA +GLL+RG  VLE  + V+ I  DKTGTLT G+P
Sbjct  506   VLVVSCPCALGLATPTAILVGTSLGARQGLLVRGADVLERLASVDYIALDKTGTLTEGKP  565

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
              V+ +                ++  + E ++L +A+ VE+  +HPI +AI+  AKS N  
Sbjct  566   AVSGI----------------ASSMYEESEILQIAAAVENTASHPIARAILNKAKSLNMS  609

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN--------  1443
             I        + EPG G +A ++ + V+VG+L+WV +    +  V +  + ++        
Sbjct  610   IPVTRRQ--LTEPGFGTLAEVDGRLVAVGSLEWVHQRFQAKANVSDLSNLEHTVRQSSEG  667

Query  1442  -------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAE  1287
                    +++VYVG +G  + G I + D LR DA + V  L ++GI T L SGD++ A  
Sbjct  668   ITPSSYSKTIVYVGREGEGIIGAIAISDSLRHDAEYTVNRLQQKGIRTVLFSGDREEAVA  727

Query  1286  YVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgvai  1113
              +A  VGI  E V   + P  KS  +S L+     VAMVGDGINDA   ALA   +   I
Sbjct  728   TIAKAVGIENEFVKSSLTPQGKSGAISSLKDAGHHVAMVGDGINDAPSLALADVGIAFQI  787

Query  1112  gggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILL  933
              G   AAS+ +S++L+ N+LSQ++DALELS+ TM  V QNL WA  YN+  +P+AAG+LL
Sbjct  788   EGQENAASNAASIILLGNKLSQVVDALELSQATMAKVYQNLSWAIAYNLFAIPIAAGVLL  847

Query  932   PFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             P     +TPS++G +M LSSI V++NSLLL+L  ++  K+
Sbjct  848   PQYDFAMTPSLSGGMMALSSIFVVSNSLLLQLHKSNGSKK  887



>ref|XP_011081596.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Sesamum 
indicum]
Length=893

 Score =   533 bits (1372),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 349/824 (42%), Positives = 493/824 (60%), Gaps = 70/824 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CG C   VK I+ +  RV SA VN+ TETA +  + +A  V      + +ELAK ++
Sbjct  84    GMMCGACVTRVKSIISADERVESAVVNMLTETAAI-KLKQAVAVGEDLSGVADELAKRVS  142

Query  2963  SCGFKANVR------DSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLS  2802
             + GF A  R      +++     ET EKK     A L  S   +A +W L A+C   H S
Sbjct  143   ASGFDARRRVSGMGVEAKVRKWRETVEKK----EALLMKSRNRVAFAWTLVALCCGSHAS  198

Query  2801  HFFGA------KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVG  2640
             H   +        S + +LH++     + L +LL PGR L+ DGL++  KG+PNMN+LVG
Sbjct  199   HILHSLGIHIGHGSVLDILHNSYVKGGLALGSLLGPGRDLLFDGLRAFKKGSPNMNSLVG  258

Query  2639  LGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNV  2463
              GA+++FA+S+++   P+L W A FF+EPVML+ F+LLGR+LE+RA+IKA+SDM  LL++
Sbjct  259   FGAIAAFAISAVSLLNPELQWNAAFFDEPVMLLGFILLGRSLEERARIKASSDMNELLSL  318

Query  2462  LPSKARLVV---------NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGR  2310
             + +K+RLV+         +S +      +EVP  ++ +GD I+V PG+ IP DG + AGR
Sbjct  319   ISTKSRLVISPSGSDVSADSVLCSDAMCIEVPTDDIRIGDSILVFPGETIPVDGKILAGR  378

Query  2309  STVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSR  2130
             S VDES  TGE LPV K  G  V+AG+IN +G L +E    G  + I  IV +VE+AQ R
Sbjct  379   SVVDESMLTGESLPVFKEKGLSVSAGTINWDGPLRIEASSTGSNSTISKIVNMVEDAQGR  438

Query  2129  EAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalql  1968
             EAP+QRLAD ++G F Y VM LSAATF FW   GT + P  L        G+   L+++L
Sbjct  439   EAPIQRLADSIAGPFVYSVMTLSAATFAFWYYIGTHIFPDVLLNDIAGPDGNSLLLSMKL  498

Query  1967  scsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTI  1788
             +  VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + ++ I  DKTGTLT 
Sbjct  499   AVDVLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLAGIDYITLDKTGTLTE  558

Query  1787  GRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSR  1608
             GRPTV+ V   GH                 E ++L +A+ VE   +HP+ KAI+  A+S 
Sbjct  559   GRPTVSAVASFGHE----------------ESELLEIAAAVEKTASHPLAKAIIAKAESL  602

Query  1607  NCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHG----------------VGE  1476
             N  I        + EPGSG +A +    V+VG L WV                    + +
Sbjct  603   NLNIPSTSRQ--LAEPGSGTLAEVGGLLVAVGKLSWVHERFQQKKSLSDLKKLEQSVIHQ  660

Query  1475  TRVQEFDDFKNQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKK  1299
             +  +      ++++VYVG +G  + G I + D LR DA   +  L ++GI T LLSGD++
Sbjct  661   SSAEHSSSNHSRTIVYVGREGEGIIGAIAISDNLRPDAESTITRLQQKGIRTVLLSGDRE  720

Query  1298  NAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshv  1125
              A   VA  VG+  E V   + P +KS  +S LQ     VAMVGDGINDA   ALA   +
Sbjct  721   EAVAAVAKTVGVENEFVNGSLTPQQKSDAISSLQASGHRVAMVGDGINDAPSLALADVGI  780

Query  1124  gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAA  945
              + I G   AAS+ +S++L+ NRLSQ+++A++++R TM  V+QNL WA  YN++ +P+AA
Sbjct  781   ALQIEGQENAASNAASIILLGNRLSQVVEAIDVARATMAKVRQNLTWAVAYNVIAIPMAA  840

Query  944   GILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             G+LLP     +TPS++G +M LSSI V+TNSLLL+     ++KE
Sbjct  841   GVLLPHFDFAMTPSLSGGMMALSSIFVVTNSLLLQFHGPQRKKE  884



>ref|XP_006287036.1| hypothetical protein CARUB_v10000184mg [Capsella rubella]
 gb|EOA19934.1| hypothetical protein CARUB_v10000184mg [Capsella rubella]
Length=888

 Score =   532 bits (1371),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 356/814 (44%), Positives = 493/814 (61%), Gaps = 69/814 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A VK +L S  RV+SA VN+ TETA V    E +VV +      E LAK LT
Sbjct  89    GMMCGGCVARVKSVLMSDDRVASAVVNMLTETAAVRLKPEVEVVAD----AAESLAKRLT  144

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
               GF+A  R S     EN+ +   K+M +K+  L    R  +A +W L A+C   H SH 
Sbjct  145   DSGFEAKRRVSGMGVAENVKKW--KEMVSKKEDLLVKSRNRVAFAWTLVALCCGSHTSHI  202

Query  2795  FGAKASWI------HLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
               +    I       LLH++     + +  LL PGR+L+ DG+K+  K +PNMN+LVGLG
Sbjct  203   LHSLGIHIAHGGIWDLLHNSYVKGGLAVGALLGPGRELLFDGIKAFGKRSPNMNSLVGLG  262

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F++S ++   P+L W A FFEEPVML+ FVLLGR+LE+RAK+KA+S+M  LL+++ 
Sbjct  263   SMAAFSISLISLVNPELEWDASFFEEPVMLLGFVLLGRSLEERAKLKASSNMNELLSLIS  322

Query  2456  SKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+ S          +   +  V VP  ++ VGD ++VLPG+  P DG V AGRS 
Sbjct  323   TQSRLVITSSDNNTAADSVLSSDSICVNVPVDDIRVGDSLLVLPGETFPVDGSVLAGRSV  382

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V+AG+IN +G L ++    G  + I  IVR+VE+AQ   A
Sbjct  383   VDESMLTGESLPVFKEEGCSVSAGTINWDGPLRIKASSTGSNSTISKIVRMVEDAQGNAA  442

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+L+L+ 
Sbjct  443   PVQRLADAIAGPFVYTIMSLSAVTFAFWYYIGSHIFPDVLLNDIAGPDGDPLALSLKLAV  502

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + ++ +  DKTGTLT GR
Sbjct  503   DVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASIDCVALDKTGTLTEGR  562

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V+ V                ++  + E +VL LA+ VE    HPI KAIV  A + N 
Sbjct  563   PVVSGV----------------ASLRYKEQEVLELAAAVEKTATHPIAKAIVNEAAALNL  606

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV------RRHGVGETRVQEFDDFK--  1446
                  E    + EPG G +A I+   V+VG+L+WV      +       +++ F D K  
Sbjct  607   E--TPETRGQLTEPGFGTLAEIDGCLVAVGSLEWVSDRFLKKNDSSDMVKLECFLDHKLS  664

Query  1445  --------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
                     +++VVYVG +G  + G I + D LR+DA   V  L ++GI T LLSGD++ A
Sbjct  665   STSSTSRYSKTVVYVGREGEGIIGAIAISDCLRQDAEFTVARLQEKGIKTVLLSGDREGA  724

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--gv  1119
                VA  VGI  E+  Y + P+ K KF+S LQ     VAMVGDGINDA +LA + V   +
Sbjct  725   VATVAKNVGIESESTNYSLSPEMKFKFISDLQSSGHRVAMVGDGINDAPSLAQADVGIAL  784

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
              I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P+AAG+
Sbjct  785   KIEAQENAASNAASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIPIAAGV  844

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             LLP     +TPS++G LM LSSI V++NSLLL+L
Sbjct  845   LLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQL  878



>ref|XP_004501429.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
[Cicer arietinum]
Length=884

 Score =   531 bits (1369),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 349/813 (43%), Positives = 497/813 (61%), Gaps = 68/813 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC + VK IL +  RV S  VN+ +ETA V    + K + +    + E LA+ L+
Sbjct  85    GMMCGGCVSRVKTILSADDRVDSVVVNMLSETAAV----KLKRLEDEPASVAESLARRLS  140

Query  2963  SCGFKANVRDS---RRENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
              CGF    R+S     EN+ +   K++  K+ +L A  R  +A +W L A+C   H SH 
Sbjct  141   ECGFPTKRRESGLGVAENVRKW--KELVKKKEELLAKSRNRVAFAWTLVALCCGSHASHI  198

Query  2795  FG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
             F       A   +   LH++     + L +LL PGR+L+ DGL +  KG+PNMN+LVG G
Sbjct  199   FHSFGIHIAHGPFWEFLHNSYVKGGLALGSLLGPGRELLFDGLNAFKKGSPNMNSLVGFG  258

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F +SS++   P+L W A FF+EPVML+ FVLLGR+LE++A+I+A+SDM  LL+++ 
Sbjct  259   SVAAFIISSISLLNPELAWDASFFDEPVMLLGFVLLGRSLEEKARIQASSDMNELLSLIS  318

Query  2456  SKARLVVNSDMG---------EQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+ S  G           T  VEVP  ++ VGD ++VLPG+ IP DG V AGRS 
Sbjct  319   TQSRLVITSSEGTPSTDSVICSDTICVEVPTDDIRVGDSVLVLPGETIPIDGRVIAGRSV  378

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V+A +IN +G L +E    G  T I  IVR+VE+AQSREA
Sbjct  379   VDESMLTGESLPVFKEEGLTVSAXTINWDGPLRIESSSTGSNTMISKIVRMVEDAQSREA  438

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F + +M LSAATF FW   G+ + P  L       +G    L+L+LS 
Sbjct  439   PVQRLADSIAGPFVFSIMTLSAATFAFWYFVGSHIFPDVLLNDIAGPEGDPLLLSLKLSV  498

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + VN I  DKTGTLT G+
Sbjct  499   DVLVVSCPCALGLATPTAILVGTSLGARKGLLIRGGDVLERLAGVNYIALDKTGTLTRGK  558

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V+ +                S+  + E ++L +A+ VE   +HPI KAI+  A+S   
Sbjct  559   PVVSAI----------------SSIHYGESEILQIAAAVEKTASHPIAKAIINKAESLEL  602

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN-------  1443
              ++    G  + EPG G +A +  + V++G+L WV    V      +  + +        
Sbjct  603   -VLPLTKGQIV-EPGFGTLAEVSGRLVAIGSLHWVNERFVTRMNSSDLMNLERTLMNRSS  660

Query  1442  --------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAA  1290
                     ++VVYVG +G  + G I + D +REDA   V  L K+GI T+LLSGD++ A 
Sbjct  661   NTSSSKYSKTVVYVGREGEGIIGAIAISDIVREDAESTVTRLKKKGIKTFLLSGDREEAV  720

Query  1289  EYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--gva  1116
               +A  VGI ++ V   + P +KS F+S L+     VAMVGDGINDA +LA++ V   + 
Sbjct  721   ATIAETVGIEKDFVKASLSPQQKSAFISALKAAGHHVAMVGDGINDAPSLAAADVGIALQ  780

Query  1115  igggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGIL  936
                   AASD +S++L+ N++SQ++DA++L++ TM  V QNL WA  YN++ +P+AAG+L
Sbjct  781   NEAQENAASDAASIILLGNKISQVIDAIDLAQTTMAKVYQNLSWAVAYNVIAIPIAAGVL  840

Query  935   LPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             LP     +TPS++G LM +SSI V++NSLLL+L
Sbjct  841   LPQFDFAMTPSLSGGLMAMSSIFVVSNSLLLKL  873



>ref|WP_015185222.1| heavy metal translocating P-type ATPase [Microcoleus sp. PCC 
7113]
 ref|YP_007124495.1| heavy metal translocating P-type ATPase [Microcoleus sp. PCC 
7113]
 gb|AFZ21089.1| heavy metal translocating P-type ATPase [Microcoleus sp. PCC 
7113]
Length=831

 Score =   530 bits (1364),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 344/824 (42%), Positives = 497/824 (60%), Gaps = 69/824 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC + V+R L   P V SA VNL TE AVV       V P         +A+ LT
Sbjct  25    GMRCAGCVSVVERQLSQHPGVVSARVNLVTEVAVV-ECETGTVDP-------ASIAEQLT  76

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASG--RGLAVSWALCAVCLVGHLSHFFG  2790
             + GF +  R ++   +  T + +  A+R   +A    R LA++  L  + L+GH+ H+  
Sbjct  77    AKGFPSQPR-AQAGRMPATPDTRTPAERHAQEAREQVRRLAIAAVLIFLSLIGHIGHWM-  134

Query  2789  AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
               A  + +L +  FH  +    LL PGR +IIDG K L   APNMNTLVGLGAL+++  S
Sbjct  135   -DAPMLPVLSNIWFHWGLATLALLGPGRPIIIDGWKGLWHQAPNMNTLVGLGALTAYTAS  193

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
              +A F P LGW  FF+EPVM++ F+LLGR LEQRA+ +A S    LL + P  ARL+   
Sbjct  194   CVALFFPHLGWDCFFDEPVMMLGFILLGRTLEQRARRRAASAFESLLALQPKVARLI---  250

Query  2429  DMGEQTST---------------VEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDE  2295
               G+ TST               +E+P   + VG+ + VLPG++IP DG V AG+S VDE
Sbjct  251   --GKSTSTATSPGKGKGEIEQLGIEIPVEQVRVGEWLRVLPGEKIPVDGEVMAGQSLVDE  308

Query  2294  SSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQ  2115
             S  TGEP+PV K PG  + AG++N +G + ++  R G ET +  IV LVEEAQ+R+APVQ
Sbjct  309   SMLTGEPIPVLKQPGDPITAGTLNQSGAIALQATRTGEETTLAQIVALVEEAQTRKAPVQ  368

Query  2114  RLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLH-------QGslaslalq-----  1971
             +LAD V+G+FTYGV+A+++ TF+FW L GT++ P  L         G     +       
Sbjct  369   KLADTVAGYFTYGVLAIASLTFLFWYLAGTKIWPHVLSPMADMMGHGMAQPTSTSPLLLS  428

Query  1970  --lscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGT  1797
               L+ +VLV+ACPCALGLATPTA++VGT+LGA RG+L++GG +LE    ++TIVFDKTGT
Sbjct  429   LKLAITVLVIACPCALGLATPTAILVGTTLGAERGILIKGGDILERAHQLDTIVFDKTGT  488

Query  1796  LTIGRPTVTEVVP-------QGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIG  1638
             LT G+PTVT+ +P       +G+    N   D+  T + S   +L  A+  E+ T+HP+ 
Sbjct  489   LTTGQPTVTDCLPWLESGLFEGNESHRNGHGDTLLT-QASATKLLQWAAAAETGTSHPLA  547

Query  1637  KAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGV--GETRVQ  1464
              AI   A  +   +++A+D  F  EPG G  A++E ++V +G  DW+ + G+   +T  Q
Sbjct  548   SAIRTTAHQQELPMLEAQD--FYTEPGLGISAMVENRRVWLGNADWLAQQGIKMSDTVNQ  605

Query  1463  EFDDFKN--QSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAA  1290
             +     +  ++VVYV VDGVLAG++   D LR DA+  VE L   G    L++GD+ ++A
Sbjct  606   QVRVLADAGKTVVYVAVDGVLAGVLAARDVLRPDAKETVERLKALGFRVMLMTGDQLDSA  665

Query  1289  EYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaig  1110
               +A  + I  ++V  GV+P+ K+  +  LQ + + VAMVGDGIND  ALA + VG+++ 
Sbjct  666   RAIAQQLLIHPDHVLAGVRPNGKAAAIQTLQSEGRRVAMVGDGINDGPALAQADVGISLH  725

Query  1109  ggvgaasdvssvVLMQ--------NRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLP  954
              G   A + + ++LM+         RL  +++++EL+R T   ++QNL+WAFGYN +G+P
Sbjct  726   VGTDVARETAGIILMRVSATRPQDVRLLDVVESIELARTTFNKIRQNLFWAFGYNTLGIP  785

Query  953   VAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASK  822
              A G+LLP  G  L+P+ AGA M  SS+ V+TNSLLLR  F +K
Sbjct  786   AACGVLLPGFGIALSPASAGAFMAFSSVSVVTNSLLLRRAFKAK  829



>ref|XP_004985506.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
[Setaria italica]
Length=903

 Score =   531 bits (1369),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 357/824 (43%), Positives = 490/824 (59%), Gaps = 73/824 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGCAA V+ IL +  RV +A+VNL  E+A V   + A          GE LA  LT
Sbjct  95    GMMCGGCAARVRAILAADARVETAAVNLLAESAAVRLRAPAP------PGAGEALAARLT  148

Query  2963  SCGFKANVRDSRRENLFETFEKK---MNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
              CGF A  R            +K   M A++ +L A  RG +A +W L A+C   H SH 
Sbjct  149   ECGFPAAARRGGAAAGAGESARKWREMAARKEELLARSRGRVAFAWTLVALCCGSHASHI  208

Query  2795  FG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
                     A  +++ LLH++     +    L  PGR ++ DG ++  +G+PNMN+LVG G
Sbjct  209   LHSLGIHVAHGTFLDLLHNSYVKCGVATTALFGPGRDILFDGFRAFKQGSPNMNSLVGFG  268

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             + ++FA+S+M+   P+L W + FF+EPVML+ FVLLGR+LE+ A++KA+SDM  L+++L 
Sbjct  269   SAAAFAISAMSLLNPELEWNSTFFDEPVMLLGFVLLGRSLEESARLKASSDMNELISLLS  328

Query  2456  SKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
              ++RL+V S          +     TVEVP  ++ VGD I+VLPG+ IP DG V  G S 
Sbjct  329   PQSRLIVTSSSDDPSSDTILNSDAITVEVPVDDVRVGDSILVLPGETIPVDGNVIGGSSF  388

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V AG++N +G L +     G  + I  IVR+VE+AQ+REA
Sbjct  389   VDESMLTGESLPVAKETGLPVFAGTVNWDGPLKIRATCTGPSSTIAKIVRMVEDAQAREA  448

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F Y VM L+AATF FW   GT + P  L        G    L+++L+ 
Sbjct  449   PVQRLADSIAGPFVYTVMTLAAATFSFWYYIGTHLFPEVLLNDIAGPDGDSLLLSIKLAV  508

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA+++GTSLGA RGLL+RGG VLE  + ++ +V DKTGTLT G+
Sbjct  509   DVLVVSCPCALGLATPTAILIGTSLGAKRGLLIRGGDVLERLAGIDALVLDKTGTLTEGK  568

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P VT                S ++  + E +VL LA+ VE    HPI  AI+  A+    
Sbjct  569   PVVT----------------SIASLAYEEAEVLRLAAAVEKTALHPIANAIMNKAELLKL  612

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQ--EFDDFKN-----  1443
              I        + EPG G +A ++   V+VGTLDWV  H   ET+    E  D +N     
Sbjct  613   DIPITSGQ--LTEPGFGCLAEVDGCLVAVGTLDWV--HNRFETKASPTELRDLRNHLEFM  668

Query  1442  -----------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKK  1299
                        +S+ YVG +G  + G I + D LREDA+  V+ L ++ ITT+LLSGD++
Sbjct  669   LSSEASSSNQSKSIAYVGREGEGIIGAIAISDILREDAKLTVDRLQQESITTFLLSGDRE  728

Query  1298  NAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--  1125
              A   +  +VGI  EN+   + P +K+  +S LQ +   VAMVGDGINDA +LA++ V  
Sbjct  729   EAVTSIGRIVGIRNENIKSSLTPQDKASIISTLQGEGHRVAMVGDGINDAPSLAAADVGI  788

Query  1124  gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAA  945
              +       AASD +SVVL+ NRLSQ++DAL LS+ TM  V+QNL WA  YNIV +P+AA
Sbjct  789   AMRTHSKENAASDAASVVLLGNRLSQVVDALSLSKATMAKVQQNLAWAVAYNIVAIPIAA  848

Query  944   GILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             G+LLP     +TPS++G LM LSSI V++NSLLL+L  + +  E
Sbjct  849   GVLLPQFDFAMTPSLSGGLMALSSIFVVSNSLLLQLHGSFQNTE  892



>emb|CAC34486.1| metal-transporting ATPase-like protein [Arabidopsis thaliana]
 gb|AAO73891.1| ATPase, E1-E2 type family [Arabidopsis thaliana]
Length=856

 Score =   530 bits (1364),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 350/821 (43%), Positives = 496/821 (60%), Gaps = 69/821 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A VK +L S  RV+SA VN+ TETA V    E +V  +      E LAK LT
Sbjct  57    GMMCGGCVARVKSVLMSDDRVASAVVNMLTETAAVKFKPEVEVTAD----TAESLAKRLT  112

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
               GF+A  R S     EN+ +   K+M +K+  L    R  +A +W L A+C   H SH 
Sbjct  113   ESGFEAKRRVSGMGVAENVKKW--KEMVSKKEDLLVKSRNRVAFAWTLVALCCGSHTSHI  170

Query  2795  FGAKASWI------HLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
               +    I       LLH++     + +  LL PGR+L+ DG+K+  K +PNMN+LVGLG
Sbjct  171   LHSLGIHIAHGGIWDLLHNSYVKGGLAVGALLGPGRELLFDGIKAFGKRSPNMNSLVGLG  230

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F++S ++   P+L W A FF+EPVML+ FVLLGR+LE+RAK++A++DM  LL+++ 
Sbjct  231   SMAAFSISLISLVNPELEWDASFFDEPVMLLGFVLLGRSLEERAKLQASTDMNELLSLIS  290

Query  2456  SKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+ S          +   +  + V   ++ VGD ++VLPG+  P DG V AGRS 
Sbjct  291   TQSRLVITSSDNNTPVDSVLSSDSICINVSVDDIRVGDSLLVLPGETFPVDGSVLAGRSV  350

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V+AG+IN +G L ++    G  + I  IVR+VE+AQ   A
Sbjct  351   VDESMLTGESLPVFKEEGCSVSAGTINWDGPLRIKASSTGSNSTISKIVRMVEDAQGNAA  410

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+L+L+ 
Sbjct  411   PVQRLADAIAGPFVYTIMSLSAMTFAFWYYVGSHIFPDVLLNDIAGPDGDALALSLKLAV  470

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + ++ +  DKTGTLT GR
Sbjct  471   DVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASIDCVALDKTGTLTEGR  530

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V+ V   G+ ++                +VL +A+ VE    HPI KAIV  A+S N 
Sbjct  531   PVVSGVASLGYEEQ----------------EVLKMAAAVEKTATHPIAKAIVNEAESLNL  574

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV------RRHGVGETRVQEFDDFK--  1446
             +    E    + EPG G +A I+ + V+VG+L+WV      +       +++   D K  
Sbjct  575   K--TPETRGQLTEPGFGTLAEIDGRFVAVGSLEWVSDRFLKKNDSSDMVKLESLLDHKLS  632

Query  1445  --------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
                     +++VVYVG +G  + G I + D LR+DA   V  L ++GI T LLSGD++ A
Sbjct  633   NTSSTSRYSKTVVYVGREGEGIIGAIAISDCLRQDAEFTVARLQEKGIKTVLLSGDREGA  692

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--gv  1119
                VA  VGI  E+  Y + P++K +F+S LQ     VAMVGDGINDA +LA + V   +
Sbjct  693   VATVAKNVGIKSESTNYSLSPEKKFEFISNLQSSGHRVAMVGDGINDAPSLAQADVGIAL  752

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
              I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P+AAG+
Sbjct  753   KIEAQENAASNAASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIPIAAGV  812

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             LLP     +TPS++G LM LSSI V++NSLLL+L  +   K
Sbjct  813   LLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQLHKSETSK  853



>ref|XP_011002837.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
[Populus euphratica]
Length=885

 Score =   530 bits (1366),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 358/814 (44%), Positives = 492/814 (60%), Gaps = 65/814 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CG C + VK IL +  RV SA VN+ TETA V    EA +       +GE LAK L+
Sbjct  83    GMMCGSCVSRVKSILSTDERVESAVVNMLTETAAVKLKPEALLEGEVSASIGESLAKRLS  142

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRGLAV-SWALCAVCLVGHLSHF  2796
              CGF+A  R S     EN+ +   K M  K+ +L    R   V +W L A+C   H SH 
Sbjct  143   ECGFEAKKRVSGSGVAENVKKW--KDMVTKKEELIVKSRNRVVFAWTLVALCCGSHASHI  200

Query  2795  ---FG---AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
                FG      S + +LH++     + L +LL PGR L++DGL++  KG+PNMN+LVG G
Sbjct  201   LHSFGIHVGHGSVLEVLHNSYVKGGLALGSLLGPGRDLLVDGLRAFKKGSPNMNSLVGFG  260

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F +S+++   P L W A FF+EPVML+ FVLLGR+LE++A+I+A+SDM  LL ++ 
Sbjct  261   SIAAFVISAISLLNPALEWDASFFDEPVMLLGFVLLGRSLEEKARIRASSDMNELLALMS  320

Query  2456  SKARLVVN-SDMGEQTSTV--------EVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+  SD       V        EVP  ++ VGD ++VLPG+ IP DG V AGRS 
Sbjct  321   TQSRLVITPSDSNSPMENVLCSDAICTEVPTDDVRVGDTLLVLPGETIPVDGRVLAGRSV  380

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G +V+AG+IN +G L VE    G  + I  I+R+VE+AQ  EA
Sbjct  381   VDESMLTGESLPVFKEEGLKVSAGTINWDGPLRVEALSTGSNSTISRIIRMVEDAQGSEA  440

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             P+QRLAD ++G F Y VM +SAATF FW   G+ V P  L        G    L+L+LS 
Sbjct  441   PIQRLADSIAGPFVYSVMTVSAATFAFWYYIGSHVFPDVLLNDIAGPDGDPLLLSLKLSV  500

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + ++ +  DKTGTLT G+
Sbjct  501   DVLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLASISYVALDKTGTLTEGK  560

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V+ V                ++  + E ++L +A  VE    HPI KAIV  A+S   
Sbjct  561   PAVSAV----------------ASISYEESEILQMAFAVERTALHPIAKAIVNKAESLKL  604

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFK--------  1446
              I        + EPG G +A ++ + V+VG+LDWV       T++ +  D +        
Sbjct  605   TIPVTRGQ--LTEPGFGTLAEVDGRLVAVGSLDWVNERFQRRTKLSDLKDLETKVMYQSS  662

Query  1445  --------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
                     +++VVYVG +G  + G I + D LR DA   +  L ++GI T LLSGD++ A
Sbjct  663   EGMPSSNYSKTVVYVGREGEGIIGAIAISDCLRHDAESTISRLQQKGINTVLLSGDREEA  722

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgv  1119
                +A+ VGI  E +   + P +KS+ +S LQ     VAMVGDGINDA   ALA   + +
Sbjct  723   VATIANRVGIESEFINASLTPQKKSEVISSLQAAGHRVAMVGDGINDAPSLALADVGIAI  782

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
                    AASDV+S++L+ NRL+Q++DAL+LSR TM  V QNL WA  YN+V +P+AAG+
Sbjct  783   QNEAQENAASDVASIILLGNRLAQVVDALDLSRATMAKVYQNLSWAIAYNVVAIPIAAGV  842

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             LLP     +TPS++G LM LSSI V++NSLLL+L
Sbjct  843   LLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQL  876



>ref|XP_009767519.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Nicotiana 
sylvestris]
Length=898

 Score =   531 bits (1367),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 346/821 (42%), Positives = 490/821 (60%), Gaps = 68/821 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLG--EELAKH  2970
             GM CG C   VK IL +  RV SA VN+ TETA +      K+ P   +     EELA+ 
Sbjct  90    GMMCGACVTRVKSILSADDRVDSAVVNMLTETAAI------KLKPEAGESFAAAEELAQR  143

Query  2969  LTSCGFKANVRDSRR--ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHF  2796
             LT CGF  N R S    +   + +++ +  K A L  S   +  +W+L A+C   H +H 
Sbjct  144   LTGCGFPTNKRSSGLGVDEKVKKWKEMVEKKEALLVESRNRVFFAWSLVALCCGTHATHI  203

Query  2795  FGA------KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
               +        S + +LH++     + +  LL PGR L+ DG+++  KG+PNMN+LVG G
Sbjct  204   LHSLGIHIGHGSVLDVLHNSYVKAGLAIGALLGPGRDLLFDGIRAFTKGSPNMNSLVGFG  263

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++FA+SS++   P L W+A FF+EPVML+ FVLLGR+LE+RA++KA+SDM  LL+++ 
Sbjct  264   SIAAFAISSVSLLNPALQWEATFFDEPVMLLGFVLLGRSLEERARLKASSDMNELLSLIS  323

Query  2456  SKARLVVNSD--------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             +++RLVV S         +G     +EVP  ++ VGD ++VLPG+ IP DG V AGRS V
Sbjct  324   TQSRLVVTSSGSGSSADVVGSDAICIEVPTDDIRVGDSLLVLPGETIPVDGRVIAGRSVV  383

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DES  TGE LPV K  G  V+AG+IN +  L +E    G  + I  IV +VE+AQ REAP
Sbjct  384   DESMLTGESLPVFKEKGFSVSAGTINWDSPLRIEASSTGSNSTISKIVNMVEDAQGREAP  443

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscs  1959
             +QRLAD ++G F Y VM LSAATF FW   G+ + P  L       +G    L+L+L+  
Sbjct  444   IQRLADTIAGPFVYSVMTLSAATFGFWYYVGSHIFPDVLLNDIAGPEGDPLLLSLKLAVD  503

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + V+ ++ DKTGTLT G+P
Sbjct  504   VLVVSCPCALGLATPTAILVGTSLGARQGLLIRGGDVLERLASVDHVMLDKTGTLTEGKP  563

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
              V+ V    H                 E+++L +A+ VE   +HPI  AI+  A+S +  
Sbjct  564   AVSAVASLVHE----------------ELEILQIAAAVEKTASHPIAHAIITKAESLDLS  607

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQ-------  1440
             I        + EPGSG MA +    V++G L WV+     +  + +    +         
Sbjct  608   IPVTRGQ--LAEPGSGTMAEVNGLLVAIGKLKWVQERFQQKADLSDLRSLEQSVMHKSLE  665

Query  1439  ---------SVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAA  1290
                      +VVYVG +G  + G I + D+LREDA   +  L  +GI T LLSGD++ A 
Sbjct  666   DRQSSNHSTTVVYVGREGEGVIGAIAISDKLREDAESTIRRLQDKGIETVLLSGDREEAV  725

Query  1289  EYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgva  1116
               VA  VGI  + V   + P +KS  +S LQ     VAMVGDGINDA   ALA   + + 
Sbjct  726   ATVAKTVGIKDKFVNASLTPQQKSAAISVLQASGHRVAMVGDGINDAPSLALADVGIALR  785

Query  1115  igggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGIL  936
             + G   AAS+ +S++L+ NRLSQ+++AL+L+R TM  V QNL WA  YN+V +P+AAG+L
Sbjct  786   VEGQETAASNAASIILLGNRLSQVVEALDLARATMAKVHQNLSWAVAYNVVAIPIAAGVL  845

Query  935   LPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             LP     +TPS++G LM LSSI V++NSLLL+   + ++++
Sbjct  846   LPNFDFAMTPSLSGGLMALSSIFVVSNSLLLQFHGSQRKRK  886



>ref|XP_010493252.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Camelina 
sativa]
Length=884

 Score =   530 bits (1365),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 355/815 (44%), Positives = 494/815 (61%), Gaps = 70/815 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A VK +L S  RV+SA VN+ TETA V    E  V       + E LAK LT
Sbjct  84    GMMCGGCVARVKSVLMSDDRVASAVVNMLTETAGVRLKPEVDV----VVDVAESLAKRLT  139

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
               GF+A  R S     EN+ +   K+M +K+ +L    R  +A +W L A+C   H SH 
Sbjct  140   ESGFEAKRRVSGMGVAENVKKW--KEMVSKKEELLVKSRNRVAFAWTLVALCCGSHTSHI  197

Query  2795  FGAKASWI------HLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
               +    I       LLH++     + +  LL PGR+L+ DG+K+  K +PNMN+LVGLG
Sbjct  198   LHSLGIHIAHGGIWDLLHNSYVKGGLAVGALLGPGRELLFDGVKAFGKRSPNMNSLVGLG  257

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F++S ++   P+L W A FFEEPVML+ FVLLGR+LE+RAK+KA+SDM  LL+++ 
Sbjct  258   SMAAFSISLISLVNPELEWDASFFEEPVMLLGFVLLGRSLEERAKLKASSDMNELLSLIS  317

Query  2456  SKARLVVNSDMGEQTST----------VEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRS  2307
             +++RLV+ S     T+           V VP  ++ VGD ++VLPG+  P DG V AGRS
Sbjct  318   TQSRLVITSSDNNNTAADSVLSSDSICVNVPVDDIRVGDSLLVLPGETFPVDGSVLAGRS  377

Query  2306  TVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSRE  2127
              VDES  TGE LPV K  G  V+AG+IN +G L ++    G  + I  IVR+VE+AQ   
Sbjct  378   VVDESMLTGESLPVFKEEGCSVSAGTINWDGPLRIKASSTGSNSTISKIVRMVEDAQGNA  437

Query  2126  APVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqls  1965
             APVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+L+L+
Sbjct  438   APVQRLADAIAGPFVYTIMSLSAVTFAFWYYIGSHIFPDVLLNDIAGPDGDPLALSLKLA  497

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
               VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + ++ +  DKTGTLT G
Sbjct  498   VDVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASIDCVALDKTGTLTEG  557

Query  1784  RPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRN  1605
             RP V+ +                ++  + E +VL LA+ VE    HPI KAIV  A++ N
Sbjct  558   RPVVSGI----------------ASLRYEEQEVLKLAAAVEKTATHPIAKAIVNEAEALN  601

Query  1604  CRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV------RRHGVGETRVQEFDDFK-  1446
                   E    + EPG G +A I+ + V+VG+L+WV      +       +++ F D K 
Sbjct  602   LE--TPETRGQLTEPGFGTLAEIDGRLVAVGSLEWVSDRFLKKNDSSDMVKLESFLDNKL  659

Query  1445  ---------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKN  1296
                      +++VVYVG +G  + G I + D LR+DA   V  L ++GI T LLSGD++ 
Sbjct  660   SSTSSTSRNSKTVVYVGREGEGIIGAIAISDCLRQDAEFTVGRLQEKGIKTVLLSGDREG  719

Query  1295  AAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--g  1122
             A   VA  VGI  E+  Y + P+ K +F+S LQ     VAMVGDGINDA +LA + V   
Sbjct  720   AVATVAKNVGIESESTNYSLSPEMKFEFISSLQSSGHRVAMVGDGINDAPSLAQADVGIA  779

Query  1121  vaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAG  942
             + I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P+AAG
Sbjct  780   LKIEAQENAASNTASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIPIAAG  839

Query  941   ILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             +LLP     +TPS++G LM LSSI V++NSLLL+L
Sbjct  840   VLLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQL  874



>ref|XP_006372043.1| hypothetical protein POPTR_0018s08380g [Populus trichocarpa]
 gb|ERP49840.1| hypothetical protein POPTR_0018s08380g [Populus trichocarpa]
Length=889

 Score =   530 bits (1365),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 352/813 (43%), Positives = 493/813 (61%), Gaps = 63/813 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CG C + VK IL +  RV SA VN+ TETA V    EA +       +GE LAK L+
Sbjct  83    GMMCGACVSRVKSILSADERVESAVVNMLTETAAVKLKPEALLEGEVSASIGESLAKRLS  142

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
              CGF+A  R S     EN+ +  +     +   +++  R +  +W L A+C   H SH  
Sbjct  143   ECGFEAKKRVSGNGVAENVKKWKDMVKKKEELIVKSRNR-VVFAWTLVALCCGSHASHIL  201

Query  2792  GA------KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGA  2631
              +        S + +LH++     + L +LL PGR L++DGL++  KG+PNMN+LVG G+
Sbjct  202   HSLGIHVGHGSVLEVLHNSYVKGGLALGSLLGPGRDLLVDGLRAFKKGSPNMNSLVGFGS  261

Query  2630  LSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPS  2454
             +++F +S+++   P L W A FF+EPVML+ FVLLGR+LE++A+I+A+SDM  LL ++ +
Sbjct  262   IAAFVISAISLLNPALEWDASFFDEPVMLLGFVLLGRSLEEKARIRASSDMNELLALMST  321

Query  2453  KARLVVN-SDMGEQTSTV--------EVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             ++RLV+  SD    T  V        EVP  ++ VGD ++VLPG+ IP DG V AGRS V
Sbjct  322   QSRLVITPSDSNSPTENVLCSDAICTEVPTDDVRVGDTLLVLPGETIPVDGRVLAGRSVV  381

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DES  TGE LPV K  G +V+AG+IN +G L VE    G  + I  I+R+VE+AQ  EAP
Sbjct  382   DESMLTGESLPVFKEEGLKVSAGTINWDGPLRVEALSTGSNSTISRIIRMVEDAQGSEAP  441

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscs  1959
             +QRLAD ++G F Y VM +SAATF FW   G+ V P  L        G    L+L+LS  
Sbjct  442   IQRLADSIAGPFVYSVMTVSAATFAFWYYIGSHVFPDVLLNDIAGPDGDPLLLSLKLSVD  501

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + ++ +  DKTGTLT G+P
Sbjct  502   VLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLASISYVALDKTGTLTEGKP  561

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
              V+ V                ++  + E ++L +A  VE    HPI KAIV  A+S   +
Sbjct  562   AVSAV----------------ASISYEESEILQMAFAVERTALHPIAKAIVNKAES--LK  603

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFK---------  1446
             +   E    + EPG G +A ++ + V+VG+LDWV       T++ +  D +         
Sbjct  604   LTIPETRGQLTEPGFGTLAEVDGRLVAVGSLDWVNERFQRRTKLSDLKDLETKVTYQSSE  663

Query  1445  -------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAA  1290
                    +++VVYVG +G  + G I + D LR DA   +  L ++GI T LLSGD++ A 
Sbjct  664   GMPSSNYSKTVVYVGREGEGIIGAIAISDCLRHDAESTISRLQQKGINTVLLSGDREEAV  723

Query  1289  EYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgva  1116
               +A+ VGI  E +   + P +KS+ +S LQ     VAMVGDGINDA   ALA   + + 
Sbjct  724   ATIANRVGIESEFINASLTPQKKSEVISSLQAAGHRVAMVGDGINDAPSLALADVGIAIQ  783

Query  1115  igggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGIL  936
                   AASDV+S++L+ NRL+Q++DAL+LSR TM  V QNL WA  YN+V +P+AAG+L
Sbjct  784   NEAQENAASDVASIILLGNRLAQVVDALDLSRATMAKVYQNLSWAIAYNVVAIPIAAGVL  843

Query  935   LPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             LP     +TPS++G LM LSSI V++NSLLL+L
Sbjct  844   LPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQL  876



>ref|XP_006353855.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006353856.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
isoform X3 [Solanum tuberosum]
Length=897

 Score =   530 bits (1366),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 350/818 (43%), Positives = 492/818 (60%), Gaps = 63/818 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CG C + VK IL +  RV SA VN+ TETA V   ++A       Q    ELAK LT
Sbjct  90    GMMCGACVSRVKAILSADDRVDSAVVNMLTETAAVKLKADAAETGLAAQ----ELAKRLT  145

Query  2963  SCGFKANVRDSRR--ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
              CGF    R SR   +   + +++ +  K A L  S   +A +W L A+C   H +H   
Sbjct  146   ECGFPTKKRSSRLGIDAKVKKWKETVKKKEALLVESRNRVAFAWTLVALCCGTHATHILH  205

Query  2789  AKASWIH-----LLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALS  2625
             +    IH     +LH++     + +  LL PGR L+ DGL +  KG+PNMN+LVG G+++
Sbjct  206   SLGIHIHGSMLDILHNSYVKAGLAVGALLGPGRDLLFDGLWAFTKGSPNMNSLVGFGSIA  265

Query  2624  SFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKA  2448
             +FA+SS++   P+L W+A FF+EPVML+ FVLLGR+LE+RA++KA+SDM  LL ++ +++
Sbjct  266   AFAISSVSLLNPELQWEASFFDEPVMLLGFVLLGRSLEERARLKASSDMNELLLLISTQS  325

Query  2447  RLVVNSDMGEQTST--------VEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDES  2292
             RLV+ S   + ++         +EVP  ++ VGD ++V PG+ IP DG V AGRS VDES
Sbjct  326   RLVITSSGSDSSTDVVSSDAICIEVPTDDIRVGDSLLVFPGETIPVDGRVVAGRSVVDES  385

Query  2291  SFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQR  2112
               TGE LPV K  G  V+AG+IN +  L +E    G  + I  IV +VE+AQ REAP+QR
Sbjct  386   MLTGESLPVFKEKGVSVSAGTINWDSPLRIEASSTGSNSTISKIVNMVEDAQGREAPIQR  445

Query  2111  LADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscsvlv  1950
             LAD ++G F Y VM LSAATF FW   G+ + P  L       +G    L+L+L+  VLV
Sbjct  446   LADTIAGPFVYSVMTLSAATFGFWYYVGSNIFPDVLLNDIAGPEGDPLLLSLKLAVDVLV  505

Query  1949  vaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVT  1770
             V+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + V+ ++ DKTGTLT G+P V+
Sbjct  506   VSCPCALGLATPTAILVGTSLGARQGLLIRGGDVLERLASVDHVMLDKTGTLTEGKPAVS  565

Query  1769  EVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVK  1590
              +   GH                 E+++L +A+ VE  T+HPI  AI+  A+S N  I  
Sbjct  566   AITSLGHE----------------ELEILQIAAAVEKTTSHPIAHAIISKAESLNLSIPV  609

Query  1589  AEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQ----------  1440
                   + EPGSG MA +    V++G L WV+     +T + +    +            
Sbjct  610   TRGQ--LAEPGSGTMAEVNGLLVAIGKLKWVQERFQQKTDLSDLMTLEQSVMHKSLQDSQ  667

Query  1439  ------SVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYV  1281
                   +VVYVG +G  + G I + D+LREDA   +  L  +GI T LLSGD++ A   V
Sbjct  668   SSNHSTTVVYVGREGEGVIGAIAISDKLREDAESTIRRLQHKGIETVLLSGDREEAVATV  727

Query  1280  ASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgvaigg  1107
             A  VGI  + V   + P +KS  +S LQ     VAMVGDGINDA   ALA   + + + G
Sbjct  728   AKTVGIKDKFVNASLTPQQKSAAISDLQASGHRVAMVGDGINDAPSLALADVGIALQVEG  787

Query  1106  gvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPF  927
                AAS+ +S++L+ NRLSQ+L+AL+L++ TM  V QNL WA  YN+V +P+AAG+LLP 
Sbjct  788   QETAASNAASIILLGNRLSQVLEALDLAQATMAKVHQNLSWAVAYNVVAIPIAAGVLLPN  847

Query  926   TGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
                 +TPS++G LM +SSI V++NSLLL+   + K+++
Sbjct  848   FDFAMTPSLSGGLMAMSSIFVVSNSLLLQFHGSQKKRK  885



>ref|XP_006452988.1| hypothetical protein CICLE_v10007408mg [Citrus clementina]
 ref|XP_006452989.1| hypothetical protein CICLE_v10007408mg [Citrus clementina]
 gb|ESR66228.1| hypothetical protein CICLE_v10007408mg [Citrus clementina]
 gb|ESR66229.1| hypothetical protein CICLE_v10007408mg [Citrus clementina]
Length=887

 Score =   530 bits (1364),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 360/836 (43%), Positives = 493/836 (59%), Gaps = 91/836 (11%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQL-GEELAKHL  2967
             GM CGGC A VK +L +  RV S +VN+ TETA +   +EA            E L K L
Sbjct  80    GMMCGGCVARVKSVLTADDRVDSVAVNMLTETAAIKLRTEAVEESEEVVNNVAESLGKRL  139

Query  2966  TSCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSH  2799
               CGF+A  R S     EN+ +   K++  KR  L    R  +A +W L A+C   H SH
Sbjct  140   MECGFEAKRRVSGTGVAENVKKW--KEVAKKREDLLVKSRNRVAFAWTLVALCCGSHASH  197

Query  2798  FFGAKASWIHLLHSTGFHMS----------------MCLFTLLVPGRQLIIDGLKSLLKG  2667
                       +LHS G H++                  L  L  PGR L+ DGL++  KG
Sbjct  198   ----------ILHSLGIHIAHGPLWELLDNSYVKGGFALGALFGPGRDLLSDGLRAFRKG  247

Query  2666  APNMNTLVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKAT  2490
             +PNMN+LVG G++ +F +S ++   P+L W A FFEEPVML+ FVLLGR+LE+RA+I+A+
Sbjct  248   SPNMNSLVGFGSIVAFLISLVSLLKPELEWDASFFEEPVMLLGFVLLGRSLEERARIRAS  307

Query  2489  SDMTGLLNVLPSKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIP  2337
             SDM  LL+++ +++RLV+ S          +      VEVP  ++ VGD ++VLPG+ IP
Sbjct  308   SDMNELLSLVSTQSRLVITSSESGSSADNVLCSDAICVEVPTDDIRVGDSVLVLPGETIP  367

Query  2336  ADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIV  2157
              DG V AGRS VDES  +GE LPV K  G  V+AG+IN +G L +E    G  + I  IV
Sbjct  368   VDGRVLAGRSVVDESMLSGESLPVFKEEGFTVSAGTINWDGPLRIEACSTGSNSMISKIV  427

Query  2156  RLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQG  1995
              +VEEAQ REAP+QRLAD ++G F Y VM LSAATF FW   G+++ P  L        G
Sbjct  428   SMVEEAQGREAPIQRLADAIAGPFVYSVMTLSAATFAFWYYIGSQIFPDVLLSDMAGPNG  487

Query  1994  slaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIV  1815
             +   L+L+LS  VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + ++ + 
Sbjct  488   NPLLLSLKLSVDVLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLARIDYLA  547

Query  1814  FDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGK  1635
              DKTGTLT G+P V  V                ++  + E ++L +A+ VE    HPI K
Sbjct  548   LDKTGTLTEGKPAVFNV----------------ASFVYDESEILKIAAAVEKTATHPIAK  591

Query  1634  AIVEAAKSRNCR--IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV--RRHGVGE-TR  1470
             AIV  A+S N    I + +    + EPG G +  ++ + V+VGTL+WV  R    G+ + 
Sbjct  592   AIVNKAESLNLTSPITRGQ----LAEPGFGILGEVDGRLVAVGTLEWVYERFQKQGDHSD  647

Query  1469  VQEFDDF-------------KNQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQG  1332
             VQ  +                ++SVVYVG +G  + G I + D LR DA H V SL ++G
Sbjct  648   VQHLEHAVTHQSSELASPSNYSKSVVYVGREGEGIIGAIAISDSLRHDAEHTVRSLQQKG  707

Query  1331  ITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGIND  1152
             I T LLSGD++ A    A  VGI +E +   + P +KS+ +S LQ     VAMVGDGIND
Sbjct  708   IKTVLLSGDREEAVAATAKEVGIGKEYINSSLTPQQKSEVISTLQTSGHHVAMVGDGIND  767

Query  1151  AA--ALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAF  978
             A   ALA   + + I     AAS  +S++L+ N+LSQ++DAL+L++ TM  V QNL WA 
Sbjct  768   APSLALADVGIALQIEAQENAASTAASIILLGNKLSQVVDALDLAKATMAKVYQNLLWAV  827

Query  977   GYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL-KFASKQKE  813
              YN+V +P+AAG LLP     +TPS++G LM LSSI V++NSLLL+  +F S +K+
Sbjct  828   AYNVVAIPIAAGALLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQFHEFESNKKK  883



>ref|NP_680181.2| P-type ATPase [Arabidopsis thaliana]
 ref|NP_001031920.1| P-type ATPase [Arabidopsis thaliana]
 sp|B9DFX7.1|HMA8_ARATH RecName: Full=Copper-transporting ATPase PAA2, chloroplastic; 
AltName: Full=Protein HEAVY METAL ATPASE 8; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAH19644.1| AT5G21930 [Arabidopsis thaliana]
 gb|AED92956.1| P-type ATPase [Arabidopsis thaliana]
 gb|AED92957.1| P-type ATPase [Arabidopsis thaliana]
Length=883

 Score =   529 bits (1363),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 350/821 (43%), Positives = 496/821 (60%), Gaps = 69/821 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A VK +L S  RV+SA VN+ TETA V    E +V  +      E LAK LT
Sbjct  84    GMMCGGCVARVKSVLMSDDRVASAVVNMLTETAAVKFKPEVEVTAD----TAESLAKRLT  139

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
               GF+A  R S     EN+ +   K+M +K+  L    R  +A +W L A+C   H SH 
Sbjct  140   ESGFEAKRRVSGMGVAENVKKW--KEMVSKKEDLLVKSRNRVAFAWTLVALCCGSHTSHI  197

Query  2795  FGAKASWI------HLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
               +    I       LLH++     + +  LL PGR+L+ DG+K+  K +PNMN+LVGLG
Sbjct  198   LHSLGIHIAHGGIWDLLHNSYVKGGLAVGALLGPGRELLFDGIKAFGKRSPNMNSLVGLG  257

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F++S ++   P+L W A FF+EPVML+ FVLLGR+LE+RAK++A++DM  LL+++ 
Sbjct  258   SMAAFSISLISLVNPELEWDASFFDEPVMLLGFVLLGRSLEERAKLQASTDMNELLSLIS  317

Query  2456  SKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+ S          +   +  + V   ++ VGD ++VLPG+  P DG V AGRS 
Sbjct  318   TQSRLVITSSDNNTPVDSVLSSDSICINVSVDDIRVGDSLLVLPGETFPVDGSVLAGRSV  377

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V+AG+IN +G L ++    G  + I  IVR+VE+AQ   A
Sbjct  378   VDESMLTGESLPVFKEEGCSVSAGTINWDGPLRIKASSTGSNSTISKIVRMVEDAQGNAA  437

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+L+L+ 
Sbjct  438   PVQRLADAIAGPFVYTIMSLSAMTFAFWYYVGSHIFPDVLLNDIAGPDGDALALSLKLAV  497

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + ++ +  DKTGTLT GR
Sbjct  498   DVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASIDCVALDKTGTLTEGR  557

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V+ V   G+ ++                +VL +A+ VE    HPI KAIV  A+S N 
Sbjct  558   PVVSGVASLGYEEQ----------------EVLKMAAAVEKTATHPIAKAIVNEAESLNL  601

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV------RRHGVGETRVQEFDDFK--  1446
             +    E    + EPG G +A I+ + V+VG+L+WV      +       +++   D K  
Sbjct  602   K--TPETRGQLTEPGFGTLAEIDGRFVAVGSLEWVSDRFLKKNDSSDMVKLESLLDHKLS  659

Query  1445  --------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
                     +++VVYVG +G  + G I + D LR+DA   V  L ++GI T LLSGD++ A
Sbjct  660   NTSSTSRYSKTVVYVGREGEGIIGAIAISDCLRQDAEFTVARLQEKGIKTVLLSGDREGA  719

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--gv  1119
                VA  VGI  E+  Y + P++K +F+S LQ     VAMVGDGINDA +LA + V   +
Sbjct  720   VATVAKNVGIKSESTNYSLSPEKKFEFISNLQSSGHRVAMVGDGINDAPSLAQADVGIAL  779

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
              I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P+AAG+
Sbjct  780   KIEAQENAASNAASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIPIAAGV  839

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             LLP     +TPS++G LM LSSI V++NSLLL+L  +   K
Sbjct  840   LLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQLHKSETSK  880



>ref|XP_010454455.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
[Camelina sativa]
Length=889

 Score =   529 bits (1363),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 356/815 (44%), Positives = 493/815 (60%), Gaps = 70/815 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A VK +L S  RV+SA VN+ TETA V      K        + E LAK LT
Sbjct  89    GMMCGGCVARVKSVLMSDDRVASAVVNMLTETAAV----RLKPEVEVVVDVAESLAKRLT  144

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
               GF+A  R S     EN+ +   K+M +K+ +L    R  +A +W L A+C   H SH 
Sbjct  145   DSGFEAKRRVSGMGVAENVKKW--KEMVSKKEELLVKSRNRVAFAWTLVALCCGSHTSHI  202

Query  2795  FGAKASWI------HLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
               +    I       LLH++     + +  LL PGR+L+ DG+K+  K +PNMN+LVGLG
Sbjct  203   LHSLGIHIAHGGIWDLLHNSYVKGGLAVGALLGPGRELLFDGIKAFGKRSPNMNSLVGLG  262

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F +S ++   P+L W A FFEEPVML+ FVLLGR+LE+RAK+KA+SDM  LL+++ 
Sbjct  263   SMAAFTISLISLVNPELEWDASFFEEPVMLLGFVLLGRSLEERAKLKASSDMNELLSLIS  322

Query  2456  SKARLVVNSDMGEQTST----------VEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRS  2307
             +++RLV+ S     T+           V VP  ++ VGD ++VLPG+  P DG V AGRS
Sbjct  323   TQSRLVITSSDNNNTAADSVLSSDSICVNVPVDDIRVGDSLLVLPGETFPVDGSVLAGRS  382

Query  2306  TVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSRE  2127
              VDES  TGE LPV K  G  V+AG+IN +G L ++V   G  + I  IVR+VE+AQ   
Sbjct  383   VVDESMLTGESLPVFKEGGCSVSAGTINWDGPLRIKVSSTGSNSTISKIVRMVEDAQGNA  442

Query  2126  APVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqls  1965
             APVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+L+L+
Sbjct  443   APVQRLADAIAGPFVYTIMSLSAVTFAFWYYIGSNIFPDVLLNDIAGPDGDPLALSLKLA  502

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
               VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + V+ +  DKTGTLT G
Sbjct  503   VDVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASVDCVALDKTGTLTEG  562

Query  1784  RPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRN  1605
             RP V+ +                ++  + E +VL LA+ VE    HPI KAIV  A++ N
Sbjct  563   RPVVSGI----------------ASLRYEEQEVLKLAAAVEKTATHPIAKAIVNEAEALN  606

Query  1604  CRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV------RRHGVGETRVQEFDDFK-  1446
                   E    + EPG G +A I+ + V+VG+L+WV      +       +++ F D K 
Sbjct  607   QE--TPETRGQLTEPGFGTLAEIDGRLVAVGSLEWVSDRFLKKNDSSDMVKLESFLDNKL  664

Query  1445  ---------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKN  1296
                      +++VVYVG +G  + G I + D LR+DA   V  L ++GI T LLSGD++ 
Sbjct  665   SSTSSTSRYSKTVVYVGREGEGIIGAIAISDCLRQDAEFTVARLQEKGIKTVLLSGDREG  724

Query  1295  AAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--g  1122
             A   VA  VGI  E+  Y + P+ K +F+S LQ     VAMVGDGINDA +LA + V   
Sbjct  725   AVATVAKNVGIESESTNYSLSPEMKFEFISNLQSSGHRVAMVGDGINDAPSLAQADVGIA  784

Query  1121  vaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAG  942
             + I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P+AAG
Sbjct  785   LKIEAQENAASNTASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIPIAAG  844

Query  941   ILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             +LLP     +TPS++G LM LSSI V++NSLLL+L
Sbjct  845   VLLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQL  879



>ref|XP_006580903.1| PREDICTED: chloroplast copper-translocating HMA8 P-ATPase isoform 
X1 [Glycine max]
Length=903

 Score =   529 bits (1363),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 351/822 (43%), Positives = 495/822 (60%), Gaps = 68/822 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CG C + VK IL +  RV S  VN+ TETA V    + + +      + E LA  L+
Sbjct  87    GMMCGACVSRVKNILSADDRVDSVVVNMLTETAAV----KLRRIEEEPASVAESLALRLS  142

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
              CGF    R S     EN+ +   K++  K+ +L    R  +A +W L A+C   H SH 
Sbjct  143   DCGFPTKRRASSSGVTENVRKW--KELVKKKEELVVKSRSRVAFAWTLVALCCGSHASHI  200

Query  2795  FG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
             F       A    + +LHS+     + L +LL PGR+L+ DGL +  KG+PNMN+LVG G
Sbjct  201   FHSLGIHIAHGPLMEILHSSYLKGGLALGSLLGPGRELLFDGLNAFKKGSPNMNSLVGFG  260

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F +SS++   P L W A FF+EPVML+ FVLLGR+LE++A+I+A+SDM  LL+++ 
Sbjct  261   SVAAFIISSISLLNPGLAWDASFFDEPVMLLGFVLLGRSLEEKARIQASSDMNELLSLIS  320

Query  2456  SKARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+ S  G  ++          VEVP  ++ VGD ++VLPG+ IP DG V +GRS 
Sbjct  321   TQSRLVITSTEGSPSTDTVLCSDAICVEVPTDDIRVGDSVLVLPGETIPIDGTVISGRSV  380

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             +DES  TGE LPV K  G  V+AG+IN +G L +E    G  T I  IVR+VE+AQSREA
Sbjct  381   IDESMLTGESLPVFKEKGLTVSAGTINWDGPLRIEASSTGSNTMISKIVRMVEDAQSREA  440

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F Y VM LSAATF FW   G+ + P  L       +G    L+L+LS 
Sbjct  441   PVQRLADSIAGPFVYSVMTLSAATFAFWYFVGSHIFPDVLLNDIAGPEGDPLLLSLKLSV  500

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + +N I  DKTGTLT G+
Sbjct  501   DVLVVSCPCALGLATPTAILVGTSLGARKGLLIRGGDVLERLAGINYIALDKTGTLTKGK  560

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V+ +                S+  + E ++L LA+ VE   +HPI KAIV  A+S   
Sbjct  561   PVVSAI----------------SSILYGESEILRLAAAVEKTASHPIAKAIVNKAESLEL  604

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN-------  1443
              ++    G  + EPG G +A ++   ++VG+L+WV           +  + +N       
Sbjct  605   -VLPVTKGQLV-EPGFGTLAEVDGHLIAVGSLEWVHERFQTRANPSDLTNLENSLMNHSL  662

Query  1442  --------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAA  1290
                     ++VVYVG +G  + G I + D +REDA   +  L ++GI T LLSGD++ A 
Sbjct  663   NTTSSKYSKTVVYVGREGEGIIGAIAISDTVREDAESTITRLKQKGIKTVLLSGDREEAV  722

Query  1289  EYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--gva  1116
               VA  VGI  + V   + P +KS F+S L+     VAMVGDGINDA +LA + V   + 
Sbjct  723   ATVADTVGIENDFVKASLSPQQKSGFISSLKAAGHHVAMVGDGINDAPSLAVADVGIALQ  782

Query  1115  igggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGIL  936
                   AASD +S++L+ N++SQ++DAL+L++ TM  V QNL WA  YN+V +P+AAG+L
Sbjct  783   NEAQENAASDAASIILLGNKISQVVDALDLAQATMGKVYQNLCWAVAYNVVAIPIAAGVL  842

Query  935   LPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEI  810
             LP     +TPS++G LM LSSI V+ NSLLL+L  +   +++
Sbjct  843   LPHFDFAMTPSLSGGLMALSSIFVVGNSLLLQLHGSQISRKV  884



>gb|KFK26354.1| hypothetical protein AALP_AA8G237600 [Arabis alpina]
Length=880

 Score =   528 bits (1360),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 351/814 (43%), Positives = 493/814 (61%), Gaps = 68/814 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A VK +L S  RV+SA VN+ TETA V    E + V    +   E LAK LT
Sbjct  81    GMMCGGCVARVKSVLMSDERVASAVVNMLTETAAVKLKPEVEEV---MEDAAESLAKRLT  137

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
               GF+A  R S     EN+ +   K+M +K+ +L    R  +A +W L A+C   H SH 
Sbjct  138   ESGFEAKRRVSGMGVAENVKKW--KEMVSKKEELLVKSRNRVAFAWTLVALCCGSHTSHI  195

Query  2795  FG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
                     A   +  LLH++     + +  LL PGR+L+ DG+K+  K +PNMN+LVGLG
Sbjct  196   LHSLGIHIAHGGFWDLLHNSYVKGGLAVGALLGPGRELLFDGIKAFGKRSPNMNSLVGLG  255

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F++S ++   P+L W A FFEEPVML+ FVLLGR+LE+RAK+KA+SDM  LL+++ 
Sbjct  256   SMAAFSISLISLVNPELEWDASFFEEPVMLLGFVLLGRSLEERAKLKASSDMNELLSLIS  315

Query  2456  SKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+ S          +   +  + VP   + VGD ++VLPG+  P DG V AGRS 
Sbjct  316   TQSRLVITSSVSNTAADTVLSSDSICINVPVDEIRVGDSLLVLPGETFPVDGSVLAGRSV  375

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V+AG+IN +G L ++    G  + I  IVR+VE+AQ   A
Sbjct  376   VDESMLTGESLPVFKEEGHSVSAGTINWDGPLRIKASSTGSNSTISKIVRMVEDAQGNAA  435

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+L+L+ 
Sbjct  436   PVQRLADAIAGPFVYTIMSLSAVTFAFWYYIGSHIFPDVLLNDIAGPDGDPLALSLKLAV  495

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + ++ +  DKTGTLT GR
Sbjct  496   DVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASIDCVALDKTGTLTEGR  555

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V+ +                ++  + E  VL +A+ VE    HPI KAIV  A++ N 
Sbjct  556   PIVSGI----------------ASLRYEEQVVLKMAAAVEKTATHPIAKAIVNKAEALNL  599

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV--RRHGVGE-TRVQEFDDFKNQ---  1440
                  E    + EPG G +A ++ + V+VG+  WV  R H   + + V + + + N+   
Sbjct  600   E--TPETRGQLTEPGFGTLAEVDGRLVAVGSFQWVSDRFHKKNDPSDVVKLEIYLNRKLS  657

Query  1439  ----------SVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
                       +VVYVG +G  + G I + D LR+DA   V  L ++GI T LLSGD++ A
Sbjct  658   STSSTSKYSKTVVYVGREGEGIIGAIAISDCLRQDAEFTVARLQEKGIKTVLLSGDREGA  717

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--gv  1119
                VA  VGI  E+  Y + P++K +F+S LQ     VAMVGDGINDA +LA + V   +
Sbjct  718   VATVAKNVGIESESTNYSLSPEKKFEFISNLQSSGHRVAMVGDGINDAPSLAQADVGIAL  777

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
              I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P+AAG+
Sbjct  778   KIEAQENAASNAASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIPIAAGV  837

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             LLP     +TPS++G LM LSSI V++NSLLL+L
Sbjct  838   LLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQL  871



>ref|XP_002871979.1| hypothetical protein ARALYDRAFT_910174 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48238.1| hypothetical protein ARALYDRAFT_910174 [Arabidopsis lyrata subsp. 
lyrata]
Length=887

 Score =   528 bits (1359),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 351/815 (43%), Positives = 494/815 (61%), Gaps = 71/815 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A VK +L S  RV+SA VN+ TETA V    E +V  +      E LAK LT
Sbjct  88    GMMCGGCVARVKSVLMSDDRVASAVVNMLTETAAVKLKPEVEVTAD----AAESLAKRLT  143

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
               GF+A  R S     EN+ +   K+M +K+  L    R  +A +W L A+C   H SH 
Sbjct  144   ESGFEAKRRVSGMGVAENVKKW--KEMVSKKEDLLVKSRNRVAFAWTLVALCCGSHTSHI  201

Query  2795  FGAKASWI------HLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
               +    I       LLH++     + +  LL PGR L+ DG+K+  K +PNMN+LVGLG
Sbjct  202   LHSLGIHIAHGGIWDLLHNSYVKGGLAVGALLGPGRDLLFDGIKAFGKRSPNMNSLVGLG  261

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F++S ++   P+L W A FFEEPVML+ FVLLGR+LE+RAK+KA+SDM  LL+++ 
Sbjct  262   SMAAFSISLISLVNPELEWDASFFEEPVMLLGFVLLGRSLEERAKLKASSDMNELLSLIS  321

Query  2456  SKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+ S          +   +  + V   ++ VGD ++VLPG+  P DG V AGRS 
Sbjct  322   TQSRLVITSSDNNTAADSVLSSDSICINVSVDDIRVGDSLLVLPGETFPVDGSVLAGRSV  381

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V+AG+IN +G L ++    G  + I  IVR+VE+AQ   A
Sbjct  382   VDESMLTGESLPVFKEEGCSVSAGTINWDGPLRIKASSTGSNSTISKIVRMVEDAQGNAA  441

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+L+L+ 
Sbjct  442   PVQRLADAIAGPFVYTIMSLSAVTFAFWYYVGSHIFPDVLLNDIAGPDGDALALSLKLAV  501

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + ++ +  DKTGTLT GR
Sbjct  502   DVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASIDCVALDKTGTLTEGR  561

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V  V                ++  + E +VL +A+ VE    HPI KAIV  A+S N 
Sbjct  562   PVVAGV----------------ASLRYEEQEVLKVAAAVEKTATHPIAKAIVNEAESLNL  605

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV------RRHGVGETRVQEFDDFK--  1446
             +    E    + EPG G +A ++ + V+VG+L+WV      +       +++ F D K  
Sbjct  606   K--TPETRGQLTEPGFGTLAEVDGRLVAVGSLEWVSDRFLKKNDSSDMVKLESFLDNKLS  663

Query  1445  --------NQSVVYVGV--DGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKN  1296
                     +++VVYVG   +G++ G I + D LR+DA   V  L ++GI T LLSGD++ 
Sbjct  664   NASSTSRYSKTVVYVGREEEGII-GAIAISDCLRQDAAFTVARLQEKGIKTVLLSGDREG  722

Query  1295  AAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--g  1122
             A   VA  VGI  E+  Y + P++K +F++ LQ     VAMVGDGINDA +LA + V   
Sbjct  723   AVATVAKNVGIESESTNYSLSPEKKFEFITNLQSSGHRVAMVGDGINDAPSLAQADVGIA  782

Query  1121  vaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAG  942
             + I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P+AAG
Sbjct  783   LKIEAQENAASNAASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIPIAAG  842

Query  941   ILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             +LLP     +TPS++G LM LSSI V++NSLLL+L
Sbjct  843   VLLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQL  877



>ref|XP_007012428.1| P-type ATPase of 2 isoform 1 [Theobroma cacao]
 gb|EOY30047.1| P-type ATPase of 2 isoform 1 [Theobroma cacao]
Length=897

 Score =   527 bits (1358),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 348/818 (43%), Positives = 491/818 (60%), Gaps = 62/818 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC + VK ++ S  RV S  VNL TETA +  +++  +       +   +A+ ++
Sbjct  87    GMMCGGCVSRVKSVISSDERVESVVVNLLTETAAI-KLNQEVIESETVDSVAVSIAQRVS  145

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
              CGF A  R S     EN+ +   K+M  K+ +L    R  +A +W L A+C   H SH 
Sbjct  146   ECGFMAKRRVSGLGIGENVRKW--KEMLKKKEELLVKSRNRVAFAWTLVALCCGSHASHI  203

Query  2795  FG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
                     A   ++ +LH++ F   + L  LL PGR L++DGL +  KG+PNMN+LVG G
Sbjct  204   LHSLGIHIAHGPFLEVLHNSYFKGGLALAALLGPGRDLLVDGLMAFKKGSPNMNSLVGFG  263

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F +S+++   P L W A FF+EPVML+ FVLLGR+LE++A+I+A+SDM  LL+++ 
Sbjct  264   SIAAFIISAVSLLNPGLAWDASFFDEPVMLLGFVLLGRSLEEKARIQASSDMNELLSLIS  323

Query  2456  SKARLVVNSD--------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             +++RLV+ S         +      +EVP  ++ VGD ++VLPG+ IP DG V AGRS V
Sbjct  324   TRSRLVITSSDDSSADSVLCSDAICIEVPSDDIRVGDSVLVLPGETIPTDGKVLAGRSVV  383

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DES  TGE LPV K  G  V+AG+IN +G L +E    G  + I  IVR+VE+AQ +EAP
Sbjct  384   DESMLTGESLPVFKEKGLMVSAGTINWDGPLRIEATSTGSNSTISKIVRMVEDAQGQEAP  443

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscs  1959
             VQRLAD ++G F Y +M LSAATF FW   G+ + P  L        G    L+L+L+  
Sbjct  444   VQRLADAIAGPFVYSIMTLSAATFAFWYYAGSHIFPDVLLNDIAGPDGDPLLLSLKLAVD  503

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + V+ + FDKTGTLT G+P
Sbjct  504   VLVVSCPCALGLATPTAILVGTSLGARQGLLIRGGDVLERLASVDHVAFDKTGTLTEGKP  563

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
             TV+ V                ++  + E ++L +A+ VE    HPI KAIV+ A+S N  
Sbjct  564   TVSSV----------------ASFAYDESEILQIAAAVERTATHPIAKAIVKKAESLNLA  607

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN--------  1443
               +   G  + EPG G +A +    V+VG L WV      + +  +  + ++        
Sbjct  608   FPETR-GQLV-EPGFGTLAEVNGHLVAVGNLKWVNERFQIKAKPSDLMNLEHATMHHSSS  665

Query  1442  -----QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYV  1281
                  ++ VYVG +G  + G I + D LR DA   V  L K+GI T L+SGD++ A   +
Sbjct  666   PSNNSKTAVYVGREGEGVIGAIGISDSLRYDAESTVRRLQKKGIKTILISGDREEAVATI  725

Query  1280  ASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgvaigg  1107
             A  VGI  E V   + P +KS+ +S LQ     +AMVGDGINDA   ALA   + +    
Sbjct  726   AQTVGIGSEFVNASLTPQQKSRVISTLQTAGHRIAMVGDGINDAPSLALADVGISIQTEA  785

Query  1106  gvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPF  927
                AASD +S++L+ NRLSQ++DAL+L++ TM  V QNL WA  YN V +P+AAG+LLP 
Sbjct  786   QDTAASDAASIILLGNRLSQVVDALDLAQATMAKVYQNLSWAVAYNAVAIPIAAGVLLPQ  845

Query  926   TGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
                 +TPS++G LM LSSI V+TNSLLLRL    K ++
Sbjct  846   YDFAMTPSLSGGLMALSSIFVVTNSLLLRLHGLEKSRK  883



>ref|WP_007310860.1| ATPase [Crocosphaera watsonii]
 gb|EHJ12612.1| cation-transporting P-type ATPase [Crocosphaera watsonii WH 0003]
 emb|CCQ50974.1| cation-transporting P-type ATPase [Crocosphaera watsonii WH 8502]
Length=783

 Score =   523 bits (1348),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 324/782 (41%), Positives = 483/782 (62%), Gaps = 46/782 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQL--GEELAKH  2970
             GM C GC ++V++ L  Q  V SA VNL TE AV+          N++ Q    E LA+ 
Sbjct  26    GMKCAGCVSAVEKQLTQQSGVVSACVNLITEVAVI----------NYEPQTVQAETLAEK  75

Query  2969  LTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
             LT  GF +++R S+     +    +   + A+ +     L  +  L     +GHL HF G
Sbjct  76    LTKIGFTSDIRTSQTLTPQQIHFNQSQRREAEARQQKINLITAAILLIFSALGHLEHFGG  135

Query  2789  AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
                  + ++ S GFH  +    LL+PGR++IIDG ++L  G  NMNTLVGLG LS++  S
Sbjct  136   PT---LPIISSLGFHWGLATMALLIPGREVIIDGWRALSHGMANMNTLVGLGTLSAYITS  192

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
              +A   P LGW+ FF+EPVML+ F+LLGR LE++A+ +A+S +  L+ + PS ARLV   
Sbjct  193   CVAFLFPILGWECFFDEPVMLLGFILLGRTLEKQARNRASSALEALIALQPSLARLV-GD  251

Query  2429  DMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPG  2250
                E +S++E+P   + VG+ + +LPG++IP DG +  G++ +DES  TGE LP+ K PG
Sbjct  252   PFSEDSSSIEIPVEQVRVGEYVKILPGEKIPVDGEIITGKTAIDESLVTGESLPIAKNPG  311

Query  2249  AQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVM  2070
              +  AG++N +G++T++    G +T +  I+  VE AQ+R+AP+Q+LAD V+G+F YGVM
Sbjct  312   DRAIAGTLNHSGVITLKTTEVGEDTTLAQIIASVETAQTRKAPIQQLADTVAGYFAYGVM  371

Query  2069  ALSAATFMFWNLFGTRVLPATLH------QGslaslalqlscsvlvvaCPCALGLATPTA  1908
              L++ TF+FW +FGT   P  L+        S   L+L+L+ +VLV+ACPCALGLATPTA
Sbjct  372   VLASLTFLFWYIFGTHWYPQVLNLDSLGMSSSPLLLSLKLAIAVLVIACPCALGLATPTA  431

Query  1907  VMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAK  1728
             ++VGTS+G+ RGLL++GG VLE    +  ++FDKTGTLT+G PTVT+ +  G     + K
Sbjct  432   ILVGTSMGSERGLLIKGGDVLEKVHQLEGVIFDKTGTLTVGHPTVTDCISWG-----DIK  486

Query  1727  RDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGA  1548
              +S          +L LA+ VES TNHP+G AI+E A+ +   ++ A D  F  E GSG 
Sbjct  487   PES----------LLQLAATVESGTNHPLGLAILEKAQQQELPLLSARD--FYTEAGSGV  534

Query  1547  MAVIEEKKVSVGTLDWVRRHGVGETRVQE----FDDFKNQSVVYVGVDGVLAGLIYVEDQ  1380
              A +E K V +G   W+   G+   +  +      +   ++VVY+G++G + G++ ++D 
Sbjct  535   QAQVEGKMVWLGNQRWLEDQGLSLDKNHDKLIGSLNRAGKTVVYLGIEGSIQGVLALKDN  594

Query  1379  LREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGL  1200
             LR DA+  V  L K+G+   LL+GD    A+ +AS VGI +  V   + P  K+  V  L
Sbjct  595   LRTDAQKTVSELQKRGLEVILLTGDHPEVAQAIASQVGITQ--VLAEIPPSGKAAVVEEL  652

Query  1199  QKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSR  1020
             QK +K VAMVGDGINDA ALA + +G+++ G    A + + +VLM N+L  ++ A++LS 
Sbjct  653   QKSKK-VAMVGDGINDAPALAQADLGISLQGATEVAMETADIVLMSNQLWDVITAMDLSL  711

Query  1019  LTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLR  840
              T + ++QNL WA GYN   +P+AAG+LLP  G ML+P++A   M  SS+ V+TNSLLLR
Sbjct  712   GTFRKIRQNLMWALGYNTFAIPMAAGVLLPSLGLMLSPAMAAGFMAFSSVTVVTNSLLLR  771

Query  839   LK  834
              +
Sbjct  772   YR  773



>ref|WP_008276409.1| ATPase [Cyanothece sp. CCY0110]
 gb|EAZ90477.1| cation-transporting P-type ATPase [Cyanothece sp. CCY0110]
Length=779

 Score =   523 bits (1348),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 321/785 (41%), Positives = 480/785 (61%), Gaps = 47/785 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L  Q  V SA VNL TE AV+       V P+        LA+ LT
Sbjct  26    GMKCAGCVSAVERQLTQQSGVVSACVNLITEVAVI-DYEPQTVKPDI-------LAEKLT  77

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF +++R S+     +    +   +  + +     L  +  L     +GHL HF G  
Sbjct  78    KIGFPSDIRSSQTLTPQQVHLNQSQRREEEAKQQKINLITAAILLIFSTLGHLEHFGGPT  137

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I ++ +  FH  +    LL+PGR++IIDG + L  G  NMNTLVGLG LS++  S +
Sbjct  138   ---IPIISNLWFHWGLATLALLIPGREIIIDGWRGLSHGMANMNTLVGLGTLSAYLTSCV  194

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LGW+ FF+EPVML+ F+LLGR LE++A+ +A+S +  L+ + P+ ARLV     
Sbjct  195   AFIFPSLGWECFFDEPVMLLGFILLGRTLEKQARNRASSALEALMALQPTLARLV-GDPF  253

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
              E +S++E+P   + VG+ + VLPG++IP DG +  G++T+DES  TGE +PV K PG +
Sbjct  254   SEDSSSIEIPVEQVRVGEYVKVLPGEKIPVDGEIVKGKTTIDESLVTGESVPVAKEPGEK  313

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
               AG++N +G++T++    G  T +  I+  VE AQ+R+AP+Q+LAD V+G+F YGVM L
Sbjct  314   AIAGTLNQSGVITLKTTEVGENTTLAQIIASVETAQTRKAPIQQLADTVAGYFAYGVMGL  373

Query  2063  SAATFMFWNLFGTRVLPATLHQGslasl---------alqlscsvlvvaCPCALGLATPT  1911
             ++ TF+FW + GT + P  L+                +L+L+ +VLVVACPCALGLATPT
Sbjct  374   ASLTFLFWFIVGTNLYPQVLNPNHTDMAMGSTSPLLLSLKLAIAVLVVACPCALGLATPT  433

Query  1910  AVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNA  1731
             A++VGTS+G+ RGLL++GG VLE    V  ++FDKTGTLT+G P+VT             
Sbjct  434   AILVGTSIGSERGLLIKGGDVLEKVHQVEGVIFDKTGTLTVGHPSVT-------------  480

Query  1730  KRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSG  1551
               D  +    S   +L LA+ VES TNHP+G AI+E A+     +++AED  F  E GSG
Sbjct  481   --DYFTFDGMSPQSLLQLAATVESGTNHPLGLAIIEKAEQEELSLLQAED--FQTEAGSG  536

Query  1550  AMAVIEEKKVSVGTLDWVRRHGV-----GETRVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
               A+++ + V +G   W++  G+      + R+ E      ++V Y+G++G + G++ ++
Sbjct  537   VQAIVDGQTVWLGNEAWLKEKGLIVEKDQKNRINELTQ-AGKTVAYLGIEGSIKGVLALK  595

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVS  1206
             D LR DA+  V  L K+G+   LL+GD    A+ +A+ +GI    VF  + P  K+  V 
Sbjct  596   DNLRPDAKKTVSELQKRGLEVILLTGDHPQVAQTIATQLGI--NQVFAEIPPSGKAAMVE  653

Query  1205  GLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALEL  1026
              LQK +K VAMVGDGINDA ALA +++G+++ G    A + + +VLM +RL+ ++ A++L
Sbjct  654   ELQK-RKTVAMVGDGINDAPALAQANLGISLQGSTQVAMETADIVLMSDRLADVITAMDL  712

Query  1025  SRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLL  846
             S  T + ++QNL WA GYN + +P+AAGILLP  G +L+P++A  LM  SS+ V+TNSLL
Sbjct  713   SLGTFRKIRQNLMWALGYNTLAIPIAAGILLPSFGVILSPALAAGLMAFSSVTVVTNSLL  772

Query  845   LRLKF  831
             LR +F
Sbjct  773   LRYQF  777



>ref|WP_007305602.1| ATPase [Crocosphaera watsonii]
 gb|EAM50715.1| Copper-translocating P-type ATPase:Heavy metal translocating 
P-type ATPase [Crocosphaera watsonii WH 8501]
Length=783

 Score =   523 bits (1347),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 324/782 (41%), Positives = 483/782 (62%), Gaps = 46/782 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQL--GEELAKH  2970
             GM C GC ++V++ L  Q  V SA VNL TE AV+          N++ Q    E LA+ 
Sbjct  26    GMKCAGCVSAVEKQLTQQSGVVSACVNLMTEVAVI----------NYEPQTVQAETLAEK  75

Query  2969  LTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
             LT  GF +++R S+     +    +   + A+ +     L  +  L     +GHL HF G
Sbjct  76    LTKIGFTSDIRTSQTLTPQQIHFNQSQRREAEARQQKINLITAAILLIFSALGHLEHFGG  135

Query  2789  AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
                  + ++ S GFH  +    LL+PGR++IIDG ++L  G  NMNTLVGLG LS++  S
Sbjct  136   PT---LPIISSLGFHWGLATMALLIPGREVIIDGWRALSHGMANMNTLVGLGTLSAYITS  192

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
              +A   P LGW+ FF+EPVML+ F+LLGR LE++A+ +A+S +  L+ + PS ARLV   
Sbjct  193   CVAFLFPILGWECFFDEPVMLLGFILLGRTLEKQARNRASSALEALIALQPSLARLV-GD  251

Query  2429  DMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPG  2250
                E +S++E+P   + VG+ + +LPG++IP DG +  G++ +DES  TGE LP+ K PG
Sbjct  252   PFSEDSSSIEIPVEQVRVGEYVKILPGEKIPVDGEIITGKTAIDESLVTGESLPIAKNPG  311

Query  2249  AQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVM  2070
              +  AG++N +G++T++    G +T +  I+  VE AQ+R+AP+Q+LAD V+G+F YGVM
Sbjct  312   DRAIAGTLNHSGVITLKTTEVGEDTTLAQIIASVETAQTRKAPIQQLADTVAGYFAYGVM  371

Query  2069  ALSAATFMFWNLFGTRVLPATLH------QGslaslalqlscsvlvvaCPCALGLATPTA  1908
              L++ TF+FW +FGT   P  L+        S   L+L+L+ +VLV+ACPCALGLATPTA
Sbjct  372   VLASLTFLFWYIFGTHWYPQVLNLDSLGMSSSPLLLSLKLAIAVLVIACPCALGLATPTA  431

Query  1907  VMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAK  1728
             ++VGTS+G+ RGLL++GG VLE    +  ++FDKTGTLT+G PTVT+ +  G     + K
Sbjct  432   ILVGTSMGSERGLLIKGGDVLEKVHQLEGVIFDKTGTLTVGHPTVTDCISWG-----DIK  486

Query  1727  RDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGA  1548
              +S          +L LA+ VES TNHP+G AI+E A+ +   ++ A D  F  E GSG 
Sbjct  487   PES----------LLQLAATVESGTNHPLGLAILEKAQQQELPLLSARD--FYTEAGSGV  534

Query  1547  MAVIEEKKVSVGTLDWVRRHGVGETRVQE----FDDFKNQSVVYVGVDGVLAGLIYVEDQ  1380
              A +E K V +G   W+   G+   +  +      +   ++VVY+G++G + G++ ++D 
Sbjct  535   QAQVEGKMVWLGNQRWLEDQGLSLDKNHDKLIGSLNRAGKTVVYLGIEGSIQGVLALKDN  594

Query  1379  LREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGL  1200
             LR DA+  V  L K+G+   LL+GD    A+ +AS VGI +  V   + P  K+  V  L
Sbjct  595   LRTDAQKTVSKLQKRGLEVILLTGDHPEVAQAIASQVGITQ--VLAEIPPSGKAAVVEEL  652

Query  1199  QKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSR  1020
             QK +K VAMVGDGINDA ALA + +G+++ G    A + + +VLM N+L  ++ A++LS 
Sbjct  653   QKSKK-VAMVGDGINDAPALAQADLGISLQGATEVAMETADIVLMSNQLWDVITAMDLSL  711

Query  1019  LTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLR  840
              T + ++QNL WA GYN   +P+AAG+LLP  G ML+P++A   M  SS+ V+TNSLLLR
Sbjct  712   GTFRKIRQNLMWALGYNTFAIPMAAGVLLPSLGLMLSPAMAAGFMAFSSVTVVTNSLLLR  771

Query  839   LK  834
              +
Sbjct  772   YR  773



>ref|WP_021835334.1| cation-transporting P-type ATPase [Crocosphaera watsonii]
 emb|CCQ61453.1| cation-transporting P-type ATPase [Crocosphaera watsonii WH 0401]
Length=783

 Score =   523 bits (1347),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 323/782 (41%), Positives = 482/782 (62%), Gaps = 46/782 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQL--GEELAKH  2970
             GM C GC ++V++ L  Q  V SA VNL TE AV+          N++ Q    E LA+ 
Sbjct  26    GMKCAGCVSAVEKQLTQQSGVVSACVNLITEVAVI----------NYEPQTVQAETLAEK  75

Query  2969  LTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
             LT  GF +++R S+     +    +   + A+ +     L  +  L     +GHL HF G
Sbjct  76    LTKIGFTSDIRTSQTLTPQQIHFNQSQRREAEARQQKINLITAAILLIFSALGHLEHFGG  135

Query  2789  AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
                  + ++   GFH  +    LL+PGR++IIDG ++L  G  NMNTLVGLG LS++  S
Sbjct  136   PN---LPIISGLGFHWGLATMALLIPGREVIIDGWRALSHGMANMNTLVGLGTLSAYITS  192

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
              +A   P LGW+ FF+EPVML+ F+LLGR LE++A+ +A+S +  L+ + PS ARLV   
Sbjct  193   CVAFLFPILGWECFFDEPVMLLGFILLGRTLEKQARNRASSALEALIALQPSLARLV-GD  251

Query  2429  DMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPG  2250
                E +S++E+P   + VG+ + +LPG++IP DG +  G++ +DES  TGE LP+ K PG
Sbjct  252   PFSEDSSSIEIPVEQVRVGEYVKILPGEKIPVDGEIITGKTAIDESLVTGESLPIAKNPG  311

Query  2249  AQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVM  2070
              +  AG++N +G++T++    G +T +  I+  VE AQ+R+AP+Q+LAD V+G+F YGVM
Sbjct  312   DRAIAGTLNHSGLITLKTTEVGEDTTLAQIIASVETAQTRKAPIQQLADTVAGYFAYGVM  371

Query  2069  ALSAATFMFWNLFGTRVLPATLH------QGslaslalqlscsvlvvaCPCALGLATPTA  1908
              L++ TF+FW +FGT   P  L+        S   L+L+L+ +VLV+ACPCALGLATPTA
Sbjct  372   VLASLTFLFWYIFGTHWYPQVLNLDSLGMSSSPLLLSLKLAIAVLVIACPCALGLATPTA  431

Query  1907  VMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAK  1728
             ++VGTS+G+ RGLL++GG VLE    +  ++FDKTGTLT+G PTVT+ +  G     + K
Sbjct  432   ILVGTSMGSERGLLIKGGDVLEKVHQLEGVIFDKTGTLTVGHPTVTDCISWG-----DIK  486

Query  1727  RDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGA  1548
              +S          +L LA+ VES TNHP+G AI+E A+ +   ++ A D  F  E GSG 
Sbjct  487   PES----------LLQLAATVESGTNHPLGLAILEKAQQQELPLLSARD--FYTEAGSGV  534

Query  1547  MAVIEEKKVSVGTLDWVRRHGVGETRVQE----FDDFKNQSVVYVGVDGVLAGLIYVEDQ  1380
              A +E K V +G   W+   G+   +  +      +   ++VVY+G++G + G++ ++D 
Sbjct  535   QAQVEGKMVWLGNQRWLEDQGLSLDKNHDKLIGSLNRAGKTVVYLGIEGSIQGVLALKDN  594

Query  1379  LREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGL  1200
             LR DA+  V  L K+G+   LL+GD    A+ +AS VGI +  V   + P  K+  V  L
Sbjct  595   LRTDAQKTVSELQKRGLEVILLTGDHPEVAQAIASQVGITQ--VLAEIPPSGKAAVVEEL  652

Query  1199  QKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSR  1020
             QK +K VAMVGDGINDA ALA + +G+++ G    A + + +VLM N+L  ++ A++LS 
Sbjct  653   QKSKK-VAMVGDGINDAPALAQADLGISLQGATEVAMETADIVLMSNQLWDVITAMDLSL  711

Query  1019  LTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLR  840
              T + ++QNL WA GYN   +P+AAG+LLP  G ML+P++A   M  SS+ V+TNSLLLR
Sbjct  712   GTFRKIRQNLMWALGYNTFAIPMAAGVLLPSLGLMLSPAMAAGFMAFSSVTVVTNSLLLR  771

Query  839   LK  834
              +
Sbjct  772   YR  773



>gb|AAP55720.1| Paa2 P-type ATPase [Arabidopsis thaliana]
Length=883

 Score =   526 bits (1354),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 349/821 (43%), Positives = 495/821 (60%), Gaps = 69/821 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A VK +L S  RV+SA VN+ TETA V    E +V  +      E LAK LT
Sbjct  84    GMMCGGCVARVKSVLMSDDRVASAVVNMLTETAAVKFKPEVEVTAD----TAESLAKRLT  139

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
               GF+A  R S     EN+ +   K+M +K+  L    R  +A +W L A+C   H SH 
Sbjct  140   ESGFEAKRRVSGMGVAENVKKW--KEMVSKKEDLLVKSRNRVAFAWTLVALCCGSHTSHI  197

Query  2795  FGAKASWI------HLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
               +    I       LLH++     + +  LL PGR+L+ DG+K+  K +PNMN+LVGLG
Sbjct  198   LHSLGIHIAHGGIWDLLHNSYVKGGLAVGALLGPGRELLFDGIKAFGKRSPNMNSLVGLG  257

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F++S ++   P+L W A FF+EPVML+ FVLLGR+LE+RAK++A++DM   L+++ 
Sbjct  258   SMAAFSISLISLVNPELEWDASFFDEPVMLLGFVLLGRSLEERAKLQASTDMNEPLSLIS  317

Query  2456  SKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+ S          +   +  + V   ++ VGD ++VLPG+  P DG V AGRS 
Sbjct  318   TQSRLVITSSDNNTPVDSVLSSDSICINVSVDDIRVGDSLLVLPGETFPVDGSVLAGRSV  377

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V+AG+IN +G L ++    G  + I  IVR+VE+AQ   A
Sbjct  378   VDESMLTGESLPVFKEEGCSVSAGTINWDGPLRIKASSTGSNSTISKIVRMVEDAQGNAA  437

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+L+L+ 
Sbjct  438   PVQRLADAIAGPFVYTIMSLSAMTFAFWYYVGSHIFPDVLLNDIAGPDGDALALSLKLAV  497

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + ++ +  DKTGTLT GR
Sbjct  498   DVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASIDCVALDKTGTLTEGR  557

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V+ V   G+ ++                +VL +A+ VE    HPI KAIV  A+S N 
Sbjct  558   PVVSGVASLGYEEQ----------------EVLKMAAAVEKTATHPIAKAIVNEAESLNL  601

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV------RRHGVGETRVQEFDDFK--  1446
             +    E    + EPG G +A I+ + V+VG+L+WV      +       +++   D K  
Sbjct  602   K--TPETRGQLTEPGFGTLAEIDGRFVAVGSLEWVSDRFLKKNDSSDMVKLESLLDHKLS  659

Query  1445  --------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
                     +++VVYVG +G  + G I + D LR+DA   V  L ++GI T LLSGD++ A
Sbjct  660   NTSSTSRYSKTVVYVGREGEGIIGAIAISDCLRQDAEFTVARLQEKGIKTVLLSGDREGA  719

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--gv  1119
                VA  VGI  E+  Y + P++K +F+S LQ     VAMVGDGINDA +LA + V   +
Sbjct  720   VATVAKNVGIKSESTNYSLSPEKKFEFISNLQSSGHRVAMVGDGINDAPSLAQADVGIAL  779

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
              I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P+AAG+
Sbjct  780   KIEAQENAASNAASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIPIAAGV  839

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             LLP     +TPS++G LM LSSI V++NSLLL+L  +   K
Sbjct  840   LLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQLHKSETSK  880



>ref|XP_006474499.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006474500.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
isoform X2 [Citrus sinensis]
 ref|XP_006474501.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=887

 Score =   526 bits (1354),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 356/828 (43%), Positives = 494/828 (60%), Gaps = 75/828 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVV-WPVSEAKVVPNWQQQLGEELAKHL  2967
             GM CGGC A VK +L +  RV S +VN+ TETA +       +        + E L K L
Sbjct  80    GMMCGGCVARVKSVLTADDRVDSVAVNMLTETAAIKLRTEVVEESEEVVNNVAESLGKRL  139

Query  2966  TSCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSH  2799
               CGF+A  R S     EN+ +   K++  KR  L    R  +A++W L A+C   H SH
Sbjct  140   MECGFEAKRRVSGTGVAENVKKW--KELAKKREDLLVKSRNRVALAWTLVALCCGSHASH  197

Query  2798  FFGAKASWIHLLHSTGFHM--------SMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLV  2643
                + +  IH+ H   + +           L  L+ PGR L+ DGL++  KG+PNMN+LV
Sbjct  198   I--SHSLGIHIAHGPLWELLDNSYVKGGFALGALIGPGRDLLSDGLRAFRKGSPNMNSLV  255

Query  2642  GLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLN  2466
             G G++ +F +S ++   P+L W A FFEEPVML+ FVLLGR+LE+RA+I+A+SDM  LL+
Sbjct  256   GFGSIVAFLISLVSLLKPELDWDASFFEEPVMLLGFVLLGRSLEERARIRASSDMNELLS  315

Query  2465  VLPSKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAG  2313
             ++ +++RLV+ S          +      VEVP  ++ VGD ++VLPG+ IP DG V AG
Sbjct  316   LVSTQSRLVITSSESGSSADNVLCSDAICVEVPTDDIRVGDSVLVLPGETIPVDGRVLAG  375

Query  2312  RSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQS  2133
             RS VDES  +GE LPV K  G  V+AG+IN +G L +E    G  + I  IV +VEEAQ 
Sbjct  376   RSVVDESMLSGESLPVFKEEGFTVSAGTINWDGPLRIEACSTGSNSMISKIVSMVEEAQG  435

Query  2132  REAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalq  1971
             REAP+QRLAD ++G F Y VM LSAATF FW   G+++ P  L        G+   L+L+
Sbjct  436   REAPIQRLADAIAGPFVYSVMTLSAATFAFWYYIGSQIFPDVLLSDMAGPNGNPLLLSLK  495

Query  1970  lscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLT  1791
             LS  VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + ++ +  DKTGTLT
Sbjct  496   LSVDVLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLARIDYLALDKTGTLT  555

Query  1790  IGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKS  1611
              G+P V  V                ++  + E ++L +A+ VE    HPI KAIV  A+S
Sbjct  556   EGKPAVFNV----------------ASFVYDESEILKIAAAVEKTATHPIAKAIVNKAES  599

Query  1610  RNCR--IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV--RRHGVGE-TRVQEFDDF-  1449
              N    I + +    + EPG G +  ++ + V+VGTL+WV  R    G+ + VQ  +   
Sbjct  600   LNLTSPITRGQ----LAEPGFGILGEVDGRLVAVGTLEWVYERFQKQGDHSDVQHLEHAV  655

Query  1448  ------------KNQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSG  1308
                          ++SVVYVG +G  + G I + D LR DA H V SL ++GI T LLSG
Sbjct  656   THQSSELASPSNYSKSVVYVGREGEGIIGAIAISDSLRHDAEHTVRSLQQKGIKTLLLSG  715

Query  1307  DKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALas  1134
             D++ A    A  VGI +E +   + P +KS+ +S LQ     VAMVGDGINDA   ALA 
Sbjct  716   DREEAVAATAKEVGIGKEYINSSLTPQQKSEVISTLQTSGHHVAMVGDGINDAPSLALAD  775

Query  1133  shvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLP  954
               + + I     AAS  +S++L+ N+LSQ++DAL+L++ TM  V QNL WA  YN+V +P
Sbjct  776   VGIALQIEAQENAASTAASIILLGNKLSQVVDALDLAKATMAKVYQNLSWAVAYNVVAIP  835

Query  953   VAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL-KFASKQKE  813
             +AAG LLP     +TPS++G LM LSSI V++NSLLL+  +F S +K+
Sbjct  836   IAAGALLPQYEFAMTPSLSGGLMALSSIFVVSNSLLLQFHEFESNKKK  883



>ref|WP_015203177.1| heavy metal translocating P-type ATPase [Crinalium epipsammum]
 ref|YP_007142571.1| heavy metal translocating P-type ATPase [Crinalium epipsammum 
PCC 9333]
 gb|AFZ13061.1| heavy metal translocating P-type ATPase [Crinalium epipsammum 
PCC 9333]
Length=786

 Score =   521 bits (1342),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 341/788 (43%), Positives = 482/788 (61%), Gaps = 44/788 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L SQ  V +A VNL TE AVV       V P+        LA  LT
Sbjct  25    GMKCAGCVKAVERQLSSQSGVLNACVNLLTEVAVV-ECEVGTVNPD-------TLADKLT  76

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQ---LQASGRGLAVSWALCAVCLVGHLSHFF  2793
             S GF    R ++ + L  T      ++R Q    Q  GR L V+  L  +  +GH S+  
Sbjct  77    STGFPTQPRYAQGQ-LAGTNTSITPSQRHQQESYQLLGR-LIVAGILLVLSGIGHFSYHA  134

Query  2792  GAKAS------WIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGA  2631
                AS      +   L S  FH  +    LL PGR +++DG + L  G PNMNTLVGLG 
Sbjct  135   SHLASHPSPSPYTSFLVSIWFHWGLATLALLAPGRSMLVDGWRGLRHGMPNMNTLVGLGT  194

Query  2630  LSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSK  2451
             L+++  S +A   P+LGW+ FF+EPVML+ F+LLGR LEQ+A+ +A++    LL + P  
Sbjct  195   LTAYTASVVALLFPQLGWECFFDEPVMLVGFILLGRTLEQQARHRASAAFEALLALQPKV  254

Query  2450  ARLVVNS-DMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEP  2274
             ARL+  S  +  +   +E+P   + VG+ + VLPG++IP DG V  G++ VDES  TGEP
Sbjct  255   ARLIGKSAPVNFEQPGIEIPVEQVRVGEWLRVLPGEKIPVDGEVCDGKTAVDESMLTGEP  314

Query  2273  LPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVS  2094
             +PV K  G  VAAG++N +G++T++  R G +T +  IV +VEEAQ+R+APVQRL D V+
Sbjct  315   MPVVKQAGDLVAAGTLNQSGVITLQATRTGKDTTLAQIVAMVEEAQTRKAPVQRLVDTVA  374

Query  2093  GHFTYGVMALSAATFMFWNLFGTRV-LPATLHQGslaslalqlscsvlvvaCPCALGLAT  1917
             G+FTYGVMA+++ TF+FW   GT     + L   S   L+L+L+ +VLVVACPCALGLAT
Sbjct  375   GYFTYGVMAIASITFLFWYFIGTHFDHSSLLTPPSSLLLSLKLAIAVLVVACPCALGLAT  434

Query  1916  PTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTE-VVPQGHNDE  1740
             PTA++VGTS+GA +GLL++GG +LE    +NT+VFDKTGTLT G+P VT+ VVP+  + E
Sbjct  435   PTAILVGTSIGAEKGLLIKGGDILEKVHKLNTVVFDKTGTLTSGKPRVTDCVVPEQSDIE  494

Query  1739  TNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEP  1560
                           E  ++ LA+  ES T HP+  AI + A+     I  A+D     E 
Sbjct  495   --------------ESYIMQLAAAAESGTCHPLALAIGQEAQRLELTIPSAQD--CYTEA  538

Query  1559  GSGAMAVIEEKKVSVGTLDWVRRHGVG-----ETRVQEFDDFKNQSVVYVGVDGVLAGLI  1395
             G G  A++  K+V +G  DW++   +      E + Q   D   ++VVY+ VDGV+AGLI
Sbjct  539   GLGVSALVTGKRVLLGNGDWLKLQQITISDDWEAKAQALSD-AGKTVVYIAVDGVIAGLI  597

Query  1394  YVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSK  1215
              V D LR DA+  VE L K G+   +L+GD+   A  +A+ + I  + +  G++P+ K+ 
Sbjct  598   AVTDTLRADAKETVERLQKMGLRVIILTGDRLEVANAIATQLEINFDQIVAGIRPEGKAS  657

Query  1214  FVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDA  1035
              ++ LQ     VAMVGDGINDA ALA + VG+++ G    A + + +VLM++RL   + A
Sbjct  658   AIANLQAQGYRVAMVGDGINDAPALAQADVGISLHGSTDVAMETAGIVLMRSRLLDAVAA  717

Query  1034  LELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTN  855
             ++LSR T   V+QNL+WA GYN++ +PVAAG+ LP  G +L+P+ AGALM  SS+ V+TN
Sbjct  718   IQLSRATFNKVRQNLFWALGYNVLAIPVAAGLFLPSLGILLSPASAGALMAFSSVSVVTN  777

Query  854   SLLLRLKF  831
             SLLLR  F
Sbjct  778   SLLLRRSF  785



>ref|WP_038298393.1| hypothetical protein, partial [[Scytonema hofmanni] UTEX B 1581]
Length=823

 Score =   521 bits (1343),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 340/814 (42%), Positives = 484/814 (59%), Gaps = 65/814 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L   P V SA VNL TE AVV   SE   V          LAK LT
Sbjct  26    GMKCAGCVKAVERQLIEHPGVKSACVNLATEVAVV--ESEVGAVDRL------ALAKRLT  77

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF    R +  +   E   K+   +R ++++S R LA++  L  +  +GH  H  G+ 
Sbjct  78    DAGFPTQPRQAGNKQDDENPAKR---QRQEMRSSLRQLAIATTLLILSGIGHFGHMTGS-  133

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                +  L +   H  +   +LL+PGR +++DG +   + APNMNTLVGLG L+++  S +
Sbjct  134   ---MQPLDNIWLHCGLATVSLLIPGRPILVDGWRGWRRNAPNMNTLVGLGTLTAYTASLV  190

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD-  2427
             A   P++GW  FF+EPVM+I F+LLGR LE+ A+ +A +    LL + P  ARL+ N + 
Sbjct  191   ALLFPQMGWDCFFDEPVMMIGFILLGRTLERYARGRAAAAFRKLLALQPQIARLIANPEK  250

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
              G  +  VE+P   + VG+ + VLPGD++P DG V  G++TVDES  TGE +PV K  G 
Sbjct  251   AGANSPAVEIPAEQVRVGEWLQVLPGDKMPVDGKVMVGQTTVDESMLTGEAVPVIKQVGD  310

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
              V AG++N +G + ++  R G +T +  IV LVE+AQ+R+APVQ+LAD V+G+FTYGV+ 
Sbjct  311   VVTAGTLNQSGAIAIQATRTGNDTTLAQIVALVEDAQTRKAPVQKLADTVAGYFTYGVLT  370

Query  2066  LSAATFMFWNLFGTRVLPAT----LHQGslaslalql--------scsvlvvaCPCALGL  1923
              +  TF FW LFGT +         H G                 + +V+VVACPCALGL
Sbjct  371   AAVLTFGFWYLFGTHIWQNVNMDMFHHGQSYPAPAMSGLLLSLKLAIAVMVVACPCALGL  430

Query  1922  ATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTE-VVPQGHN  1746
             ATPTA++VGT +GA RGLL++GG VLE    ++TIVFDKTGTLT G PTVT+ +V +   
Sbjct  431   ATPTAILVGTGIGAERGLLIKGGDVLERVHQLDTIVFDKTGTLTTGNPTVTDCLVIKVEE  490

Query  1745  DET-----NAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAED  1581
             D+       + RD+ +    S   ++ LA+ VES T HP+ KAI + A+ +   I  A+D
Sbjct  491   DKKVISSPYSCRDAINRV--STYSLIQLAAAVESGTCHPLAKAIQQEAQQQQLSIPDAKD  548

Query  1580  GTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHG--VGETRVQEFDDF--KNQSVVYVGVDG  1413
               F  EPG G  AV+E   V +G  DW+   G  + ET  Q  ++     ++VVYV ++G
Sbjct  549   --FYTEPGLGVSAVVEGTSVILGNSDWLSWQGISISETASQMAEELAANGKTVVYVALEG  606

Query  1412  VLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVK  1233
             +L+GLI V+D LR DA+  V+ L   G+   LLSGD+  AA  +A  +G+  ENV  GV 
Sbjct  607   ILSGLIAVQDTLRPDAKAAVDKLRLMGLRVMLLSGDRLEAASAIAKQLGLDSENVMAGVP  666

Query  1232  PDEKSKFVSGLQKDQK-----------------------VVAMVGDGINDAAALasshvg  1122
             P +K+  +  LQK  K                       +VAMVGDGINDA AL+ + VG
Sbjct  667   PSKKAAAIEALQKGDKGTRDWGLRKLIPNHQSPLPTPHSLVAMVGDGINDAPALSQADVG  726

Query  1121  vaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAG  942
             +A+  G   A + + +VLM++RL+ ++++++LSR T   ++QNL+WAF YN +G+P+AAG
Sbjct  727   IALHSGTDVAMETAEIVLMRDRLTDVVESIQLSRATFNKIRQNLFWAFAYNTLGIPLAAG  786

Query  941   ILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLR  840
             +L P  G +L+PS A ALM  SS+ V+TNSLLLR
Sbjct  787   VLFPSFGFVLSPSGAAALMAFSSVSVVTNSLLLR  820



>ref|XP_007199846.1| hypothetical protein PRUPE_ppa006208mg [Prunus persica]
 gb|EMJ01045.1| hypothetical protein PRUPE_ppa006208mg [Prunus persica]
Length=422

 Score =   506 bits (1304),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 307/421 (73%), Positives = 349/421 (83%), Gaps = 19/421 (5%)
 Frame = -2

Query  2072  MALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgt  1893
             M LSAATF+FW+L G  +LPA  H G+  SLALQLSCSVLVVACPCALGLATPTAV+VGT
Sbjct  1     MTLSAATFLFWSLIGGHILPAAFHGGNSVSLALQLSCSVLVVACPCALGLATPTAVLVGT  60

Query  1892  slgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTS  1713
             SLGA RGLLLRGG++LE FSMVNTIVFDKTGTLT+G+P VT+++                
Sbjct  61    SLGAKRGLLLRGGNILEKFSMVNTIVFDKTGTLTMGKPVVTKILT---------------  105

Query  1712  TCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIE  1533
                  E+DVL  A+GVESNT HP+GKAIVEAA++ NC  +K  DGTF+EEPGSGA+A IE
Sbjct  106   ----PELDVLKFAAGVESNTVHPVGKAIVEAAQAVNCHNMKIVDGTFLEEPGSGAVATIE  161

Query  1532  EKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVV  1353
              KKVS+GTLDWVRRHGV E   QE +  K+QSVVYVG+D  LAGLI  EDQ+REDA  VV
Sbjct  162   NKKVSIGTLDWVRRHGVNENPFQEVEAHKSQSVVYVGIDSTLAGLICFEDQIREDAGQVV  221

Query  1352  ESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAM  1173
             +SLSKQGI  Y+LSGDK+N AEYVASVVGIP+E V  GVKP EK KF++ LQKDQ +VAM
Sbjct  222   KSLSKQGINVYMLSGDKRNNAEYVASVVGIPKEKVISGVKPREKKKFITELQKDQNIVAM  281

Query  1172  VGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQN  993
             VGDGINDAAALASSHVG+A+GGGVGAAS+VSS+VL+ NRLSQ+LDALELSRLTMKTVKQN
Sbjct  282   VGDGINDAAALASSHVGIAMGGGVGAASEVSSIVLLGNRLSQVLDALELSRLTMKTVKQN  341

Query  992   LWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             LWWAF YNIVGLP+AAG+LLP TGTMLTPSIAGALMGLSS+GVM NSLLLR KF+SKQ E
Sbjct  342   LWWAFAYNIVGLPIAAGVLLPVTGTMLTPSIAGALMGLSSVGVMANSLLLRYKFSSKQGE  401

Query  812   I  810
             I
Sbjct  402   I  402



>ref|WP_015226316.1| heavy metal translocating P-type ATPase [Halothece sp. PCC 7418]
 ref|YP_007168655.1| heavy metal translocating P-type ATPase [Halothece sp. PCC 7418]
 gb|AFZ44441.1| heavy metal translocating P-type ATPase [Halothece sp. PCC 7418]
Length=770

 Score =   518 bits (1333),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 326/784 (42%), Positives = 482/784 (61%), Gaps = 44/784 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R +E +  V +A VNL T TAVV    E +V P+       E+A  LT
Sbjct  25    GMKCAGCVSAVERQIEQRDGVIAAQVNLVTATAVVQYEPE-QVNPD-------EIAAQLT  76

Query  2963  SCGFKANVRDSRRENLFETFE-KKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             + GF +   D+  EN  +T+E K+  A R  LQ     LA++  L  +  +GHL HF G 
Sbjct  77    AKGFPSQRHDTDEENTAQTYEEKRQQADRENLQK----LAIAAVLIILSALGHLKHFTGF  132

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
                 +  L +  FH  +    LL PGR++IIDG K L    PNMN+L+ LG LS++  S 
Sbjct  133   H---VPFLSNIWFHWGLATLALLFPGREIIIDGAKGLWSRVPNMNSLIALGTLSAYIASC  189

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
              A   P+LGW+ FF+EPVML+ F+LLGR LEQRA+ +A + ++ L+++ P  ARLV N+ 
Sbjct  190   TALVFPQLGWECFFDEPVMLLGFILLGRTLEQRARGEAGAALSALISLKPQTARLVKNTS  249

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               E   ++EVP + +  G  + VLPG++IP DG +  G +T+DES  TGE +PV K    
Sbjct  250   -NENEKSMEVPVTTVQGGQWLRVLPGEKIPVDGEIVTGETTIDESMLTGESVPVAKTEAD  308

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
              V AG++NL G++T++  + G +T +  I+  VE AQ R+APVQ+LAD+V+G+F YGVMA
Sbjct  309   VVKAGTLNLTGVITLQATQVGKDTTLAKIIASVENAQMRKAPVQKLADQVAGYFAYGVMA  368

Query  2066  LSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtsl  1887
             ++  TF+FW   GT V      + S   L+L+L  +VLV+ACPCALGLATPTA++VGT +
Sbjct  369   VATLTFLFWYFIGTNVWIDVTAETSPLLLSLKLMIAVLVIACPCALGLATPTAILVGTGI  428

Query  1886  gatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTC  1707
             GA +GLLL+GG VLE+   ++T+VFDKTGTLT G+P VT+                 +T 
Sbjct  429   GAKQGLLLKGGDVLENVHRLDTLVFDKTGTLTEGQPKVTDYF-------------GVATP  475

Query  1706  EWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC-RIVKAEDGTFIEEPGSGAMAVIEE  1530
             +  E  +L  A+  E+ TNHP+  AIV AA+ +   R+  +E  T   + GSG +A +E+
Sbjct  476   DIEEETLLQFAASAEAGTNHPLASAIVNAAQDKGISRLPVSESQT---KAGSGVVATVEQ  532

Query  1529  KKVSVGTLDWVRRHGV----GETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDAR  1362
             ++++VG   W+    +       +  +  +   ++VVYV ++G LAGL+ ++D LR DA 
Sbjct  533   QQIAVGNEKWLHSQDIKIPSAIAQQAQQLEAAGKTVVYVAINGALAGLMALKDCLRPDAV  592

Query  1361  HVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKV  1182
               V  L K G    LL+GD +     +A  + +  ++VF  V P+EK++ +  LQ+    
Sbjct  593   ATVSKLQKMGFQVILLTGDNQRVGSAIAQQLNLSSDHVFAEVHPEEKAQVIKSLQEKGYK  652

Query  1181  VAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTV  1002
             V MVGDGINDA ALA + VG+AI  G   A + +S+VLM++R+  ++ A+ LS  T+  +
Sbjct  653   VGMVGDGINDAPALAQADVGIAIAQGTEVALETASIVLMRDRVGDVITAVRLSLATLNKI  712

Query  1001  KQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASK  822
             +QNL+WA GYN++ +P+AAG+LLP    +L+P+IA   M LSS+ V+TNS+LL      K
Sbjct  713   RQNLFWALGYNVITIPLAAGVLLPKYDILLSPAIAAGFMALSSVIVVTNSVLL------K  766

Query  821   QKEI  810
             Q+EI
Sbjct  767   QQEI  770



>gb|EYU20293.1| hypothetical protein MIMGU_mgv1a001497mg [Erythranthe guttata]
Length=808

 Score =   518 bits (1335),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 347/831 (42%), Positives = 489/831 (59%), Gaps = 87/831 (10%)
 Frame = -2

Query  3140  MTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGE-------E  2982
             M CG C   VK I+ +  RV+S  VN+ TETA +            ++ LGE       E
Sbjct  1     MMCGACVTRVKSIVSADERVASVVVNMLTETAAI----------KLKEGLGEDFAGVADE  50

Query  2981  LAKHLTSCGFKANVR------DSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVC  2820
             LA  +++ GF A  R      +++     ET EKK     A L  S   +A +W L A+C
Sbjct  51    LANRVSASGFDARRRVSGLGVEAKVWKWRETVEKK----DALLIKSRNRVAFAWTLVALC  106

Query  2819  LVGHLSHFFGA------KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPN  2658
                H SH   +        S + +LH++     + L +LL PGR L+ DGL++  KG+PN
Sbjct  107   CGSHGSHILHSVGIHIGHGSLLDILHNSYVKGGLALGSLLGPGRDLLFDGLRAFRKGSPN  166

Query  2657  MNTLVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDM  2481
             MN+LVG G++++F +S+++ F P+L W A FF+EPVML+ F+LLGR+LE+RA+IKA+SDM
Sbjct  167   MNSLVGFGSIAAFGISAVSLFNPELQWNATFFDEPVMLLGFILLGRSLEERARIKASSDM  226

Query  2480  TGLLNVLPSKARLVVNSDMGEQTST----------VEVPCSNLSVGDQIIVLPGDRIPAD  2331
               LL+++ +K+RLV+    G   S           +EVP  ++ VGD ++VLPG+ IP D
Sbjct  227   NELLSLISTKSRLVIAPSGGSDVSAENVLCTDAMCIEVPTDDIRVGDSLLVLPGETIPVD  286

Query  2330  GIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRL  2151
             G V AGRS VDES  TGE LPV K  G  V+AG++N +G L +E    G  + I  IV +
Sbjct  287   GKVMAGRSVVDESMLTGESLPVFKEKGLSVSAGTLNWDGPLRIEASSTGSNSTISKIVNM  346

Query  2150  VEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGsl  1989
             VE+AQ REAP+QRLAD ++G F + VM +SAATF FW   GT + P  L        G+ 
Sbjct  347   VEDAQGREAPIQRLADSIAGPFVFSVMTMSAATFAFWYYIGTHIFPDVLLNDIAGPDGNS  406

Query  1988  aslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFD  1809
               L+++L+  VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + ++ I  D
Sbjct  407   LLLSMKLAVDVLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLAGIDYITLD  466

Query  1808  KTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAI  1629
             KTGTLT GRP V+ V   GH                 E ++L +A+ VE   +HP+  AI
Sbjct  467   KTGTLTEGRPAVSAVASLGHE----------------ESEILKIAAAVEKTASHPLANAI  510

Query  1628  VEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDF  1449
             +  A+S N  I        + EPGSG +A +    V+VG L WVR     +T + +    
Sbjct  511   IAKAESLNLNIPSTRGQ--LAEPGSGTLAEVNGLLVAVGKLSWVRERFQPKTSLSDIKRL  568

Query  1448  K----------------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTY  1320
             +                ++++VYVG +G  + G I + D LR DA   V  L + GI T 
Sbjct  569   EQTAILQSSAEYSSSNYSRTIVYVGREGEGVIGAIAISDNLRCDAESTVNRLQQMGICTV  628

Query  1319  LLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--  1146
             LLSGD++ A   +A  VG+  E V   + P +KS  +S LQ     VAMVGDGINDA   
Sbjct  629   LLSGDREEAVAEIAKTVGVENEFVNGSLTPQQKSGVISNLQASGHRVAMVGDGINDAPSL  688

Query  1145  ALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNI  966
             ALA   + + I G   AAS+ +S++L+ NRLSQ+++A++L+R TM  V+QNL WA  YN+
Sbjct  689   ALADVGIALQIEGQENAASNAASIILLGNRLSQVVEAIDLARATMTKVRQNLTWAVAYNV  748

Query  965   VGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             V +P+AAG+LLP     +TPS++G +M +SSI V++NSLLL+     K+KE
Sbjct  749   VAIPMAAGVLLPHFDFAMTPSLSGGMMAMSSILVVSNSLLLQFHKPQKKKE  799



>ref|WP_016872375.1| ATPase [Chlorogloeopsis fritschii]
Length=804

 Score =   518 bits (1334),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 340/805 (42%), Positives = 482/805 (60%), Gaps = 57/805 (7%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC  +V+R L   P V +A VNL TE AVV   SE  VV        + LAK L
Sbjct  25    GGMKCAGCVKAVERQLAQYPGVKNACVNLATEVAVVE--SEIGVVEP------DALAKQL  76

Query  2966  TSCGFKANVRDSRRENLFETF-EKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
             T+ GF +  R S  +    T  +     +R ++ ++ R L ++  L  +  +GH  +F G
Sbjct  77    TAAGFPSQPRQSDEKLTDRTLLQDPAQQQRQEMLSARRQLVIATVLLVLSGIGHFGNFSG  136

Query  2789  AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
             A    +  LH+  FH  +    LL+PGR +IIDG     + APNMNTLVGLG L+++  S
Sbjct  137   A---LLPGLHNIWFHFGLATAALLIPGRSIIIDGWLGWRRNAPNMNTLVGLGTLTAYIAS  193

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
              +A   P+LGW+ FF+EPVM++ F+LLGR LE++A+ +A +    LL++ P  ARL+   
Sbjct  194   LVALLFPQLGWECFFDEPVMMLGFILLGRTLEKQARGRAAAAFKQLLDLQPQVARLLSKP  253

Query  2429  DM-GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLP  2253
              + GE    +E+P   + VG+ + VLPGD+IP DG+V  G++T+DES  TGE +PV K  
Sbjct  254   KIAGEVGEILEIPADRVRVGEWLQVLPGDKIPVDGVVVDGQTTIDESMLTGESVPVLKQN  313

Query  2252  GAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGV  2073
             G  V AG+IN +G + +E  R G +T +  IV LVE AQ R+APVQ+LAD ++G+FTYGV
Sbjct  314   GDTVTAGTINQSGAIALEATRTGSDTTLAQIVALVEAAQIRKAPVQKLADTIAGYFTYGV  373

Query  2072  MALSAATFMFWNLFGTRVLP---------ATLH-------QGslaslalqlscsvlvvaC  1941
             +  +  TF+FW   GT + P          T H         S   L+L+L+ SV+VVAC
Sbjct  374   LTAALLTFLFWYFIGTNIWPDIAMSTGMDMTHHLSTKLPTHHSPLLLSLKLAISVMVVAC  433

Query  1940  PCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTE-V  1764
             PCALGLATPTA++VGT++ A +G+L++GG VLE    +NTIVFDKTGTLT G P VT+ +
Sbjct  434   PCALGLATPTAILVGTAIAAEQGILIKGGDVLEKVHQLNTIVFDKTGTLTTGNPIVTDCL  493

Query  1763  VPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAE  1584
             V +  N  +N++             +L LA+ VES T HP+  AI + A+ +   +   +
Sbjct  494   VLEEPNPVSNSQH------------LLQLAAAVESGTCHPLATAIRKEAQRQQLSVPSGD  541

Query  1583  DGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVG--ETRVQEFDDF--KNQSVVYVGVD  1416
                F  EPG G  AV+E   V +G  DW+  HG+   ET            ++VV V V 
Sbjct  542   --RFYTEPGLGVSAVVEGNLVLLGNWDWLLVHGISIDETAQNTAQALAADGKTVVGVAVG  599

Query  1415  GVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGV  1236
               +AGLI V+D LR DA+  V++L + G+   LLSGD   AA  +A  +G+   +V  GV
Sbjct  600   EKIAGLIAVQDTLRPDAKLAVDNLHRMGLRVMLLSGDTPAAAFAIAEQLGLNPNDVMAGV  659

Query  1235  KPDEKSKFVSGLQ--------KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvs  1080
              P +K+  +  LQ          Q VVAMVGDGINDA AL+ + +G+A+  G   A + +
Sbjct  660   PPAKKADVIKSLQAPEIGKIPNSQSVVAMVGDGINDAPALSQADIGIALHAGTDVAMETA  719

Query  1079  svVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSI  900
              +VLM+N L+ ++ +++LSR T  T++QNL+WAF YN +G+P+AAGILLP    +L P+ 
Sbjct  720   DIVLMRNSLTDVVKSIQLSRATFNTIRQNLFWAFAYNTLGIPLAAGILLPSLHFVLNPAG  779

Query  899   AGALMGLSSIGVMTNSLLLRLKFAS  825
             A ALM  SS+ V+TNSLLLR +FAS
Sbjct  780   AAALMAFSSVSVVTNSLLLR-RFAS  803



>ref|WP_035736254.1| ATPase [Arthrospira platensis]
Length=787

 Score =   517 bits (1332),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 331/793 (42%), Positives = 479/793 (60%), Gaps = 55/793 (7%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC  +V+R L  QP V +  VNL TE A V       V P       ++LA  L
Sbjct  28    GGMKCAGCVMAVERQLNQQPGVIAVRVNLATEVATV-ECEPGTVDP-------QKLADIL  79

Query  2966  TSCGFKANVRDSRRENLFETF-EKKMNAKRAQLQASGRGLAVSWALCAVCL-VGHLSHFF  2793
             T  GF + +R     N   TF E+     R Q+   GR +     +C V + +  + HF 
Sbjct  80    TETGFNSQLRYGSAANQKLTFKERHRQEMRDQI---GRVV-----ICGVLIFLSGIGHFH  131

Query  2792  GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAV  2613
                   I ++ +  FH  +    LL PGR LI+DG++SL + APNMNTLVGLG +S++  
Sbjct  132   QMGWGPIPVVSNIWFHWGLATLALLFPGRSLIVDGVRSLARNAPNMNTLVGLGTISAYTA  191

Query  2612  SSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVN  2433
             S +A   P+LGW+ FF+EPVML+ F+LLG+ LEQ+A+ +A      L  + P+ A+++++
Sbjct  192   SLVALLFPRLGWQCFFDEPVMLLGFILLGKTLEQQARFRAAQAFESLWALQPTTAQVILS  251

Query  2432  SDMGEQTS----------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFT  2283
             + + E T           TVEVP   + VGD + V PGD+IP DG V  G STVDES  T
Sbjct  252   TQLQETTQENSAIAWSSPTVEVPAEQVRVGDLVKVFPGDKIPVDGRVIMGSSTVDESMLT  311

Query  2282  GEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLAD  2103
             GE  PVTK P   V AG++N +G L +   R G ET +  I+ LVE AQ+R+AP+Q LAD
Sbjct  312   GESFPVTKQPDLMVCAGTLNQSGALIIATTRTGEETTVSQIISLVETAQTRKAPIQFLAD  371

Query  2102  KVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQG-------slaslalqlscsvlvva  1944
             KV+G+FTY VM L+A T +FW   GT + P  +  G       +   L+L+L+ +VLV+A
Sbjct  372   KVAGYFTYLVMGLAALTLIFWYTIGTYIWPEVMTSGGVNLAVDAPLLLSLKLAIAVLVIA  431

Query  1943  CPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV  1764
             CPCALGLATPTA++VG+++GA RGLL++GG +LE    ++T+VFDKTGTLT   P VT  
Sbjct  432   CPCALGLATPTAILVGSAIGAERGLLIKGGDILERVHQLDTVVFDKTGTLTTASPQVTTC  491

Query  1763  VPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAE  1584
             V   H               +S+  +L LA+ VE  T+HPI  AI  A + RN   + AE
Sbjct  492   VSLSHG--------------FSDDRILQLAAAVEQGTHHPIATAICRAVEGRNLPTIDAE  537

Query  1583  DGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGV--GETRVQEFDDFKNQSVVYVGVDGV  1410
                F+ + G GA A+++ +++ VG+ + + R GV  GE+ +        Q+VVYV V   
Sbjct  538   G--FVTQTGLGAAAMVDGERIWVGSAEGLSRCGVTLGESVLSIIP--PGQTVVYVTVAEE  593

Query  1409  LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKP  1230
             L G+I + D+L+ DA+  VE L + G+   LL+GD+ + AE +AS + +  E+V   V+P
Sbjct  594   LVGVIGICDRLKSDAKMTVERLQQMGLNVVLLTGDRFSVAEAIASELELSPESVRAEVRP  653

Query  1229  DEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLS  1050
             ++K+K ++  Q+    VAMVGDGINDA ALA + V +A+G G   A + + +VL+ + L 
Sbjct  654   EDKAKAIASYQQQGHRVAMVGDGINDAPALAQADVAIALGSGTDVAIETADIVLIGDALM  713

Query  1049  QLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSI  870
              +++++ LS+ T   ++QNL+WAF YN +GLP+AAG+LLP  G +L+P++A A M  SS+
Sbjct  714   DVVESIRLSQQTFNKIRQNLFWAFAYNTIGLPMAAGVLLPGFGIVLSPAVAAAFMAFSSV  773

Query  869   GVMTNSLLLRLKF  831
              V+TNSLLLR +F
Sbjct  774   SVVTNSLLLRRQF  786



>ref|WP_009543558.1| MULTISPECIES: ATPase [Cyanothece]
 ref|YP_001805799.1| cation-transporting P-type ATPase [Cyanothece sp. ATCC 51142]
 gb|ACB53733.1| cation-transporting P-type ATPase [Cyanothece sp. ATCC 51142]
Length=779

 Score =   517 bits (1331),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 320/789 (41%), Positives = 487/789 (62%), Gaps = 55/789 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L  Q  V SA VNL TE AV+       V P+        LA+ LT
Sbjct  26    GMKCAGCVSAVERQLTQQSGVISACVNLITEVAVI-DYEPQTVKPD-------TLAEKLT  77

Query  2963  SCGFKANVRDSR-----RENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSH  2799
               GF +++R ++     + +L ++  ++  AK+ ++      L  +  L     +GHL H
Sbjct  78    KIGFPSDIRSAQTLTPQQVHLNQSQRREEEAKQQKIN-----LVTAAILLIFSTLGHLEH  132

Query  2798  FFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSF  2619
             F G     I ++ +  FH  +    +L+PGR++IIDG + L  G  NMNTLVGLG LS++
Sbjct  133   FGGPT---IPIISNLWFHWGLATLAILIPGREIIIDGWRGLSHGMANMNTLVGLGTLSAY  189

Query  2618  AVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLV  2439
               S +A  +P LGW+ FF+EPVML+ F+LLGR LE++A+ +A+S +  L+ + P+ ARLV
Sbjct  190   ITSCVAFLVPSLGWECFFDEPVMLLGFILLGRTLEKQARNRASSALEALMALQPTLARLV  249

Query  2438  VNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTK  2259
                   + +S++E+P   + VG+ + VLPG++IP DG +  G++ +DES  TGE +PV K
Sbjct  250   -GDPFSDDSSSIEIPVEQVRVGEYVKVLPGEKIPVDGEIVKGKTAIDESLVTGESVPVAK  308

Query  2258  LPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTY  2079
               G +  AG++N +G++T++  + G  T +  I+  VE AQ+R+AP+Q+LAD V+G+F Y
Sbjct  309   ETGDKAIAGTLNQSGVITLKTTQVGENTTLAQIITSVETAQTRKAPIQQLADTVAGYFAY  368

Query  2078  GVMALSAATFMFWNLFGTRVLPATLHQGslasl---------alqlscsvlvvaCPCALG  1926
             GVM L++ TF+FW   GT   P  L+                +L+L+ +VLVVACPCALG
Sbjct  369   GVMGLASVTFLFWFTVGTNSYPQVLNPSHTEMAMGSTSPMLLSLKLAIAVLVVACPCALG  428

Query  1925  LATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHN  1746
             LATPTA++VGTS+G+ RGLL++GG VLE    ++ ++FDKTGTLT+G P+VT        
Sbjct  429   LATPTAILVGTSIGSERGLLIKGGDVLEKVHQLDGVIFDKTGTLTVGHPSVT--------  480

Query  1745  DETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIE  1566
                    D  +    S   +L LA+ VES  NHP+G AI+E A+     +++AED  F  
Sbjct  481   -------DYFTFDGMSSQSLLQLAATVESGANHPLGLAILEKAQQEGLSLLQAED--FQT  531

Query  1565  EPGSGAMAVIEEKKVSVGTLDWVRRHG--VGETRVQEFDDFKN--QSVVYVGVDGVLAGL  1398
             E GSG  A++E K V +G   W++  G  + E    + ++     ++VVY+GV+G + G+
Sbjct  532   EAGSGVQAIVEGKIVWLGNEGWLQEKGLIIEEDEKNKINELTQAGKTVVYLGVEGSIKGV  591

Query  1397  IYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKS  1218
             + ++D LR DA+  V  L K+G+   LL+GD    A+ +A+ + I +  VF  ++P EK+
Sbjct  592   LALKDNLRPDAKQTVSELQKRGLEVILLTGDHPQVAQTIATQLNISQ--VFAEIRPGEKA  649

Query  1217  KFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLD  1038
               V  LQK++K VAMVGDGINDA ALA +++G+++ G    A + + +VLM +RL  ++ 
Sbjct  650   AMVEALQKNKK-VAMVGDGINDAPALAQANLGISLQGSTQVAMETADIVLMSDRLFDVIT  708

Query  1037  ALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMT  858
             A++LS  T + ++QNL WA GYN   +P+AAGILLP  G +L+P++A  LM  SS+ V+T
Sbjct  709   AMDLSLGTFRKIRQNLIWALGYNTFAIPIAAGILLPSFGVILSPALAAGLMAFSSVTVVT  768

Query  857   NSLLLRLKF  831
             NSLLLR +F
Sbjct  769   NSLLLRYQF  777



>ref|WP_015172780.1| heavy metal translocating P-type ATPase [Geitlerinema sp. PCC 
7407]
 ref|YP_007110268.1| heavy metal translocating P-type ATPase [Geitlerinema sp. PCC 
7407]
 gb|AFY67216.1| heavy metal translocating P-type ATPase [Geitlerinema sp. PCC 
7407]
Length=804

 Score =   517 bits (1332),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 341/801 (43%), Positives = 477/801 (60%), Gaps = 65/801 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L S P V SA VNL TE A V   +EA             +A+ LT
Sbjct  25    GMKCAGCVSAVERQLLSHPGVVSACVNLVTEVATVECATEADPA---------AIAQRLT  75

Query  2963  SCGFKANVRDSRRE--NLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
               GF +  R + R     +   E+     R Q     R LA++  L     +GHL+ F G
Sbjct  76    EAGFPSQPRQTGRSAPEGWSPAERHQQETRQQT----RRLAIATLLLVFSAIGHLNLFGG  131

Query  2789  AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
                  + LL    FH  +    L  PGR L++DG + L  G PNMNTLVGLG +S++  S
Sbjct  132   PT---LPLLSDIWFHCGLATVALFGPGRSLLVDGWQGLRHGVPNMNTLVGLGTVSAYTAS  188

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
              +A   P LGW+ FF+EPVML+ F+LLGR LEQRA+ +A +    LL + P +ARLV   
Sbjct  189   VVALVFPGLGWECFFDEPVMLVGFILLGRTLEQRARTRAAAAFQALLALQPQRARLVAKK  248

Query  2429  DM------GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLP  2268
             D+       E    +E+P   + VG+ I VLPG++IP DG V AG++TVDES  TGE +P
Sbjct  249   DLLPEEELTETHQAIEIPADQVRVGEWIQVLPGEKIPVDGEVVAGQTTVDESMLTGESVP  308

Query  2267  VTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGH  2088
             V K PG +V+AG++N +G + +   R G +TA+  I+ LVE AQ+R+AP+QRLAD V+G+
Sbjct  309   VRKQPGDRVSAGTLNQSGAIALRATRVGSDTALASIIELVETAQTRKAPIQRLADTVAGY  368

Query  2087  FTYGVMALSAATFMFWNLFGTRVLPATLHQGsla---------------------slalq  1971
             F YGVMA++A TF FW   GTR+ P  L  G +A                      L+L+
Sbjct  369   FAYGVMAIAALTFGFWYFLGTRLWPQVLAHGDMAHPMTHDLMGHMVSHASETDPMMLSLR  428

Query  1970  lscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLT  1791
             L+ +VLVVACPC+LGLATPTA++VGT +GA +GLL+RGG +LE    V+T++FDKTGTLT
Sbjct  429   LAIAVLVVACPCSLGLATPTAILVGTGVGAEQGLLIRGGDILERVRQVSTLIFDKTGTLT  488

Query  1790  IGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKS  1611
              G+PTVT+  P               T + S   +L LA+ VE  T HP+ +AI  AA+ 
Sbjct  489   TGQPTVTDCQPL--------------TPDGSAETLLRLAASVEQGTRHPLAEAIQRAAED  534

Query  1610  RNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVG-ETRVQEFDDF---KN  1443
             R   ++ A+D T   EPG G  A +++++V +GT DW++  GV      Q   D      
Sbjct  535   RTLALLPAKDWT--TEPGCGVAAQVQQQQVMLGTADWLQAQGVDLSPEAQALGDTYAADG  592

Query  1442  QSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGI  1263
             ++VVYV  D  L GLI   D L+ DA   V+ L + GI   LL+GD+  AA  +A  + +
Sbjct  593   KTVVYVAADQQLLGLIAAIDTLKPDAAQTVQQLRQMGIRVMLLTGDQPAAATAIARSLDL  652

Query  1262  PRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdv  1083
               E+   GV+P  K+  ++ LQ   +VVAMVGDGINDA ALA + +G+++     AA + 
Sbjct  653   SPEDTLAGVQPSGKAAAIAHLQAQGQVVAMVGDGINDAPALAQADLGISLQSATDAAIET  712

Query  1082  ssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPS  903
             + +VLM++RL+ ++ A+ LSR T+  ++QNL+WA  YN++G+P+AAGILLP     L+P+
Sbjct  713   AQIVLMRDRLTDVVAAIRLSRATLAKIRQNLFWAMAYNVLGIPIAAGILLPALEFSLSPA  772

Query  902   IAGALMGLSSIGVMTNSLLLR  840
              AG LM  SS+ V+TNSLLLR
Sbjct  773   AAGGLMAFSSVSVVTNSLLLR  793



>ref|XP_008644818.1| PREDICTED: uncharacterized protein LOC100383364 isoform X1 [Zea 
mays]
Length=1003

 Score =   522 bits (1345),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 351/824 (43%), Positives = 481/824 (58%), Gaps = 73/824 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGCAA V+ IL + PRV  A+VNL  E+A V   + A          GEELA  LT
Sbjct  195   GMMCGGCAARVRSILAADPRVEMAAVNLLAESAAVRLRAPAP------PGAGEELAARLT  248

Query  2963  SCGFKANVRDSRRENLFETFEKK---MNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
              CGF A  R            +K   M A++ +L    RG +A +W L A+C   H SH 
Sbjct  249   ECGFPATARRGGAAAGAGESARKWREMAARKEELLVRSRGRVAFAWTLVALCCGSHASHI  308

Query  2795  FGA------KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
               +        +++ LLH+      +    L  PGR ++ DG ++  +G+PNMN+LVG G
Sbjct  309   LHSLGIHVGHGTFLDLLHNPYVKCGIATTALFGPGRDILFDGFRAFKQGSPNMNSLVGFG  368

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             + ++F +S+++   P   W + FF+EPVML+ FVLLGR+LE+ A++KA+SDM  L+++L 
Sbjct  369   SAAAFTISAVSLLNPDWEWNSTFFDEPVMLLGFVLLGRSLEESARLKASSDMNELISLLS  428

Query  2456  SKARLVV---------NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
              ++RL+V         +S +     TVEVP  ++ VGD I+VLPG+ IP DG V  G S 
Sbjct  429   PQSRLIVTSSSDNPSADSSLNSDAITVEVPVDDVRVGDSILVLPGETIPVDGNVIEGSSF  488

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V +G++N +G L +     G  + I  IVR+VE+AQ+REA
Sbjct  489   VDESMLTGESLPVAKETGLPVFSGTVNWDGPLKIRATCTGPSSTIAKIVRMVEDAQAREA  548

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F Y VM L+A TF FW   GT + P  L        G    L+++L+ 
Sbjct  549   PVQRLADSIAGPFVYTVMTLAATTFSFWYYIGTHLFPEVLLNDIAGPDGDSLLLSIKLAV  608

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA+++GTSLGA RGLL+RGG VLE  + ++T+V DKTGTLT G+
Sbjct  609   DVLVVSCPCALGLATPTAILIGTSLGAKRGLLVRGGDVLERLAGIDTLVLDKTGTLTEGK  668

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P VT +                ++  + E +VL LA+ VE    HPI  AI+  A+    
Sbjct  669   PVVTSI----------------ASLAYEETEVLRLAAAVEKTALHPIANAIMNKAELLKL  712

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQ--EFDDFKN-----  1443
              I        +  PG G +A ++   V+VGTLDWV  H   ET+    E  D +N     
Sbjct  713   DIPITSGQ--LTSPGFGCLAEVDGSLVAVGTLDWV--HDRFETKASPTELRDLRNRLEFM  768

Query  1442  -----------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKK  1299
                        +S+ YVG +G  + G I + D LREDA   VE L ++ ITT+LLSGD+ 
Sbjct  769   LSSEASSSNQSKSIAYVGREGEGIIGAIAISDILREDANLTVERLQQESITTFLLSGDRG  828

Query  1298  NAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--  1125
              A   +   +GI  EN+   + P +K+  +S LQ     VAMVGDGINDA +LA++ V  
Sbjct  829   EAVTSIGRTIGIRNENIKSSLTPQDKASIISTLQAKGHRVAMVGDGINDAPSLAAADVGI  888

Query  1124  gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAA  945
              +       AASD +SVVL+ NRLSQ++DAL LS+ TM  V QNL WA  YNIV +P+AA
Sbjct  889   AMRTHSKENAASDAASVVLLGNRLSQVVDALSLSKATMAKVHQNLAWAVAYNIVAIPIAA  948

Query  944   GILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             G+LLP     +TPS++G LM LSSI V++NSLLL+L  + +  E
Sbjct  949   GVLLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQLHGSFQNTE  992



>ref|XP_004305609.1| PREDICTED: LOW QUALITY PROTEIN: copper-transporting ATPase PAA2, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=887

 Score =   518 bits (1335),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 341/811 (42%), Positives = 484/811 (60%), Gaps = 65/811 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC + VK +L +  RV S +VN+ TETA V   +E        ++  E LA  LT
Sbjct  91    GMMCGGCVSRVKSVLSADDRVHSVAVNMLTETAAVKLKAEVG-----AEEAAESLAGRLT  145

Query  2963  SCGFKANVRDSRR--ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
              CGF A  R S          +++ +  K   L  S   + ++W L A+C   H SH   
Sbjct  146   ECGFAAKRRASGMGVAESVRKWKEMVKNKEEMLVKSRNRVILAWTLVALCCGSHASHILH  205

Query  2789  ------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGAL  2628
                   A  S++ +LH++     + +  LL PGR L+ DGL++  KG+PNMN+LVG G+L
Sbjct  206   SLGIHIAHGSYMDVLHNSYVKGGLAMAALLGPGRDLLFDGLRAFRKGSPNMNSLVGFGSL  265

Query  2627  SSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSK  2451
             ++F +S+++   P L W A FF+EPVML+ FVLLGR+LE+RA+I+A+SDM  LL+++ ++
Sbjct  266   AAFTISAVSLLNPDLQWDAAFFDEPVMLLGFVLLGRSLEERARIRASSDMNELLSLINTQ  325

Query  2450  ARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVD  2298
             +RLV+ S          +G     +EVP  ++ VGD ++VLPG+ IP DG V AGRS VD
Sbjct  326   SRLVIASSENDSSSDTVLGSDAICLEVPTDDVRVGDSVLVLPGETIPVDGRVLAGRSVVD  385

Query  2297  ESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPV  2118
             ES  TGE LPV K     V+AG+IN +G L +E    G  + I  IVR+VE+AQ  EAP+
Sbjct  386   ESMLTGESLPVFKEKELTVSAGTINWDGPLRIEATSTGSNSMISKIVRMVEDAQGHEAPI  445

Query  2117  QRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscsv  1956
             QRLAD ++G F Y +M LSA TF FW   GT + P  L        G    L+L+L+  V
Sbjct  446   QRLADSIAGPFVYTIMTLSATTFAFWYYIGTHIFPDVLLNDIAGPDGDPLLLSLKLAVDV  505

Query  1955  lvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPT  1776
             LVV+CPCALGLATPTA++VGTSLGA +GLL+RG  VLE  + ++ I  DKTGTLT G+P 
Sbjct  506   LVVSCPCALGLATPTAILVGTSLGARQGLLVRGADVLERLASIDHIALDKTGTLTEGKPA  565

Query  1775  VTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRI  1596
             V+                S ++ ++ E ++L +A+ VES  +HPI  AI+  AKS +  I
Sbjct  566   VS----------------SIASFKYKESEILQIAAAVESTASHPIANAILNKAKSLDLSI  609

Query  1595  VKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN---------  1443
                +    + EPG G +A ++   V+VG+L+WV       T   E  + ++         
Sbjct  610   PVTKRQ--LTEPGFGTLAEVDGLLVAVGSLEWVHERFQRRTDRSEILNLEHAVCRSSEGI  667

Query  1442  ------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEY  1284
                   +++VYVG +G  + G I + D LR DA   V  L ++GI T L SGD++ A   
Sbjct  668   TPSSYSKTIVYVGREGEGIIGAIAISDSLRHDAEFTVTRLQQKGIKTVLFSGDREEAVAT  727

Query  1283  VASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgvaig  1110
             +A  VGI ++ +   + P  KS  +S L+     VAMVGDGINDA   ALA   + + IG
Sbjct  728   IAKAVGIEKKFIKSSLTPQGKSGAISSLKAAGHHVAMVGDGINDAPSLALADVGIALQIG  787

Query  1109  ggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLP  930
             G   AAS+ +S++L+ N+LSQ++DALEL++ TM  V QNL WA  YN++ +P+AAG+LLP
Sbjct  788   GQENAASNAASIILLGNKLSQVVDALELAQATMAKVYQNLSWAVAYNVIAIPIAAGVLLP  847

Query  929   FTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
                  +TPS++G +M LSSI V+TNSLLL+L
Sbjct  848   QYDFAMTPSLSGGMMALSSIFVVTNSLLLQL  878



>ref|WP_014274764.1| copper-transporting P-type ATPase CtaA [Arthrospira platensis]
 ref|YP_005067806.1| copper-transporting P-type ATPase CtaA [Arthrospira platensis 
NIES-39]
 dbj|BAI89268.1| copper-transporting P-type ATPase CtaA [Arthrospira platensis 
NIES-39]
Length=787

 Score =   515 bits (1326),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 330/793 (42%), Positives = 479/793 (60%), Gaps = 55/793 (7%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC  +V+R L  QP V +  VNL TE A V       V P       ++LA  L
Sbjct  28    GGMKCAGCVMAVERQLNQQPGVIAVRVNLATEVATV-ECEPGTVDP-------QKLADIL  79

Query  2966  TSCGFKANVRDSRRENLFETF-EKKMNAKRAQLQASGRGLAVSWALCAVCL-VGHLSHFF  2793
             T  GF + +R     N   TF E+     R Q+   GR +     +C V + +  + HF 
Sbjct  80    TETGFNSQLRYGSAANQKLTFKERHRQEMRDQI---GRVV-----ICGVLIFLSGIGHFH  131

Query  2792  GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAV  2613
                   I ++ +  FH  +    L+ PGR LI+DG++SL + APNMNTLVGLG +S++  
Sbjct  132   QMGWGPIPVVSNIWFHWGLATLALMFPGRSLIVDGVRSLARNAPNMNTLVGLGTISAYTA  191

Query  2612  SSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVN  2433
             S +A   P+LGW+ FF+EPVML+ F+LLG+ LEQ+A+ +A      L  + P+ A+++++
Sbjct  192   SLVALLFPRLGWQCFFDEPVMLLGFILLGKTLEQQARFRAAQAFESLWALQPTTAQVILS  251

Query  2432  SDMGEQTS----------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFT  2283
             + + E T           TVEVP   + VGD + V PGD+IP DG V  G STVDES  T
Sbjct  252   TQLQETTQENSAIAWSSPTVEVPAEQVLVGDLVKVFPGDKIPVDGRVIMGSSTVDESMLT  311

Query  2282  GEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLAD  2103
             GE  PVTK P   V AG++N +G L +   R G ET +  I+ LVE AQ+R+AP+Q LAD
Sbjct  312   GESFPVTKQPDLMVCAGTLNQSGALIIATTRTGEETTVSQIISLVETAQTRKAPIQFLAD  371

Query  2102  KVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQG-------slaslalqlscsvlvva  1944
             KV+G+FTY VM L+A T +FW   GT + P  +  G       +   L+L+L+ +VLV+A
Sbjct  372   KVAGYFTYLVMGLAALTLIFWYTIGTYIWPEVMTSGGVNLAVDAPLLLSLKLAIAVLVIA  431

Query  1943  CPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV  1764
             CPCALGLATPTA++VG+++GA RGLL++GG +LE    ++T+VFDKTGTLT   P VT  
Sbjct  432   CPCALGLATPTAILVGSAIGAERGLLIKGGDILERVHQLDTVVFDKTGTLTTASPQVTTC  491

Query  1763  VPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAE  1584
             V   H               +S+  +L LA+ VE  T+HPI  AI  A + RN   + AE
Sbjct  492   VSLSHG--------------FSDDRILQLAAAVEQGTHHPIATAICRAVEGRNLPTIDAE  537

Query  1583  DGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGV--GETRVQEFDDFKNQSVVYVGVDGV  1410
                F+ + G GA A+++ +++ VG+ + + R GV  GE+ +        Q+VVYV V   
Sbjct  538   G--FVTQTGLGAAAMVDGERIWVGSAEGLIRCGVTLGESVLSIIP--PGQTVVYVTVAEE  593

Query  1409  LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKP  1230
             L G+I + D+L+ DA+  VE L + G+   LL+GD+ + AE +AS + +  E+V   V+P
Sbjct  594   LVGVIGICDRLKSDAKMTVERLQQMGLNVVLLTGDRFSVAEAIASELELSPESVRAEVRP  653

Query  1229  DEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLS  1050
             ++K+K ++  Q+    VAMVGDGINDA ALA + V +A+G G   A + + +VL+ + L 
Sbjct  654   EDKAKAIASYQQQGHRVAMVGDGINDAPALAQADVAIALGSGTDVAIETADIVLIGDALM  713

Query  1049  QLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSI  870
              +++++ LS+ T   ++QNL+WAF YN +GLP+AAG+LLP  G +L+P++A A M  SS+
Sbjct  714   DVVESIRLSQQTFNKIRQNLFWAFAYNTIGLPMAAGVLLPGFGIVLSPAVAAAFMAFSSV  773

Query  869   GVMTNSLLLRLKF  831
              V+TNSLLLR +F
Sbjct  774   SVVTNSLLLRRQF  786



>ref|WP_039729886.1| ATPase [Lyngbya confervoides]
 gb|KIF16829.1| ATPase [Aphanocapsa montana BDHKU210001]
 gb|KIF41843.1| ATPase [Lyngbya confervoides BDU141951]
Length=796

 Score =   515 bits (1326),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 329/797 (41%), Positives = 481/797 (60%), Gaps = 61/797 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V++ L +   V SA+VNL TE AVV  +++ +V P       ++LA  LT
Sbjct  25    GMMCAGCVRAVEKQLTACDGVQSATVNLITEVAVVETLADRQVDP-------QQLADRLT  77

Query  2963  SCGFKANVR---DSRREN--LFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSH  2799
               GF + +R   D  + +  L +   +K    R Q   +GR       L A+  +GHL H
Sbjct  78    QNGFPSQLRTAADGTQTDAGLTDWLHRKQQENREQ---AGRLAIAL-TLLALSTIGHLHH  133

Query  2798  FFGAKASWIHL--LHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALS  2625
             F      W+ +  L +  FH  +    LL P R++++DG +   +G PNMNTLV LGALS
Sbjct  134   F-----GWVTVPVLSNLWFHFVLATAVLLFPAREIVVDGWQGARRGTPNMNTLVALGALS  188

Query  2624  SFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKAR  2445
             ++  S +A   P LGW+ FF+EPVML++F+LLGR LE RA+ +AT  +  L+ + P++AR
Sbjct  189   AYGASVVALLWPTLGWECFFDEPVMLLSFILLGRTLEHRARFRATDALRSLIALQPAQAR  248

Query  2444  LV-VNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLP  2268
             L+ + +  G     VE+P S +  G+ + VLPG+ IPADG++  G++TVDES  TGE LP
Sbjct  249   LIGMPAADGSTQPGVEIPVSAVQPGEWLRVLPGETIPADGVIETGQTTVDESMLTGESLP  308

Query  2267  VTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGH  2088
             V K PG  V AG++N  G + ++V   G +T +  ++RLVE AQ+R+AP+Q+LAD +SG+
Sbjct  309   VEKQPGEMVVAGTVNQTGAIALKVTETGSDTMLAQMIRLVEAAQTRKAPIQQLADVISGY  368

Query  2087  FTYGVMALSAATFMFWNLFGTRVLPATLH--------------QGslaslalqlscsvlv  1950
             FTYGV+ L+  TF+FW   G  + P  +               Q S   ++L+L+ +VLV
Sbjct  369   FTYGVLTLATLTFLFWYFVGLPLWPDVMDSALGAVHATHTMTMQSSTLLVSLKLAIAVLV  428

Query  1949  vaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVT  1770
             +ACPCALGLATPTA++VG+ +GA RGLL+RGG VLE  S ++T+VFDKTGTLT G P VT
Sbjct  429   IACPCALGLATPTAILVGSGMGAERGLLIRGGDVLEMLSQIDTVVFDKTGTLTAGLPRVT  488

Query  1769  EVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVK  1590
                 Q   D+             ++ D+L LA+ VES T HP+  AI +AA   +  +  
Sbjct  489   HC--QSLADDL------------TDNDLLALAATVESGTQHPLAIAIQQAATEASLELPP  534

Query  1589  AEDGTFIEEPGSGAMAVI----EEKKVSVGTLDWVRRHGVGET---RVQEFDDFKNQSVV  1431
             A D  F+ + G G  A +    +   V +G  DW+ + G+  T     Q       Q+ V
Sbjct  535   ASD--FLTQAGLGVAATVTWHEQSHPVWIGNADWLAQQGIVPTDTATTQMAAIAPGQTAV  592

Query  1430  YVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPREN  1251
             Y+ +   + GLI V D+LREDA   + +L +QG+  +LL+GD+   A+ +A+ VGIP   
Sbjct  593   YIAMGDRVVGLIAVADELREDAPETITALQQQGLKVHLLTGDRAPVAQAIATTVGIPATQ  652

Query  1250  VFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvV  1071
             V   V P +KS+ ++ LQ     VA+VGDGINDA ALA + VG+++  G   A++ + VV
Sbjct  653   VRAEVLPADKSQAIAALQAQGHRVALVGDGINDAPALAQADVGISLSSGTDIAAESAGVV  712

Query  1070  LMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGA  891
             LM +RL+ +L++L L R T+  ++QNL WAF YN++G+P AAGILLP  G  L+P++AG 
Sbjct  713   LMSDRLTGVLESLRLGRATVAKIRQNLAWAFAYNLIGIPAAAGILLPAYGVSLSPAVAGG  772

Query  890   LMGLSSIGVMTNSLLLR  840
             LM  SS+ V+ NSLLL+
Sbjct  773   LMAFSSVTVVVNSLLLK  789



>ref|WP_012407309.1| ATPase [Nostoc punctiforme]
 ref|YP_001864227.1| ATPase P [Nostoc punctiforme PCC 73102]
 gb|ACC79284.1| heavy metal translocating P-type ATPase [Nostoc punctiforme PCC 
73102]
Length=808

 Score =   515 bits (1327),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 339/803 (42%), Positives = 483/803 (60%), Gaps = 59/803 (7%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC  +V+R L   P V SA VNL TE AVV   SE   V        + LA+ L
Sbjct  25    GGMKCAGCVNAVERQLTQHPGVKSACVNLATEVAVV--ESETGAVD------ADALAQRL  76

Query  2966  TSCGFKANVRDSRRENLFE--TFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             T+ GF    R +R     E  T       +R ++++S R LA++  L  +   GH  +  
Sbjct  77    TAVGFPTQPRKARATVAGEISTLPDPAERQRREMRSSVRQLAIAAMLLLLSGSGHFGNL-  135

Query  2792  GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAV  2613
                +S + LL++  FH  +    LL+PGR +++DG     + APNMNTL+GLG L+++  
Sbjct  136   --GSSVLPLLNNIWFHCGLATVALLIPGRPILVDGWLGWRRNAPNMNTLIGLGTLTAYIA  193

Query  2612  SSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVN  2433
             S +A   P++GW+ FF+EPVM++ F+LLGR LEQ+A+ +A +    LL + P  ARL+ N
Sbjct  194   SLVALLFPQMGWECFFDEPVMMLGFILLGRTLEQQARGRAAAAFRKLLALQPQVARLIAN  253

Query  2432  SDMGE-QTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKL  2256
              + G   +S+VE+P   + VG+ + VLPGD+IP DG V  G++TVDES  TGE +PV K 
Sbjct  254   PEKGGVGSSSVEIPAEQVRVGEWLQVLPGDKIPVDGEVVLGQTTVDESMLTGEAVPVIKQ  313

Query  2255  PGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYG  2076
             PG  V  G++N +G + ++  R G +T +  IV LVE AQ+R+APVQ+LAD V+G+FTYG
Sbjct  314   PGDSVTGGTLNQSGAIAIQTTRTGSDTTLAQIVALVEAAQTRKAPVQKLADTVAGYFTYG  373

Query  2075  VMALSAATFMFWNLFGTRV------------LPATLHQG--slaslalqlscsvlvvaCP  1938
             V+  S  TF+FW  F T +            +   +HQ   S   ++L+L+ +V+VVACP
Sbjct  374   VLTASLLTFVFWYFFDTHLWTDIAMSGEMEMMSHAIHQAPRSPLLISLKLAIAVMVVACP  433

Query  1937  CALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVP  1758
             CALGLATPTA++VGT++GA RGLL++GG VLE    ++T+VFDKTGTLT G P VT+ + 
Sbjct  434   CALGLATPTAILVGTAMGAERGLLIKGGDVLEKVHQLDTVVFDKTGTLTTGHPIVTDCLL  493

Query  1757  QGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDG  1578
                    N               ++ LA+ VES T+HP+ KAI + A+ +   I +A D 
Sbjct  494   ISETGSGN------------PYSLIQLATAVESGTHHPLAKAIQQEAQRQKLSIPEAVD-  540

Query  1577  TFIEEPGSGAMAVIEEKKVSVGTLDWVRRHG--VGETRVQEFDDFKN--QSVVYVGVDGV  1410
              F  EPG G  AV+E+  V +G  DW+  HG  + ET  Q   D     ++VV V V G 
Sbjct  541   -FHTEPGLGVSAVVEDTVVLLGNWDWLSWHGISISETAQQVAQDLATDGKTVVCVAVGGT  599

Query  1409  LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKP  1230
             LAGLI V D LR DA+  V+ L + G+   LLSGD+  AA  +A  +G+   +V  GV P
Sbjct  600   LAGLIAVSDTLRPDAQSTVDKLRQMGLRVMLLSGDRLEAASAIAKQLGLDSADVIAGVPP  659

Query  1229  DEKSKFVSGLQK-------------DQKVVAMVGDGINDAAALasshvgvaigggvgaas  1089
              +K+  +  LQ+                VVAMVGDGINDA AL+ + VG+A+  G   A 
Sbjct  660   AKKAAAIKNLQQAGTKGTPNSSLLTQHSVVAMVGDGINDAPALSQADVGIALHSGTDVAM  719

Query  1088  dvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLT  909
             + + +VLM++RL+ ++++++LSR T   ++QNL+WAF YN VG+P+AAG+L P  G +L 
Sbjct  720   ETAEIVLMRDRLNDVVESIQLSRATFNKIRQNLFWAFAYNTVGIPLAAGVLFPSLGFVLN  779

Query  908   PSIAGALMGLSSIGVMTNSLLLR  840
             PS A ALM  SS+ V+TNS+LLR
Sbjct  780   PSGAAALMAFSSVSVVTNSILLR  802



>gb|AAO13462.1| Unknown protein [Oryza sativa Japonica Group]
Length=910

 Score =   518 bits (1335),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 356/837 (43%), Positives = 487/837 (58%), Gaps = 97/837 (12%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGCAA V+ IL +  RV +A+VNL  E+A V   S        +   G+ELA  LT
Sbjct  96    GMMCGGCAARVRTILAADERVETAAVNLLAESAAVRLRSP-------EPAAGKELAARLT  148

Query  2963  SCGFKANVR---------DSRRENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLV  2814
              CGF +  R         DS R+       ++M A++A+L    RG +A +W L A+C  
Sbjct  149   ECGFPSVARRGGAASGASDSARK------WREMAARKAELLTRSRGRVAFAWTLVALCCG  202

Query  2813  GHLSHFFGA------KASWIHLLHSTGFHMSMCLFTLLVPGR--------------QLII  2694
              H +HF  +        +++ LLH++     + +  L  PGR               ++ 
Sbjct  203   SHATHFLHSLGIHVGHGTFLDLLHNSYVKCGIAIAALFGPGRGFLSFSQNVFNVTPDILF  262

Query  2693  DGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNL  2517
             DGL++  +G+PNMN+LVG G+ ++FA+SS++   P+L W + FF+EPVML+ FVLLGR+L
Sbjct  263   DGLRAFKQGSPNMNSLVGFGSAAAFAISSVSLLNPELEWNSTFFDEPVMLLGFVLLGRSL  322

Query  2516  EQRAKIKATSDMTGLLNVLPSKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQI  2364
             E+ A++KA+SDM  L+++L  ++RLVV S          +     TVEVP  ++ VGD I
Sbjct  323   EESARLKASSDMNELVSLLSPQSRLVVTSSSDDPSSDGVLNSDAITVEVPVDDVRVGDFI  382

Query  2363  IVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPG  2184
             +VLPG+ IP DG V  G S VDES  TGE LPV K  G  V AG++N +G L ++    G
Sbjct  383   LVLPGETIPVDGNVLGGSSFVDESMLTGESLPVPKEKGFPVFAGTVNWDGPLKIKATTTG  442

Query  2183  GETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL  2004
               + I  IVR+VE+AQ+REAPVQRLAD ++G F Y VM LSAATF FW   GT + P  L
Sbjct  443   PSSTIAKIVRMVEDAQAREAPVQRLADSIAGPFVYTVMTLSAATFSFWYYIGTHIFPEVL  502

Query  2003  ------HQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLE  1842
                     G    L+L+L+  VLVV+CPCALGLATPTA+++GTSLGA RGLL+RGG VLE
Sbjct  503   LNDISGPDGDSLLLSLKLAVDVLVVSCPCALGLATPTAILIGTSLGAKRGLLIRGGDVLE  562

Query  1841  SFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVE  1662
               + ++ IV DKTGTLT GRP VT                S ++  + E ++L LA+ VE
Sbjct  563   RLAGIDAIVLDKTGTLTKGRPVVT----------------SIASLAYEEAEILRLAAAVE  606

Query  1661  SNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGV  1482
                 HPI  AI+E A+     I  A  G  + EPG G +A ++   V+VGTLDWV     
Sbjct  607   KTALHPIANAIMEEAELLKLDI-PATSGQ-LTEPGFGCLAEVDGCLVAVGTLDWVHNRFE  664

Query  1481  GETRVQEFDDFKN---------------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVE  1350
              +    E  D  N               +S+ YVG +G  + G I V D LR+DA+  V+
Sbjct  665   TKASSTELTDLGNHLEFVSSSEASSNHSKSIAYVGREGEGIIGAIAVSDVLRDDAKATVD  724

Query  1349  SLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMV  1170
              L ++ I T+LLSGD+K A E +   VGI  EN+   + P EK+  ++ LQ + + VAMV
Sbjct  725   RLQQEEILTFLLSGDRKEAVESIGRTVGIRSENIKSSLTPHEKAGIITALQGEGRRVAMV  784

Query  1169  GDGINDAAALassh--vgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQ  996
             GDGINDA +LA++   V +       AASD +SVVL+ NRLSQ++DAL LS+ TM  V Q
Sbjct  785   GDGINDAPSLAAADVGVAMRTNSKESAASDAASVVLLGNRLSQVMDALSLSKATMAKVHQ  844

Query  995   NLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIA--GALMGLSSIGVMTNSLLLRLKF  831
             NL WA  YNIV +P+AAG+LLP     +TPS++  G   G S +    N L  R+KF
Sbjct  845   NLAWAVAYNIVAIPIAAGVLLPQFDFAMTPSLSEYGKTTGRSELQAELNLLADRIKF  901



>ref|WP_015199494.1| heavy metal translocating P-type ATPase [Calothrix parietina]
 ref|YP_007138841.1| heavy metal translocating P-type ATPase [Calothrix sp. PCC 6303]
 gb|AFZ02869.1| heavy metal translocating P-type ATPase [Calothrix sp. PCC 6303]
Length=808

 Score =   514 bits (1323),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 334/814 (41%), Positives = 474/814 (58%), Gaps = 80/814 (10%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC  +V+R L   P V +A+VNL T+ AVV    E   V        + LA+HL
Sbjct  24    GGMKCAGCMRTVERHLSQYPGVKTAAVNLATDVAVV--EYETGTVD------ADALAQHL  75

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLV-GHLSHFFG  2790
             TS GF   VR  ++          +N KR     S R      +L     V GH+S   G
Sbjct  76    TSVGFLTQVRQGKQT------AATLNTKRHHEMRSARQQLAIASLLLALSVMGHVSSILG  129

Query  2789  AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
                  +  LH+   H ++    +L+PGR +++DG  S  + +PNMNTLVGLG L+++  S
Sbjct  130   FS---VPFLHNIWLHFALATLAILIPGRPILVDGWLSWWRNSPNMNTLVGLGTLTAYTAS  186

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
              +A   P+LGW+ FF+EPVM++ F+LLG+ LEQ A+ KA S    LL + P +A+L+   
Sbjct  187   VVALLFPQLGWECFFDEPVMILGFMLLGKTLEQSARGKAASAFRKLLALQPQQAKLIGKP  246

Query  2429  DM-----GEQTST------------VEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
                    GE++ T            VE+P   + VG+ + VLPG++IP DG +  G+STV
Sbjct  247   KKKQGAGGEESGTIFPIALNLFESVVEIPAEQVRVGEWVQVLPGEKIPVDGEIIYGQSTV  306

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DE+  TGE + + K  G  V AG++N  GML +E  R G +T I  IV LVE AQ+R+AP
Sbjct  307   DEAMLTGESVALLKQVGDTVTAGTLNQLGMLAIEANRTGDDTTIAQIVALVETAQNRKAP  366

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRV---LPAT-----------LHQGslas  1983
             VQR AD VSG+FTY V+A S  TF+FW   G  +   +P +            H  S   
Sbjct  367   VQRFADIVSGYFTYFVLAASLVTFLFWYFIGANLWGNIPMSDGMGMSHQVGVEHSPSNLL  426

Query  1982  lalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKT  1803
             L+L+L+ +V+VVACPCALGLATPTA+MVGT++ A RGLL++GG VLE    + TIVFDKT
Sbjct  427   LSLKLAIAVMVVACPCALGLATPTAIMVGTAMSAERGLLIKGGDVLEKVHHLKTIVFDKT  486

Query  1802  GTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVE  1623
             GTLT G+PTVT+ +         ++ DS          +L  AS  ES T+HP+  AI  
Sbjct  487   GTLTTGKPTVTDCI------SLTSEEDS---------QLLEFASAAESGTSHPLAIAIQA  531

Query  1622  AAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGV-----GETRVQEF  1458
              A  R   I +AED  F  EPG G  AV++ K + +G  DW+  HG+      ET  QE 
Sbjct  532   EAAKRKLIIPQAED--FYTEPGLGVSAVVQGKTILLGNADWLSWHGISLNQQAETITQEL  589

Query  1457  DDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVA  1278
                  ++++Y+  +G LAG+I   D LR DA++ ++ L K G+   LLSGD+  A   +A
Sbjct  590   AQ-AGKTIIYLTKNGQLAGIIAATDTLRSDAQNTIKHLQKMGLRVMLLSGDRLEAVNAIA  648

Query  1277  SVVGIPRENVFYGVKPDEKSKFVSGLQK--------DQKVVAMVGDGINDAAALasshvg  1122
               +GI + ++  GV P +K+  +  LQK         + +VAMVGDGINDA AL+ + VG
Sbjct  649   QQLGINKSDIIAGVPPAKKAAIIESLQKGEFHPNSPQKSIVAMVGDGINDAPALSQADVG  708

Query  1121  vaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAG  942
             +++  G   A + + ++LM++ L+ ++ A+ELSR T   ++QNL+WAF YN VG+P+AAG
Sbjct  709   ISLHSGTDVAMETAEIILMRDELTDVITAIELSRATFSKIRQNLFWAFAYNTVGIPLAAG  768

Query  941   ILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLR  840
             ++LP  G +L+P+ A  LM  SS+ V+TNSLLLR
Sbjct  769   VMLPSLGFILSPAGAALLMAFSSVSVVTNSLLLR  802



>ref|WP_012594879.1| MULTISPECIES: ATPase [Cyanothece]
 ref|YP_002371762.1| heavy metal translocating P-type ATPase [Cyanothece sp. PCC 8801]
 ref|YP_003137322.1| ATPase P [Cyanothece sp. PCC 8802]
 gb|ACK65606.1| heavy metal translocating P-type ATPase [Cyanothece sp. PCC 8801]
 gb|ACV00487.1| heavy metal translocating P-type ATPase [Cyanothece sp. PCC 8802]
Length=793

 Score =   513 bits (1321),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 334/793 (42%), Positives = 491/793 (62%), Gaps = 56/793 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V++ L  Q  V SA VNL TE AVV  VS  +V P       + LA+ LT
Sbjct  26    GMKCAGCVKAVEKQLAQQSGVISACVNLITEVAVVKYVS-GEVEP-------QNLAQKLT  77

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF AN+R+S+   + ET    +  K+A+ + +   L  +  L  +  +GHL H  G  
Sbjct  78    TVGFPANLRNSQGITVKETHLNAVQRKQAEKKQNLWKLVTAAILLLLSGLGHLQHLGGPT  137

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                + L+ +  FH  +    LL+PGR++IIDG++ L  G  NMNTLVGLG LS++  SS+
Sbjct  138   ---VPLVSNIWFHAGLATLALLIPGREIIIDGVRGLRHGMANMNTLVGLGTLSAYFASSI  194

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A F P+LGW+ FFEEPVML+ F+LLGR LE  A+ +A++ +  L+ + PS ARL+     
Sbjct  195   ALFFPQLGWECFFEEPVMLLGFILLGRTLEAEARSRASAALEALIALQPSVARLI-GDPF  253

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                 S++E+P   + VG+ + VLPG++IP DG V  G + +DES  TGE LPV K PG  
Sbjct  254   ANDPSSIEIPVEQVKVGEWLRVLPGEKIPVDGEVVVGETLIDESLVTGESLPVAKQPGDG  313

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V  G++N +G + ++  R G  T +  I+  VE+AQ+R+AP+Q+ AD V+G+F YGVMA+
Sbjct  314   VIGGTLNQSGAIAIKATRIGNNTTLAQIIASVEDAQTRKAPIQQFADTVAGYFAYGVMAV  373

Query  2063  SAATFMFWNLFGTRVLPATL----HQGslasl-----alqlscsvlvvaCPCALGLATPT  1911
             +  TF+FW   GT++ P  L    H G +        +L+L+ +VLVVACPCALGLATPT
Sbjct  374   ALLTFVFWVSIGTQLYPQVLTTIEHHGMIMITSPVVLSLKLAIAVLVVACPCALGLATPT  433

Query  1910  AVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNA  1731
             A++VGT +GA RGLL++GG VLE    ++ IVFDKTGTLT+G PTVT+ +P         
Sbjct  434   AILVGTGIGAERGLLIKGGDVLEKVHQLDAIVFDKTGTLTVGHPTVTDCIP---------  484

Query  1730  KRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSG  1551
                     + S   +L  A+ VES TNHP+  AI+EAA+++N  ++KA++  F  E G G
Sbjct  485   ------LTQISPQRLLQWAATVESGTNHPLALAILEAAQTQNLPLLKADN--FYTEAGRG  536

Query  1550  AMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN--QSVVYVGVDGVLAGLIYVEDQL  1377
               A++E + V +G  DW++  G+   RV+  D   +  +++VY+ VDG L GL+ ++D L
Sbjct  537   VRAMVEGESVLLGNEDWLKEQGI---RVEGTDPLTDVSKTLVYLAVDGELQGLLALKDNL  593

Query  1376  REDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQ  1197
             R DA+  V  L ++G+   L++GD+ + A+ +A  +GI +  VF  V+P +K+  +  LQ
Sbjct  594   RPDAQETVTRLQERGLEVILVTGDRLSVAQAIAQQLGITQ--VFAQVRPQQKASLIEHLQ  651

Query  1196  KDQ-----------KVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLS  1050
                           + VAM+GDGINDA ALA + +G+++ G    A + + +VLM  RL 
Sbjct  652   HGNSKTLPSSHTPPRKVAMIGDGINDAPALAQADLGISLQGATEVALETADIVLMGTRLL  711

Query  1049  QLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSI  870
              ++ A++LS  T   ++QNL WA GYN + +PVAAG+LLP    +L+P++AGALM  SSI
Sbjct  712   DVVQAIDLSLATFYKIRQNLLWALGYNTLAIPVAAGLLLPTFSLVLSPALAGALMACSSI  771

Query  869   GVMTNSLLLRLKF  831
              V+TNSLLLR +F
Sbjct  772   TVVTNSLLLRRQF  784



>ref|XP_010535751.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Tarenaya 
hassleriana]
Length=885

 Score =   516 bits (1329),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 341/817 (42%), Positives = 485/817 (59%), Gaps = 74/817 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQ--QLGEELAKH  2970
             GM CGGC A VK +L +  +V S  VN+ TETA V      ++ P  Q+     E LAK 
Sbjct  86    GMMCGGCVARVKSVLAADEQVDSVVVNMLTETAAV------RLKPEVQEVADAAESLAKK  139

Query  2969  LTSCGFKANVRDS---RRENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLS  2802
             LT CGF+A  R S     EN+ +   K+M +K+ +L    R  +A +W L A+C   H S
Sbjct  140   LTDCGFEAKRRVSGLGVAENVKKW--KEMVSKKEELLVKSRNRVAFAWTLVALCCGSHSS  197

Query  2801  HFFG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVG  2640
             H         A   +   LH++     + +  LL PGR+L+ DGLK+  K +PNMN+LVG
Sbjct  198   HILHSLGIHIAHGGFWEFLHNSYVKGGLAVGALLGPGRELLFDGLKAFAKRSPNMNSLVG  257

Query  2639  LGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNV  2463
             +G++++F +S ++   P L W A FF+EPVML+ FVLLGR+LE+RAK++A+SDM  LL++
Sbjct  258   IGSVTAFTISLISLLNPGLEWDASFFDEPVMLLGFVLLGRSLEERAKLRASSDMNELLSL  317

Query  2462  LPSKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGR  2310
             + +++RLV+ S          +      ++VP  ++ VGD ++VLPG+  P DG V AGR
Sbjct  318   ITNQSRLVITSSGSDSPSDSVLSSDAICIDVPIDDIRVGDSLLVLPGETFPVDGRVVAGR  377

Query  2309  STVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSR  2130
             S VDES  TGE LPV K  G  V+AG++N +G L +E    G  + I  IVR+VE+AQ  
Sbjct  378   SVVDESMLTGESLPVFKEEGCPVSAGTVNWDGPLRIEASSTGSNSTISKIVRMVEDAQGN  437

Query  2129  EAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQ------Gslaslalql  1968
              APVQRLAD ++G F Y V+ LS ATF FW   G+ + P  L        G    L+L+L
Sbjct  438   AAPVQRLADAIAGPFVYTVITLSVATFAFWYYIGSNIFPDVLLNDISGPGGDPLVLSLKL  497

Query  1967  scsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTI  1788
             +  VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + ++ + FDKTGTLT 
Sbjct  498   AVDVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASIDCVAFDKTGTLTE  557

Query  1787  GRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSR  1608
             G+P V+ +                +   + E ++L +A+ VE    HPI KAI++ A+  
Sbjct  558   GKPVVSGI----------------ACFLYEESEILKIAAAVEKTATHPIAKAIIKEAEGL  601

Query  1607  NCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN-----  1443
                I        + EPG G +A ++ + V+VG +DWV      +  + +    ++     
Sbjct  602   KLEIPVTRGQ--LTEPGFGTLAEVDGRLVAVGAMDWVNDRFPEKKEISDVITLESIIDHR  659

Query  1442  ------------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDK  1302
                         ++VVYVG +G  + G I V D+LR DA   V  L ++GI T LLSGD+
Sbjct  660   LSSTSSSSSNHSKTVVYVGREGEGIIGAIAVSDRLRNDAEFTVARLKQKGIKTVLLSGDR  719

Query  1301  KNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv-  1125
             + A   VA  VGI  E+  Y + P++K  F+S +Q     VAMVGDGINDA +LA ++V 
Sbjct  720   EGAVATVAKNVGIETESTNYSLTPEQKFHFISNIQSSGSRVAMVGDGINDAPSLARANVG  779

Query  1124  -gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVA  948
               + I     AAS+ +SV+L++N+LS ++D L L++ TM  V QNL WA  YN+V +P+A
Sbjct  780   IALQIEAQETAASNAASVILLRNKLSHVVDVLGLAKATMSKVYQNLAWAVAYNVVAIPIA  839

Query  947   AGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             AG+LLP     +TPS++G LM LSSI V++NSLLLRL
Sbjct  840   AGLLLPRYDFAMTPSLSGGLMALSSIFVVSNSLLLRL  876



>ref|WP_015139738.1| P-type ATPase, translocating [Nostoc sp. PCC 7524]
 ref|YP_007076906.1| P-type ATPase, translocating [Nostoc sp. PCC 7524]
 gb|AFY49309.1| P-type ATPase, translocating [Nostoc sp. PCC 7524]
Length=833

 Score =   513 bits (1321),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 337/816 (41%), Positives = 485/816 (59%), Gaps = 60/816 (7%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC ++V+R L   P V SA VNL TE AVV   SE   V        E LA+ L
Sbjct  25    GGMKCAGCVSAVERQLTQYPGVKSACVNLATEVAVV--ESETGAVDP------EGLAQKL  76

Query  2966  TSCGFKANVRDSRRENLFET-FEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
             T+ GF   +R +  +   ++        ++ Q++A+ R L ++  L     VGHL +F  
Sbjct  77    TAAGFPTQLRQANHQVTDKSPLADPRERQQQQMRAAWRQLIIAGLLLVFSSVGHLGNF--  134

Query  2789  AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
               +  +  L +  FH  +    LL+PGR +++DG     + APNMNTLVGLG ++++  S
Sbjct  135   -GSPILSSLTNIWFHCGLATVALLIPGRSILVDGWLGWRRNAPNMNTLVGLGTVTAYTAS  193

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
              +A   P+LGW+ FF+EPVM++ F+LLGR LEQ+A+ +A +    LL + P  ARL+ N 
Sbjct  194   LIALLFPQLGWECFFDEPVMMLGFILLGRTLEQQARGRAAAAFRQLLALQPQVARLIPNP  253

Query  2429  DM---GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTK  2259
             D+   G  T++VE+P   + VG+ + VLPGD+IP DG VR G++T+DES  TGE +PV K
Sbjct  254   DLEKVGLGTNSVEIPAEQVRVGEWVQVLPGDKIPVDGEVRFGQTTIDESMLTGEAVPVIK  313

Query  2258  LPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTY  2079
               G  VAAG+IN +G + ++  R G +T +  IV LVE AQ+R+APVQ+LAD V+G+FTY
Sbjct  314   QVGDAVAAGTINQSGAIAIQATRTGSDTTLAHIVALVEAAQTRKAPVQKLADTVAGYFTY  373

Query  2078  GVMALSAATFMFWNLFGTRVLP-ATLHQGslaslalqlscsvlvvaC-------------  1941
             GV+  S  TF+FW   GT + P  TL +G         + S   ++              
Sbjct  374   GVLTASVLTFIFWYFCGTHIWPHTTLSEGLAMMSHAAHTMSHSQLSIHHSPLVISLKLAI  433

Query  1940  -------PCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
                    PCALGLATPTA++VGT +GA RGLL++GG VLE    ++TIVFDKTGTLT G 
Sbjct  434   AVMVVACPCALGLATPTAILVGTGIGAERGLLIKGGDVLEKVHQLDTIVFDKTGTLTTGN  493

Query  1781  PTVTEVVPQGHNDETNAKRDS-----------------TSTCEWSEVDVLTLASGVESNT  1653
             P VT+ +  G  +E    R++                  ++   ++  ++ LA+ VES T
Sbjct  494   PKVTDCLGIGDWEEAGEAREAGEEKSNIPLSIQHAAQRPASANTTQHSLIQLAAAVESGT  553

Query  1652  NHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHG--VG  1479
              HP+ KAI + AK     I +A D  F  EPG G  AV+  + V +G  +W+  HG  + 
Sbjct  554   YHPLAKAIQQEAKRLELSIPEAVD--FHTEPGLGVSAVVAGETVLLGNWEWLSWHGIAIA  611

Query  1478  ETRVQEFDDF--KNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGD  1305
             ET  Q  +    + ++VV V + G LAGLI V+D LR DA   VE L + G+   LLSGD
Sbjct  612   ETAQQAANKLAAEGKTVVGVAIAGTLAGLIGVQDTLRTDAHDTVERLRQMGLRVMLLSGD  671

Query  1304  KKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQ-KDQKVVAMVGDGINDAAALassh  1128
             +   A  +A  +GI   +V  GV P +K+  +  LQ +  + VAMVGDGINDA AL+ + 
Sbjct  672   RPEVASAIAQKLGINSADVMAGVPPSKKAGIIQELQAQSAQQVAMVGDGINDAPALSQAD  731

Query  1127  vgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVA  948
             VG+A+  G   A + + +VLM++RLS +++A++LSR T   ++QNL+WAF YN +G+P+A
Sbjct  732   VGIALHSGTDVAMETAQIVLMRDRLSDVVEAIQLSRATFNKIQQNLFWAFAYNTIGIPLA  791

Query  947   AGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLR  840
             AG+LLP +G +L+P+ A ALM  SS+ V+TNS+LLR
Sbjct  792   AGVLLPNSGFVLSPASAAALMAFSSVSVVTNSVLLR  827



>ref|WP_006667964.1| MULTISPECIES: ATPase [Arthrospira]
 gb|EDZ97162.1| heavy metal translocating P-type ATPase [Arthrospira maxima CS-328]
Length=800

 Score =   510 bits (1313),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 329/796 (41%), Positives = 477/796 (60%), Gaps = 61/796 (8%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC  +V+R L  Q  V +  VNL TE A V       V P       ++LA  L
Sbjct  28    GGMKCAGCVMAVERQLNQQQGVIAVRVNLATEVATV-ECEPGTVDP-------QKLADIL  79

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAK-RAQLQASGRGLAVSWALCAVCL----VGHLS  2802
             T  GF + +R     +   TFE++   + R Q+   GR +     +C V +    +GH  
Sbjct  80    TETGFNSQLRYGSAAHQKLTFEERHRQEMRDQI---GRVI-----ICGVLIFLSGIGHFH  131

Query  2801  HFFGAKASW--IHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGAL  2628
             H      +W  + L+ S  FH  +    LL PGR LI+DG++SL + APNMNTLVGLG +
Sbjct  132   HI-----AWGGLPLVSSIWFHWGLATLALLFPGRSLIVDGVRSLARNAPNMNTLVGLGTI  186

Query  2627  SSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKA  2448
             S++  S +A   P+LGW+ FF+EPVML+ F+LLG+ LEQ+A+I+A      L  + P+ A
Sbjct  187   SAYTASLVALLFPRLGWECFFDEPVMLLGFILLGKTLEQQARIRAARAFEALWGLQPTTA  246

Query  2447  RLVVNSDMGEQTS----------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVD  2298
             ++++++ + E T           TVEVP   + VGD + V PG++IP DG V  G STVD
Sbjct  247   QVILSTQLPELTQENSAIAWSSPTVEVPAEQVRVGDLVKVFPGEKIPVDGRVIMGSSTVD  306

Query  2297  ESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPV  2118
             ES  TGE  PVTK     V AG++N +G L +   R G ET +  I+ LVE AQ+R+AP+
Sbjct  307   ESMLTGESFPVTKQRDLMVFAGTLNQSGGLIIAATRTGEETTVAQIISLVETAQTRKAPI  366

Query  2117  QRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQG-------slaslalqlscs  1959
             Q LADKV+G+FTY VM L+  T +FW   GT++ P  +  G       +   L+L+L+ +
Sbjct  367   QFLADKVAGYFTYLVMGLATLTLIFWYTIGTKIWPEVMTSGGVNLAVDAPLLLSLKLAIA  426

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLV+ACPCALGLATPTA++VG+++GA RG+L++GG +LE    ++T+VFDKTGTLT   P
Sbjct  427   VLVIACPCALGLATPTAILVGSAIGAERGILIKGGDILERVHQLHTVVFDKTGTLTTASP  486

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
              VT  V   H               +SE  +L LA+ VE  T+HPI  AI  A + RN  
Sbjct  487   QVTTCVSLSHG--------------FSEDRILQLAAAVEQGTHHPIATAICRALEGRNLP  532

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGV  1419
             I+ AE   F+ + G GA A+++ ++V VG+ + +   GV  +          ++VVYV V
Sbjct  533   IIDAEG--FVTQTGLGAAAMVDGERVWVGSAEGLSGCGVILSESVLSIIPPGETVVYVTV  590

Query  1418  DGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG  1239
                L G+I + D+L+ DA+  VE L K G+   LL+GD+ + AE +AS + +   +V   
Sbjct  591   GDELVGVIGICDRLKSDAKMTVERLQKMGLNVVLLTGDRFSVAEAIASELQLSEGSVLAE  650

Query  1238  VKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQN  1059
             V+P++K+K ++  Q+    VAMVGDGINDA ALA + V +A+G G   A + + +VLM +
Sbjct  651   VRPEDKAKAIAAYQQQGHRVAMVGDGINDAPALAQADVAIALGTGTDVAIETADIVLMGD  710

Query  1058  RLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGL  879
              L  +++++ LS+ T   ++QNL+WAF YN +GLP+AAG+LLP  G + +PS+A A M  
Sbjct  711   ALGDVVESIRLSQQTFNKIRQNLFWAFAYNTIGLPMAAGVLLPGFGIVFSPSVAAAFMAF  770

Query  878   SSIGVMTNSLLLRLKF  831
             SS+ V+TNSLLLR +F
Sbjct  771   SSVSVVTNSLLLRRQF  786



>ref|XP_003603219.1| Copper-exporting P-type ATPase A [Medicago truncatula]
Length=887

 Score =   512 bits (1319),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 342/815 (42%), Positives = 482/815 (59%), Gaps = 77/815 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC + VK IL S  RV S  VN+ TETA V    + K +      + + LA+ LT
Sbjct  93    GMMCGGCVSRVKTILSSDDRVDSVVVNMLTETAAV----KLKKLEEESTSVADGLARRLT  148

Query  2963  SCGFKANVRDS---RRENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
              CGF    R+S     EN+ +   K++  K+ +L A  R  +A +W L A+C   H SH 
Sbjct  149   GCGFPTKRRESGLGVSENVRKW--KELVKKKEELLAKSRNRVAFAWTLVALCCGSHASHI  206

Query  2795  FG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
             F       A   +   LH++     + L  LL PG+ L+ DGL +  KG+PNMN+LVG G
Sbjct  207   FHSLGIHIAHGPFWEFLHNSYVKGGLALGALLGPGKDLLFDGLLAFKKGSPNMNSLVGFG  266

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F +SS++   P+L W A FF+EPVML+ FVLLGR+LE++A+I+A+SDM  LL+++ 
Sbjct  267   SIAAFIISSISLLNPELAWDASFFDEPVMLLGFVLLGRSLEEKARIQASSDMNELLSLIS  326

Query  2456  SKARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+ S  G  ++          VEVP  ++ VGD ++VLPG+ IP DG V AGRS 
Sbjct  327   TQSRLVITSSEGSPSTDSVLSSDAICVEVPTDDIRVGDSVLVLPGETIPIDGRVIAGRSV  386

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V+AG+IN +G L +E    G  T I  IVR+VE+AQSREA
Sbjct  387   VDESMLTGESLPVFKEEGLTVSAGTINWDGPLRIESSSTGSNTMISKIVRMVEDAQSREA  446

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F + +MALSAATF FW   GT + P  L       +G    L+L+LS 
Sbjct  447   PVQRLADSIAGPFVFSIMALSAATFAFWYFAGTHIFPDVLLNDIAGPEGDPLLLSLKLSV  506

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA++VGTSLG +        ++         +   + GTLT G+
Sbjct  507   DVLVVSCPCALGLATPTAILVGTSLGTSYQRRGCTRTLGWC-----KLYCSRQGTLTRGK  561

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V+ +                 +  + E ++L +A+ VE   +HPI KAI+  A+S   
Sbjct  562   PVVSAI----------------GSIHYGESEILHIAAAVEKTASHPIAKAIINKAES--L  603

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQ------  1440
              +V       I EPG G +A I+ + V+VG+L+WV  H    TR+   D    +      
Sbjct  604   ELVLPPTKGQIVEPGFGTLAEIDGRLVAVGSLEWV--HERFNTRMNPSDLMNLERALMNH  661

Query  1439  -----------SVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKN  1296
                        +VVYVG +G  + G I + D +REDA   V  L K+GI T LLSGD++ 
Sbjct  662   SSSTSSSKYSKTVVYVGREGEGIIGAIAISDIVREDAESTVMRLKKKGIKTVLLSGDREE  721

Query  1295  AAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--g  1122
             A   +A  VGI  + V   + P +KS F+S L+     VAMVGDGINDA +LA++ V   
Sbjct  722   AVATIAETVGIENDFVKASLSPQQKSAFISSLKAAGHHVAMVGDGINDAPSLAAADVGIA  781

Query  1121  vaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAG  942
             +       AASD +S++L+ N++SQ++DAL+L++ TM  V QNL WA  YN++ +P+AAG
Sbjct  782   LQNEAQENAASDAASIILLGNKISQVIDALDLAQATMAKVYQNLSWAVAYNVIAIPIAAG  841

Query  941   ILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL  837
             +LLP     +TPS++G LM +SSI V++NSLLL+L
Sbjct  842   VLLPQFDFAMTPSLSGGLMAMSSILVVSNSLLLKL  876



>ref|XP_002465760.1| hypothetical protein SORBIDRAFT_01g045340 [Sorghum bicolor]
 gb|EER92758.1| hypothetical protein SORBIDRAFT_01g045340 [Sorghum bicolor]
Length=877

 Score =   511 bits (1317),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 350/824 (42%), Positives = 479/824 (58%), Gaps = 96/824 (12%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGCAA V+ IL + PRV +A+VNL  E+A V      ++        GEELA  LT
Sbjct  92    GMMCGGCAARVRAILAADPRVETAAVNLLAESAAV------RLRAPAPPGAGEELAARLT  145

Query  2963  SCGFKANVRDSRRENLFETFEKK---MNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
              CGF    R            +K   M A++ +L A  RG +A +W L A+C   H SH 
Sbjct  146   ECGFPTTARRGGAAAGAGESARKWREMAARKEELLARSRGRVAFAWTLVALCCGSHASHI  205

Query  2795  FGA------KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
               +        +++ LLH++     +    LL PGR ++ DG ++  +G+PNMN+LVG G
Sbjct  206   LHSLGIHIGHGTFLDLLHNSYVKCGIATAALLGPGRDILFDGFRAFKQGSPNMNSLVGFG  265

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             + ++FA+S+++   P+L W + FF+EPVML+ FVLLGR+LE+ A++KA+SDM  L+++L 
Sbjct  266   SAAAFAISAVSLLNPELEWNSTFFDEPVMLLGFVLLGRSLEESARLKASSDMNELISLLS  325

Query  2456  SKARLVVNS---DMGEQTS------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
              ++RL+V S   D    TS      TVEVP  ++ VGD I+VLPG+ IP DG V  G S 
Sbjct  326   PQSRLIVTSSSDDPSADTSLNSDAITVEVPVDDVRVGDSILVLPGETIPVDGNVIGGSSF  385

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V +G++N                        VE+AQ+REA
Sbjct  386   VDESMLTGESLPVAKEIGLPVFSGTVNW-----------------------VEDAQAREA  422

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQ------Gslaslalqlsc  1962
             PVQRLAD ++G F Y VM L+AATF FW   GT V P  L        G    L+++L+ 
Sbjct  423   PVQRLADSIAGPFVYTVMTLAAATFSFWYYIGTHVFPEVLFNDIAGPDGDSLLLSIKLAV  482

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA+++GTSLGA RGLL+RGG VLE  + ++ +V DKTGTLT G+
Sbjct  483   DVLVVSCPCALGLATPTAILIGTSLGAKRGLLIRGGDVLERLAGIDALVLDKTGTLTEGK  542

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P VT                S ++  + + ++L LA+ VE    HPI  AI+  A+    
Sbjct  543   PVVT----------------SIASLAYEDTEILRLAAAVEKTALHPIANAIMNKAELLKL  586

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQ--EFDDFKN-----  1443
              I        + EPG G +A ++   V+VGTLDWV  H   ET+    E  D +N     
Sbjct  587   DIPITSGQ--LTEPGFGCLAEVDGSLVAVGTLDWV--HDRFETKASPTELRDLRNRLESM  642

Query  1442  -----------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKK  1299
                        +S+ YVG +G  + G I + D LREDA   VE L ++ ITT+LLSGD++
Sbjct  643   LSSEASSSNQSKSIAYVGREGEGIIGAIAISDILREDANLTVERLQQESITTFLLSGDRE  702

Query  1298  NAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--  1125
              A   +   +GI  EN+   + P +K+  +S LQ     VAMVGDGINDA +LA++ V  
Sbjct  703   EAVTSIGRTIGIRDENIKSSLTPQDKASIISTLQGKGHRVAMVGDGINDAPSLAAADVGI  762

Query  1124  gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAA  945
              +       AASD +SVVL+ NRLSQ++DAL LS+ TM  V QNL WA  YNIV +P+AA
Sbjct  763   AMRTHSKENAASDAASVVLLGNRLSQVVDALSLSKATMAKVHQNLAWAVAYNIVAIPIAA  822

Query  944   GILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKE  813
             G+LLP     +TPS++G LM LSSI V++NSLLL+L  + +  E
Sbjct  823   GVLLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQLHGSFQNTE  866



>ref|XP_007225307.1| hypothetical protein PRUPE_ppa001206mg [Prunus persica]
 gb|EMJ26506.1| hypothetical protein PRUPE_ppa001206mg [Prunus persica]
Length=881

 Score =   511 bits (1317),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 328/792 (41%), Positives = 471/792 (59%), Gaps = 62/792 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC + VK +L +  RV S +VN+ TETA +    E  V  +  + + E LA  LT
Sbjct  90    GMMCGGCVSRVKSVLSADERVDSVAVNMLTETAAIKLRPE--VAADGVETVAESLAGRLT  147

Query  2963  SCGFKANVRDSRR--ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
              CGF +  R S          +++ M  K   L  S   +  +W L A+C   H SH   
Sbjct  148   ECGFASKRRASGMGVTESVRKWKETMKKKEEMLVKSRNRVIFAWTLVALCCGSHASHILH  207

Query  2789  ------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGAL  2628
                   A  S+  +LH++     +    LL PGR L+ DGL++L KG+PNMN+LVG G+L
Sbjct  208   SLGIHVAHGSFWEVLHNSYAKAGLASGALLGPGRDLLFDGLRALKKGSPNMNSLVGFGSL  267

Query  2627  SSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSK  2451
             ++F +S+++   P L W A FF+EPVML+ FVLLGR+LE+RA+I+A+SDM  LL+++ ++
Sbjct  268   AAFTISAVSLLNPGLQWDASFFDEPVMLLGFVLLGRSLEERARIRASSDMNELLSLINTQ  327

Query  2450  ARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVD  2298
             +RLV+ S   + ++          VEVP  ++ VGD ++VLPG+ IP DG V AGRS VD
Sbjct  328   SRLVIASSENDSSADSVLCADAICVEVPTDDIRVGDSVLVLPGETIPVDGRVLAGRSVVD  387

Query  2297  ESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPV  2118
             ES  TGE LPV K     V+AG+IN +G L VE    G  + I  IVR+VE+AQ  EAP+
Sbjct  388   ESMLTGESLPVFKEKDLTVSAGTINWDGPLRVEASSTGSNSMISKIVRMVEDAQGNEAPI  447

Query  2117  QRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscsv  1956
             QRLAD ++G F Y +M LSA TF FW   GT++ P  L        G    L+L+L+  V
Sbjct  448   QRLADSIAGPFVYSIMTLSATTFAFWYYIGTQIFPDVLLNDIAGPDGDPLLLSLKLAVDV  507

Query  1955  lvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPT  1776
             LVV+CPCALGLATPTA++VGTSLGA +GLL+RG  VLE  + ++ I  DKTGTLT G+P 
Sbjct  508   LVVSCPCALGLATPTAILVGTSLGARQGLLVRGADVLERLANIDYIALDKTGTLTEGKPA  567

Query  1775  VTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRI  1596
             V+ +                ++  + E ++L +++ VE+  +HPI KAI+  AKS N  I
Sbjct  568   VSGI----------------ASFMYEESEILQISAAVENTASHPIAKAIINKAKSLNISI  611

Query  1595  VKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFK----------  1446
                +    + EPG G +A ++ + V+VG+L+WV     G T + +  + +          
Sbjct  612   PVTKRQ--LTEPGFGTLAEVDGRLVAVGSLEWVHERFQGRTDMSDILNLEQAVRQTSEGI  669

Query  1445  -----NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEY  1284
                  ++++VYVG +G  + G I + D LR DA   V  L ++GI T L SGD++ A   
Sbjct  670   TPSGYSKTIVYVGREGEGIIGAIAISDSLRHDAEFTVTRLQQKGIRTVLFSGDREEAVVT  729

Query  1283  VASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgvaig  1110
             +A  VGI  E +   + P  KS  +S L+ +   VAMVGDGINDA   ALA   + + + 
Sbjct  730   IAKAVGIENEFIKSSLTPQGKSGAISSLKDEGHRVAMVGDGINDAPSLALADVGIALQVE  789

Query  1109  ggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLP  930
             G   AAS+ +S++L+ N+LSQ++DALEL++ TM  V QNL WA  YN++ +P+AAG+LLP
Sbjct  790   GQENAASNAASIILLGNKLSQVVDALELAQATMAKVYQNLSWAVAYNVIAIPIAAGVLLP  849

Query  929   FTGTMLTPSIAG  894
                  +TPS++G
Sbjct  850   QYDFAMTPSLSG  861



>ref|WP_008056852.1| ATPase [Arthrospira sp. PCC 8005]
 emb|CCE20372.1| copper transporter [Arthrospira sp. PCC 8005]
 emb|CDM92911.1| copper transporter [Arthrospira sp. PCC 8005]
Length=800

 Score =   509 bits (1310),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 328/796 (41%), Positives = 477/796 (60%), Gaps = 61/796 (8%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC  +V+R L  Q  V +  VNL TE A V       V P       ++LA  L
Sbjct  28    GGMKCAGCVMAVERQLNQQQGVIAVRVNLATEVATV-ECEPGTVDP-------QKLADIL  79

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAK-RAQLQASGRGLAVSWALCAVCL----VGHLS  2802
             T  GF + +R     +   TFE++   + R Q+   GR +     +C V +    +GH  
Sbjct  80    TETGFNSQLRYGSAAHQKLTFEERHRQEMRDQI---GRVI-----ICGVLIFLSGIGHFH  131

Query  2801  HFFGAKASW--IHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGAL  2628
             H      +W  + L+ S  FH  +    LL PGR LI+DG++SL + APNMNTLVGLG +
Sbjct  132   HI-----AWGGLPLVSSIWFHWGLATLALLFPGRSLIVDGVRSLARNAPNMNTLVGLGTI  186

Query  2627  SSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKA  2448
             S++  S +A   P+LGW+ FF+EPVML+ F+LLG+ LEQ+A+I+A      L  + P+ A
Sbjct  187   SAYTASLVALLFPRLGWECFFDEPVMLLGFILLGKTLEQQARIRAARAFEALWGLQPTTA  246

Query  2447  RLVVNSDMGEQTS----------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVD  2298
             ++++++ + E T           TVEVP   + VGD + V PG++IP DG V  G STVD
Sbjct  247   QVILSTQLPELTQENSAIAWSSPTVEVPAEQVRVGDLVKVFPGEKIPVDGRVIMGSSTVD  306

Query  2297  ESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPV  2118
             ES  TGE  PVTK     V AG++N +G L +   R G ET +  I+ LVE AQ+R+AP+
Sbjct  307   ESMLTGESFPVTKQRDLMVFAGTLNQSGGLIIAATRTGEETTVAQIISLVETAQTRKAPI  366

Query  2117  QRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQG-------slaslalqlscs  1959
             Q LADKV+G+FTY VM L+  T +FW   GT++ P  +  G       +   L+L+L+ +
Sbjct  367   QFLADKVAGYFTYLVMGLATLTLIFWYTIGTKIWPEVMTSGGVNLAVDAPLLLSLKLAIA  426

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLV+ACPCALGLATPTA++VG+++GA RG+L++GG +LE    ++T+VFDKTGTLT   P
Sbjct  427   VLVIACPCALGLATPTAILVGSAIGAERGILIKGGDILERVHQLHTVVFDKTGTLTTASP  486

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
              VT  V   H               +S+  +L LA+ VE  T+HPI  AI  A + RN  
Sbjct  487   QVTTCVSLSHG--------------FSDDRILQLAAAVEQGTHHPIATAICRALEGRNLP  532

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGV  1419
             I+ AE   F+ + G GA A+++ ++V VG+ + +   GV  +          ++VVYV V
Sbjct  533   IIDAEG--FVTQTGLGAAAMVDGERVWVGSAEGLSGCGVILSESVLSIIPPGETVVYVTV  590

Query  1418  DGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG  1239
                L G+I + D+L+ DA+  VE L K G+   LL+GD+ + AE +AS + +   +V   
Sbjct  591   GDELVGVIGICDRLKSDAKMTVERLQKMGLNVVLLTGDRFSVAEAIASELQLSEGSVLAE  650

Query  1238  VKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQN  1059
             V+P++K+K ++  Q+    VAMVGDGINDA ALA + V +A+G G   A + + +VLM +
Sbjct  651   VRPEDKAKAIAAYQQQGHRVAMVGDGINDAPALAQADVAIALGTGTDVAIETADIVLMGD  710

Query  1058  RLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGL  879
              L  +++++ LS+ T   ++QNL+WAF YN +GLP+AAG+LLP  G + +PS+A A M  
Sbjct  711   ALGDVVESIRLSQQTFNKIRQNLFWAFAYNTIGLPMAAGVLLPGFGIVFSPSVAAAFMAF  770

Query  878   SSIGVMTNSLLLRLKF  831
             SS+ V+TNSLLLR +F
Sbjct  771   SSVSVVTNSLLLRRQF  786



>ref|WP_027843146.1| ATPase [Mastigocoleus testarum]
Length=826

 Score =   509 bits (1310),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 328/820 (40%), Positives = 483/820 (59%), Gaps = 68/820 (8%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVV-PNWQQQLGEELAKH  2970
             GGM C GC  +V+R L   P V+   VNL TE AVV   S+A VV PN        LA+ 
Sbjct  21    GGMKCAGCVKAVERQLAQYPGVTDVVVNLATEIAVVE--SQAGVVDPN-------ALAQK  71

Query  2969  LTSCGFKANVRDSRRENL-----FETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHL  2805
             +T  GF + +R S   ++         E K      ++++S   L ++  L  +  +GH 
Sbjct  72    ITDAGFPSQIRQSDANDVGSNSSVRDLETK---HHREMRSSMIQLVIAAVLLILSGIGHF  128

Query  2804  SHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALS  2625
              H  G     + ++ +  FH  +    LL+PG+++I+DG +SL +  PNMNTLV LG L+
Sbjct  129   GHLSGVM---LPVVSNIWFHCGLATLALLIPGKEIIVDGWRSLWRNTPNMNTLVALGTLT  185

Query  2624  SFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKAR  2445
             ++  S +A   P + W+ FF+EPVM++ F+LLGR LE+RA+ +A +    LL++ P  AR
Sbjct  186   AYIASVIALLFPNMAWECFFDEPVMMLGFILLGRTLEKRARGRAAAAFRKLLSLQPIVAR  245

Query  2444  LVVNSDMGEQ------TSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFT  2283
             L+ N    +       T+ +E+P + + VG+ + VLP ++IP DG V  G++TVDES  +
Sbjct  246   LIANPHKTKTEKNNITTNFIEIPAAQVKVGEWLQVLPSEKIPVDGEVMEGKTTVDESMLS  305

Query  2282  GEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLAD  2103
             GE +PV K PG +VAAG+IN +G + ++ +R G +T +  IV LVE AQ+R+APVQ+LAD
Sbjct  306   GEAVPVLKQPGDKVAAGTINQSGAIVIQAERTGDDTTLAHIVALVENAQTRKAPVQKLAD  365

Query  2102  KVSGHFTYGVMALSAATFMFWNLFGTRVLPATLHQGslasl-------alqlscsvlvva  1944
              V+G+FTYGV+  +  TF+FW   G  +       G   S        +L+L+ +V+VVA
Sbjct  366   TVAGYFTYGVLGAAILTFVFWYFIGVNIWDNLTIWGGTTSAGQASLLLSLKLAIAVMVVA  425

Query  1943  CPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV  1764
             CPCALGLATPTA++VGT++ A +GLL++GG VLE    ++T++FDKTGTLTIG+PTVT+ 
Sbjct  426   CPCALGLATPTAILVGTAIAAEKGLLIKGGDVLERVHQLDTVIFDKTGTLTIGKPTVTDC  485

Query  1763  V--------------PQGHNDETNAKRDSTSTCE--------------WSEVDVLTLASG  1668
             +              P+    E   +  S+ T                     +L LA+ 
Sbjct  486   LLIEELLTDNSATRKPEAQTYELQTQESSSQTITVTFPKERVKNLSPVLDSQSLLKLAAA  545

Query  1667  VESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRH  1488
             VES T HP   AI+ AA+ +N  I  A D  F  EPG G   V+EEK V +G   W+  H
Sbjct  546   VESGTVHPFATAIINAAQQQNLTIPVATD--FRTEPGLGVSGVVEEKSVLLGNKAWLELH  603

Query  1487  G--VGETRVQEFDDF-KN-QSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTY  1320
             G  V +T  Q  ++F KN ++VVYV V+  + G+  + D +REDA  VVE L +  +   
Sbjct  604   GIVVDQTLSQAVENFTKNGKTVVYVAVNYAIVGIFAISDVVREDAVSVVEQLQQMNLRVM  663

Query  1319  LLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAAL  1140
             LLSGD    A  +   + +   ++  GV P EK++ +  LQ +QK V MVGDGINDA AL
Sbjct  664   LLSGDTPEVAIALGRQLSLDDSDIIAGVMPGEKAEVIESLQNNQKHVGMVGDGINDAPAL  723

Query  1139  asshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVG  960
             + + VG+A+  G   A + + +VLM++ L+ +++++  SR T   ++QNL+WAF YN +G
Sbjct  724   SQADVGIALHSGTDVAMETADIVLMRDSLNDVVESIRFSRATFNKIRQNLFWAFAYNTLG  783

Query  959   LPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLR  840
             +P+AAGILLP    +LTP+ A ALM  SS+ V+TNSLLLR
Sbjct  784   IPLAAGILLPSFNFVLTPAGAAALMAFSSVSVVTNSLLLR  823



>ref|XP_008220574.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic [Prunus 
mume]
Length=886

 Score =   510 bits (1314),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 334/821 (41%), Positives = 489/821 (60%), Gaps = 68/821 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC + VK +L +  RV S +VN+ TETA +    E  V  +  + + E LA  LT
Sbjct  90    GMMCGGCVSRVKSVLSADERVDSVAVNMLTETAAIKLRPE--VAADGVETVAESLAGRLT  147

Query  2963  SCGFKANVRDSRRENLFETFEK--KMNAKRAQLQASGRGLAV-SWALCAVCLVGHLSHFF  2793
              CGF A+ R +    + E+  K  +M  K+ ++    R   + +W L A+C   H SH  
Sbjct  148   ECGF-ASKRRASGMGVTESVRKWKEMVKKKEEMLVKSRNRVIFAWTLVALCCGSHASHIL  206

Query  2792  G------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGA  2631
                    A  S+  +LH++     +    LL PGR L+ DGL++L KG+PNMN+LVG G+
Sbjct  207   HSLGIHVAHGSFWEVLHNSYVKAGLASGALLGPGRDLLFDGLRALKKGSPNMNSLVGFGS  266

Query  2630  LSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPS  2454
             L++F +S+++   P L W A FF+EPVML+ FVLLGR+LE+RA+I+A+SDM  LL+++ +
Sbjct  267   LAAFTISAVSLLNPGLQWDASFFDEPVMLLGFVLLGRSLEERARIRASSDMNELLSLINT  326

Query  2453  KARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             ++RLV+ S   + ++          VEVP  ++ VGD ++VLPG+ IP DG V AGRS V
Sbjct  327   QSRLVIASSENDSSADSVLCADAICVEVPTDDIRVGDSVLVLPGETIPVDGRVLAGRSVV  386

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DES  T      T     + A+  +  +G L VE    G  + I  IVR+VE+AQ  EAP
Sbjct  387   DESMLTLGMFTYT----GERASVHLFQDGPLRVEASSTGSNSMISKIVRMVEDAQGNEAP  442

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscs  1959
             +QRLAD ++G F Y +M LSA TF FW   GT++ P  L        G    L+L+L+  
Sbjct  443   IQRLADSIAGPFVYSIMTLSATTFAFWYYIGTQIFPDVLLNDIAGQDGDPLLLSLKLAVD  502

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVV+CPCALGLATPTA++VGTSLGA +GLL+RG  VLE  + ++ I  DKTGTLT G+P
Sbjct  503   VLVVSCPCALGLATPTAILVGTSLGARQGLLVRGADVLERLANIDYIALDKTGTLTEGKP  562

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
              V+ +                ++  + E ++L +++ VE+  +HPI KAI+  AKS N  
Sbjct  563   AVSGI----------------ASFMYEESEILQISAAVENTASHPIAKAIINKAKSLNIS  606

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFK---------  1446
             I   +    + EPG G +A ++ + V+VG+L+WV +   G T + +  + +         
Sbjct  607   IPVTKRQ--LTEPGFGTLAEVDGRLVAVGSLEWVHKRFQGRTDMSDILNLEQAVRQTSEG  664

Query  1445  ------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAE  1287
                   ++++VYVG +G  + G I + D LR DA   V  L ++GI T L SGD++ A  
Sbjct  665   ITPSGYSKTIVYVGREGEGIIGAIAISDSLRHDAEFTVTRLQQKGIRTVLFSGDREEAVA  724

Query  1286  YVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgvai  1113
              +A  VGI  E +   + P  KS  +S L+ +   VAMVGDGINDA   ALA   + + +
Sbjct  725   TIAKAVGIENEFIKSSLTPQGKSGAISSLKDEGHRVAMVGDGINDAPSLALADVGIALQV  784

Query  1112  gggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILL  933
              G   AAS+ +S++L+ N+LSQ++DALEL++ TM  V QNL WA  YN++ +P+AAG+LL
Sbjct  785   EGQENAASNAASIILLGNKLSQVVDALELAQATMAKVYQNLSWAVAYNVIAIPIAAGVLL  844

Query  932   PFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEI  810
             P     +TPS++G +M LSSI V+TNSLLL+L  +   ++I
Sbjct  845   PQYDFAMTPSLSGGMMALSSIFVVTNSLLLQLHRSDGSRKI  885



>ref|WP_035987250.1| ATPase [Leptolyngbya sp. KIOST-1]
Length=791

 Score =   507 bits (1305),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 335/793 (42%), Positives = 476/793 (60%), Gaps = 56/793 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+  L     V SA+VNL TE AVV    E K+       L E++A+   
Sbjct  28    GMKCAGCVRAVENRLAQVEGVRSATVNLVTEVAVV----ETKIGAVTADYLAEQVAQ---  80

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF A  R S  +   +     + AKRA+ Q  GR L V+ AL  +  +GHL+HF    
Sbjct  81    -AGFGATPRTSDGDG--DDLTAWVEAKRAEQQQQGRRLGVAIALLVLSAIGHLNHF----  133

Query  2783  ASW--IHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
               W  + +L    FH  +   TL  P R +++DG   L +  PNMNTLV LG++S++  S
Sbjct  134   -GWLTVPVLSDLWFHAVLATVTLAFPARAILVDGWTGLRRLTPNMNTLVALGSVSAYLAS  192

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVN-  2433
              +A     LGW+ FF+EPVML+AF+LLGR LEQRA+ +A   +  L+ + P+ ARL+ N 
Sbjct  193   VVALVFSGLGWECFFDEPVMLLAFILLGRTLEQRARYRAADALRSLVELQPAVARLISNP  252

Query  2432  SDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLP  2253
             +  G   + VEVP   L VG+ + VLPG+++PADG + +G+STVDES  TGE +PV K P
Sbjct  253   ATAGIAQTGVEVPARCLQVGEWVQVLPGEKVPADGTIVSGQSTVDESMLTGESMPVLKQP  312

Query  2252  GAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGV  2073
             G  V AG++N +G + ++V   G  T +  ++RLVE AQSR+AP+QRLAD +SG+FTYGV
Sbjct  313   GDGVTAGTLNQSGAIALQVTGTGQNTVLAQMIRLVETAQSRKAPIQRLADVISGYFTYGV  372

Query  2072  MALSAATFMFWNLFGTRVLPATLHQG--------------slaslalqlscsvlvvaCPC  1935
             M L+  TF+FW   G    P  +H                S   ++L+L+ +V+VVACPC
Sbjct  373   MTLATLTFLFWYFIGLHQWPEVMHSALGMAHMGHTMTYTSSTLLVSLKLAIAVMVVACPC  432

Query  1934  ALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQ  1755
             ALGLATPTA++VG+ LGA RGLLLRGG  LE+ + ++T+VFDKTGTLT+G+P VTEV  Q
Sbjct  433   ALGLATPTAILVGSGLGAERGLLLRGGDSLETIAHLDTVVFDKTGTLTLGQPAVTEV--Q  490

Query  1754  GHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGT  1575
                D+             SE D++ LA+ VES T HP+ KAI +AA +R   +++A++  
Sbjct  491   ALTDDL------------SEADIVQLAATVESGTQHPLAKAIHQAAAARELDLLQADE--  536

Query  1574  FIEEPGSGAMAVIEEKKV----SVGTLDW-VRRHGVGETRVQEFDDFK---NQSVVYVGV  1419
             F  +PG G  A +  +      ++G   W + R  + +  VQ+    +    Q+VVYV +
Sbjct  537   FDTQPGLGVAAQVTWRNTVQPCALGNQQWMIEREMMLDADVQDQAKARAEAGQTVVYVAL  596

Query  1418  DGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG  1239
                + GL+ + DQLR DA  VV+ L  QG+   +L+GD+K  A  +A+ + +  + V   
Sbjct  597   GDAVVGLVAIADQLRPDAAAVVKDLQDQGLQVRVLTGDRKEVAGAIAAQIHLNPDQVTAE  656

Query  1238  VKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQN  1059
             V P  K   +  LQ     VA++GDGINDA ALA + VG+++  G   A + + V+LM +
Sbjct  657   VSPQGKVDAIRQLQDSGHTVALMGDGINDAPALAQADVGISLHSGTDIAMETADVILMGD  716

Query  1058  RLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGL  879
             +LS LL+ L LSR T   ++QNL WAF YN+V +P+AAG+LLP  G  LTP+ AG +M  
Sbjct  717   QLSALLETLTLSRATFNKIRQNLAWAFAYNLVAIPLAAGVLLPTAGVSLTPAAAGGMMAF  776

Query  878   SSIGVMTNSLLLR  840
             SS+ V+ NSLLLR
Sbjct  777   SSVAVVVNSLLLR  789



>gb|EPS60878.1| hypothetical protein M569_13922, partial [Genlisea aurea]
Length=783

 Score =   506 bits (1302),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 343/818 (42%), Positives = 474/818 (58%), Gaps = 94/818 (11%)
 Frame = -2

Query  3140  MTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQL---GEELAKH  2970
             M CG C   VK IL +  RV S  VN+ TETA V      K+   +   L    +ELA  
Sbjct  1     MMCGACVTRVKSILSADQRVQSVVVNMLTETAAV------KLKRGFGDDLSTVADELATA  54

Query  2969  LTSCGFKANVRDSRR--ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHF  2796
             ++  GF A  R S    E    T+ +K+  K A L  S   +A +W L AVC   H SH 
Sbjct  55    VSGGGFDARRRVSGMGIEEKVRTWREKVEKKEALLAKSRGRVAFAWTLVAVCCGSHASH-  113

Query  2795  FGAKASWIHLLHSTGFHMS----------------MCLFTLLVPGRQLIIDGLKSLLKGA  2664
                      +LHS G H++                + L +LL PGR+L+ DGL +  KG+
Sbjct  114   ---------ILHSLGIHIAHGPIFDTLHNPFVRSGLALGSLLGPGRELLFDGLGAFTKGS  164

Query  2663  PNMNTLVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATS  2487
             PNMN+LVG GA+++FA+S ++   P L W A FF+EPVML+ F+LLGR+LE+R +I+A+S
Sbjct  165   PNMNSLVGFGAIAAFAISMVSLLNPDLQWNASFFDEPVMLLGFILLGRSLEERVRIQASS  224

Query  2486  DMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSN----------LSVGDQIIVLPGDRIP  2337
             DM  LL++L +K+RLVVN   G + ST  V C +          + +GD I+VLPG+ IP
Sbjct  225   DMNELLSLLSTKSRLVVNPS-GSEISTDSVLCPDDMCTEVSTDAIRIGDSILVLPGETIP  283

Query  2336  ADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIV  2157
              DG V AGRS VDES  TGE LPV K  G  V+AG++N +G L +E    G  + I  IV
Sbjct  284   VDGKVLAGRSVVDESMLTGESLPVFKERGLSVSAGTVNWDGPLRIEASSTGSNSTISKIV  343

Query  2156  RLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQG  1995
              ++E+AQ REAP+QRLAD ++GHF Y +M LSA TF FW   GT V P  L        G
Sbjct  344   NMIEDAQGREAPIQRLADSIAGHFVYTIMTLSAGTFAFWYYIGTDVFPTVLLNDIAGPDG  403

Query  1994  slaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIV  1815
             +   L+L+L+  VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + ++ I 
Sbjct  404   NSLLLSLKLAVDVLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLAGIDCIT  463

Query  1814  FDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGK  1635
              DKTGTLT GRPTV+ V    H                 E ++L +A+ VE    HP+ K
Sbjct  464   LDKTGTLTEGRPTVSAVASLHHE----------------ESEILRIAAAVEKTALHPLAK  507

Query  1634  AIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV-------------R  1494
             AI+  A+S N  I        + EPGSG +A +E   V+VG  +WV             +
Sbjct  508   AIISKAESLNLSIPATRRQ--LVEPGSGTLAEVEGLLVAVGKSNWVCDCFQRTTSLSDLK  565

Query  1493  RHGVGETRVQEFDDF-----KNQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQG  1332
             R  +     Q  D        ++++VYVG +G  + G I + D+LR+DA   +  L ++G
Sbjct  566   RLELSLEHHQSLDGLSSSFGHSRTIVYVGREGEGVIGAIAIADELRDDAESTISRLQEKG  625

Query  1331  ITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGIND  1152
             I T +LSGD++ A   VA  VG+ +E   + + P +KS  +S L++    VAMVGDGIND
Sbjct  626   IRTVILSGDREEAVAAVAKRVGVEKEFAHFSLTPQQKSSVISRLKESGHRVAMVGDGIND  685

Query  1151  AA--ALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAF  978
             A   ALA   + +   G   AAS+ +SVVL+ NRLSQ+++A+E+ R TM  V+QNL WA 
Sbjct  686   APSLALADVGIALQNEGHENAASNAASVVLLGNRLSQVVEAIEIGRETMAKVRQNLTWAI  745

Query  977   GYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGV  864
              YN V +PVAAG+LLP     +TPS++G ++  +++ +
Sbjct  746   AYNAVAIPVAAGLLLPQFDFAMTPSLSGNVIRFTTVSI  783



>ref|WP_027403978.1| ATPase [Aphanizomenon flos-aquae]
Length=804

 Score =   505 bits (1300),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 330/806 (41%), Positives = 485/806 (60%), Gaps = 72/806 (9%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLG----EEL  2979
             GGM C GC  +V++ L     V S  VNL TE AVV            + ++G    E L
Sbjct  30    GGMKCAGCVNAVEKQLIQHSGVKSVCVNLATEVAVV------------EAEVGTVDIEAL  77

Query  2978  AKHLTSCGFKANVRDSRR--ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHL  2805
              + LT+ GF + +R  +   +NL    E +   +R ++Q + R L ++  L  +  +GH 
Sbjct  78    VQGLTATGFPSQLRTGKSAGDNLQSAVEAR---QRQEMQGTVRQLGIAGLLLLLSGIGH-  133

Query  2804  SHFFGAKASWIH-LLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGAL  2628
                FG   S I   L+   FH  +    +++PGR ++++G     +GAPNMNTL+GLG L
Sbjct  134   ---FGNIGSVIFPFLNDIWFHCGLATIAIIIPGRPILVEGWLGWRRGAPNMNTLIGLGTL  190

Query  2627  SSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKA  2448
             +++  S +A   P++GW+ FF+EPVM++ F+LLGR LE++A+ +A      LL + P  A
Sbjct  191   TAYTASLVALLFPQMGWECFFDEPVMMLGFILLGRTLEKQARGRAAKAFRQLLALAPQTA  250

Query  2447  RLVVNSD---MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGE  2277
             RL++N +   +    + +E+P   + VG+ + VLPGD+IP DG VR G++T+DES  TGE
Sbjct  251   RLIINPEPEKLIAGANIMEIPAEQVRVGEWLQVLPGDKIPVDGEVRFGQTTIDESMLTGE  310

Query  2276  PLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKV  2097
              +PV K PG  V  G++N +G + ++  R G +T +  IV LVE AQ+R+APVQ+LAD V
Sbjct  311   VVPVMKQPGDTVTGGTLNQSGAIAIQATRTGDDTILAQIVALVEAAQTRKAPVQKLADTV  370

Query  2096  SGHFTYGVMALSAATFMFWNLFGTRVLP--------ATLH-------------QGslasl  1980
             +G+FTYGV+  +  TF+FW L GT + P        A  H             Q S   +
Sbjct  371   AGYFTYGVLTAAGLTFVFWYLLGTHLWPDVTMSGAMAMAHNMGHNPQHLLPHTQYSSLLI  430

Query  1979  alqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTG  1800
             +L+L+  V+VVACPCALGLATPTA++VGT +GA RGLL++GG VLE    ++T+VFDKTG
Sbjct  431   SLKLAIVVMVVACPCALGLATPTAILVGTGMGAERGLLIKGGDVLEKVHKLDTVVFDKTG  490

Query  1799  TLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEA  1620
             TLT G+PTVT+ +             + ST   S   ++ LA+ VES T HP+  AI + 
Sbjct  491   TLTTGKPTVTDCL-----------VIAESTLPSS---LIQLAAAVESGTYHPLATAIQQE  536

Query  1619  AKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRH--GVGETRVQEFDDF-  1449
             AK+R   I  A D  F  EPG G  AV+E KKV +G  +W   H   + ET  ++     
Sbjct  537   AKARELIIPHAVD--FHTEPGMGVSAVVEGKKVLLGNWEWFNYHQININETAEKQRQRLA  594

Query  1448  -KNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASV  1272
              + ++V+ V VDG L+GLI V D LR DA+  V+ L + G+   +LSGD+  AA+ +A  
Sbjct  595   TEGKTVIGVAVDGTLSGLIAVSDTLRPDAKTAVDKLRQMGLRVMILSGDRLEAAKAIAKQ  654

Query  1271  VGIPRENVFYGVKPDEKSKFVSGLQ--KDQKVVAMVGDGINDAAALasshvgvaigggvg  1098
             +GI   ++  G+ P +K+  +  LQ  K    VAMVGDGINDA AL+ + VG+A+  G  
Sbjct  655   LGIANTDIMAGIPPAQKAATIQSLQCGKINTFVAMVGDGINDAPALSQADVGIALHSGTD  714

Query  1097  aasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGT  918
              A + + ++LM+N L+ ++ +++LSR T  T++QNL+WAF YN +G+P+AAGILLP  G 
Sbjct  715   VAMETAEIILMRNSLTDVVKSIQLSRATFNTIRQNLFWAFAYNTIGIPLAAGILLPAYGF  774

Query  917   MLTPSIAGALMGLSSIGVMTNSLLLR  840
             +L P+ A ALM  SS+ V+TNS+LLR
Sbjct  775   VLGPASAAALMAFSSVSVVTNSILLR  800



>ref|WP_017288390.1| hypothetical protein [Leptolyngbya boryana]
Length=764

 Score =   503 bits (1294),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 313/782 (40%), Positives = 468/782 (60%), Gaps = 62/782 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V++ L  QP V SA+VNL TE A V    +  V P+        LA  LT
Sbjct  22    GMKCAGCVRAVEKQLIQQPGVKSATVNLVTELATVE--CDRSVDPD-------HLAATLT  72

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF +  R S      E   ++   ++ Q       LA++  L     +GHL       
Sbjct  73    EAGFPSQPRTSEDSTRAEDLAERRQLEQKQ---QTTNLAIAILLLIFSTIGHLG------  123

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I LL     H  + +  L  PGR +I++G + L +  PNMNTLV LGAL++F  S +
Sbjct  124   ---IPLLSDVWVHCGLAIAALSFPGRSMIVEGWQGLRRNVPNMNTLVSLGALTAFTASFI  180

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A  +P+LGW+ FF+EPVML+ F+LLGR LEQRA+ +A   +  L  + P  ARL+   D 
Sbjct  181   ALIVPQLGWECFFDEPVMLVGFILLGRTLEQRARGQAAIALQSLAALQPKSARLIGKQDT  240

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
              +  S +E+P ++L  GD + VLP ++IP DG +  G +T+DES  TGE +PV K  G  
Sbjct  241   HQ--SAIEIPVAHLRPGDWLQVLPSEQIPVDGEIVKGETTIDESMLTGESVPVQKQVGDF  298

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AG++N +G + ++V R G ET +  I+  VE AQ+R+AP+Q+LAD ++G+FTYGVM++
Sbjct  299   VTAGTMNQSGAIALQVTRVGKETTLARILEFVETAQARKAPIQKLADTIAGYFTYGVMSI  358

Query  2063  SAATFMFWNLFGTRV----------LPATLHQGslaslalqlscsvlvvaCPCALGLATP  1914
             +  TF+FW   GT++          +  +   G ++  +  L    L +ACPCALGLATP
Sbjct  359   ALLTFLFWEFIGTKLWSNAGAWTIGMEHSHSMGMMSHPSPMLLSVKLAIACPCALGLATP  418

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VG+ +GA RGLL+RGG VLE    ++TIVFDKTGTLT G+P VT+V+         
Sbjct  419   TAILVGSGIGAERGLLIRGGDVLERVHSLDTIVFDKTGTLTTGQPVVTDVI---------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                      E+    VL +A+ VE  T HP+  AI +AA   +  ++ AED  F   PG 
Sbjct  470   ---------EFENNQVLQIAAAVERGTRHPLAAAIQQAAT--DLPLLPAED--FYTLPGF  516

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGETRVQEFDDF--KNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++++   +GT  W+ ++   +  + +++ +      +++VYV  D ++ G+I V 
Sbjct  517   GVSATVDQQPAFLGTAQWMEKNQIEISASAIEQANQLAASGKTIVYVATDKLI-GIIAVS  575

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVS  1206
             D LR DA+  +++L K  +   +L+GD+K  A  +AS +GI    +   + P+EK+  ++
Sbjct  576   DALRSDAKSTIQALKKLNLKILMLTGDRKETASAIASELGI--TEILAEIPPEEKAAAIA  633

Query  1205  GLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALEL  1026
              LQ +Q  VAMVGDGINDA ALA + VG+A+  G   A + + +VLM++RL+ +++++ L
Sbjct  634   QLQANQHQVAMVGDGINDAPALAQADVGIALQSGTEVAIETAGIVLMRDRLTDVVESIRL  693

Query  1025  SRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLL  846
             SR T   ++QNL+WAFGYN++G+P+AAG LLP  G +L+P+ AGALM LSS+ V+TNSLL
Sbjct  694   SRATFTKIQQNLFWAFGYNLLGIPIAAGALLPSFGLLLSPAAAGALMALSSVSVVTNSLL  753

Query  845   LR  840
             LR
Sbjct  754   LR  755



>ref|WP_015142660.1| heavy metal translocating P-type ATPase [Pleurocapsa minor]
 ref|YP_007079909.1| heavy metal translocating P-type ATPase [Pleurocapsa sp. PCC 
7327]
 gb|AFY76352.1| heavy metal translocating P-type ATPase [Pleurocapsa sp. PCC 
7327]
Length=853

 Score =   504 bits (1298),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 338/854 (40%), Positives = 490/854 (57%), Gaps = 107/854 (13%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L   P V SA VNL TE AVV      + VP   Q   E LA+ LT
Sbjct  27    GMKCAGCVKAVERQLTQNPGVVSACVNLVTEVAVV------QYVPGAIQP--ENLAQKLT  78

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF + +R S      E     +  ++ +++   R LA++  L     +GHL H  G K
Sbjct  79    ETGFPSRLRSSAAGGAGELATSAVERRQQEVKQQLRNLAIAAILLVFSSLGHLDHIGGPK  138

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I    +  FH ++    LL PGR L+IDG +SL  G PNMNTLVGLG  S++  S +
Sbjct  139   ---IPFFSNIWFHWALATLALLFPGRSLLIDGWRSLWHGMPNMNTLVGLGTFSAYLASCI  195

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P+L W+ FF+EPVML+ F+ LGR LE RA+I+A S +  L+ + P  ARL+ +   
Sbjct  196   ALLFPQLEWECFFDEPVMLLGFIFLGRTLEARARIRARSALEALVALQPPLARLIGDPST  255

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
              +  S +E+P   + VG+ + VLPG++IP DG + AG+ +VDES  TGE LPV K  G  
Sbjct  256   AD-PSGIEIPVEQVRVGEWVWVLPGEKIPVDGEIVAGQCSVDESMLTGESLPVAKQEGNT  314

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AG++N +G + ++  R G +T +  I+  VE+AQ+R+APVQ+LAD V+G+F YGVMA+
Sbjct  315   VTAGTLNQSGAIAIKATRIGKDTTLAKIIASVEDAQTRKAPVQQLADTVAGYFAYGVMAV  374

Query  2063  SAATFMFWNLFGTRVLPATLHQGsl-------------aslalqlscsvlvvaCPCALGL  1923
             ++ TF+FW+L GT++ P  L  G                 L+L+L+ +VLV+ACPCALGL
Sbjct  375   ASLTFLFWDLIGTKLYPEVLMAGMSHDMGHEMVMSPSPLLLSLKLAIAVLVIACPCALGL  434

Query  1922  ATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHND  1743
             ATPTA++VGT +GA  GLL++GG +LE    ++ IVFDKTGTLTIG PTVT+ +P     
Sbjct  435   ATPTAILVGTGIGAEHGLLIKGGEILEKVHQLDAIVFDKTGTLTIGHPTVTDCIP-----  489

Query  1742  ETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEE  1563
                         E +E  +L LA+ VES TNHP+  AI+E A+ R   +++A+D  F  E
Sbjct  490   ----------LTEINEDRLLQLAATVESGTNHPLATAIIEEAQKRELPLLEAKD--FYTE  537

Query  1562  PGSGAMAVIEEKKVSVGTLDWVRRHGVG---ETRVQEFDDFK-NQSVVYVGVDGVLAGLI  1395
              G G  A +  ++V +G   W+   G+      ++Q     K  ++VVY+ + G +AG+I
Sbjct  538   AGLGISASVGTEEVLLGNEAWMSDRGIAIDEAAQIQARSLAKAGKTVVYLAIAGKVAGII  597

Query  1394  YVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKS-  1218
              + D LR DA+  VE L + G+   L++GD+ + A  +A  VGI +  VF  V+P +K+ 
Sbjct  598   ALRDPLRPDAKETVERLQRLGLQVILVTGDRADVAGAIAQQVGIAQ--VFASVRPQQKAE  655

Query  1217  ---------------------------------KFVS---------------------GL  1200
                                              KF+                      G 
Sbjct  656   IIKSLQMGERKSEVRRHGNQGTRGSGESGGTPKKFIQNPFIPNPKSAVLLEKVQGACGGF  715

Query  1199  QKDQ----KVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
              K Q    K+VAM+GDGINDA ALA + +G+++ GG   A + + +VLM+ RL  +++A+
Sbjct  716   AKIQNPKSKIVAMIGDGINDAPALAQADIGISLHGGTDVAIETAGIVLMRERLLDVVEAI  775

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
             +LS  T   ++QNL+WA GYN + +PVAAG+LLP  G +L+P++AGALM  SS+ V+TNS
Sbjct  776   QLSLATFNKIRQNLFWALGYNTLAIPVAAGVLLPGFGLLLSPALAGALMAFSSVTVVTNS  835

Query  851   LLLRLKFASKQKEI  810
             LLLR +F  + + I
Sbjct  836   LLLRRQFKIQTRTI  849



>ref|WP_006528049.1| heavy metal-translocating P-type ATPase [Gloeocapsa sp. PCC 73106]
 gb|ELR99131.1| heavy metal-translocating P-type ATPase [Gloeocapsa sp. PCC 73106]
Length=745

 Score =   499 bits (1286),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 315/775 (41%), Positives = 466/775 (60%), Gaps = 66/775 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L   P V SASVNL TE AVV  + E  + P       E LA++L+
Sbjct  18    GMKCAGCVKAVERQLMQNPGVISASVNLVTEVAVVAYLPEV-IHP-------ETLAENLS  69

Query  2963  SCGFKANVRDSRRENL---FETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             + GF++ +R S+   +    +  E+K    + QL      L  +  L      GHL H  
Sbjct  70    NRGFESQIRTSQSARITADVDFLERKKQESQQQLGE----LITAAVLLLFSTFGHLKHLG  125

Query  2792  GAKASWIHL--LHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSF  2619
             G     IHL  + +  FH  +    LL+PGR LI DG+++L   +PNMNTLV LG LS++
Sbjct  126   G-----IHLPLVQTIAFHWGLATLALLIPGRALIQDGMRNLWYRSPNMNTLVALGTLSAY  180

Query  2618  AVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLV  2439
               S +A   P+L W+ FF+EPVML+ F+ LGR LE +A+ +A   ++ L+ + P  A L+
Sbjct  181   FASCVALLFPQLNWECFFDEPVMLLGFIFLGRTLEAKARTRAFRALSSLIALQPEVAYLI  240

Query  2438  --VNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPV  2265
               +NS+ G     +++P   + VG+ + VLPGD+IP DG +  G ++VDES  TGE +PV
Sbjct  241   GDLNSENG-----IKIPVEQVRVGEWVRVLPGDKIPIDGEIIQGETSVDESMLTGESIPV  295

Query  2264  TKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHF  2085
              K  G +V AG+IN +G + ++V R G +T +  I+ LVE AQ ++APVQ+LAD V+G+F
Sbjct  296   AKKVGDEVKAGTINQSGAIAIKVTRIGNQTTLAQIIALVETAQMQKAPVQKLADTVAGYF  355

Query  2084  TYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAV  1905
              YGVMA++  TF+ W   GT ++           L+L+L+ +VLV+ACPCALGLATPTA+
Sbjct  356   AYGVMAIALVTFITWYGVGTSII-----------LSLKLAIAVLVIACPCALGLATPTAL  404

Query  1904  MVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKR  1725
             +VGT +GA  G+L++GG VLE    ++TIVFDKTGTLT G+P VT  +P     E+    
Sbjct  405   LVGTGIGAENGILIKGGDVLERAHRIDTIVFDKTGTLTAGKPKVTACLPLSEEIESR---  461

Query  1724  DSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAM  1545
                        ++L LA+ +E  TNHP+  AI++ A+++   +  A D  +   PG G  
Sbjct  462   -----------ELLRLAATIEKGTNHPLATAIMQEAEAQELALEIATD--YYTAPGLGVR  508

Query  1544  AVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDA  1365
             A++  +   +G   W+   G+      E     NQ  VY+  +  L G+IY+ D LR DA
Sbjct  509   ALLAGEMFYLGNQAWLESQGINIIETLE----NNQIQVYLAKESKLLGVIYLSDSLRPDA  564

Query  1364  RHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQK  1185
             +  +E+L   G+   L+SGD++  AE +AS + I +  VF  VKP++K+K +  LQ   +
Sbjct  565   KATIETLQNLGLNVILMSGDREEIAEAIASQLKITQ--VFAQVKPEDKAKLIRSLQAQGR  622

Query  1184  VVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKT  1005
             VVAMVGDGINDA ALA + +G+ +      A + + +VL+ N+L  ++ A++LSR T   
Sbjct  623   VVAMVGDGINDAPALAQADLGITLQASTDVAIETADIVLISNKLKDVVSAIQLSRATFNK  682

Query  1004  VKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLR  840
             + QNL+WA GYN++ +P+AAGI     G +L+P+IAGALM  SS+ V+TNSLLL+
Sbjct  683   ICQNLFWALGYNLIAIPLAAGIF----GIVLSPAIAGALMAFSSVMVVTNSLLLK  733



>ref|NP_001190357.1| P-type ATPase [Arabidopsis thaliana]
 gb|AED92958.1| P-type ATPase [Arabidopsis thaliana]
Length=860

 Score =   503 bits (1294),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 343/821 (42%), Positives = 484/821 (59%), Gaps = 92/821 (11%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A VK +L S  RV+SA VN+ TETA V    E +V  +      E LAK LT
Sbjct  84    GMMCGGCVARVKSVLMSDDRVASAVVNMLTETAAVKFKPEVEVTAD----TAESLAKRLT  139

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
               GF+A  R S     EN+ +   K+M +K+  L    R  +A +W L A+C   H SH 
Sbjct  140   ESGFEAKRRVSGMGVAENVKKW--KEMVSKKEDLLVKSRNRVAFAWTLVALCCGSHTSHI  197

Query  2795  FGAKASWI------HLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
               +    I       LLH++     + +  LL PGR+L+ DG+K+  K +PNMN+LVGLG
Sbjct  198   LHSLGIHIAHGGIWDLLHNSYVKGGLAVGALLGPGRELLFDGIKAFGKRSPNMNSLVGLG  257

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F++S ++   P+L W A FF+EPVML+ FVLLGR+LE+RAK++A++DM  LL+++ 
Sbjct  258   SMAAFSISLISLVNPELEWDASFFDEPVMLLGFVLLGRSLEERAKLQASTDMNELLSLIS  317

Query  2456  SKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             +++RLV+ S          +   +  + V   ++ VGD ++VLPG+  P DG V AGRS 
Sbjct  318   TQSRLVITSSDNNTPVDSVLSSDSICINVSVDDIRVGDSLLVLPGETFPVDGSVLAGRSV  377

Query  2303  VDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREA  2124
             VDES  TGE LPV K  G  V+AG+IN                        VE+AQ   A
Sbjct  378   VDESMLTGESLPVFKEEGCSVSAGTINW-----------------------VEDAQGNAA  414

Query  2123  PVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlsc  1962
             PVQRLAD ++G F Y +M+LSA TF FW   G+ + P  L        G   +L+L+L+ 
Sbjct  415   PVQRLADAIAGPFVYTIMSLSAMTFAFWYYVGSHIFPDVLLNDIAGPDGDALALSLKLAV  474

Query  1961  svlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGR  1782
              VLVV+CPCALGLATPTA+++GTSLGA RG L+RGG VLE  + ++ +  DKTGTLT GR
Sbjct  475   DVLVVSCPCALGLATPTAILIGTSLGAKRGYLIRGGDVLERLASIDCVALDKTGTLTEGR  534

Query  1781  PTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNC  1602
             P V+ V   G+ ++                +VL +A+ VE    HPI KAIV  A+S N 
Sbjct  535   PVVSGVASLGYEEQ----------------EVLKMAAAVEKTATHPIAKAIVNEAESLNL  578

Query  1601  RIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV------RRHGVGETRVQEFDDFK--  1446
             +    E    + EPG G +A I+ + V+VG+L+WV      +       +++   D K  
Sbjct  579   K--TPETRGQLTEPGFGTLAEIDGRFVAVGSLEWVSDRFLKKNDSSDMVKLESLLDHKLS  636

Query  1445  --------NQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNA  1293
                     +++VVYVG +G  + G I + D LR+DA   V  L ++GI T LLSGD++ A
Sbjct  637   NTSSTSRYSKTVVYVGREGEGIIGAIAISDCLRQDAEFTVARLQEKGIKTVLLSGDREGA  696

Query  1292  AEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshv--gv  1119
                VA  VGI  E+  Y + P++K +F+S LQ     VAMVGDGINDA +LA + V   +
Sbjct  697   VATVAKNVGIKSESTNYSLSPEKKFEFISNLQSSGHRVAMVGDGINDAPSLAQADVGIAL  756

Query  1118  aigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGI  939
              I     AAS+ +SV+L++N+LS ++DAL L++ TM  V QNL WA  YN++ +P+AAG+
Sbjct  757   KIEAQENAASNAASVILVRNKLSHVVDALSLAQATMSKVYQNLAWAIAYNVISIPIAAGV  816

Query  938   LLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQK  816
             LLP     +TPS++G LM LSSI V++NSLLL+L  +   K
Sbjct  817   LLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQLHKSETSK  857



>ref|XP_007012429.1| P-type ATPase of 2 isoform 2 [Theobroma cacao]
 gb|EOY30048.1| P-type ATPase of 2 isoform 2 [Theobroma cacao]
Length=881

 Score =   503 bits (1295),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 333/794 (42%), Positives = 473/794 (60%), Gaps = 62/794 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC + VK ++ S  RV S  VNL TETA +  +++  +       +   +A+ ++
Sbjct  87    GMMCGGCVSRVKSVISSDERVESVVVNLLTETAAI-KLNQEVIESETVDSVAVSIAQRVS  145

Query  2963  SCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHF  2796
              CGF A  R S     EN+ +   K+M  K+ +L    R  +A +W L A+C   H SH 
Sbjct  146   ECGFMAKRRVSGLGIGENVRKW--KEMLKKKEELLVKSRNRVAFAWTLVALCCGSHASHI  203

Query  2795  FG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLG  2634
                     A   ++ +LH++ F   + L  LL PGR L++DGL +  KG+PNMN+LVG G
Sbjct  204   LHSLGIHIAHGPFLEVLHNSYFKGGLALAALLGPGRDLLVDGLMAFKKGSPNMNSLVGFG  263

Query  2633  ALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             ++++F +S+++   P L W A FF+EPVML+ FVLLGR+LE++A+I+A+SDM  LL+++ 
Sbjct  264   SIAAFIISAVSLLNPGLAWDASFFDEPVMLLGFVLLGRSLEEKARIQASSDMNELLSLIS  323

Query  2456  SKARLVVNSD--------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTV  2301
             +++RLV+ S         +      +EVP  ++ VGD ++VLPG+ IP DG V AGRS V
Sbjct  324   TRSRLVITSSDDSSADSVLCSDAICIEVPSDDIRVGDSVLVLPGETIPTDGKVLAGRSVV  383

Query  2300  DESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAP  2121
             DES  TGE LPV K  G  V+AG+IN +G L +E    G  + I  IVR+VE+AQ +EAP
Sbjct  384   DESMLTGESLPVFKEKGLMVSAGTINWDGPLRIEATSTGSNSTISKIVRMVEDAQGQEAP  443

Query  2120  VQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalqlscs  1959
             VQRLAD ++G F Y +M LSAATF FW   G+ + P  L        G    L+L+L+  
Sbjct  444   VQRLADAIAGPFVYSIMTLSAATFAFWYYAGSHIFPDVLLNDIAGPDGDPLLLSLKLAVD  503

Query  1958  vlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRP  1779
             VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + V+ + FDKTGTLT G+P
Sbjct  504   VLVVSCPCALGLATPTAILVGTSLGARQGLLIRGGDVLERLASVDHVAFDKTGTLTEGKP  563

Query  1778  TVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCR  1599
             TV+                S ++  + E ++L +A+ VE    HPI KAIV+ A+S N  
Sbjct  564   TVS----------------SVASFAYDESEILQIAAAVERTATHPIAKAIVKKAESLNLA  607

Query  1598  IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN--------  1443
               +   G  + EPG G +A +    V+VG L WV      + +  +  + ++        
Sbjct  608   FPETR-GQLV-EPGFGTLAEVNGHLVAVGNLKWVNERFQIKAKPSDLMNLEHATMHHSSS  665

Query  1442  -----QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYV  1281
                  ++ VYVG +G  + G I + D LR DA   V  L K+GI T L+SGD++ A   +
Sbjct  666   PSNNSKTAVYVGREGEGVIGAIGISDSLRYDAESTVRRLQKKGIKTILISGDREEAVATI  725

Query  1280  ASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALasshvgvaigg  1107
             A  VGI  E V   + P +KS+ +S LQ     +AMVGDGINDA   ALA   + +    
Sbjct  726   AQTVGIGSEFVNASLTPQQKSRVISTLQTAGHRIAMVGDGINDAPSLALADVGISIQTEA  785

Query  1106  gvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPF  927
                AASD +S++L+ NRLSQ++DAL+L++ TM  V QNL WA  YN V +P+AAG+LLP 
Sbjct  786   QDTAASDAASIILLGNRLSQVVDALDLAQATMAKVYQNLSWAVAYNAVAIPIAAGVLLPQ  845

Query  926   TGTMLTPSIAGALM  885
                 +TPS++G  M
Sbjct  846   YDFAMTPSLSGKKM  859



>ref|XP_006651094.1| PREDICTED: copper-transporting ATPase PAA2, chloroplastic-like 
[Oryza brachyantha]
Length=728

 Score =   497 bits (1279),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 323/739 (44%), Positives = 456/739 (62%), Gaps = 63/739 (9%)
 Frame = -2

Query  2894  MNAKRAQLQASGRG-LAVSWALCAVCLVGHLSHFFGA------KASWIHLLHSTGFHMSM  2736
             M A++A+L    RG +A +W L A+C   H +HF  +        +++ LLH++     +
Sbjct  1     MAARKAELLTRSRGRVAFAWTLVALCCGSHGTHFLHSLGIHVGHGTFLDLLHNSYVKCGI  60

Query  2735  CLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKA-FFEE  2559
              +  L  PGR ++ DGL++  +G+PNMN+LVG G+ ++FA+S+++   P+L W + FF+E
Sbjct  61    AIAALFGPGRDILFDGLRAFKQGSPNMNSLVGFGSAAAFAISAVSLLNPELEWNSTFFDE  120

Query  2558  PVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD---------MGEQTST  2406
             PVML+ FVLLGR+LE+ A++KA+SDM  L+++L  ++RLVV S          +     T
Sbjct  121   PVMLLGFVLLGRSLEESARLKASSDMNELISLLSPQSRLVVTSSSDDPSSDGALNSDAIT  180

Query  2405  VEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSI  2226
             VEVP  ++ +GD I+VLPG+ IP DG V  G S VDES  TGE LPV K  G+ V +G++
Sbjct  181   VEVPVDDVRIGDLILVLPGETIPVDGNVLGGSSYVDESMLTGESLPVPKEKGSSVFSGTV  240

Query  2225  NLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFM  2046
             N +G L ++    G  + I  IVR+VE+AQ+REAPVQRLAD ++G F Y VM LSAATF 
Sbjct  241   NWDGPLRIKATSTGPSSTIAKIVRMVEDAQAREAPVQRLADSIAGPFVYTVMTLSAATFS  300

Query  2045  FWNLFGTRVLPATL------HQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslg  1884
             FW   GT + P  L        G    L+L+L+  VLVV+CPCALGLATPTA+++GTSLG
Sbjct  301   FWYYIGTHIFPEVLLNDISGPDGDSLLLSLKLAVDVLVVSCPCALGLATPTAILIGTSLG  360

Query  1883  atrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCE  1704
             A RGLL+RGG VLE  + ++ I+ DKTGTLT GRP VT                S ++  
Sbjct  361   AKRGLLIRGGDVLERLAGIDAILLDKTGTLTKGRPVVT----------------SIASLA  404

Query  1703  WSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKK  1524
             + E ++L LA+ VE    HPI  AI++ A+     I        + EPG G +A ++ + 
Sbjct  405   FEEEEILRLAAAVEKTALHPIANAIMDEAERLKLDIPTTSGQ--LTEPGFGCLAEVDGRL  462

Query  1523  VSVGTLDWVRRHGVGETRVQEFD--DFKNQ---------------SVVYVGVDGV-LAGL  1398
             V+VGTLDWV  H   ET+    D  + +N                S+ +VG +G  + G 
Sbjct  463   VAVGTLDWV--HNRFETKASSTDLRELRNHLEFVSSSEESSTHSKSIAFVGREGEGIIGA  520

Query  1397  IYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKS  1218
             I + D LR+DA+ +V  L ++ ITT+LLSGD+K + E +   VGI  EN+   + P EKS
Sbjct  521   IAISDVLRDDAKAIVNRLQQEEITTFLLSGDRKESVESIGRTVGIRSENIKSSLTPHEKS  580

Query  1217  KFVSGLQKDQKVVAMVGDGINDAAALasshv--gvaigggvgaasdvssvVLMQNRLSQL  1044
               ++ LQ +   VAMVGDGINDA +LA++ V   +       AASD +SVVL+ N+LSQ+
Sbjct  581   SIITALQGEGHRVAMVGDGINDAPSLAAADVGIAMRTHAKESAASDAASVVLLGNKLSQV  640

Query  1043  LDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGV  864
             +DAL LS+ TM  V QNL WA  YNIV +P+AAG+LLP     +TPS++G LM LSSI V
Sbjct  641   MDALSLSKATMAKVHQNLAWAVAYNIVAIPIAAGVLLPQFDFAMTPSLSGGLMALSSIFV  700

Query  863   MTNSLLLRLKFASKQKEIQ  807
             ++NSLLL+L  + +  E Q
Sbjct  701   VSNSLLLQLHGSFENTEKQ  719



>gb|KHN32168.1| Putative copper-transporting ATPase PAA1 [Glycine soja]
Length=841

 Score =   499 bits (1286),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 332/772 (43%), Positives = 470/772 (61%), Gaps = 64/772 (8%)
 Frame = -2

Query  2993  LGEELAKHLTSCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCA  2826
             + E LA  L+ CGF    R S     EN+ +   K++  K+ +L    R  +A +W L A
Sbjct  71    VAESLALRLSDCGFPTKRRASSSGVTENVRKW--KELVKKKEELVVKSRSRVAFAWTLVA  128

Query  2825  VCLVGHLSHFFG------AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGA  2664
             +C   H SH F       A    + +LHS+     + L +LL PGR+L+ DGL +  KG+
Sbjct  129   LCCGSHASHIFHSLGIHIAHGPLMEILHSSYLKGGLALGSLLGPGRELLFDGLNAFKKGS  188

Query  2663  PNMNTLVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATS  2487
             PNMN+LVG G++++F +SS++   P L W A FF+EPVML+ FVLLGR+LE++A+I+A+S
Sbjct  189   PNMNSLVGFGSVAAFIISSISLLNPGLAWDASFFDEPVMLLGFVLLGRSLEEKARIQASS  248

Query  2486  DMTGLLNVLPSKARLVVNSDMGEQTS---------TVEVPCSNLSVGDQIIVLPGDRIPA  2334
             DM  LL+++ +++RLV+ S  G  ++          VEVP  ++ VGD ++VLPG+ IP 
Sbjct  249   DMNELLSLISTQSRLVITSTEGSPSTDTVLCSDAICVEVPTDDIRVGDSVLVLPGETIPI  308

Query  2333  DGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVR  2154
             DG V +GRS +DES  TGE LPV K  G  V+AG+IN +G L +E    G  T I  IVR
Sbjct  309   DGTVISGRSVIDESMLTGESLPVFKEKGLTVSAGTINWDGPLRIEASSTGSNTMISKIVR  368

Query  2153  LVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGs  1992
             +VE+AQSREAPVQRLAD ++G F Y VM LSAATF FW   G+ + P  L       +G 
Sbjct  369   MVEDAQSREAPVQRLADSIAGPFVYSVMTLSAATFAFWYFVGSHIFPDVLLNDIAGPEGD  428

Query  1991  laslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVF  1812
                L+L+LS  VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + +N I  
Sbjct  429   PLLLSLKLSVDVLVVSCPCALGLATPTAILVGTSLGARKGLLIRGGDVLERLAGINYIAL  488

Query  1811  DKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKA  1632
             DKTGTLT G+P V+ +                S+  + E ++L LA+ VE   +HPI KA
Sbjct  489   DKTGTLTKGKPVVSAI----------------SSILYGESEILRLAAAVEKTASHPIAKA  532

Query  1631  IVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDD  1452
             IV  A+S    ++    G  + EPG G +A ++   ++VG+L+WV           +  +
Sbjct  533   IVNKAESLEL-VLPVTKGQLV-EPGFGTLAEVDGHLIAVGSLEWVHERFQTRANPSDLTN  590

Query  1451  FKN---------------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTY  1320
              +N               ++VVYVG +G  + G I + D +REDA   +  L ++GI T 
Sbjct  591   LENSLMNHSLNTTSSKYSKTVVYVGREGEGIIGAIAISDTVREDAESTITRLKQKGIKTV  650

Query  1319  LLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAAL  1140
             LLSGD++ A   VA  VGI  + V   + P +KS F+S L+     VAMVGDGINDA +L
Sbjct  651   LLSGDREEAVATVADTVGIENDFVKASLSPQQKSGFISSLKAAGHHVAMVGDGINDAPSL  710

Query  1139  asshv--gvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNI  966
             A + V   +       AASD +S++L+ N++SQ++DAL+L++ TM  V QNL WA  YN+
Sbjct  711   AVADVGIALQNEAQENAASDAASIILLGNKISQVVDALDLAQATMGKVYQNLCWAVAYNV  770

Query  965   VGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQKEI  810
             V +P+AAG+LLP     +TPS++G LM LSSI V+ NSLLL+L  +   +++
Sbjct  771   VAIPIAAGVLLPHFDFAMTPSLSGGLMALSSIFVVGNSLLLQLHGSQISRKV  822



>ref|WP_015211246.1| heavy metal translocating P-type ATPase [Cylindrospermum stagnale]
 ref|YP_007150693.1| heavy metal translocating P-type ATPase [Cylindrospermum stagnale 
PCC 7417]
 gb|AFZ28013.1| heavy metal translocating P-type ATPase [Cylindrospermum stagnale 
PCC 7417]
Length=835

 Score =   499 bits (1285),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 340/825 (41%), Positives = 487/825 (59%), Gaps = 65/825 (8%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC  +V+R L  QP V SA VNL TE AVV    E   V        + LAK L
Sbjct  25    GGMKCAGCVKAVERQLTQQPGVKSACVNLVTEVAVV--ELETGAVD------ADALAKQL  76

Query  2966  TSCGFKANVRDSRRENLFET--FEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             T+ GF    R +  +   ET   +      R ++ A+ R L ++  L  +  +GH  +  
Sbjct  77    TTAGFPTQTRRANDKVTGETSALQDPAARGRREMLAAIRQLVIAGILLGLSGIGHFGNI-  135

Query  2792  GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAV  2613
                +S + +L++  FH  +    LL+PGR +++DG +   +  PNMNTLVGLG L++++ 
Sbjct  136   --GSSMLPMLNNIWFHCGLATVALLIPGRPILVDGWRGWRRNMPNMNTLVGLGTLTAYSA  193

Query  2612  SSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVN  2433
             S +A   P++GW+ FF+EPVM++ F+LLGR LEQ+A+ +A +    LL + P  ARL+ N
Sbjct  194   SLVALLFPQMGWECFFDEPVMMLGFILLGRTLEQQARGRAAAAFRQLLALQPQIARLIAN  253

Query  2432  SD---MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVT  2262
              D   +G   + VE+P   + VG+ + VLPGD+IP DG VR G++TVDES  TGE +P  
Sbjct  254   PDAEKIGAGATIVEIPAEQVRVGEWLQVLPGDKIPVDGEVRFGQTTVDESMLTGEAVPAI  313

Query  2261  KLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFT  2082
             K PG  V AG++N +G + ++  R G +T +  IV LVE AQ+R+APVQ+L D V+G+FT
Sbjct  314   KQPGDIVTAGTLNQSGAIAIQATRTGNDTTLAQIVALVEAAQTRKAPVQKLVDTVAGYFT  373

Query  2081  YGVMALSAATFMFWNLFGTRVLPATLHQGslasl--------------alqlscsvlvva  1944
             YGV+  +  TF FW  FGT +       G +  +              +L+L+ +V+VVA
Sbjct  374   YGVLTAALLTFAFWYFFGTHIWTDLTMSGGMEMMGHSPLPTPHSPILVSLKLAIAVMVVA  433

Query  1943  CPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV  1764
             CPCALGLATPTA++VGT +GA RGLL++GG VLE    ++T+VFDKTGTLT G PTVT+ 
Sbjct  434   CPCALGLATPTAILVGTGMGAERGLLIKGGDVLERVHQLDTVVFDKTGTLTTGNPTVTDC  493

Query  1763  V------------PQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEA  1620
             +             Q    E+  +   T     S   +L LA+ VES T HP+ KAI + 
Sbjct  494   LVFEELFAEGKIKAQELGAESKGENVPTPLPSASST-LLRLAAAVESGTYHPLAKAIQQF  552

Query  1619  AKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVG-ETRVQEFDD---  1452
             A+ +   I  A D  F  EPG G  AV+E   V +G  DW+  HG+    R Q+      
Sbjct  553   AQQQKLSIPDAVD--FHTEPGLGVSAVVEGVSVLLGNWDWLSWHGIAISERAQQSAQRLA  610

Query  1451  FKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASV  1272
              + ++VV V V G LAGLI + D LR DA+  V+ L + G+   LLSGD+  AA+ +A  
Sbjct  611   AEGKTVVCVAVGGTLAGLIAIFDTLRPDAQAAVDQLRQMGLRVMLLSGDRLEAADAIAKQ  670

Query  1271  VGIPRENVFYGVKPDEKSKFVSGLQK---------------DQKVVAMVGDGINDAAALa  1137
             +GI   +V  GV P +K+  +  LQK                  VVAMVGDGINDA AL+
Sbjct  671   LGIDSADVMAGVPPAKKAAAIESLQKGGIWITPDSCDLNLTQHSVVAMVGDGINDAPALS  730

Query  1136  sshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGL  957
              + VG+++  G G A + + ++LM++ LS +++A++LSR T   ++QNL+WAF YN +G+
Sbjct  731   QADVGISLHCGTGVAMETAEIILMRDCLSDVVEAIQLSRATFNKIRQNLFWAFAYNTIGI  790

Query  956   PVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASK  822
             P+AAG+ LP  G +L+PS A ALM  SS+ V+TNS+LLR +FA +
Sbjct  791   PLAAGVFLPSLGFVLSPSSAAALMAFSSVSVVTNSVLLR-RFAHR  834



>ref|WP_015230701.1| copper/silver-translocating P-type ATPase [Dactylococcopsis salina]
 ref|YP_007173081.1| copper/silver-translocating P-type ATPase [Dactylococcopsis salina 
PCC 8305]
 gb|AFZ51724.1| copper/silver-translocating P-type ATPase [Dactylococcopsis salina 
PCC 8305]
Length=773

 Score =   496 bits (1278),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 322/774 (42%), Positives = 473/774 (61%), Gaps = 38/774 (5%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVV-WPVSEAKVVPNWQQQLGEELAKHL  2967
             GM C GC  +V+R +E Q  V +A VNL T TA+V +    A +         E +A  L
Sbjct  25    GMKCAGCVNAVERQIEQQTGVIAAQVNLITATAIVQYQPDRADL---------EAIAAQL  75

Query  2966  TSCGFKANVRDSRRENLFETFE-KKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
             T+ GF + + D+ +     ++E K+  A +  LQ     LA++  L  +  +GHL H  G
Sbjct  76    TAKGFPSQLHDTNQAEAGNSYEEKRQQADQENLQK----LAIAGGLILLSAIGHLKHLTG  131

Query  2789  AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
              +   I LL +  FH  +    L++PGR++IIDG K L    PNMN+L+ LG LS++  S
Sbjct  132   VE---IPLLSNIWFHWGLATLALVLPGREIIIDGGKGLWNRVPNMNSLIALGTLSAYIAS  188

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
              +A   P+LGW+ FF+EPVML+ F+LLGR LEQRA+ +A + ++ L+++ P  ARLV  +
Sbjct  189   CVALIFPQLGWECFFDEPVMLLGFILLGRTLEQRARGEAGAALSALVSLKPQTARLV-KA  247

Query  2429  DMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPG  2250
                ++   +EVP   + VG  + VLPG++ P DG V  G +TVDES  TGE +PV K P 
Sbjct  248   TPKQEDKMMEVPVGTVQVGQWLKVLPGEKFPVDGEVIKGETTVDESMLTGESMPVRKQPE  307

Query  2249  AQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVM  2070
             A V AG+INL G +T++  + G +T +  I+  VE AQ R+APVQ+LAD+V+G+F YGVM
Sbjct  308   ASVQAGTINLTGAVTLKATQVGKDTTLAKIIATVENAQMRKAPVQQLADQVAGYFAYGVM  367

Query  2069  ALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgts  1890
             A++  TF+FW   GT V  A   + S   L+L+L  +VLV+ACPCALGLATPTA++VGT 
Sbjct  368   AIALLTFLFWYSVGTNVWTAVTLETSPLLLSLKLMIAVLVIACPCALGLATPTAILVGTG  427

Query  1889  lgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTST  1710
             +GA +GLLL+GG VLE+   ++T+VFDKTGTLT G+P VT+                 +T
Sbjct  428   VGAKQGLLLKGGDVLENVHRLDTLVFDKTGTLTEGKPQVTDYW-------------VVTT  474

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEE  1530
              +  +  +L  A+ VE  TNHP+  AIV  A+ +   ++   D     + G GA A IE+
Sbjct  475   PDLQKETLLQFAASVEQGTNHPLAAAIVTEAEKQGVSLLPTADEE--TKAGFGASATIEQ  532

Query  1529  KKVSVGTLDWVRRHGV----GETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDAR  1362
             + V VG   W+   G+          E  +   ++VVYVG++G LAG I ++D LR DA 
Sbjct  533   QNVIVGNSQWLEEKGIVIPDSVALSGEKLEATGKTVVYVGINGALAGAIALKDCLRPDAI  592

Query  1361  HVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKV  1182
               V  L K G    +L+GD+   A  +   + +  +N+  GV P+EK++ +  LQ   + 
Sbjct  593   ETVSQLQKMGFRVIVLTGDQARVARAIVHALNLTTDNLIAGVHPEEKAQVIQSLQAQGQR  652

Query  1181  VAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTV  1002
             V MVGDGINDA ALA + VG+AI  G   A + +S++LM++R+S ++ A+ LS  T+  +
Sbjct  653   VGMVGDGINDAPALAQADVGIAIAQGTDVALETASIILMRDRVSDVMTAIRLSLATLNKI  712

Query  1001  KQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLR  840
             +QNL+WA GYN++ +P+AAG+LLP    +L+P++A ALM LSS+ V+TNSL L+
Sbjct  713   RQNLFWALGYNVITIPLAAGVLLPKYNLLLSPAMAAALMALSSVIVVTNSLFLK  766



>ref|WP_026072734.1| ATPase [Nodosilinea nodulosa]
Length=791

 Score =   494 bits (1272),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 338/795 (43%), Positives = 471/795 (59%), Gaps = 60/795 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+  L     V SA+VNL TE AVV   ++A  V         +LA+ +T
Sbjct  29    GMKCAGCVRAVESRLTQVEGVRSATVNLVTEVAVV--EAQAGAVT------AADLAEAVT  80

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GFKA  R S  +   +     + AKRA+ Q  GR L ++ AL  +  +GHL HF    
Sbjct  81    QAGFKATPRTSDGDG--DDLTAWVEAKRAEQQQQGRRLGLAIALLILSTIGHLHHF----  134

Query  2783  ASW--IHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
               W  I +L    FH  +   TL  P R+++IDG + + +GAPNMNTLV LG+ S++  S
Sbjct  135   -GWLTIPILSDLWFHALLATGTLAFPAREILIDGWQGIRRGAPNMNTLVALGSGSAYLAS  193

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVN-  2433
              +A   P LGW+ FF+EPVML+AF+LLGR LEQRA+ +A   +  L+ + P+ ARL+ N 
Sbjct  194   VVALVFPGLGWECFFDEPVMLLAFILLGRTLEQRARYRAADALRSLVELQPAVARLISNP  253

Query  2432  SDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLP  2253
             +  G   + VEVP   L VG+ + VLPG++I ADG +  G++TVDES  TGE +PV K P
Sbjct  254   ATAGVAQTGVEVPARCLQVGEWVQVLPGEKISADGTLVTGQTTVDESMLTGESMPVLKQP  313

Query  2252  GAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGV  2073
             G  V AG++N  G + ++V   G  T +  +VRLVE AQSR+APVQRLAD +SG+FTYGV
Sbjct  314   GDGVTAGTVNQGGAIAIQVTGTGQNTVLAQMVRLVETAQSRKAPVQRLADLISGYFTYGV  373

Query  2072  MALSAATFMFWNLFGTRVLPATL-------HQGslaslalql-------scsvlvvaCPC  1935
             ++L+  TF+FW   G    P  +       H G   ++           + +V+VVACPC
Sbjct  374   LSLAVLTFLFWYFVGLPHWPGVMDSALGMAHMGHTMTVTSSTLLVSLKLAIAVMVVACPC  433

Query  1934  ALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQ  1755
             ALGLATPTA++VG+ +GA RGLLLRGG  LE+   ++T+VFDKTGTLT G+P VT +   
Sbjct  434   ALGLATPTAILVGSGIGAERGLLLRGGDSLETIHHLDTVVFDKTGTLTQGQPQVTAIQVL  493

Query  1754  GHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGT  1575
             G               E SE D+L LA+ VES T HP+ KAI  AA  R   +++A++  
Sbjct  494   GD--------------ELSETDILQLAATVESGTQHPLAKAIHRAATERELDLLQADE--  537

Query  1574  FIEEPGSGAMAVIEEKK----VSVGTLDWVRRHG-VGETRVQEFDDFK-----NQSVVYV  1425
             F  +PG G +A I  +      ++G   W+ + G V +  VQ  D  K      Q+VVYV
Sbjct  538   FDTQPGLGVVAQITWRDDVLPCALGNQLWMTQRGMVLDADVQ--DQVKALAIAGQTVVYV  595

Query  1424  GVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVF  1245
              +   + GL+ + DQLR +A  VV +L  QG+   +L+GD K  A  +A+ + +    V 
Sbjct  596   ALGENIVGLVAIADQLRPEAVAVVNNLQAQGLQVRVLTGDSKEVAGAIATQLNLNPSQVM  655

Query  1244  YGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLM  1065
               V P  K   +  LQ +   VA++GDGINDA ALA + VG+++  G   A + + V+LM
Sbjct  656   AEVSPQGKVDAIRQLQAEGHTVALMGDGINDAPALAQADVGISLHSGTDIAMETADVILM  715

Query  1064  QNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALM  885
             QN L+ LL+ L LSR T   ++QNL WAF YN+V +P+AAG+LLP  G  L+P+ AG +M
Sbjct  716   QNDLTGLLETLTLSRATFNKIRQNLAWAFAYNLVAIPLAAGVLLPVAGVSLSPAAAGGMM  775

Query  884   GLSSIGVMTNSLLLR  840
               SS+ V+ NSLLLR
Sbjct  776   AFSSVAVVVNSLLLR  790



>ref|WP_026103783.1| ATPase [Kamptonema formosum]
Length=825

 Score =   494 bits (1272),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 327/825 (40%), Positives = 476/825 (58%), Gaps = 79/825 (10%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC A+V+R L+ QP V SA VNL TE A +    +A VV          +AK L
Sbjct  22    GGMKCAGCVAAVERQLKQQPGVISARVNLATEVAAI--EGKAGVVD------AVAIAKKL  73

Query  2966  TSCGFKANVR--DSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
             T  GF    R  + ++E L    E++    R Q+      L +        L+  L H  
Sbjct  74    TDTGFPTQPRYAEHQQEQLAAIVERRRQEIRQQIWQLAIALTLI-------LLSGLGHLV  126

Query  2792  GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAV  2613
             G +     +  +  FH  +    LL PGR ++IDG + L + +PNMNTLVGLGA ++++ 
Sbjct  127   GTETP---IFSNIWFHCGLATAALLFPGRAILIDGWRGLWRNSPNMNTLVGLGAFTAYSA  183

Query  2612  SSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVV-  2436
             S +A   P++GW+ FF+EPVML+ F+LLG+ LEQ+AK +A S +  L+++ P+ A LV  
Sbjct  184   SVIALLFPQMGWECFFDEPVMLLGFILLGKTLEQQAKRRAASALQALISLQPATANLVAK  243

Query  2435  ---------NSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFT  2283
                      NS++     TVE+P   + VG+ + VLPG++IP DG V  G +TVDES  T
Sbjct  244   PQENTGSEENSELPLTLLTVEIPADRVRVGEWLQVLPGEKIPVDGEVCKGTTTVDESMLT  303

Query  2282  GEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLAD  2103
             GE + V K  G  VAAG++N +G + +   R G ET +  IV LVE AQ+R+AP+Q LAD
Sbjct  304   GESVAVFKQRGDAVAAGTLNQSGAIVMRATRTGKETTLAQIVALVETAQTRKAPIQYLAD  363

Query  2102  KVSGHFTYGVMALSAATFMFWNLFGTRVLPATL---------HQGslasl--------al  1974
              V+G+F Y VM +S  TF+FW   GT + P  L         H G             +L
Sbjct  364   TVAGYFCYSVMTISTLTFLFWYFAGTHIWPEVLLEHTAISMNHAGMNMIQGPLSPALLSL  423

Query  1973  qlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTL  1794
             +L+ +VL +ACPCALGLATPTA++VG+ +GA RGLL++GG VLE    ++TI+FDKTGTL
Sbjct  424   KLAIAVLAIACPCALGLATPTAILVGSGMGAERGLLIKGGDVLERVHQLDTIIFDKTGTL  483

Query  1793  TIGRPTVTEVVPQGHNDETNAKRDST-------------------------STCEWSEVD  1689
             T G P VT+ + +        +                             S  +W    
Sbjct  484   TTGSPKVTDCIAKEEGRRKKEEGRRKKEEGRGEEEEGRGEEEGGKNEELPISDAQW----  539

Query  1688  VLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGT  1509
             +L +A+ VES T+HP+ +AI++ A+ +   ++ AED  F  EPG G  A++E  +V  G 
Sbjct  540   LLQIAATVESGTSHPLAEAILQEARQQGLSLLLAED--FYTEPGLGISALVEGDRVLAGN  597

Query  1508  LDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGI  1329
              DW+R++GV    +      + +++VYV V GV  G+I V D LR DA+  +E L   G+
Sbjct  598   ADWLRQYGV-FAEMSSLTSLEGKTLVYVAVAGVFVGVIAVSDTLRPDAKTTIEKLRSMGL  656

Query  1328  TTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDA  1149
                L++GD++  A  +A  + I  +++   V+P  K+  ++ LQ +   VAMVGDGINDA
Sbjct  657   RVMLVTGDRREVAFAIAQQLDIGSDDILAEVRPQGKADAIAALQAEGHQVAMVGDGINDA  716

Query  1148  AALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYN  969
              ALA + VG+ +  G  AA + + +VLM++ L  +++++ LSRLT   ++QNL+WAF YN
Sbjct  717   PALAQADVGIGMQAGTDAAVETAQIVLMRDTLGDVVESIYLSRLTFNKIRQNLFWAFAYN  776

Query  968   IVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLK  834
             I+G+P+AAGILLP  G  L+P+ AGA M  SS+ V+TNSLLLR K
Sbjct  777   ILGIPIAAGILLPTFGLALSPAAAGAFMAFSSVSVVTNSLLLRQK  821



>ref|WP_026222202.1| ATPase [filamentous cyanobacterium ESFC-1]
Length=785

 Score =   492 bits (1267),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 326/790 (41%), Positives = 469/790 (59%), Gaps = 56/790 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  SV+R L     V SA VNL TE AVV   +E KV P       E LA+ L+
Sbjct  26    GMKCAGCVKSVERQLLQNSGVVSARVNLITEVAVVQYEAE-KVKP-------ETLAQTLS  77

Query  2963  SCGFKANVRDSRRENLFETFEKK-MNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
               GF + +R+       ++ E+     K AQ Q     LA++  L     +GH  H+ G 
Sbjct  78    DRGFPSQLRNPETATTAQSLEEDDSEQKAAQTQ-----LAIATILLLFSALGHWQHWGGP  132

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
                 I ++ +  FH  +    LL+PGR++IIDG + L  G PNMNTLVGLG  S++  S 
Sbjct  133   A---IPIVSNIWFHWGLATLALLLPGREIIIDGARGLRYGMPNMNTLVGLGTTSAYIASC  189

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +A   P+LGW+ FF+EPVML+ F+LLGR LE+RA+ +AT  +  L  + P+  RL+ + D
Sbjct  190   IALLWPQLGWECFFDEPVMLLGFILLGRTLEKRARHQATGALKKLFALQPTTVRLIGSGD  249

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
                +   +E+P S    G+   VLPG+R+P DG + +G +++DES  TGE +PV K  G 
Sbjct  250   RHAEAG-IEIPVSQARSGEWAQVLPGERLPIDGEIVSGETSIDESMLTGESMPVFKQKGD  308

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
              VAAG++N  G + + +QR GG T +   + LVEEAQ+R+APVQ+LAD V+G F YGVMA
Sbjct  309   TVAAGTLNQGGAIAIRIQRSGGSTTLARAIALVEEAQTRKAPVQQLADTVAGFFAYGVMA  368

Query  2066  LSAATFMFWNLFGTRVLPATL----HQGslaslal------qlscsvlvvaCPCALGLAT  1917
             ++  TF+FW   G  + P  L     +G             +L+ +VLVVACPCALGLAT
Sbjct  369   IATLTFLFWYFLGIEIWPHVLTPTPMEGMTTGSTSGILLSLKLAIAVLVVACPCALGLAT  428

Query  1916  PTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDET  1737
             PTA++VGTSLGA RG+L++GG +LE    +  IVFDKTGTLT+G+  VT           
Sbjct  429   PTAILVGTSLGAERGILIKGGDILEQVRDLEAIVFDKTGTLTLGQMQVTRCF--------  480

Query  1736  NAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPG  1557
                    +   ++   +L  A+  ES TNHP+ KA++ + K R   ++ A D  F  + G
Sbjct  481   -------AAESYTADTLLQYAASAESGTNHPLAKAMLNSLKDRELPLLAATD--FETQLG  531

Query  1556  SGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDF--KNQSVVYVGVDGVLAGLIYVED  1383
              G  A + +K V VG   W+ + G+    ++        +Q++VYV V+G  AG I +ED
Sbjct  532   LGISAQVNQKPVWVGNQAWLVQQGIAPEVLESLTPKIEGHQTIVYVAVEGKFAGAIALED  591

Query  1382  QLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSG  1203
             QLR DA+  V  L K G+   LL+GD+ + A  +AS +GI  E V+  V+PD K + +  
Sbjct  592   QLRPDAKTTVTQLQKMGLEVMLLTGDRLSVANAIASQLGI--ERVWAEVRPDRKVEVIQD  649

Query  1202  LQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLM------QNRLSQLL  1041
             LQ+ Q+ V M+GDG+NDA ALA +H+G+++  G   A + + +VLM         L +++
Sbjct  650   LQQ-QQQVGMIGDGVNDAPALAQAHIGISVHDGTDIAMEAAGIVLMGGNHREPTSLLKVV  708

Query  1040  DALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVM  861
             +AL LS+ T   ++QNL+WA GYN + +P+AAG+LLP  G +L+P+IAGA M  SS+ V+
Sbjct  709   EALRLSQATFNKIRQNLFWALGYNAIAVPIAAGLLLPQFGVVLSPAIAGAFMAFSSVMVV  768

Query  860   TNSLLLRLKF  831
             TNSLLLR +F
Sbjct  769   TNSLLLRRQF  778



>ref|WP_015194100.1| heavy metal translocating P-type ATPase [Stanieria cyanosphaera]
 ref|YP_007133399.1| heavy metal translocating P-type ATPase [Stanieria cyanosphaera 
PCC 7437]
 gb|AFZ36433.1| heavy metal translocating P-type ATPase [Stanieria cyanosphaera 
PCC 7437]
Length=789

 Score =   493 bits (1268),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 318/773 (41%), Positives = 466/773 (60%), Gaps = 53/773 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L+    V SA VNL TE AVV    EA+ +        E+LA+ LT
Sbjct  26    GMKCAGCVKAVERQLQQHQGVISACVNLITEVAVV--EYEAETIKP------EKLAQKLT  77

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF   +R ++ E++ E  +K    ++ Q Q     L  +  L     +GH  H  G  
Sbjct  78    QTGFPTQLR-TQTESVTEVVDKTAIKRKQQQQQQFWQLITAATLLFFSTIGHFHHL-GLP  135

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
             A  I LL +  FH  +    LL+PGR L+IDG +SL    PNMNTLVGLG +S++  S +
Sbjct  136   A--IPLLSNIWFHFGLATLALLIPGRSLLIDGWRSLWHKMPNMNTLVGLGTVSAYVASCI  193

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A F+P+LGW+ FF+EPVML+ F+ LGR LE RAK +A+S +  L+ + P  ARL+   D 
Sbjct  194   ALFLPQLGWECFFDEPVMLLGFIFLGRTLEARAKHRASSALESLIALQPRIARLIGKQDS  253

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
             G  T  +E+P   + +G+ + VLPG++IP DG + AG +TVDES  TGE +P+ K PG  
Sbjct  254   G--TMGIEIPVEQVKLGEWLKVLPGEKIPVDGKIIAGTTTVDESMLTGEAIPLVKQPGEP  311

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V   +IN   ++T++V R G  T +  I++LVE+AQ+R+APVQ+LAD V+G+F YGV+ +
Sbjct  312   VYGATINQTDVITLQVTRTGKATTLAQIIKLVEQAQTRKAPVQKLADTVAGYFAYGVITV  371

Query  2063  SAATFMFWNLFGTRVLPATL--------HQGslasl----alqlscsvlvvaCPCALGLA  1920
             ++ TF+FW L GT++ P  L        H   + +     +L+L+ +VLV+ACPCALGLA
Sbjct  372   ASLTFLFWYLIGTQLYPEVLVTTSHTLGHHMVMTTSPLLLSLKLAIAVLVIACPCALGLA  431

Query  1919  TPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDE  1740
             TPTA++VGTSLGA RG+L++GG VLE    +NTIVFDKTGTLT G   VT+ +  G    
Sbjct  432   TPTAILVGTSLGAERGILIKGGDVLEKVHQLNTIVFDKTGTLTQGCLQVTDCLTFG----  487

Query  1739  TNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEP  1560
                        + S   +L LA+ VES +NHP+  AI+  A  +   ++K  D   I +P
Sbjct  488   -----------DLSSEALLQLAASVESASNHPLATAILAFAHQQELSLLKPTD--IINQP  534

Query  1559  GSGAMAVIEEKKVSVGTLDWVRRHGVG-----ETRVQEFDDFKNQSVVYVGVDGVLAGLI  1395
             G G  A++   +V +G  DW+ ++G+       T V++    + ++VVY+  +  L GL+
Sbjct  535   GLGISAIVAGTRVYLGNDDWLSKNGIEISYEVATEVEKLFT-QGKTVVYLAKEAQLLGLL  593

Query  1394  YVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSK  1215
              ++D LR  A+  + +L K G+   +L+GD++  A+ +A+ +GI  E V   VKP+EK+ 
Sbjct  594   ALKDSLRPLAKQTIANLHKLGLEIIMLTGDRQEVAQKIATQLGI--ERVIAQVKPNEKAA  651

Query  1214  FVSGLQ--KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLL  1041
              +  LQ  K  +++AMVGDGINDA ALA + +G+ + G    A   + +VLM   L  L+
Sbjct  652   VIKSLQSEKPNQIIAMVGDGINDAPALAQADLGITLQGSTDVALQAADLVLMSGNLWDLV  711

Query  1040  DALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMG  882
             +A+ LSR T+  +KQNL WA  YN+  +PVAAG+LLP  G ML+P +A   M 
Sbjct  712   EAIALSRSTVNKIKQNLIWALAYNVFAIPVAAGLLLPSFGLMLSPVVAAIAMA  764



>ref|WP_015955160.1| ATPase [Cyanothece sp. PCC 7424]
 ref|YP_002378431.1| copper-translocating P-type ATPase [Cyanothece sp. PCC 7424]
 gb|ACK71563.1| copper-translocating P-type ATPase [Cyanothece sp. PCC 7424]
Length=795

 Score =   493 bits (1268),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 328/799 (41%), Positives = 488/799 (61%), Gaps = 59/799 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L + P V SA VNL TE AV+   + A++ P       E +A  LT
Sbjct  26    GMKCAGCVKAVERQLTNNPGVVSACVNLITEVAVI-KYTPAEIEP-------ETIAAKLT  77

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF +  R    + +   +         + Q   +GL V+  L     +GH+ H  G  
Sbjct  78    AVGFPSEPRSRESQKIGGAYHSVTQRHAEEKQQQIKGLTVAAILLLFSTIGHIHHLGGPS  137

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +L +  FH  +    LL+PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  138   ---IPILSNIWFHWGLATLALLIPGRPIFIDGWRGLRHGMPNMNTLVSLGTGSAYLTSFI  194

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P+LGW+ FF+EPVML+ F+LLGR LE RA+ +A++ +  L+ + P  ARL+ + + 
Sbjct  195   ALVFPQLGWECFFDEPVMLLGFILLGRTLEARARGRASAALEALVALQPPVARLIGDPNS  254

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
              E +S +E+P   + VG+ + VLPG++IP DG V AG++TVDES  TGE +PV KLPG  
Sbjct  255   FE-SSGIEIPVEQVQVGEWLRVLPGEKIPVDGEVVAGQTTVDESMVTGESIPVAKLPGDG  313

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             +  G++NL+G + ++V + G +T +  I+  VEEAQ+R+APVQ+LAD V+G+F YGV+ +
Sbjct  314   LIGGTLNLSGAIALKVTQVGEDTTLAKIITSVEEAQTRKAPVQQLADTVAGYFAYGVIII  373

Query  2063  SAATFMFWNLFGTRVLPATL--------HQGslaslalq---------lscsvlvvaCPC  1935
             +  TF FW   GT++ P  +        HQ S++ +A+          L+ SVLV+ACPC
Sbjct  374   ALLTFGFWEFIGTKIFPEVMTQISLGMGHQMSMSQMAIAPTPFLLSLKLAISVLVIACPC  433

Query  1934  ALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQ  1755
             ALGLATPTA++VGT +GA RGLL++GG +LE    ++TIVFDKTGTLT+G P VT     
Sbjct  434   ALGLATPTAILVGTGIGAERGLLIKGGDILEKVHQLDTIVFDKTGTLTVGHPQVT-----  488

Query  1754  GHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGT  1575
                       D  S  + +  ++L LA+ VES T HP+G AI+EAA+      +KAE   
Sbjct  489   ----------DCISVSDLTSTELLQLAATVESGTTHPLGTAIIEAAQKEELPFIKAEQ--  536

Query  1574  FIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVG-----ETRVQEFDDFKNQSVVYVGVDGV  1410
             F  + G G  A++E K V +G   W+  + +      +T+ Q   +   ++VVYV  +G 
Sbjct  537   FYTKAGLGISAIVEGKSVLLGNQQWLEENQINLSELIKTQAQSLLN-AGKTVVYVAKEGN  595

Query  1409  LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKP  1230
             LAGLI ++D LR DA+  V+ L + G+   L++GD+   A+ +AS VGI +  VF  + P
Sbjct  596   LAGLIALQDPLRTDAQDTVKQLQQLGLQVILVTGDQPEPAQAIASQVGITQ--VFAQIPP  653

Query  1229  DEKSKFVSGLQ-----KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLM  1065
              EK+  +  LQ     +  ++VAMVGDGINDA ALA + +G+A+ GG   A + +++VLM
Sbjct  654   QEKANIIKSLQVGKGEQKPQIVAMVGDGINDAPALAQADIGIALHGGTQVAVETAAIVLM  713

Query  1064  QNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALM  885
             + +L  ++ +++LS  T   ++QNL+WA GYN++ +P+AAGILLP  G +L+P++A ALM
Sbjct  714   REQLKDVVHSIQLSLATFNKIRQNLFWALGYNVIAIPIAAGILLPNFGFVLSPALAAALM  773

Query  884   GLSSIGVMTNSLLLRLKFA  828
               SSI V+TNS+LL  +F+
Sbjct  774   ASSSILVVTNSVLLHRQFS  792



>gb|ABF94278.1| copper-translocating P-type ATPase family protein, expressed 
[Oryza sativa Japonica Group]
Length=885

 Score =   494 bits (1272),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 351/842 (42%), Positives = 476/842 (57%), Gaps = 126/842 (15%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGCAA V+ IL +  RV +A+VNL  E+A V   S        +   G+ELA  LT
Sbjct  96    GMMCGGCAARVRTILAADERVETAAVNLLAESAAVRLRSP-------EPAAGKELAARLT  148

Query  2963  SCGFKANVR---------DSRRENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLV  2814
              CGF +  R         DS R+       ++M A++A+L    RG +A +W L A+C  
Sbjct  149   ECGFPSVARRGGAASGASDSARK------WREMAARKAELLTRSRGRVAFAWTLVALCCG  202

Query  2813  GHLSHFFGA------KASWIHLLHSTGFHMSMCLFTLLVPGR--------------QLII  2694
              H +HF  +        +++ LLH++     + +  L  PGR               ++ 
Sbjct  203   SHATHFLHSLGIHVGHGTFLDLLHNSYVKCGIAIAALFGPGRGFLSFSQNVFNVTPDILF  262

Query  2693  DGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLE  2514
             DGL++  +G+PNMN+LV                              ML+ FVLLGR+LE
Sbjct  263   DGLRAFKQGSPNMNSLV------------------------------MLLGFVLLGRSLE  292

Query  2513  QRAKIKATSDMTGLLNVLPSKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQII  2361
             + A++KA+SDM  L+++L  ++RLVV S          +     TVEVP  ++ VGD I+
Sbjct  293   ESARLKASSDMNELVSLLSPQSRLVVTSSSDDPSSDGVLNSDAITVEVPVDDVRVGDFIL  352

Query  2360  VLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGG  2181
             VLPG+ IP DG V  G S VDES  TGE LPV K  G  V AG++N +G L ++    G 
Sbjct  353   VLPGETIPVDGNVLGGSSFVDESMLTGESLPVPKEKGFPVFAGTVNWDGPLKIKATTTGP  412

Query  2180  ETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL-  2004
              + I  IVR+VE+AQ+REAPVQRLAD ++G F Y VM LSAATF FW   GT + P  L 
Sbjct  413   SSTIAKIVRMVEDAQAREAPVQRLADSIAGPFVYTVMTLSAATFSFWYYIGTHIFPEVLL  472

Query  2003  -----HQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLES  1839
                    G    L+L+L+  VLVV+CPCALGLATPTA+++GTSLGA RGLL+RGG VLE 
Sbjct  473   NDISGPDGDSLLLSLKLAVDVLVVSCPCALGLATPTAILIGTSLGAKRGLLIRGGDVLER  532

Query  1838  FSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVES  1659
              + ++ IV DKTGTLT GRP VT                S ++  + E ++L LA+ VE 
Sbjct  533   LAGIDAIVLDKTGTLTKGRPVVT----------------SIASLAYEEAEILRLAAAVEK  576

Query  1658  NTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVG  1479
                HPI  AI+E A+     I  A  G  + EPG G +A ++   V+VGTLDWV      
Sbjct  577   TALHPIANAIMEEAELLKLDI-PATSGQ-LTEPGFGCLAEVDGCLVAVGTLDWVHNRFET  634

Query  1478  ETRVQEFDDFKN---------------QSVVYVGVDGV-LAGLIYVEDQLREDARHVVES  1347
             +    E  D  N               +S+ YVG +G  + G I V D LR+DA+  V+ 
Sbjct  635   KASSTELTDLGNHLEFVSSSEASSNHSKSIAYVGREGEGIIGAIAVSDVLRDDAKATVDR  694

Query  1346  LSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVG  1167
             L ++ I T+LLSGD+K A E +   VGI  EN+   + P EK+  ++ LQ + + VAMVG
Sbjct  695   LQQEEILTFLLSGDRKEAVESIGRTVGIRSENIKSSLTPHEKAGIITALQGEGRRVAMVG  754

Query  1166  DGINDAAALassh--vgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQN  993
             DGINDA +LA++   V +       AASD +SVVL+ NRLSQ++DAL LS+ TM  V QN
Sbjct  755   DGINDAPSLAAADVGVAMRTNSKESAASDAASVVLLGNRLSQVMDALSLSKATMAKVHQN  814

Query  992   LWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL--KFASKQ  819
             L WA  YNIV +P+AAG+LLP     +TPS++G LM LSSI V++NSLLL+L   F S +
Sbjct  815   LAWAVAYNIVAIPIAAGVLLPQFDFAMTPSLSGGLMALSSIFVVSNSLLLQLHGSFQSTE  874

Query  818   KE  813
             K+
Sbjct  875   KQ  876



>ref|WP_015123957.1| copper/silver-translocating P-type ATPase,heavy metal-translocating 
P-type ATPase, Cd/Co/Hg/Pb/Zn-transporting [Synechococcus 
sp. PCC 6312]
 ref|YP_007060956.1| copper/silver-translocating P-type ATPase,heavy metal-translocating 
P-type ATPase, Cd/Co/Hg/Pb/Zn-transporting [Synechococcus 
sp. PCC 6312]
 gb|AFY60413.1| copper/silver-translocating P-type ATPase,heavy metal-translocating 
P-type ATPase, Cd/Co/Hg/Pb/Zn-transporting [Synechococcus 
sp. PCC 6312]
Length=801

 Score =   491 bits (1263),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 319/781 (41%), Positives = 466/781 (60%), Gaps = 37/781 (5%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC A+V++ L  QP V+SA+VNL T TA+V    E K +        + LA HLT
Sbjct  51    GMRCGGCVANVEKQLMQQPGVTSAAVNLVTATAMV--AYEPKTIQP------QALADHLT  102

Query  2963  SCGFKANVRDSR---RENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFF  2793
               GF   V  S     ++L +  E   +            L ++     +  VGH+  + 
Sbjct  103   QAGFPTEVLSSDLPITQSLLDVSESNSHTD-VIFAFPHTDLILAIVFLLLSGVGHVQDWL  161

Query  2792  GAKASWI---HLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSS  2622
             G     +   H+LH+  +H  +    L+ PGR +I DG +SL +G P MNTLVGLGA+SS
Sbjct  162   GLSLHHVPGLHILHTMAWHWGLATLALIGPGRGIIRDGWQSLWRGNPTMNTLVGLGAVSS  221

Query  2621  FAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARL  2442
             +  S +A  +P L W+ FF+EPVM+I F+LLGR LEQRA+ KA+  +  L+ + P+ A+ 
Sbjct  222   YVASVIAWRVPGLAWECFFDEPVMIIGFILLGRTLEQRARNKASQSLRSLIALQPALAQW  281

Query  2441  VVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVT  2262
             V N D   +T  V +P + + +GD + VLPGD++P DG+V  G + V E+  TGE  P+ 
Sbjct  282   VANPD---RTDGVTIPVAQVQIGDWLRVLPGDKLPVDGVVVRGETFVTEAVLTGEARPIA  338

Query  2261  KLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFT  2082
             K+PG  V AGS+N    +T++    G +T +G I+ LV +AQ+R+AP+QRLAD ++G+FT
Sbjct  339   KVPGDTVMAGSLNQASAITIQATACGNDTLLGQILTLVTQAQTRKAPIQRLADLIAGYFT  398

Query  2081  YGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVM  1902
             YGV+ L+A T  FW      +L       +   L L+L  +VLVVACPCALGLATPTA++
Sbjct  399   YGVLVLAAVTIGFWWGLAPTLL-GIAGGTAALLLGLKLGMAVLVVACPCALGLATPTAIL  457

Query  1901  VgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRD  1722
             VGTSLGA +GLL+RGG VLE+   + T+VFDKTGTLT G+ TV   +P  + DET     
Sbjct  458   VGTSLGAEQGLLIRGGDVLETLHRLTTVVFDKTGTLTWGKLTVQNSIPLANLDET-----  512

Query  1721  STSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMA  1542
                       ++L LA+ +E N  HPI +A++  AK +N  ++   +   I  PG G  A
Sbjct  513   ----------ELLQLAASLEQNYRHPIAQALLSEAKDKNITLLPITETESI--PGLGIKA  560

Query  1541  VIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDAR  1362
             V  E+ + VG+L W+ + G+ +    E  + +N SV+ +G+D  L GLI +EDQLR DA 
Sbjct  561   VWNEQVLRVGSLAWLAKEGL-KAETLEDQNQQNLSVIGIGLDQKLIGLIALEDQLRSDAV  619

Query  1361  HVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKV  1182
               +E L + G+   +L+GD + A + +   + + +  +   + P EK  ++   +   KV
Sbjct  620   QTLEKLKEIGLEIQVLTGDSETATQAILEPLNLKKTQIQTQLLPTEKVAWIEQQKAAGKV  679

Query  1181  VAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTV  1002
             +AMVGDG NDA ALA + VG+A+  G   A + + +VL  NRL+ ++ A++LSR T   +
Sbjct  680   IAMVGDGTNDAPALAGADVGIALASGTDVALETAGIVLTHNRLADVVAAIKLSRATFSKI  739

Query  1001  KQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASK  822
             +QNL WA GYN++ +PVAAG+LLP     LTP +A A M LSSI V+ N+LLLR ++   
Sbjct  740   QQNLAWACGYNLIAIPVAAGVLLPVWQISLTPGLAAACMALSSISVVANALLLRKEYHRP  799

Query  821   Q  819
             Q
Sbjct  800   Q  800



>dbj|BAK61879.1| P-type ATPase [Citrus unshiu]
Length=872

 Score =   492 bits (1267),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 341/816 (42%), Positives = 473/816 (58%), Gaps = 90/816 (11%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVV-WPVSEAKVVPNWQQQLGEELAKHL  2967
             GM CGGC A VK +L +  RV S +VN+ TETA +       +        + E L K L
Sbjct  80    GMMCGGCVARVKSVLTADDRVDSVAVNMLTETAAIKLRTEVVEESEEVVNNVAESLGKRL  139

Query  2966  TSCGFKANVRDSRR---ENLFETFEKKMNAKRAQLQASGRG-LAVSWALCAVCLVGHLSH  2799
               CGF+A  R S     EN+ +   K++  KR  L    R  +A++W L A+C   H SH
Sbjct  140   MECGFEAKRRVSGTGVAENVKKW--KELAKKREDLLVKSRNRVALAWTLVALCCGSHASH  197

Query  2798  FFGAKASWIHLLHSTGFHM--------SMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLV  2643
                + +  IH+ H   + +           L  L+ PGR L+ DGL++  KG+PNMN+LV
Sbjct  198   I--SHSLGIHIAHGPLWELLDNSYVKGGFALGALIGPGRDLLSDGLRAFRKGSPNMNSLV  255

Query  2642  GLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLN  2466
             G G++ +F +S ++   P+L W A FFEEPVML+ FVLLGR+LE+RA+I+A+SDM  LL+
Sbjct  256   GFGSIVAFLISLVSLLKPELDWDASFFEEPVMLLGFVLLGRSLEERARIRASSDMNELLS  315

Query  2465  VLPSKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAG  2313
             ++ +++RLV+ S          +      VEVP  ++ VGD ++VLPG+ IP DG V AG
Sbjct  316   LVSTQSRLVITSSESGSSADNVLCSDAICVEVPTDDIRVGDSVLVLPGETIPVDGRVLAG  375

Query  2312  RSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQS  2133
             RS VDES  +GE LPV K  G  V+AG+IN +G L +E    G  + I  IV +VEEAQ 
Sbjct  376   RSVVDESMLSGESLPVFKEEGFTVSAGTINWDGPLRIEACSTGSNSMISKIVSMVEEAQG  435

Query  2132  REAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------HQGslaslalq  1971
             REAP+QRLAD ++G F Y VM LSAATF FW   G+++ P  L        G+   L+L+
Sbjct  436   REAPIQRLADAIAGPFVYSVMTLSAATFAFWYYIGSQIFPDVLLSDMAGPNGNPLLLSLK  495

Query  1970  lscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLT  1791
             LS  VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + ++ +  DKTGTLT
Sbjct  496   LSVDVLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLARIDYLALDKTGTLT  555

Query  1790  IGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKS  1611
              G+P V  V                ++  + E ++L +A+ VE    HPI KAIV  A+S
Sbjct  556   EGKPAVFNV----------------ASFVYDESEILKIAAAVEKTATHPIAKAIVNKAES  599

Query  1610  RNCR--IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV--RRHGVGE-TRVQEFDDF-  1449
              N    I + +    + EPG G +  ++ + V+VGTL+WV  R    G+ + VQ  +   
Sbjct  600   LNLTSPITRGQ----LAEPGFGILGEVDGRLVAVGTLEWVYERFQKQGDHSDVQHLEHAV  655

Query  1448  ------------KNQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSKQGITTYLLSG  1308
                          ++SVVYVG +G  + G I + D LR DA H V SL ++GI T LLSG
Sbjct  656   THQSSELASPSNYSKSVVYVGREGEGIIGAIAISDSLRHDAEHTVRSLQQKGIKTLLLSG  715

Query  1307  DKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAA--ALas  1134
             D++ A    A  VGI +E +   + P +KS+ +S LQ     VAMVGDGINDA   ALA 
Sbjct  716   DREEAVAATAKEVGIGKEYINSSLTPQQKSEVISTLQTSGHHVAMVGDGINDAPSLALAD  775

Query  1133  shvgvaigggvgaasdvssvVLMQNRLSQL----------------LDALELSRLTMKTV  1002
               + + I     AAS  +S++L+ N+LSQ+                +DAL+L++ TM  V
Sbjct  776   VGIALQIEAQENAASTAASIILLGNKLSQIPTLAIQWSPRCMILYVVDALDLAKATMAKV  835

Query  1001  KQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAG  894
              QNL WA  YN+V +P+AAG LLP     +TPS++G
Sbjct  836   YQNLSWAVAYNVVAIPIAAGALLPQYEFAMTPSLSG  871



>ref|WP_013324003.1| ATPase [Cyanothece sp. PCC 7822]
 ref|YP_003889210.1| copper-translocating P-type ATPase [Cyanothece sp. PCC 7822]
 gb|ADN15935.1| copper-translocating P-type ATPase [Cyanothece sp. PCC 7822]
Length=792

 Score =   488 bits (1257),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 335/799 (42%), Positives = 481/799 (60%), Gaps = 61/799 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L     V SA VNL TE AVV      K  P+  Q   + LA+ L+
Sbjct  26    GMKCAGCVKAVERQLSHHQGVISACVNLITEVAVV------KYAPDEIQP--QVLAEKLS  77

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF +  R S   +  + +       + Q Q   RGL V+  L     +GH+SH  G  
Sbjct  78    AIGFPSEPR-SESNHSAKRYVSAAQRHQQQRQQQIRGLVVAAILLIFSTIGHISHIGGPS  136

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I L  +  FH ++    LL+PGR +++DG + L  G PNMNTLV LG +S++  S  
Sbjct  137   ---IPLFSNIWFHWALATGALLIPGRSILVDGWRGLRHGMPNMNTLVALGTISTYLTSFF  193

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P+LGW+ FF+EPVML+ F+LLGR LE +A+ +A++ +  L  + P  ARL+   D 
Sbjct  194   ALIFPQLGWECFFDEPVMLLGFILLGRTLEAKARGRASAAIEALFALSPPLARLI--GDP  251

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                 + +E+P   + VG+ I VL G++IP DG V  G+++VDES  TGE +PV K     
Sbjct  252   HSTEAGIEIPVEQVRVGEWIRVLAGEKIPVDGEVVVGQTSVDESMITGESMPVAKQATEA  311

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V  G++NL+G +T++  R G +T +  I+  VEEAQ+R+APVQ+LAD V+G+F YGVM +
Sbjct  312   VIGGTLNLSGAITLKATRVGEDTTLAKIIASVEEAQTRKAPVQQLADTVAGYFAYGVMII  371

Query  2063  SAATFMFWNLFGTRVLPATL--------HQGslaslalql---------scsvlvvaCPC  1935
             ++ TF FW+  GT+  P  L        HQ S++ + +           + SVLV+ACPC
Sbjct  372   ASVTFFFWDFIGTKWFPDVLMGMSSGMEHQMSMSDMTMTTTPLLLSLKLAISVLVIACPC  431

Query  1934  ALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQ  1755
             ALGLATPTA++VGT +GA RGLL++GG +LE    ++T++FDKTGTLTIG P VT+ +  
Sbjct  432   ALGLATPTAILVGTGIGAERGLLIKGGDILEKVHQLDTVIFDKTGTLTIGHPEVTDCITL  491

Query  1754  GHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGT  1575
             G               E +   +L LA+ VES T HP+G AIVEAA+ +    ++A    
Sbjct  492   G---------------EITSDKLLQLAATVESGTTHPLGTAIVEAAQIKELPFLEAAQ--  534

Query  1574  FIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVG-----ETRVQEFDDFKNQSVVYVGVDGV  1410
             F  E G G  AV+  K V VG   W+  H +      E +VQ     + ++VVYV V G 
Sbjct  535   FATEAGLGISAVVAGKLVLVGNQQWLESHQIEPSATLEAKVQSLLK-EGKTVVYVAVAGK  593

Query  1409  LAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKP  1230
             LAG++ ++D LR DA+  VE L K G+   L++GD +  AE +A  +GI    VF GV P
Sbjct  594   LAGIMGLQDVLRADAQQTVEQLKKMGLRVMLVTGDHQEVAEIIAGKIGI--TEVFSGVTP  651

Query  1229  DEKSKFVSGLQ---KDQK--VVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLM  1065
              EK+K V  L+    DQK  +VAMVGDGINDA ALAS+ +G+A+ GG   A + +++VLM
Sbjct  652   QEKAKIVESLRLESGDQKPAIVAMVGDGINDAPALASADIGIALHGGTEVALETAAIVLM  711

Query  1064  QNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALM  885
             + RL  ++++++LSR T + ++QNL+WA GYN   +P+AAG+LLP  G +L+P+ + ALM
Sbjct  712   RERLLDVVESIQLSRATFQKIRQNLFWALGYNTFAIPIAAGLLLPPFGFVLSPAASAALM  771

Query  884   GLSSIGVMTNSLLLRLKFA  828
               SS+ V+TNSLLL  +F+
Sbjct  772   ASSSVMVVTNSLLLHRQFS  790



>ref|XP_010527001.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X6 [Tarenaya hassleriana]
Length=471

 Score =   476 bits (1225),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 237/318 (75%), Positives = 271/318 (85%), Gaps = 0/318 (0%)
 Frame = -2

Query  3203  AAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSE  3024
             A AG+     SSDVIILDVGGMTCGGCAASVK+ILESQP+VS+ASVNLTTETA+VWPV E
Sbjct  149   AGAGDGVPSPSSDVIILDVGGMTCGGCAASVKKILESQPQVSTASVNLTTETAIVWPVLE  208

Query  3023  AKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAV  2844
             AK VPNW+++LGE LAKHL++CGF++  R     N F  FE KM  K  +L+ SGR LAV
Sbjct  209   AKSVPNWKEELGEMLAKHLSNCGFESTPRGLTNVNFFRVFESKMKEKHTRLKESGRELAV  268

Query  2843  SWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGA  2664
             SWALCAVC+VGHL+HF G K  WIH  HSTGFH+S+ L TLL PGRQLIIDG+KSLLKGA
Sbjct  269   SWALCAVCVVGHLTHFLGVKVPWIHAFHSTGFHVSLSLLTLLGPGRQLIIDGIKSLLKGA  328

Query  2663  PNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSD  2484
             PNMNTLVGLGALSSF VSS+AA IPKLGWK FFEEPVMLIAF+LLGRNLEQRAKIKATSD
Sbjct  329   PNMNTLVGLGALSSFTVSSLAAMIPKLGWKTFFEEPVMLIAFILLGRNLEQRAKIKATSD  388

Query  2483  MTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             MTGLL+VLPSKARL+++ D    +STVEVPC++LSVGD +++LPGDR+PADGIVR+GRST
Sbjct  389   MTGLLSVLPSKARLLLDGDPQNPSSTVEVPCNSLSVGDLVVILPGDRVPADGIVRSGRST  448

Query  2303  VDESSFTGEPLPVTKLPG  2250
             +DESS TGEPLPVTK  G
Sbjct  449   IDESSLTGEPLPVTKESG  466



>ref|WP_015133786.1| heavy metal translocating P-type ATPase [Leptolyngbya sp. PCC 
7376]
 ref|YP_007070850.1| heavy metal translocating P-type ATPase [Leptolyngbya sp. PCC 
7376]
 gb|AFY38016.1| heavy metal translocating P-type ATPase [Leptolyngbya sp. PCC 
7376]
Length=756

 Score =   485 bits (1249),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 314/787 (40%), Positives = 464/787 (59%), Gaps = 70/787 (9%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC A+V+R L+ Q  V SA+VNL TE AVV    + K+VP         +A  LT
Sbjct  21    GMRCAGCVAAVERQLKQQSGVLSATVNLITEVAVV-TYEQEKIVPG-------AIAGKLT  72

Query  2963  SCGFKANVRDSRRENLFETFE-KKMNAKRAQLQASGRGLAVSWALCA--VCLVG----HL  2805
               GF    R +  E  FE ++ K+   +R Q           W L A  + LVG    HL
Sbjct  73    DMGFPTQPRTAETET-FEDYQAKRQKTQREQY----------WRLGAAILLLVGSTLDHL  121

Query  2804  SHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALS  2625
              H  G +    +L+     H  M    LL+PG  ++ DG   L+KG  NMNTLVGLG LS
Sbjct  122   HHLGGIRVPIFNLM---AVHWGMATLALLIPGFPILRDGWTGLVKGHANMNTLVGLGTLS  178

Query  2624  SFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKAR  2445
             ++  S +A   P+LGW+ FF+EPVML+ F+LLGR LE  A++ A S +  LL + P  AR
Sbjct  179   AYLTSCVAWVAPQLGWECFFDEPVMLLGFILLGRTLEGSARLNAMSALESLLALQPQGAR  238

Query  2444  LVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPV  2265
             L+  ++ GE T  V +P + + +G+ + VLPG+++P DG V  G +TVDES  TGE +P+
Sbjct  239   LMGRANKGE-TDEVIIPVTQVQIGEWVRVLPGEKMPVDGEVLRGETTVDESMLTGEAIPI  297

Query  2264  TKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHF  2085
              K PG  V AG++N  G+L V+V +    T +  I+R V  AQ+R+APVQ+LAD+V+G+F
Sbjct  298   EKRPGNTVKAGTLNQLGVLIVQVTKTAQNTVLAQIIRTVTAAQTRKAPVQQLADQVAGYF  357

Query  2084  TYGVMALSAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAV  1905
              YGVMA++  TF+FW   GT+V    L   S   L+L+L+ +VLVVACPCALGLATPTA+
Sbjct  358   AYGVMAIALCTFLFWEFIGTKVW-VELASISPEVLSLKLAIAVLVVACPCALGLATPTAL  416

Query  1904  MVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKR  1725
             +VGT +GA +G+L++GG +LE    + T+VFDKTGTLT G+P++ E++   + D      
Sbjct  417   LVGTGIGAEQGILIKGGDILERLHRLQTVVFDKTGTLTQGQPSIVEILCASNYDSAT---  473

Query  1724  DSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEP-----  1560
                         +L+LA+ VE +TNHP  KA ++A            D  F++EP     
Sbjct  474   ------------LLSLAASVEQHTNHPYAKAFLQAT-----------DPEFLDEPTEVET  510

Query  1559  --GSGAMAVIEEKKVSVGTLDW--VRRHGVGETRVQEFDDFKNQ--SVVYVGVDGVLAGL  1398
               G G    + ++++ +G++ W    +  +    +Q   ++  Q  + V + ++  + G+
Sbjct  511   VLGKGVRGTVGDRQIQIGSVRWFEAEQFNIPTAFLQTSAEWSAQGHTSVVIAINQQVVGI  570

Query  1397  IYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKS  1218
             + + D LR+DA  +V  L   G+   LLSGD+K     +A  +GI  +  F  V P EK+
Sbjct  571   VAIADPLRDDAAQMVHDLQNVGLNVVLLSGDQKTIVSNLAQKLGI--QKYFSAVSPTEKA  628

Query  1217  KFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLD  1038
             K ++ L  +++ +AMVGDGINDA ALA++ VG+++ G    A   + VVLM +RLS ++ 
Sbjct  629   KILTELNAEKQSIAMVGDGINDAPALATADVGISLSGSTDVALATADVVLMGDRLSDVVK  688

Query  1037  ALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMT  858
              L+LSR T+  ++QNLWWA GYN++ +P+AAG+ LP     L+PS+A   M +SS+ V+ 
Sbjct  689   LLKLSRATVAVIRQNLWWALGYNLIAIPLAAGVCLPLWNVSLSPSVAAGFMAMSSVLVVL  748

Query  857   NSLLLRL  837
             NSL LR 
Sbjct  749   NSLRLRF  755



>ref|WP_017304490.1| hypothetical protein [Spirulina subsalsa]
Length=797

 Score =   486 bits (1252),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 325/796 (41%), Positives = 474/796 (60%), Gaps = 63/796 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L  Q  V SA VNL T+ AV+       V P       E LA+ LT
Sbjct  29    GMKCAGCVKAVERQLTQQGGVVSAQVNLITQVAVI-QYDPQTVQP-------ESLAQTLT  80

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF + +R    + L    E++ + +R Q+Q   R L  +  LC   L GHL H+ G +
Sbjct  81    ARGFPSQLRAGETQTLPNWSERRQDEQRQQVQ---RLLTAALLLCFSAL-GHLDHWGGPR  136

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                + ++   GFH ++    L +PGR++I+DG + L    PNMNTLVGLG LS++  S +
Sbjct  137   ---LPVMSDIGFHWALATLALFIPGREIILDGARGLWYRMPNMNTLVGLGTLSAYTASCV  193

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P+L W+ FF+EPVML+ F+ LGR LE  A+ +A + +  L+ + P  ARLV +   
Sbjct  194   ALAFPQLHWECFFDEPVMLLGFIFLGRTLEGNARGRAAAALEQLMALQPRVARLVADGQS  253

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
              E+   +E+P   + VG+ + VLPG++IP DG +  G++T+DES  TGE  PV K  GA 
Sbjct  254   PEEGG-IEIPVELVRVGEWVQVLPGEKIPVDGEIVLGQTTLDESMLTGEATPVFKEVGAT  312

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             VAAG++NL+G + + V + G +TA+  I+  VE AQ R+APVQ+L D V+G+F YGVM L
Sbjct  313   VAAGTLNLSGAIALRVTQIGSDTALAKIIASVEAAQIRKAPVQKLVDTVAGYFAYGVMTL  372

Query  2063  SAATFMFWNLFGTRVLPATL---------HQGslasl----alqlscsvlvvaCPCALGL  1923
             +A TF+FW+ +GT++ P  L          +G + +     +L+L+ +VLVVACPCALGL
Sbjct  373   AALTFLFWSQWGTQLWPQVLTPVTHSMAGMEGMVTTSPVLLSLKLAIAVLVVACPCALGL  432

Query  1922  ATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHND  1743
             ATPTA++VGTSLGA RG+L++GG VLE    + TIVFDKTGTLT+G+P VT+  P G   
Sbjct  433   ATPTAILVGTSLGAERGILIKGGDVLEQMHRIKTIVFDKTGTLTVGQPKVTDCCPWGAYQ  492

Query  1742  ETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEE  1563
              +               ++L LA+ VE  +NHP+  A+V  A+ +   ++  E+  F  E
Sbjct  493   PS---------------ELLQLAASVEKGSNHPLASALVAEAQKQELPLLAGEN--FHTE  535

Query  1562  PGSGAMAVI----EEKKVSVGTLDWVRRHGVG---ETRVQ-EFDDFKNQSVVYVGVDGVL  1407
              G G +A +      ++V +G   W+ +H +    E   Q E      ++V+YV V    
Sbjct  536   AGLGVVAQVTGQGRPQRVLLGNQAWLEQHQIKIPEEVEAQGERLAQAGKTVIYVAVGVEY  595

Query  1406  AGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPD  1227
              GLI V DQLR+DA   V+ L + G+   LL+GD+  AA  +A  +GI  E ++  V P 
Sbjct  596   GGLIAVADQLRQDAAQTVQGLQEMGLEVVLLTGDRPTAARAIAQKLGI--EQIYAQVSPS  653

Query  1226  EKSKFVSGLQKDQKV--VAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNR-  1056
              K+  +  LQ       VAMVGDGINDA ALA + V +A+  G   A + +S++LM ++ 
Sbjct  654   AKAALLQTLQNSPTTAPVAMVGDGINDAPALAQADVSIALQSGTEIAMETASIILMASQG  713

Query  1055  ----LSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGAL  888
                 L  +L+A++LS+ T K ++QNL+WA  YN + +P+AAG+LLP  G  L+P +AG  
Sbjct  714   STIPLHPVLEAIQLSQATFKKIRQNLFWALSYNSLAIPIAAGVLLPSQGIALSPPLAGGF  773

Query  887   MGLSSIGVMTNSLLLR  840
             M LSS+ V+TNSLLLR
Sbjct  774   MALSSVLVVTNSLLLR  789



>ref|XP_010527000.1| PREDICTED: copper-transporting ATPase PAA1, chloroplastic isoform 
X5 [Tarenaya hassleriana]
Length=486

 Score =   475 bits (1223),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 237/320 (74%), Positives = 272/320 (85%), Gaps = 0/320 (0%)
 Frame = -2

Query  3203  AAAGEDAsvvssdviildVGGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSE  3024
             A AG+     SSDVIILDVGGMTCGGCAASVK+ILESQP+VS+ASVNLTTETA+VWPV E
Sbjct  149   AGAGDGVPSPSSDVIILDVGGMTCGGCAASVKKILESQPQVSTASVNLTTETAIVWPVLE  208

Query  3023  AKVVPNWQQQLGEELAKHLTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAV  2844
             AK VPNW+++LGE LAKHL++CGF++  R     N F  FE KM  K  +L+ SGR LAV
Sbjct  209   AKSVPNWKEELGEMLAKHLSNCGFESTPRGLTNVNFFRVFESKMKEKHTRLKESGRELAV  268

Query  2843  SWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGA  2664
             SWALCAVC+VGHL+HF G K  WIH  HSTGFH+S+ L TLL PGRQLIIDG+KSLLKGA
Sbjct  269   SWALCAVCVVGHLTHFLGVKVPWIHAFHSTGFHVSLSLLTLLGPGRQLIIDGIKSLLKGA  328

Query  2663  PNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSD  2484
             PNMNTLVGLGALSSF VSS+AA IPKLGWK FFEEPVMLIAF+LLGRNLEQRAKIKATSD
Sbjct  329   PNMNTLVGLGALSSFTVSSLAAMIPKLGWKTFFEEPVMLIAFILLGRNLEQRAKIKATSD  388

Query  2483  MTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRST  2304
             MTGLL+VLPSKARL+++ D    +STVEVPC++LSVGD +++LPGDR+PADGIVR+GRST
Sbjct  389   MTGLLSVLPSKARLLLDGDPQNPSSTVEVPCNSLSVGDLVVILPGDRVPADGIVRSGRST  448

Query  2303  VDESSFTGEPLPVTKLPGAQ  2244
             +DESS TGEPLPVTK  G +
Sbjct  449   IDESSLTGEPLPVTKESGLE  468



>ref|WP_012626474.1| ATPase [Cyanothece sp. PCC 7425]
 ref|YP_002481737.1| heavy metal translocating P-type ATPase [Cyanothece sp. PCC 7425]
 gb|ACL43376.1| heavy metal translocating P-type ATPase [Cyanothece sp. PCC 7425]
Length=803

 Score =   485 bits (1248),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 332/797 (42%), Positives = 476/797 (60%), Gaps = 58/797 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V++ L  QP V +A VNL T+TA+V      ++ P       E+LA  L+
Sbjct  31    GMRCAGCVRAVEQRLNQQPGVITAVVNLVTQTAMV-EYQPGQIEP-------EQLATTLS  82

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF   V+   +    +T +++        Q    G+A    +C+   +GHL    G  
Sbjct  83    QTGFPTQVQAQEQLRAGDTQQERRELLTNLYQL---GMAAVLVICSG--LGHLGQIAGMA  137

Query  2783  ASWIHL--------LHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGAL  2628
                 H         LHS GFH  +    LL PGR ++ +G K   +G PNMNTLVGLG L
Sbjct  138   LPDFHPGISFHSIGLHSIGFHWGLATLALLGPGRAILWEGAKGWWQGVPNMNTLVGLGTL  197

Query  2627  SSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKA  2448
             S++  S +A   P L W+ FF+EPVM+I F+LLGR LEQ+A+ KA S +  LL++ PS A
Sbjct  198   SAYLASVVALLFPALNWECFFDEPVMMIGFILLGRTLEQQARGKAKSALRKLLSLQPSTA  257

Query  2447  RLVVNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLP  2268
             R + +        +V +P   + VG ++ VLPGDRIP DG +  G++ VDES F+GEPLP
Sbjct  258   RWLADGQ-----RSVSIPVHQVQVGARLQVLPGDRIPVDGKILVGQTLVDESMFSGEPLP  312

Query  2267  VTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGH  2088
             + K  G  V  GS+N +  +T+E    G ++A+  I+RLVE AQ+R+APVQRLAD V+G+
Sbjct  313   IAKSAGDTVLGGSLNQSAAMTIEALHTGKDSALAQIIRLVETAQTRKAPVQRLADTVAGY  372

Query  2087  FTYGVMALSAATFMFW-----NLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGL  1923
             FTYGVMA++  TF+FW     + F    LP  + +     L+L+L+ +VLVVACPCALGL
Sbjct  373   FTYGVMAIALVTFLFWYGLGSHWFDLAALPQPVTEA-PLLLSLKLAIAVLVVACPCALGL  431

Query  1922  ATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEV-VPQGHN  1746
             ATPTA++VGTSLGA RGLL+RG  VLE    ++TIVFDKTGTLT G+P+V E+ +  G  
Sbjct  432   ATPTAILVGTSLGAERGLLIRGADVLEQVHHLDTIVFDKTGTLTRGKPSVVEIWLADGVG  491

Query  1745  DETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIE  1566
                   R            +L LA+ VE+   HP+G AIV+AA  R   ++  + G  + 
Sbjct  492   SSLTVDR------------LLQLAASVETGGQHPLGLAIVQAAHQRELSLLTPQQG--VT  537

Query  1565  EPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQE---FDDF--KNQSVVYVGVDGVLAG  1401
             E G G  A IEE+ V +GT  W+ + G+ E   QE    D    + Q++VYVGV G L G
Sbjct  538   EAGLGVAAQIEEQWVCLGTAHWLAQQGI-EIPAQEQLKADQLAARGQTIVYVGVGGQLVG  596

Query  1400  LIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEK  1221
              + + D L   A+  + +L   G+   +L+GD++ AA  V   +G+  + ++  ++P +K
Sbjct  597   GMAIADPLHPQAQETIAALKAMGLQVKVLTGDQRQAAIKVLQPLGLEPDCIWAEMRPADK  656

Query  1220  SKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNR-----  1056
              + ++ LQ     VAMVGDGINDA ALA + VG+A+  G   A + + +VLM  R     
Sbjct  657   VRAIAQLQAQGHRVAMVGDGINDAPALAQATVGMALASGTDVAVEAAQIVLMAGRNSEAQ  716

Query  1055  LSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLS  876
             L+ ++ AL+LSR T + ++QNL+WA GYN++GLP+AAG+LLP  G +L+P++AGA+M  S
Sbjct  717   LTGVVAALKLSRQTFRKIQQNLFWALGYNLIGLPLAAGVLLPGWGVVLSPAMAGAMMAFS  776

Query  875   SIGVMTNSLLLRLKFAS  825
             S+ V+ NSL LR K+ S
Sbjct  777   SVCVVINSLSLRWKWGS  793



>ref|WP_006507891.1| heavy metal translocating P-type ATPase [Xenococcus sp. PCC 7305]
 gb|ELS05003.1| heavy metal translocating P-type ATPase [Xenococcus sp. PCC 7305]
Length=795

 Score =   484 bits (1245),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 313/804 (39%), Positives = 465/804 (58%), Gaps = 68/804 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V++ L+  P V SA VNL TE AVV    E ++ P         LA  LT
Sbjct  21    GMKCAGCVKAVEKQLQQNPGVISACVNLITEVAVVEYEPE-QIQP-------ATLAYKLT  72

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF + +R +   ++ +  E+  + ++ Q       L  +  L     +GHL H  G  
Sbjct  73    QTGFPSEIRPTGDRSISDKAEQAKDKRQQQQNQQFWQLITAAVLLIFSSIGHL-HHLGLP  131

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
             +  + LL +  FH ++    LL+PGR LIIDG +S     PNMN+LVGLG +S++  S  
Sbjct  132   S--VPLLTNIWFHWALATLALLIPGRNLIIDGARSFYHQMPNMNSLVGLGTVSAYTASCF  189

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A F P+LGW+ FF+EPVML+ F+ LGR LE RA+ +A++ +  L+ + PS ARLV N   
Sbjct  190   ALFFPQLGWQCFFDEPVMLLGFIFLGRTLEARARYRASAALEKLVALQPSTARLVSNQAN  249

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
               +   +++P   + VG+ + V PG++IP DG +  G + +DES  TGE + V K+ G +
Sbjct  250   VSENPNLKIPVEQVRVGEWLRVFPGEKIPTDGTIMVGETKIDESMLTGESIAVQKVAGDR  309

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AG+IN       +V   G  T +  I+ LVE AQ+R+APVQ+LAD V+G+F YGVMA+
Sbjct  310   VFAGTINQEAAFAFQVTEIGNSTTLARIIELVESAQTRKAPVQQLADTVAGYFAYGVMAI  369

Query  2063  SAATFMFWNLFGTRVLPATL-------HQGslaslalql-----------------scsv  1956
             +  T +FW   GT + P  L       HQ    +  L                     +V
Sbjct  370   ATITGLFWYFIGTNLWPQVLMVSSGPMHQAMEMTNTLDANSSLISSTSPLLLSLQLVIAV  429

Query  1955  lvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPT  1776
             LV+ACPCALGLATPTA++VGT +GA +G+L++GG +LE    ++ IVFDKTGTLT G+  
Sbjct  430   LVIACPCALGLATPTAILVGTGMGAQQGILIKGGDILEQVQKLDKIVFDKTGTLTEGKLQ  489

Query  1775  VTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRI  1596
             V+ +       E     DSTS        +L +A+ VE+ +NHP+  AIV  A+ +   +
Sbjct  490   VSAI-------EAINNLDSTS--------LLQMAAAVEAQSNHPLAIAIVNHAQQQELPL  534

Query  1595  VKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVGETRVQEFDDFKN------QSV  1434
             + A D     +PG G   +IE + + +G  DW+ +H +  T  QE  +  N      Q++
Sbjct  535   LTATD--IQAKPGWGISGIIEGETILLGNQDWLNQHQI--TWPQEIQERVNALSATGQTI  590

Query  1433  VYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRE  1254
             VY+   G L GLI + DQLR DA+  V  L   G+ T LL+GD++  A+ +A+ VGI + 
Sbjct  591   VYLAKSGELEGLIALRDQLRSDAQATVTKLQAMGLDTILLTGDREEIAQQIAAEVGISQ-  649

Query  1253  NVFYGVKPDEKSKFVSGLQ------KDQKVVAMVGDGINDAAALasshvgvaigggvgaa  1092
              VF  VKP++K+K +  LQ      ++   VAM+GDGINDA ALA S VG+++      A
Sbjct  650   -VFAQVKPEDKAKIIQSLQGTLSPEQNLNRVAMIGDGINDAPALAQSDVGISLQASTDIA  708

Query  1091  sdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTML  912
              + + ++LMQN L+ +++A+ LS+ T++ ++QNL+WA GYN + +P+AAG+ LP  G +L
Sbjct  709   IETADIILMQNNLADVIEAIALSKATVQKIRQNLFWALGYNAIAIPLAAGVALPSYGLLL  768

Query  911   TPSIAGALMGLSSIGVMTNSLLLR  840
             +P +A   M  SS+ V+TNSLLL+
Sbjct  769   SPILAAIAMASSSLIVVTNSLLLK  792



>ref|WP_009631878.1| heavy metal translocating P-type ATPase [Synechocystis sp. PCC 
7509]
Length=801

 Score =   483 bits (1244),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 329/801 (41%), Positives = 471/801 (59%), Gaps = 62/801 (8%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM CGGC  +V++ L   P   +  VNL TE AVV      +  P+ + Q   ELA  LT
Sbjct  27    GMKCGGCVKTVEKQLAKHPGAIATCVNLVTEVAVV------ECQPSVEPQ---ELAARLT  77

Query  2963  SCGFKANVRDS--RRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
               GF    R++        E F ++      Q + S   L        + +   L H   
Sbjct  78    EAGFPTKPREAIAGETPTIEDFGER------QQRESRAALKQLLLALLLLIFSSLGHLPE  131

Query  2789  AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
             +  + + +L +   H  +   TLL+PGR +I++G +   + APNMNTLV LG ++++  S
Sbjct  132   SILT-LPILKNIWLHWGLATITLLIPGRPIIVEGWRGWRRNAPNMNTLVALGTVTAYITS  190

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
              +A   P LGW+ FF+EPVML+ F+LLGR LEQ+AK +A      LL + P  ARL+   
Sbjct  191   VVALLFPPLGWECFFDEPVMLLGFILLGRTLEQQAKGQAAVAFRQLLALQPQLARLIAPQ  250

Query  2429  DMG-----EQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPV  2265
              +G     + TS+VE+P   + VG+ I VLPG++IP DG V AG++T+DES  TGE  PV
Sbjct  251   AVGIENNFQSTSSVEIPADQVRVGEWIQVLPGEKIPVDGNVVAGQTTIDESMLTGEAFPV  310

Query  2264  TKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHF  2085
              K  G  V AG++N +    ++  R G +T +  IV LVE AQ+R+APVQ+LAD V+G+F
Sbjct  311   IKQLGDTVTAGTLNKSSSFALQATRTGADTTLAQIVALVEAAQTRKAPVQKLADTVAGYF  370

Query  2084  TYGVMALSAATFMFWNLFGTRV-----LPA-------TLHQGslasl----------alq  1971
             TYGV+A S  TF+FW   GT +     LP        TLH   LA            +L+
Sbjct  371   TYGVLAASILTFLFWYFVGTHIWTEVLLPGQMSSHDMTLHAQHLAKAQLLQPSPLLLSLK  430

Query  1970  lscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLT  1791
             L+ +V+VVACPCA+GLATPTA++VGT +GA +GLL++GG VLE    ++T+VFDKTGTLT
Sbjct  431   LAIAVMVVACPCAMGLATPTAILVGTGVGAQKGLLIKGGDVLEKVHKLDTVVFDKTGTLT  490

Query  1790  IGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKS  1611
              G P VT+VV    N+              SE ++L LA+ VES T HP+  AIV+AAK 
Sbjct  491   SGHPIVTDVVVMDGNNLVV-----------SEGELLKLAAVVESGTCHPLATAIVQAAKE  539

Query  1610  RNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWVRRHGVG---ETRVQEFD-DFKN  1443
             +N  I  A+D  +  EPG G  AV++ K++ +G   W+ ++ V    + R Q      K 
Sbjct  540   QNLSICAAKD--YYTEPGLGVSAVVKGKQILLGNYQWLSQNNVNISQQMRSQSVALAAKG  597

Query  1442  QSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGI  1263
             ++VV+V  +  + GLI V D LR +A+  ++ L   G+   LLSGD   AAE V + + +
Sbjct  598   KTVVFVASNSQVLGLIAVSDTLRAEAKSTIKQLRSMGLKVMLLSGDTLEAAEIVGAQLEL  657

Query  1262  PRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaasdv  1083
              + ++   V+P  K++ +  LQ     VAMVGDGINDA AL+ + VG+A+  G   A + 
Sbjct  658   EKADIMALVRPAGKAQAIQQLQAQNHYVAMVGDGINDAPALSQADVGIALKAGTEVAMEA  717

Query  1082  ssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPS  903
             + +VLM++ LS ++ A+ LSR T   ++QNL+WAF YN +G+PVAAG+LLP  G +L P+
Sbjct  718   AQIVLMRDSLSDVVAAITLSRATFLKIRQNLFWAFAYNTLGIPVAAGLLLPSFGFVLNPA  777

Query  902   IAGALMGLSSIGVMTNSLLLR  840
              AGALM  SS+ V+TNSL+LR
Sbjct  778   AAGALMAFSSVSVVTNSLMLR  798



>ref|WP_002787160.1| ATPase [Microcystis aeruginosa]
 emb|CCI16994.1| putative copper-transporting ATPase synA [Microcystis aeruginosa 
PCC 9807]
Length=776

 Score =   481 bits (1238),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 323/787 (41%), Positives = 473/787 (60%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    EA + P       E+LA  LT
Sbjct  18    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPEA-IAP-------EQLAAKLT  69

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          +++  ++ + Q     LA++  L    L+GHL H  G +
Sbjct  70    AIGFPTQPRSSSTP--LSQQNQRLQNQQKERQQQLYRLAIACCLLVFSLIGHLHHIGGPE  127

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +L S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  128   ---IPILQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  184

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  185   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  243

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  244   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDL  301

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  302   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  361

Query  2063  SAATFMFWNLFGTRVLPATL------HQ----GslaslalqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L      H+     S   L+L+L+ SVLVVACPCALGLATP
Sbjct  362   ALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQPTSPLLLSLKLAISVLVVACPCALGLATP  421

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  422   TALLVGTSLAAERGILIKGGDVLETVSQLQTVVFDKTGTLSQGHPEIT------------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S  E + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  470   ---DCLSFSELNSLEIQQLAAVVESGTNHPLAQAILDAVTPPTN--LTGED--FQTVAGL  522

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET  R+QE  +   ++V+Y+G++  L G I  +
Sbjct  523   GVSARVQGSKIVLGNRQWLAQNGIKIDETIPRIQELLE-AGKTVIYLGMEEQLLGAIAFQ  581

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  582   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAQVAPAEKSALI  638

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  639   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  698

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  699   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPRWGLAFSPALAAALMAFSSVMVVSNS  758

Query  851   LLLRLKF  831
             LLLR +F
Sbjct  759   LLLRRQF  765



>ref|WP_040054633.1| ATPase [Candidatus Atelocyanobacterium thalassa]
Length=761

 Score =   478 bits (1231),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 308/778 (40%), Positives = 457/778 (59%), Gaps = 40/778 (5%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C  C  +V++ L  QP V SA VNL TE AVV   +EA             L + LT
Sbjct  15    GMKCASCVKAVEKKLLEQPGVISAQVNLITEVAVVEYNTEAVQ--------SSSLTEKLT  66

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF ++VR S+   + +   K    ++ +       L+++  L  +  +GHL++  G  
Sbjct  67    IIGFPSSVRTSQNLTIQQRKLKSNQHQQKEETQQKINLSIATILIFISNLGHLTYIGGPD  126

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                  +L+   FH  +    +++PG  + +DG + L+ G  NMNTLVGLG  S++++S +
Sbjct  127   ---FFILNDLRFHWVLATIAIVIPGFDIFLDGWRGLVNGIANMNTLVGLGTFSAYSISCV  183

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD-  2427
             A   P LGW+ FF+EPVML+ F+LLGR LE+RAK +A+S +  L+ + P+ ARL  +SD 
Sbjct  184   ALIFPDLGWECFFDEPVMLLGFILLGRILEKRAKNRASSAIESLIELQPALARL--SSDP  241

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               E  S++E+P   + +G+ I +LPGD+IP DG +  G +T+DES  TGE +PV K  G 
Sbjct  242   FSENQSSIEIPVEQVRLGEYIKILPGDKIPVDGRIITGETTIDESLVTGESMPVVKKTGE  301

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             +V  G++N +G++ +E  R G  T +  I+  VE AQ  +AP+Q+L D ++G+F YG+M 
Sbjct  302   EVFVGTLNHSGLIIIETTRIGKNTTLAQIISSVENAQISKAPIQKLTDTIAGYFAYGIMF  361

Query  2066  LSAATFMFWNLFGTRVLPATL---HQGslaslalqlscsvlvvaCPCALGLATPTAVMVg  1896
             LS + F+FW   GT   P  L   H  +   L+L+L+ SVLVVACPCALGLATP A++VG
Sbjct  362   LSVSIFIFWLNIGTAWYPQVLNTSHHSTPFLLSLKLAISVLVVACPCALGLATPMAILVG  421

Query  1895  tslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDST  1716
             T +GA +G+L++ G +LE    ++ IVFDKTGTLT G P V           TN K    
Sbjct  422   TGIGAKKGILIKSGDILEKVPQLHGIVFDKTGTLTTGHPVV-----------TNYKSFGL  470

Query  1715  STCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVI  1536
              + ++    +L LA+ VES TNHP+G AI+  A  +N  ++KAED  F  + GSG  A I
Sbjct  471   LSPQY----LLQLAATVESGTNHPLGLAIIGEADKQNLPLLKAED--FYTKIGSGVTAKI  524

Query  1535  EEKKVSVGTLDWVRRHGVG---ETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDA  1365
             + K V +G   W+  +       +   E    K ++++YVG++  + G + ++D LR DA
Sbjct  525   QGKDVWLGNKSWLVDNEFNFDSSSYHAESLAEKAETIIYVGINKSIEGFLTLKDTLRLDA  584

Query  1364  RHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQK  1185
             +  +  L KQG+   LL+GD    A  +A+ +GI +   F  + P+ K+  +  LQK  +
Sbjct  585   KETILELKKQGLEVILLTGDNPKVAAAIATELGISK--FFAQITPNNKATIIKDLQKKGR  642

Query  1184  VVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKT  1005
              +AMVGDGINDA ALA + +G+++ G    A + S +VLM  R+  +  A+ LS  T   
Sbjct  643   -IAMVGDGINDAPALAQADIGISLQGSTQIALESSDIVLMSGRIWDITTAINLSLATFTK  701

Query  1004  VKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKF  831
             ++QNL WAFGYN + +P+A GILLP  G  + P IA ALM  SSI V+ NSL LR +F
Sbjct  702   IRQNLLWAFGYNTLSIPLAGGILLPSLGFTINPVIAAALMASSSIIVVINSLSLRYQF  759



>gb|KFF41704.1| copper/silver-translocating P-type ATPase [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=772

 Score =   478 bits (1230),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 308/778 (40%), Positives = 457/778 (59%), Gaps = 40/778 (5%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C  C  +V++ L  QP V SA VNL TE AVV   +EA             L + LT
Sbjct  26    GMKCASCVKAVEKKLLEQPGVISAQVNLITEVAVVEYNTEAVQ--------SSSLTEKLT  77

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF ++VR S+   + +   K    ++ +       L+++  L  +  +GHL++  G  
Sbjct  78    IIGFPSSVRTSQNLTIQQRKLKSNQHQQKEETQQKINLSIATILIFISNLGHLTYIGGPD  137

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                  +L+   FH  +    +++PG  + +DG + L+ G  NMNTLVGLG  S++++S +
Sbjct  138   ---FFILNDLRFHWVLATIAIVIPGFDIFLDGWRGLVNGIANMNTLVGLGTFSAYSISCV  194

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD-  2427
             A   P LGW+ FF+EPVML+ F+LLGR LE+RAK +A+S +  L+ + P+ ARL  +SD 
Sbjct  195   ALIFPDLGWECFFDEPVMLLGFILLGRILEKRAKNRASSAIESLIELQPALARL--SSDP  252

Query  2426  MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGA  2247
               E  S++E+P   + +G+ I +LPGD+IP DG +  G +T+DES  TGE +PV K  G 
Sbjct  253   FSENQSSIEIPVEQVRLGEYIKILPGDKIPVDGRIITGETTIDESLVTGESMPVVKKTGE  312

Query  2246  QVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMA  2067
             +V  G++N +G++ +E  R G  T +  I+  VE AQ  +AP+Q+L D ++G+F YG+M 
Sbjct  313   EVFVGTLNHSGLIIIETTRIGKNTTLAQIISSVENAQISKAPIQKLTDTIAGYFAYGIMF  372

Query  2066  LSAATFMFWNLFGTRVLPATL---HQGslaslalqlscsvlvvaCPCALGLATPTAVMVg  1896
             LS + F+FW   GT   P  L   H  +   L+L+L+ SVLVVACPCALGLATP A++VG
Sbjct  373   LSVSIFIFWLNIGTAWYPQVLNTSHHSTPFLLSLKLAISVLVVACPCALGLATPMAILVG  432

Query  1895  tslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDST  1716
             T +GA +G+L++ G +LE    ++ IVFDKTGTLT G P V           TN K    
Sbjct  433   TGIGAKKGILIKSGDILEKVPQLHGIVFDKTGTLTTGHPVV-----------TNYKSFGL  481

Query  1715  STCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVI  1536
              + ++    +L LA+ VES TNHP+G AI+  A  +N  ++KAED  F  + GSG  A I
Sbjct  482   LSPQY----LLQLAATVESGTNHPLGLAIIGEADKQNLPLLKAED--FYTKIGSGVTAKI  535

Query  1535  EEKKVSVGTLDWVRRHGVG---ETRVQEFDDFKNQSVVYVGVDGVLAGLIYVEDQLREDA  1365
             + K V +G   W+  +       +   E    K ++++YVG++  + G + ++D LR DA
Sbjct  536   QGKDVWLGNKSWLVDNEFNFDSSSYHAESLAEKAETIIYVGINKSIEGFLTLKDTLRLDA  595

Query  1364  RHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQK  1185
             +  +  L KQG+   LL+GD    A  +A+ +GI +   F  + P+ K+  +  LQK  +
Sbjct  596   KETILELKKQGLEVILLTGDNPKVAAAIATELGISK--FFAQITPNNKATIIKDLQKKGR  653

Query  1184  VVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKT  1005
              +AMVGDGINDA ALA + +G+++ G    A + S +VLM  R+  +  A+ LS  T   
Sbjct  654   -IAMVGDGINDAPALAQADIGISLQGSTQIALESSDIVLMSGRIWDITTAINLSLATFTK  712

Query  1004  VKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKF  831
             ++QNL WAFGYN + +P+A GILLP  G  + P IA ALM  SSI V+ NSL LR +F
Sbjct  713   IRQNLLWAFGYNTLSIPLAGGILLPSLGFTINPVIAAALMASSSIIVVINSLSLRYQF  770



>ref|WP_002767526.1| ATPase [Microcystis aeruginosa]
 emb|CCI01995.1| putative copper-transporting ATPase synA [Microcystis aeruginosa 
PCC 9443]
Length=776

 Score =   477 bits (1228),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 319/787 (41%), Positives = 471/787 (60%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  18    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDA-IAP-------EQLAAKLT  69

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          +++  ++ + Q     LA++  L    L+GHL H  G +
Sbjct  70    AIGFPTQPRSSSTP--LSQQNQRLQNQQKERQQQLYRLAIACCLLVFSLIGHLHHIGGPE  127

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +L S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  128   ---IPILQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  184

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  185   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  243

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  244   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDL  301

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  302   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  361

Query  2063  SAATFMFWNLFGTRVLPATL------HQGslasl----alqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L      H+   ++     +L+L+ SVLVVACPCALGLATP
Sbjct  362   ALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQSTSPLLLSLKLAISVLVVACPCALGLATP  421

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  422   TALLVGTSLAAERGILIKGGDVLETVSQLQTVVFDKTGTLSQGHPEIT------------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S  E + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  470   ---DCLSFSELNSLEIQQLAAVVESGTNHPLARAILDAVTPPTN--LTGED--FQTVAGL  522

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE      ++V+Y+G++  L G I  +
Sbjct  523   GVSARVQGSKIVLGNRQWLAQNGIKIDETIPGIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  581

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  582   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAQVAPTEKSALI  638

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  639   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  698

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  699   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPHWGLAFSPALAAALMAFSSVMVVSNS  758

Query  851   LLLRLKF  831
             LLLR +F
Sbjct  759   LLLRRQF  765



>ref|WP_002779125.1| ATPase [Microcystis aeruginosa]
 emb|CCI09133.1| putative copper-transporting ATPase synA [Microcystis aeruginosa 
PCC 7941]
Length=776

 Score =   477 bits (1227),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 318/787 (40%), Positives = 470/787 (60%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  18    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDA-IAP-------EQLAAKLT  69

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          +++  ++ + Q     LA++  L    L+GHL H  G +
Sbjct  70    AIGFPTQPRSSSTP--LSQQNQRLQNQQKERQQQLYRLAIACCLLVFSLIGHLHHIGGPE  127

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +  S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  128   ---IPIFQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  184

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  185   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  243

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  244   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDL  301

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  302   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  361

Query  2063  SAATFMFWNLFGTRVLPATL------HQGslasl----alqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L      H+   ++     +L+L+ SVLVVACPCALGLATP
Sbjct  362   ALIVLLFWYFWGTRLFPEVLGATTGHHEMIQSTSPLLLSLKLAISVLVVACPCALGLATP  421

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  422   TALLVGTSLAAERGILIKGGDVLETVSQLQTVVFDKTGTLSQGHPEIT------------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S  E + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  470   ---DCLSFSELNSLEIQQLAALVESGTNHPLARAILDAVTPPTN--LTGED--FQTVAGL  522

Query  1553  GAMAVIEEKKVSVGTLDWVRRHGV--GET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G+   ET   +QE      ++V+Y+G++  L G I  +
Sbjct  523   GVSARVQGSKIVLGNRQWLAQNGIKIDETIPSIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  581

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  582   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAEVAPTEKSALI  638

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  639   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  698

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  699   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPHWGLAFSPALAAALMAFSSVMVVSNS  758

Query  851   LLLRLKF  831
             LLLR +F
Sbjct  759   LLLRRQF  765



>ref|WP_002741560.1| copper-translocating P-type ATPase [Microcystis aeruginosa]
 gb|ELS49464.1| copper-translocating P-type ATPase [Microcystis aeruginosa DIANCHI905]
Length=776

 Score =   476 bits (1226),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 319/787 (41%), Positives = 470/787 (60%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  18    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDA-IAP-------EQLAAKLT  69

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          +++  ++ + Q     LA++  L    L+GHL H  G +
Sbjct  70    AIGFPTQPRSSSTP--LSQQNQRLQNQQKERQQQLYRLAIACCLLVFSLIGHLHHIGGPE  127

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +L S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  128   ---IPILQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  184

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A  +P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  185   ALILPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  243

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  244   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDL  301

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  302   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  361

Query  2063  SAATFMFWNLFGTRVLPATL------HQGslaslalqls----csvlvvaCPCALGLATP  1914
             +    +FW  +GT++ P  L      H+   ++  L LS     SVLVVACPCALGLATP
Sbjct  362   ALIVLLFWYFWGTKLFPEVLGSTTGHHEMIQSTSPLLLSLKLGISVLVVACPCALGLATP  421

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  422   TALLVGTSLAAERGILIKGGDVLETVSQLQTVVFDKTGTLSQGHPEIT------------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S  E + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  470   ---DCLSFSELNSLEIQQLAAVVESGTNHPLARAILDAVTPPTN--LTGED--FQTVAGL  522

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE      ++V+Y+G++  L G I  +
Sbjct  523   GVSARVQGSKIVLGNRQWLAQNGIKIDETIPSIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  581

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  582   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAQVAPTEKSALI  638

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  639   ADLQTKEGKIVAMVGDGINDAPALVQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  698

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  699   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPRWGLAFSPALAAALMAFSSVMVVSNS  758

Query  851   LLLRLKF  831
             LLLR +F
Sbjct  759   LLLRRQF  765



>ref|WP_024546206.1| ATPase [Synechococcus sp. NKBG15041c]
Length=768

 Score =   476 bits (1225),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 309/780 (40%), Positives = 468/780 (60%), Gaps = 42/780 (5%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L  QP VS+A VNL TE AVV     AK+ P       E +A+ L+
Sbjct  26    GMRCAGCVKAVERQLLQQPGVSTAVVNLITEVAVV-TYEVAKIQP-------EAIAQQLS  77

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF +  R +  E   +  EK+  ++R Q    G  + +   L A  L GH+ H  G K
Sbjct  78    QTGFPSQPRQAATETFNQYQEKRNQSQREQYWRLGAAIIL---LLASSL-GHIHHLTGLK  133

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I LLH  G H  M    L +PG  ++ DG   L+KG  NMNTLVGLG LS++  S +
Sbjct  134   ---IPLLHLMGIHWGMATLALFIPGLPILRDGWLGLIKGHANMNTLVGLGTLSAYITSCV  190

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A  +P+LGW  FF+EPVML+ F+ LGR LE  A++KA + +  LL + P KARL+     
Sbjct  191   AWLLPQLGWDCFFDEPVMLLGFIFLGRTLEGNARLKAIAALEALLALQPQKARLMGREHK  250

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
             GE T  + +P + + +G+ + VLPG++IP DG++  G +TVDE+  TGE LP T+     
Sbjct  251   GE-TEEITIPVAQVQIGEWVRVLPGEKIPVDGVIIRGETTVDEAMLTGEALPQTRTLADA  309

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AG++N  G++ V+  +    T +  I+R VEEAQ+R+APVQ++AD V+G+F YGVMA+
Sbjct  310   VKAGTLNQLGVIIVQASQTAENTLLAQIIRTVEEAQTRKAPVQKMADTVAGYFAYGVMAI  369

Query  2063  SAATFMFWNLFGTRVLPATLHQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslg  1884
             +A TF+FW   GTR L  T  + +   L+L+L+ +VLV+ACPCALGLATPTA++VGT LG
Sbjct  370   AALTFLFWEFVGTR-LWLTPGETNPEILSLKLAIAVLVIACPCALGLATPTALLVGTGLG  428

Query  1883  atrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCE  1704
             A +G++++GG +LE  + + T+VFDKTGTLT G+P + EVV                   
Sbjct  429   AEQGIIIKGGDILERLNQLTTVVFDKTGTLTQGKPQIVEVV---------------CFAP  473

Query  1703  WSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEP-GSGAMAVIEEK  1527
             W E  +L LA+ +E  T HP G+A +  A+ +   +++ +    +E   G G   ++   
Sbjct  474   WQEAPLLQLAASLEQRTTHPYGRAFMAIAQQQALVLLEPDQ---VETCLGKGIAGLVNGH  530

Query  1526  KVSVGTLDW--VRRHGVGETRVQEFDDFKN--QSVVYVGVDGVLAGLIYVEDQLREDARH  1359
             ++ +G+  W    +  + +T       + N  Q+ + + ++  +AGL+ + D +R DA  
Sbjct  531   QLHIGSPAWFTASQISIPKTAQSTLGAWANAGQTPIVIAINQQVAGLVAIADPIRADAAA  590

Query  1358  VVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVV  1179
             ++E+L  + +   LLSGD+++  + +AS + + + +   G+ P EK+ F+  LQ++++VV
Sbjct  591   LIENLKARNLDVILLSGDQESVVQKLASTLQLNQAH--GGLSPTEKAAFLQDLQENRQVV  648

Query  1178  AMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVK  999
             AMVGDGINDA ALA++ VG+++      A   + +VLM +RL      L L R T+K + 
Sbjct  649   AMVGDGINDAPALATADVGISLQSSTDIALATADIVLMGDRLWDFDQTLTLGRATVKVIH  708

Query  998   QNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFASKQ  819
             QNL WA GYN+V +P+AAG+LLP     L+P+ A  LM +SS+ V+TNSL L+  F ++Q
Sbjct  709   QNLIWACGYNLVAIPLAAGMLLPQYNFSLSPASAAGLMAMSSVLVVTNSLTLKKSFQTQQ  768



>ref|WP_030007444.1| ATPase [Synechococcus sp. NKBG042902]
Length=770

 Score =   476 bits (1224),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 310/788 (39%), Positives = 464/788 (59%), Gaps = 49/788 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L  Q  V SA VNL TE AVV    E K+ P       E +A  L+
Sbjct  24    GMRCAGCVKAVERQLTQQSGVLSAVVNLITEVAVVTYEPE-KIQP-------EAIANRLS  75

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF +  R +  E   +  EK+  ++R Q    G  + +   L A  L GHL H  G K
Sbjct  76    QAGFPSEPRTTEVETFNQYQEKRAQSQREQYWRLGAAIVL---LLASSL-GHLHHLTGLK  131

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I LLH  G H ++    L +PG  ++ DG   L+KG  NMNTLVGLG LS++  S +
Sbjct  132   ---IPLLHLMGVHWAIATLALFIPGLPILRDGWTGLIKGHANMNTLVGLGTLSAYLTSCV  188

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A  +P+LGW+ FF+EPVML+ F+ LGR LE  A++KA + +  LL + P  ARL+     
Sbjct  189   AWLMPQLGWECFFDEPVMLLGFIFLGRTLEGNARLKAIAALESLLALQPQGARLMGREQK  248

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
             GE T  + +P + + +G+ + +LPG++IP DG +  G +TVDES  TGE LP  K  GA 
Sbjct  249   GE-TEEITIPVAQVQIGEWVRILPGEKIPVDGAIIRGETTVDESMLTGEALPQEKTVGAS  307

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AG++N  G++ V+  +    T +  I+R VE AQ+R+APVQ++AD ++G+F YGVMAL
Sbjct  308   VKAGTLNQLGVIIVQATQTAQNTMLAQIIRTVEAAQTRKAPVQKMADTIAGYFAYGVMAL  367

Query  2063  SAATFMFWNLFGTRVLPATLHQGsl--aslalqlscsvlvvaCPCALGLATPTAVMVgts  1890
             +   F+FW L G+++    L  G+     L+L+L+ +VLVVACPCALGLATPTA++VGTS
Sbjct  368   AVLVFLFWELIGSQLW---LDPGATNPEILSLKLAIAVLVVACPCALGLATPTALLVGTS  424

Query  1889  lgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTST  1710
             LGA +G+L++GG +LE  + + T+VFDKTGTLT G+P + E V               S 
Sbjct  425   LGAEQGILIKGGDILERLNQLTTVVFDKTGTLTQGKPQIVEWV---------------SF  469

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEP-GSGAMAVIE  1533
               WS+  +L  A+ +E  + HP G+A V  A+ +N  +   +    +E   G G +  ++
Sbjct  470   APWSQDSLLQWAASLEQRSTHPYGQAFVAIAQQQNRELFAPDQ---VETALGKGIVGQVK  526

Query  1532  EKKVSVGTLDWVRRHG--VGETRVQEFDDFK--NQSVVYVGVDGVLAGLIYVEDQLREDA  1365
              + V +G   W+      + E      + +    ++ +++ +D  +AGL+ + D +R DA
Sbjct  527   GQSVHIGNQTWLETAQIIIPEACHHHLETWSAAGKTTIFIAIDHQVAGLVAIADPIRPDA  586

Query  1364  RHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQK  1185
               ++E+L  + +   LLSGD+  A + +A  + +  ++    + P EK+  +  LQ  QK
Sbjct  587   AALIENLRARNLEVILLSGDQAPAVKNLAQTLQL--DHYQGALSPIEKAAALRTLQAQQK  644

Query  1184  VVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKT  1005
             VVAM+GDGINDA ALA++ +G+++ G    A   + ++LM +RL      L LS+ T+K 
Sbjct  645   VVAMIGDGINDAPALATADIGISLQGSTDVALATADIILMGDRLMDFAQTLHLSQATVKV  704

Query  1004  VKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFAS  825
             ++QNL WAFGYN++ +P+AAGILLP     L+P++A  LM +SS+ V+TNSL L+  F  
Sbjct  705   IRQNLIWAFGYNLIAIPLAAGILLPQFNFTLSPAVAAGLMAMSSVLVVTNSLTLKKSF--  762

Query  824   KQKEIQGP  801
              QK  Q P
Sbjct  763   -QKTNQNP  769



>emb|CBI32959.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   457 bits (1176),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 221/266 (83%), Positives = 244/266 (92%), Gaps = 0/266 (0%)
 Frame = -2

Query  2894  MNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLV  2715
             M+ KR +L+ SGR LAVSWALCAVCL GHLSHF G KASWIH  HSTGFH+S+ LFTLL 
Sbjct  1     MDEKRNKLKESGRELAVSWALCAVCLFGHLSHFLGTKASWIHAFHSTGFHLSLSLFTLLG  60

Query  2714  PGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFV  2535
             PGR LI+DGLKS LKGAPNMNTLVGLGA+SSF+VSS+AA IP+LGWKAFFEEP+MLIAFV
Sbjct  61    PGRGLILDGLKSFLKGAPNMNTLVGLGAVSSFSVSSLAALIPELGWKAFFEEPIMLIAFV  120

Query  2534  LLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTSTVEVPCSNLSVGDQIIVL  2355
             LLGRNLEQRAKIKATSDMTGLL++LP+KARL +N D  E +STVEVPC+NLSVGDQI+VL
Sbjct  121   LLGRNLEQRAKIKATSDMTGLLSILPAKARLFINGDSEEFSSTVEVPCNNLSVGDQIVVL  180

Query  2354  PGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGET  2175
             PGDR+PADGIVRAGRSTVDESSFTGEPLPVTKLPGA+V+AGSINLNG L VEV+RPGGET
Sbjct  181   PGDRVPADGIVRAGRSTVDESSFTGEPLPVTKLPGAEVSAGSINLNGTLRVEVRRPGGET  240

Query  2174  AIGDIVRLVEEAQSREAPVQRLADKV  2097
             A+GDIVRLVE AQSREAPVQRLADKV
Sbjct  241   AMGDIVRLVEAAQSREAPVQRLADKV  266



>ref|WP_002782462.1| putative copper-transporting ATPase synA [Microcystis aeruginosa]
 emb|CCI12229.1| putative copper-transporting ATPase synA [Microcystis aeruginosa 
PCC 9806]
Length=776

 Score =   475 bits (1223),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 320/787 (41%), Positives = 469/787 (60%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  18    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDA-IAP-------EQLAAKLT  69

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          ++   ++ + Q     LA++  L    L+GHL H  G +
Sbjct  70    AIGFPTQPRSSSTP--LSQQNQRRQNQQKEQQQQLYRLAIACCLLVFSLIGHLHHIGGPE  127

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +  S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  128   ---IPIFQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  184

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  185   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  243

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  244   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDL  301

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  302   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  361

Query  2063  SAATFMFWNLFGTRVLPATL------HQ----GslaslalqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L      H+     S   L+L+L+ SVLVVACPCALGLATP
Sbjct  362   ALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQPTSPLLLSLKLAISVLVVACPCALGLATP  421

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  422   TALLVGTSLAAERGILIKGGDVLETVSRLQTVVFDKTGTLSQGHPEIT------------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S  E + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  470   ---DCLSFSELNSLEIQQLAAVVESGTNHPLAQAILDAVTPPTN--LTGED--FQTVAGL  522

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE      ++V+Y+G++  L G I  +
Sbjct  523   GVSARVQGSKIVLGNRQWLAQNGIKIDETIWGIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  581

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  582   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAEVAPTEKSALI  638

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  639   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  698

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  699   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPHWGLAFSPALAAALMAFSSVMVVSNS  758

Query  851   LLLRLKF  831
             LLLR +F
Sbjct  759   LLLRRQF  765



>emb|CDP13473.1| unnamed protein product [Coffea canephora]
Length=744

 Score =   474 bits (1220),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 316/732 (43%), Positives = 436/732 (60%), Gaps = 59/732 (8%)
 Frame = -2

Query  2885  KRAQLQASGRGLAVSWALCAVCLVGHLSHFFG------AKASWIHLLHSTGFHMSMCLFT  2724
             K A L  S   +A +W L A+C   H SH         A  S   +LH++     + L  
Sbjct  22    KEALLLESRNRVAFAWTLVALCCGAHASHILHSLGIHVAHGSVFEVLHNSYVKCGLALGA  81

Query  2723  LLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVML  2547
             LL PGR L+ DGL++  KG+PNMN+LVG G++++FA+S ++   P+L W A FF+EPVML
Sbjct  82    LLGPGRDLLFDGLRAFRKGSPNMNSLVGFGSIAAFAMSMVSLLNPELEWDASFFDEPVML  141

Query  2546  IAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDMGEQTS---------TVEVP  2394
             + FVLLGR+LE+RA+I+A+SDM  LL+++ +++RLV+     E             +EVP
Sbjct  142   LGFVLLGRSLEERARIRASSDMNELLSLVSTQSRLVIAPSGSESADDSVLCTGAMCIEVP  201

Query  2393  CSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNG  2214
               ++ +GD ++VLPG+ IP DG V AGRS VDES  TGE LPV K  G  V+AG+IN +G
Sbjct  202   TDDIKIGDSVLVLPGETIPVDGKVLAGRSVVDESMLTGESLPVFKEKGLLVSAGTINWDG  261

Query  2213  MLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNL  2034
              L ++    G  + I  IV +VE+AQ REAP+QRLAD ++G F Y VM LSAATF FWN 
Sbjct  262   PLRIQATTTGSNSTITKIVTMVEDAQGREAPIQRLADSIAGPFVYTVMTLSAATFAFWNY  321

Query  2033  FGTRVLPATL------HQGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrg  1872
              GT   P  L       +G+   L+L+LS  VLVV+CPCALGLATPTA++VGTSLGA +G
Sbjct  322   IGTHAFPDVLLNDVAGPEGNPLLLSLKLSVDVLVVSCPCALGLATPTAILVGTSLGAKQG  381

Query  1871  lllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEV  1692
             LL+RGG VLE  + ++ I  DKTGTLT G+P V+ V    H                 E 
Sbjct  382   LLIRGGDVLERLAGIDHITLDKTGTLTEGKPAVSGVASLSHG----------------ES  425

Query  1691  DVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIEEKKVSVG  1512
             ++L +A+ VE   +HPI KAI+  A+S N  +        I EPG G +A ++   V+VG
Sbjct  426   EILRMAAAVEKTASHPIAKAILTRAESLNLDLPPTRGQ--IAEPGFGTLAEVDGLLVAVG  483

Query  1511  TLDWVRRHGVGETRVQEFDDFKNQ----------------SVVYVG-VDGVLAGLIYVED  1383
             TL WV      +T        +                  + VYVG     + G I + D
Sbjct  484   TLSWVHERFQQKTDPSHLKILEESVMRQSSMNSSSSVHSITAVYVGREGEGIIGAIGISD  543

Query  1382  QLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSG  1203
              LR DA+  +  L ++GI T LLSGD++ A   VA  VGI  E +   + P +KS  +S 
Sbjct  544   SLRSDAKSTMLGLKQRGIRTVLLSGDREEAVATVAKSVGIENEFINASLTPQQKSGVISS  603

Query  1202  LQKDQKVVAMVGDGINDAA--ALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALE  1029
             LQ     VAMVGDGINDA   ALA   + + I     AAS+ +S++L+ N+LSQ+ +A++
Sbjct  604   LQAAGHSVAMVGDGINDAPSLALADVGIALQIEKQENAASNAASIILLGNKLSQVAEAID  663

Query  1028  LSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSL  849
             L+R TM  V QNL WA  YNI+ +P+AAG+LLP     +TPS++G LM LSSI V+TNSL
Sbjct  664   LARATMAKVHQNLSWAVAYNIIAIPIAAGVLLPNFDFAMTPSLSGGLMALSSIFVVTNSL  723

Query  848   LLRLKFASKQKE  813
             LL+   + ++++
Sbjct  724   LLQFHRSDRKEK  735



>ref|WP_040936519.1| ATPase, partial [Prochloron didemni]
Length=818

 Score =   476 bits (1226),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 327/823 (40%), Positives = 475/823 (58%), Gaps = 86/823 (10%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQL--GEELAKH  2970
             GM C GC  SV+R L+    V +ASVNL TE AVV           +Q +L   E LA  
Sbjct  26    GMKCAGCVKSVERQLQQNSGVIAASVNLITEVAVV----------EYQPELVEPETLATK  75

Query  2969  LTSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFG  2790
             LTS GF A +R S   +      K+    R QL      L  +  L     +GHL H   
Sbjct  76    LTSKGFPAQLRVSNSNSYENVLSKQEQENRQQLWR----LITAAILLLFSSLGHLHHL--  129

Query  2789  AKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVS  2610
                + + LL +  FH  +    L +PG  ++ DG + L +  PNMN+L+GLG  S++  S
Sbjct  130   -GFTLLPLLSNIWFHWGLATLALAIPGFSILADGARGLWQRMPNMNSLIGLGTFSAYTTS  188

Query  2609  SMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNS  2430
             ++A   P+LGW+ FF+EPVML+ F+ LGR LE RA+ KA S +T LL + P  ARL+   
Sbjct  189   TVALLFPQLGWECFFDEPVMLLGFIFLGRTLEGRARNKAASALTALLALQPKVARLIAPD  248

Query  2429  DMGEQT--STVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKL  2256
                 ++  + +++P   + VG+ + VLPG+++P DG+V  G ST+D+S  TGE + V K 
Sbjct  249   SKSSKSKETGIQIPVEQVQVGEWVWVLPGEQVPVDGVVVEGSSTIDQSMVTGESIAVLKQ  308

Query  2255  PGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYG  2076
              G +V AG++N +G + V   + G  T +  I+  V+EAQ R+AP+Q+LAD V+G+FTYG
Sbjct  309   LGDKVTAGTMNQSGAIAVRTTQTGDNTTLAQIIASVQEAQMRKAPIQQLADTVAGYFTYG  368

Query  2075  VMALSAATFMFWNLFGTRVLPATL----HQGslaslalq--------lscsvlvvaCPCA  1932
             VM ++  T +FW   GT + P  L    H                  L+ +VLV++CPCA
Sbjct  369   VMTVAGLTLLFWYFVGTIIWPDVLLNIGHHSVTGMSPTTSSLLLSLKLAIAVLVISCPCA  428

Query  1931  LGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQG  1752
             LGLATPTA++VGT +GA RGLL++GG +LE    ++T+VFDKTGTLTIG+P VT+++P G
Sbjct  429   LGLATPTAILVGTGIGAERGLLIKGGDILERVQQLDTVVFDKTGTLTIGQPEVTDILPLG  488

Query  1751  HNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTF  1572
              N E N              D+L LA+  ES TNHP+  AIV AAK  +  I+ A +  F
Sbjct  489   -NGEINVH------------DLLQLAATAESGTNHPLATAIVNAAKELDISILAATN--F  533

Query  1571  IEEPGSGAMAVIEEKKVSVGTLDWVRRHGVG-ETRVQEFDDF---KNQSVVYVGVDGVLA  1404
                PG G  + IE K++ +G  DW+ + G+  E  +++  ++   + +++VYV V+  LA
Sbjct  534   ATFPGLGVTSEIEGKRIWLGNEDWIGKQGIEIEKEIKDKAEYLVKQGKNLVYVAVENSLA  593

Query  1403  GLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDE  1224
             GLI ++D+LR DA   V+ L   G+ T LL+GD     + +AS VGI +  VF  VKP+E
Sbjct  594   GLIALKDELRPDAAATVKKLQDWGLETVLLTGDCWITGKAIASQVGISQ--VFAEVKPNE  651

Query  1223  KSKFVSGLQ-------------------------------KDQKVVAMVGDGINDAAALa  1137
             K+  +  LQ                                + K VAMVGDGINDA ALA
Sbjct  652   KAAIIQSLQTTNTSTTLRLRSGQALSAGNQQPTTNNQQQITNNKTVAMVGDGINDAPALA  711

Query  1136  sshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGL  957
              + +G+++  G   A + + ++LM++RL  L+ +++LS+ T KT++QNL+WA GYN + +
Sbjct  712   QADIGISLKMGTEVAVETAGIILMRDRLLDLVQSIQLSKATTKTIRQNLFWALGYNAIAI  771

Query  956   PVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFA  828
             P+AAGILLP  G +L P+ A A M LSS+ V+ NSLLLR  F+
Sbjct  772   PIAAGILLPL-GVVLNPATAAAFMALSSVTVVANSLLLRRSFS  813



>ref|WP_002759061.1| ATPase [Microcystis aeruginosa]
 emb|CCH96779.1| putative copper-transporting ATPase synA [Microcystis aeruginosa 
PCC 9717]
Length=776

 Score =   475 bits (1222),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 324/796 (41%), Positives = 475/796 (60%), Gaps = 58/796 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    EA + P       E+LA  LT
Sbjct  18    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPEA-IAP-------EQLAAKLT  69

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          +++  ++ + Q     LA++  L    L+GHL H  G +
Sbjct  70    AIGFPTQPRSSSTP--LSQQNQRLQNQQKERQQQLYRLAIACCLLVFSLIGHLHHIGGPE  127

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +  S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  128   ---IPIFQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  184

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A  +P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  185   ALILPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  243

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  244   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDL  301

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  302   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  361

Query  2063  SAATFMFWNLFGTRVLPATL------HQ----GslaslalqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L      H+     S   L+L+L+ SVLVVACPCALGLATP
Sbjct  362   ALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQPTSPLLLSLKLAISVLVVACPCALGLATP  421

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  422   TALLVGTSLAAERGILIKGGDVLETVSQLQTVVFDKTGTLSQGHPEIT------------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S    + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  470   ---DCLSFSILNSLEIQQLAAVVESGTNHPLARAILDAVTLPTN--LTGED--FQTVAGL  522

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE      ++V+Y+G++  L G I  +
Sbjct  523   GVSARVQGSKIVLGNRQWLAQNGIKIDETIWGIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  581

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++ A   +A+ +GI +   FY  V P EKS  +
Sbjct  582   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEAVTAIANSLGISQ---FYAQVAPAEKSALI  638

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  639   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  698

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  699   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPRWGLAFSPALAAALMAFSSVMVVSNS  758

Query  851   LLLRLKF---ASKQKE  813
             LLLR +F    S Q+E
Sbjct  759   LLLRRQFPPLKSTQEE  774



>ref|WP_024969874.1| ATPase [Microcystis aeruginosa]
Length=776

 Score =   474 bits (1221),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 319/787 (41%), Positives = 467/787 (59%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  18    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDA-IAP-------EQLAAKLT  69

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          ++   ++ + Q     LA++  L    L+GHL H  G +
Sbjct  70    AIGFPTQPRSSSTP--LSQQNQRRQNQQKERQQQLYRLAIACCLLVFSLIGHLHHIGGPE  127

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +  S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  128   ---IPIFQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  184

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  185   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  243

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  244   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGEL  301

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  302   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  361

Query  2063  SAATFMFWNLFGTRVLPATL----------HQGslaslalqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L             S   L+L+L+ SVLVVACPCALGLATP
Sbjct  362   ALIVLLFWYFWGTRLFPEVLGSTTGHHELIQSTSPLLLSLKLAISVLVVACPCALGLATP  421

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  422   TALLVGTSLAAERGILIKGGDVLETVSQLQTVVFDKTGTLSQGHPEIT------------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S  E + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  470   ---DCLSFSELNPLEIQQLAALVESGTNHPLAQAILDAVTPPTN--LTGED--FQTVAGL  522

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE      ++V+Y+G++  L G I  +
Sbjct  523   GVSARVQGSKIVLGNRQWLAQNGIKIDETIWGIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  581

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  582   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAEVAPTEKSALI  638

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  639   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  698

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  699   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPRWGLAFSPALAAALMAFSSVMVVSNS  758

Query  851   LLLRLKF  831
             LLLR +F
Sbjct  759   LLLRRQF  765



>ref|WP_004158372.1| ATPase [Microcystis aeruginosa]
 emb|CCH92228.1| putative copper-transporting ATPase synA [Microcystis aeruginosa 
PCC 9432]
Length=776

 Score =   474 bits (1220),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 319/787 (41%), Positives = 468/787 (59%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  18    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDA-IAP-------EQLAAKLT  69

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          +++  ++ + Q     LA++  L    L+GHL H  G +
Sbjct  70    AIGFPTQPRSSSTP--LSQQNQRLQNQQKERQQQLYRLAIACCLLVFSLIGHLHHIGGPE  127

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +  S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  128   ---IPIFQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  184

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  185   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  243

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  244   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDL  301

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  302   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIVAVESAQTRKAPVQKIADRVAGYFAYGVMII  361

Query  2063  SAATFMFWNLFGTRVLPATL----------HQGslaslalqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L             S   L+L+L+ SVLVVACPCALGLATP
Sbjct  362   ALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQHTSPLLLSLKLAISVLVVACPCALGLATP  421

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  422   TALLVGTSLAAERGILIKGGDVLETVSRLQTVVFDKTGTLSQGHPEIT------------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S  E + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  470   ---DCLSFSELNSLEIQQLAALVESGTNHPLAQAILDAVTPPTN--LTGED--FQTVAGL  522

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE      ++V+Y+G++  L G I  +
Sbjct  523   GVSARVQGSKIVLGNRQWLAQNGIKIDETIWGIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  581

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  582   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAEVAPTEKSALI  638

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  639   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  698

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  699   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPRWGIAFSPALAAALMAFSSVMVVSNS  758

Query  851   LLLRLKF  831
             LLLR +F
Sbjct  759   LLLRRQF  765



>ref|WP_002732767.1| copper-translocating P-type ATPase [Microcystis aeruginosa]
 gb|ELP56069.1| copper-translocating P-type ATPase [Microcystis aeruginosa TAIHU98]
Length=781

 Score =   474 bits (1220),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 319/787 (41%), Positives = 468/787 (59%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  23    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIQYQPDA-IAP-------EQLAAKLT  74

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          +++  ++ + Q     LA++  L    L+GHL H  G +
Sbjct  75    AIGFPTQPRSSSTP--LGQQNQRLQNQQKERQQQLYRLAIACCLLVFSLIGHLHHIGGPE  132

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +  S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  133   ---IPIFQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  189

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  190   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  248

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  249   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGEL  306

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  307   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  366

Query  2063  SAATFMFWNLFGTRVLPATL----------HQGslaslalqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L             S   L+L+L+ SVLVVACPCALGLATP
Sbjct  367   ALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQSTSSLLLSLKLAISVLVVACPCALGLATP  426

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  427   TALLVGTSLAAERGILIKGGDVLETVSRLQTVVFDKTGTLSQGHPEIT------------  474

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S  E + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  475   ---DCLSFSELNSLEIQQLAAVVESGTNHPLAQAILDAVTPPTN--LTGED--FQTVAGL  527

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE      ++V+Y+G++  L G I  +
Sbjct  528   GVSARVQGSKIVLGNRQWLAQNGIKIDETIPSIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  586

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  587   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAEVAPTEKSALI  643

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  644   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  703

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  704   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPRWGLAFSPALAAALMAFSSVMVVSNS  763

Query  851   LLLRLKF  831
             LLLR +F
Sbjct  764   LLLRRQF  770



>ref|WP_012954371.1| ATPase [Candidatus Atelocyanobacterium thalassa]
 ref|YP_003422065.1| copper/silver-translocating P-type ATPase [Candidatus Atelocyanobacterium 
thalassa]
 gb|ADB95684.1| copper/silver-translocating P-type ATPase [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=771

 Score =   473 bits (1217),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 299/779 (38%), Positives = 459/779 (59%), Gaps = 40/779 (5%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
              GM C  C  +++  L  QP V SA  NL T+ AVV        + N +      L   L
Sbjct  25    AGMKCASCVKAIEEKLSEQPGVISAQANLITQVAVV--------IYNPESTEPSVLTNKL  76

Query  2966  TSCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGA  2787
             T+ GF +++RDS+   + +   K   +K+ +       L ++  L  +  +GHL++  G 
Sbjct  77    TAVGFPSSIRDSQNLTVQQRKSKSDQSKQTEEIHQKINLFIAAILIFISSLGHLTYIGGP  136

Query  2786  KASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSS  2607
                   +L+   FH  +    + +PG  + +DG + L+ G  NMNTLVGLG  S++++S 
Sbjct  137   D---FFVLNDLRFHWVLATIAIAIPGFDIFLDGWRGLVNGMANMNTLVGLGTFSAYSISC  193

Query  2606  MAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSD  2427
             +A   P+LGW+ FF+EPVML+ F+LLGR LE+RAK +A+S +  L+ + P+ ARL  +SD
Sbjct  194   IALIFPELGWECFFDEPVMLLGFILLGRILEKRAKNRASSALKSLIELQPTFARL--SSD  251

Query  2426  -MGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPG  2250
                E  S++E+P   + +G+ I +LPGD+IP DG +  G +T+DES  TGE +PV K  G
Sbjct  252   PYSENQSSIEIPVEQVRLGEYIKILPGDKIPVDGEIITGETTIDESLVTGESMPVAKKIG  311

Query  2249  AQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVM  2070
              +V+ G++N +G++ ++  R G +T +  I+  VE AQ  + P+Q+L D ++G+F YG++
Sbjct  312   DEVSVGTLNHSGLIIIKTIRIGNDTTLSQIIFSVENAQMLKPPIQKLTDTIAGYFAYGII  371

Query  2069  ALSAATFMFWNLFGTRVLPATL---HQGslaslalqlscsvlvvaCPCALGLATPTAVMV  1899
             +LS   F+FW   GT   P  L   +  +   L+L+L+ SVLVVACPCALGLATP A++V
Sbjct  372   SLSILVFIFWFAIGTNWYPQVLNANYNNTSFLLSLKLAISVLVVACPCALGLATPMAILV  431

Query  1898  gtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDS  1719
             GT +GA +G+L++ G VLE  S +  +VFDKTGTLT G P V           T  K   
Sbjct  432   GTGIGAKKGILIKNGDVLEKVSQLYAVVFDKTGTLTTGHPVV-----------TGCKSFG  480

Query  1718  TSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAV  1539
               + ++    +L LA+ VE+ TNHP+  AI+E AK  N  ++KA++  F  + GSG  A 
Sbjct  481   VLSSQY----LLQLAATVENGTNHPLALAIMEEAKRENLSLLKAKN--FCTKIGSGVTAE  534

Query  1538  IEEKKVSVGTLDWVRRHGVGETRVQEFDDF---KNQSVVYVGVDGVLAGLIYVEDQLRED  1368
             +EEK++ +G  +W+  +G        + +    K ++++YVG++  + G + ++D LR +
Sbjct  535   VEEKEIWLGNKNWLLNNGFNFNSNSYYLESLTQKGETIIYVGINKSIEGFLTLKDTLRPE  594

Query  1367  ARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQ  1188
             A+  +  L K+G+   LL+GD    A  +A+ +GI +   F  V P  K+  +  LQK  
Sbjct  595   AQETILELKKKGLEIILLTGDNPKVAAAIATELGINK--FFAQVNPSNKASVIKDLQKQG  652

Query  1187  KVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMK  1008
             K +AMVGDGINDA AL  + +GV++ G    A + S +VLM   +  +L A+ LS  T  
Sbjct  653   K-IAMVGDGINDAPALVQADIGVSLQGSTQIALESSDIVLMSGSILDILTAINLSLATFT  711

Query  1007  TVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKF  831
              ++QNL WAFGYN + +P+A GILLP  G  ++P IA ALM  SSI V+ NSL LR +F
Sbjct  712   KIRQNLLWAFGYNTLSIPLAGGILLPSLGLTISPVIAAALMASSSIIVVINSLSLRYQF  770



>ref|WP_008195909.1| ATPase [Microcystis sp. T1-4]
 emb|CCI30296.1| putative copper-transporting ATPase synA [Microcystis sp. T1-4]
Length=776

 Score =   472 bits (1215),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 320/787 (41%), Positives = 470/787 (60%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  18    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDA-IAP-------EQLAAKLT  69

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          +++  ++ + Q     LA++  L    L+GHL H  G +
Sbjct  70    AIGFPTQPRSSSTP--LSQQNQRLQNQQKERQQQLYRLAIACCLLVFSLIGHLHHIGGPE  127

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +L S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  128   ---IPILQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  184

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  185   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  243

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  244   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDL  301

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  302   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  361

Query  2063  SAATFMFWNLFGTRVLPATL------HQ----GslaslalqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L      H+     S   L+L+L+ SVLVVACPCALGLATP
Sbjct  362   ALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQPTSPLLLSLKLAISVLVVACPCALGLATP  421

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  422   TALLVGTSLAAERGILIKGGDVLETVSQLQTVVFDKTGTLSQGHPEIT------------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S    + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  470   ---DCLSFSILNSLEIQQLAAVVESGTNHPLAQAILDAVTPPTN--LTGED--FQTVAGL  522

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE      ++V+Y+G++  L G I  +
Sbjct  523   GVSARVQGSKIVLGNRQWLAQNGIKIDETIRGIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  581

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  582   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAEVAPTEKSALI  638

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  639   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  698

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  699   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPSWGLAFSPALAAALMAFSSVMVVSNS  758

Query  851   LLLRLKF  831
             LLLR +F
Sbjct  759   LLLRRQF  765



>ref|WP_016515063.1| Cation-transporting ATPase PacS [Microcystis aeruginosa]
 gb|EPF22906.1| Cation-transporting ATPase PacS [Microcystis aeruginosa SPC777]
Length=776

 Score =   472 bits (1214),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 320/787 (41%), Positives = 469/787 (60%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  18    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDA-IAP-------EQLAAKLT  69

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          +++  ++ + Q     LA++  L    L+GHL H  G +
Sbjct  70    AIGFPTQPRSSSTP--LSQQNQRLQNQQKERQQQLYRLAIACCLLVFSLIGHLHHIGGPE  127

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +L S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  128   ---IPILQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  184

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  185   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  243

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  244   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDL  301

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  302   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  361

Query  2063  SAATFMFWNLFGTRVLPATL------HQ----GslaslalqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L      H+     S   L+L+L+ SVLVVACPCALGLATP
Sbjct  362   ALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQPTSPLLLSLKLAISVLVVACPCALGLATP  421

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  422   TALLVGTSLAAERGILIKGGDVLETVSQLQTVVFDKTGTLSQGHPEIT------------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S    + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  470   ---DCLSFSILNSLEIQQLAAVVESGTNHPLAQAILDAVTPPTN--LTGED--FQTVAGL  522

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE      ++V+Y+G++  L G I  +
Sbjct  523   GVSARVQGSKIVLGNRQWLAQNGIKIDETIWGIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  581

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  582   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAEVAPTEKSALI  638

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  639   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  698

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  699   HLSLATWQKIRQNLVWALGYNTFAIPIAGGLLLPHWGLAFSPALAAALMAFSSVMVVSNS  758

Query  851   LLLRLKF  831
             LLLR +F
Sbjct  759   LLLRRQF  765



>ref|WP_002793826.1| ATPase [Microcystis aeruginosa]
 emb|CCI24949.1| putative copper-transporting ATPase synA [Microcystis aeruginosa 
PCC 9808]
Length=776

 Score =   472 bits (1214),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 319/787 (41%), Positives = 470/787 (60%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  18    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDA-IAP-------EQLAAKLT  69

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          +++  ++ + Q     LA++  L    L+GHL H  G +
Sbjct  70    AIGFPTQPRSSSTP--LSQQNQRLQNQQKEQQQQLYRLAIACCLLVFSLIGHLHHIGGPE  127

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +L S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  128   ---IPILQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  184

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A + +  L ++ P+ A L+ ++D 
Sbjct  185   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAAGLEALTSLQPAVAHLIGSTD-  243

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  244   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDL  301

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  302   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  361

Query  2063  SAATFMFWNLFGTRVLPATL------HQ----GslaslalqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L      H+     S   L+L+L+ SVLVVACPCALGLATP
Sbjct  362   ALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQPTSPLLLSLKLAISVLVVACPCALGLATP  421

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  422   TALLVGTSLAAERGILIKGGDVLETVSQLQTVVFDKTGTLSQGHPEIT------------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S  E + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  470   ---DCLSFSELNPLEIQQLAAVVESGTNHPLAQAILDAVTPPTN--LTGED--FQTVAGL  522

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE  +   ++V+Y+G +  L G I  +
Sbjct  523   GVSARVQGSKIVLGNRQWLAQNGIKIDETIWGIQELLE-AGKTVIYLGREEQLLGAIAFQ  581

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  582   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAEVAPTEKSALI  638

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   + + + +VL+ +RL  ++ +L
Sbjct  639   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVSMETAGIVLISDRLEDVVQSL  698

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  699   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPHWGLAFSPALAAALMAFSSVMVVSNS  758

Query  851   LLLRLKF  831
             LLLR +F
Sbjct  759   LLLRRQF  765



>ref|WP_012308205.1| ATPase [Synechococcus sp. PCC 7002]
 ref|YP_001735842.1| cation-transporting P-type ATPase [Synechococcus sp. PCC 7002]
 gb|ACB00587.1| cation-transporting P-type ATPase [Synechococcus sp. PCC 7002]
Length=770

 Score =   472 bits (1214),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 309/788 (39%), Positives = 462/788 (59%), Gaps = 49/788 (6%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R L  Q  V SA VNL TE AVV    E K+ P       E +A  L+
Sbjct  24    GMRCAGCVKAVERQLTQQSGVLSAVVNLITEVAVVTYEPE-KIQP-------EAIANRLS  75

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF +  R +  E   +  EK+  ++R Q    G  + +   L A  L GHL H  G K
Sbjct  76    QAGFPSEPRTTEVETFNQYQEKRAQSQREQYWRLGAAIVL---LLASSL-GHLHHLTGLK  131

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I LLH  G H ++    L +PG  ++ DG   L+KG  NMNTLVGLG LS++  S +
Sbjct  132   ---IPLLHLMGVHWAIATLALFIPGLPILRDGWTGLIKGHANMNTLVGLGTLSAYLTSCV  188

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A  +P+LGW+ FF+EPVML+ F+ LGR LE  A++KA + +  LL + P  ARL+     
Sbjct  189   AWLMPQLGWECFFDEPVMLLGFIFLGRTLEGNARLKAIAALESLLALQPQGARLMGREQK  248

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
             GE T  + +P + + +G+ + +LPG++IP DG +  G +TVDES  TGE LP  K  GA 
Sbjct  249   GE-TEEITIPVAQVQIGEWVRILPGEKIPVDGAIIRGETTVDESMLTGEALPQEKTVGAS  307

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AG++N  G++ V+  +    T +  I+R VE AQ+R+APVQ++AD ++G+F YGVMAL
Sbjct  308   VKAGTLNQLGVIIVQATQTAQNTMLAQIIRTVEAAQTRKAPVQKMADTIAGYFAYGVMAL  367

Query  2063  SAATFMFWNLFGTRVLPATLHQGsl--aslalqlscsvlvvaCPCALGLATPTAVMVgts  1890
             +   F+FW L G+++    L  G+     L+L+L+ +VLVVACPCALGLATPTA++VGTS
Sbjct  368   AVLVFLFWELIGSQLW---LDPGATNPEILSLKLAIAVLVVACPCALGLATPTALLVGTS  424

Query  1889  lgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTST  1710
             LGA +G+L++GG +LE  + + T+VFDKTGTLT G+P + E V               S 
Sbjct  425   LGAEQGILIKGGDILERLNQLTTVVFDKTGTLTQGKPQIVEWV---------------SF  469

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEP-GSGAMAVIE  1533
               WS+  +L  A+ +E  + HP G+A V  A+ +N  +   +    +E   G G +  + 
Sbjct  470   APWSQDSLLQWAASLEQRSTHPYGQAFVAIAQQQNQELFAPDQ---VETALGKGIVGQVN  526

Query  1532  EKKVSVGTLDWVR--RHGVGETRVQEFDDFK--NQSVVYVGVDGVLAGLIYVEDQLREDA  1365
              + V +G   W+   +  + E      + +    ++ +++ +D  +AGL+ + D +R DA
Sbjct  527   GQSVHIGNQAWLETAQITIPEACHHHLETWSATGKTTIFIAIDHQVAGLLAIADPIRPDA  586

Query  1364  RHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQK  1185
               ++E+L  + +   LLSGD+    + +A  + +  ++    + P EK+  +  LQ  QK
Sbjct  587   AALIENLRARNLEVILLSGDQAPVVKNLAQTLQL--DHYQGALSPIEKAATLRTLQAQQK  644

Query  1184  VVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKT  1005
             VVAM+GDGINDA ALA++ +G+++ G    A   + ++LM +RL      L LS+ T+K 
Sbjct  645   VVAMIGDGINDAPALATADIGISLQGSTDVALATADIILMGDRLMDFEQTLHLSQATVKV  704

Query  1004  VKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRLKFAS  825
             + QNL WAFGYN++ +P+AAGILLP     L+P++A  LM +SS+ V+TNSL L+  F  
Sbjct  705   IYQNLIWAFGYNLIAIPLAAGILLPQFNFTLSPAVAAGLMAMSSVLVVTNSLTLKKSF--  762

Query  824   KQKEIQGP  801
              QK  Q P
Sbjct  763   -QKTNQNP  769



>ref|WP_002803118.1| ATPase [Microcystis aeruginosa]
 emb|CCI37492.1| putative copper-transporting ATPase synA [Microcystis aeruginosa 
PCC 9701]
Length=776

 Score =   472 bits (1214),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 319/787 (41%), Positives = 469/787 (60%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  18    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDA-IAP-------EQLAAKLT  69

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          +++  ++ + Q     LA++  L    L+GHL H  G +
Sbjct  70    AIGFPTQPRSSSTP--LSQQNQRLQNQQKEQQQQLYRLAIACCLLVFSLIGHLHHIGGPE  127

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +  S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  128   ---IPIFQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  184

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  185   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  243

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  244   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDL  301

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  302   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  361

Query  2063  SAATFMFWNLFGTRVLPATL------HQ----GslaslalqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L      H+     S   L+L+L+ SVLVVACPCALGLATP
Sbjct  362   ALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQPTSPLLLSLKLAISVLVVACPCALGLATP  421

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  422   TALLVGTSLAAERGILIKGGDVLETVSRLQTVVFDKTGTLSQGHPEIT------------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S    + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  470   ---DCLSFSILNPLEIQQLAAVVESGTNHPLARAILDAVTPPTN--LTGED--FQTVAGL  522

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE      ++V+Y+G++  L G I  +
Sbjct  523   GVSARVQGSKIVLGNRQWLAQNGIKIDETIPSIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  581

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  582   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAEVAPTEKSALI  638

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  639   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  698

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  699   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPRWGLAFSPALAAALMAFSSVMVVSNS  758

Query  851   LLLRLKF  831
             LLLR +F
Sbjct  759   LLLRRQF  765



>dbj|GAL91527.1| copper-translocating P-type ATPase [Microcystis aeruginosa NIES-44]
Length=781

 Score =   471 bits (1213),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 319/787 (41%), Positives = 468/787 (59%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  23    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDA-IAP-------EQLAAKLT  74

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          ++   ++ + Q     LA++  L    L+GHL H  G +
Sbjct  75    AIGFPTQPRSSSTP--LSQQNQRRQNQQKEQQQQLYRLAIACCLLVFSLIGHLHHIGGPE  132

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +  S  FH ++    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  133   ---IPIFQSIAFHWTLATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  189

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  190   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  248

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   + VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  249   --DRVGVAIPVEQVRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDP  306

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  307   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  366

Query  2063  SAATFMFWNLFGTRVLPATL------HQ----GslaslalqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L      H+     S   L+L+L+ SVLVVACPCALGLATP
Sbjct  367   ALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQPTSPLLLSLKLAISVLVVACPCALGLATP  426

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  427   TALLVGTSLAAERGILIKGGDVLETVSQLQTVVFDKTGTLSQGHPEIT------------  474

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S    + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  475   ---DCLSFSILNPLEIQQLAAVVESGTNHPLAQAILDAVTPPTN--LTGED--FQTVAGL  527

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE      ++V+Y+G++  L G I  +
Sbjct  528   GVSARVQGSKIVLGNRQWLAQNGIKIDETIPSIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  586

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  587   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAEVAPTEKSALI  643

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  644   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  703

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  704   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPRWGLAFSPALAAALMAFSSVMVVSNS  763

Query  851   LLLRLKF  831
             LLLR KF
Sbjct  764   LLLRRKF  770



>ref|WP_002795941.1| ATPase [Microcystis aeruginosa]
 emb|CCI22211.1| putative copper-transporting ATPase synA [Microcystis aeruginosa 
PCC 9809]
Length=781

 Score =   470 bits (1210),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 322/796 (40%), Positives = 472/796 (59%), Gaps = 58/796 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  23    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDA-IAP-------EQLAAKLT  74

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          +++  ++ + Q     LA++  L    L+GHL H  G +
Sbjct  75    AIGFPTQPRSSSTP--LSQQNQRLQNQQKERQQQLYRLAIACCLLVFSLIGHLHHIGGPE  132

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +  S  FH  +    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  133   ---IPIFQSIAFHWILATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  189

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  190   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  248

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  249   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDL  306

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  307   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  366

Query  2063  SAATFMFWNLFGTRVLPATL------HQ----GslaslalqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L      H+     S   L+L+L+ SVLVVACPCALGLATP
Sbjct  367   ALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQPTSPLLLSLKLAISVLVVACPCALGLATP  426

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  427   TALLVGTSLAAERGILIKGGDVLETVSQLQTVVFDKTGTLSQGHPEIT------------  474

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S    + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  475   ---DCLSFSILNSLEIQQLAAVVESGTNHPLARAILDAVTPPTN--LTGED--FQTVAGL  527

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE      ++V+Y+G++  L G I  +
Sbjct  528   GVSARVQGSKIVLGNRQWLAQNGIKIDETIWGIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  586

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  587   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAEVAPTEKSALI  643

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  644   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  703

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  704   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPRWGLAFSPALAAALMAFSSVMVVSNS  763

Query  851   LLLRLKF---ASKQKE  813
             LLLR +F    S Q+E
Sbjct  764   LLLRRQFPPLTSTQEE  779



>ref|WP_012267551.1| ATPase [Microcystis aeruginosa]
 ref|YP_001660158.1| cation-transporting P-type ATPase [Microcystis aeruginosa NIES-843]
 dbj|BAG04966.1| cation-transporting P-type ATPase [Microcystis aeruginosa NIES-843]
Length=776

 Score =   470 bits (1209),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 319/787 (41%), Positives = 468/787 (59%), Gaps = 55/787 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC ++V+R L     V SA VNL TE AV+    +A + P       E+LA  LT
Sbjct  18    GMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDA-IAP-------EQLAAKLT  69

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
             + GF    R S          +++  ++ + Q     LA++  L    L+GHL H  G +
Sbjct  70    AIGFPTQPRSSSTP--LSQQNQRLQNQQKERQQQLYRLAIACCLLVFSLIGHLHHIGGPE  127

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
                I +  S  FH  +    +L PGR + IDG + L  G PNMNTLV LG  S++  S +
Sbjct  128   ---IPIFQSIAFHWILATLAILFPGRDIFIDGWRGLRHGMPNMNTLVSLGTGSAYIASCL  184

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LG + FF+EPVML+ F+LLGR LE  ++ +A +D+  L ++ P+ A L+ ++D 
Sbjct  185   ALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIGSTD-  243

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
                   V +P   L VG+ + VLPG++IP DG +  GR+TVDE+  TGE LPV K  G  
Sbjct  244   --DRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDL  301

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V AGS NL+G + V+ ++ G +T +  I+  VE AQ+R+APVQ++AD+V+G+F YGVM +
Sbjct  302   VIAGSFNLSGAIAVQTRQVGTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMII  361

Query  2063  SAATFMFWNLFGTRVLPATL------HQ----GslaslalqlscsvlvvaCPCALGLATP  1914
             +    +FW  +GTR+ P  L      H+     S   L+L+L+ SVLVVACPCALGLATP
Sbjct  362   ALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQPTSPLLLSLKLAISVLVVACPCALGLATP  421

Query  1913  TAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETN  1734
             TA++VGTSL A RG+L++GG VLE+ S + T+VFDKTGTL+ G P +T            
Sbjct  422   TALLVGTSLAAERGILIKGGDVLETVSQLQTVVFDKTGTLSQGHPEIT------------  469

Query  1733  AKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGS  1554
                D  S    + +++  LA+ VES TNHP+ +AI++A        +  ED  F    G 
Sbjct  470   ---DCLSFSILNSLEIQQLAAVVESGTNHPLARAILDAVTPPTN--LTGED--FQTVAGL  522

Query  1553  GAMAVIEEKKVSVGTLDWVRRHG--VGET--RVQEFDDFKNQSVVYVGVDGVLAGLIYVE  1386
             G  A ++  K+ +G   W+ ++G  + ET   +QE      ++V+Y+G++  L G I  +
Sbjct  523   GVSARVQGSKIVLGNRQWLAQNGIKIDETIWGIQELLQ-AGKTVIYLGMEEQLLGAIAFQ  581

Query  1385  DQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFV  1209
             D+LR DA+  V  L K G+   LLSGD++     +A+ +GI +   FY  V P EKS  +
Sbjct  582   DRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQ---FYAEVAPTEKSALI  638

Query  1208  SGLQ-KDQKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDAL  1032
             + LQ K+ K+VAMVGDGINDA AL  +++G+A+ GG   A + + +VL+ +RL  ++ +L
Sbjct  639   ADLQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSL  698

Query  1031  ELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNS  852
              LS  T + ++QNL+WA GYN   +P+A G+LLP  G   +P++A ALM  SS+ V++NS
Sbjct  699   HLSLATWQKIRQNLFWALGYNTFAIPIAGGLLLPRWGLAFSPALAAALMAFSSVMVVSNS  758

Query  851   LLLRLKF  831
             LLLR +F
Sbjct  759   LLLRRQF  765



>ref|WP_015223700.1| copper-translocating P-type ATPase [Cyanobacterium stanieri]
 ref|YP_007166035.1| copper-translocating P-type ATPase [Cyanobacterium stanieri PCC 
7202]
 gb|AFZ48386.1| copper-translocating P-type ATPase [Cyanobacterium stanieri PCC 
7202]
Length=778

 Score =   462 bits (1189),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 300/778 (39%), Positives = 462/778 (59%), Gaps = 42/778 (5%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R +   P V S++VNL T  A+V      KV P       E LA+ LT
Sbjct  26    GMKCAGCVKAVERQINQYPGVISSTVNLITAVALV-EYKTGKVKP-------ENLAQKLT  77

Query  2963  SCGFKANVRDSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHFFGAK  2784
               GF + VR   +E  ++  ++       +LQ      AV   L     +GHL H     
Sbjct  78    LGGFPSEVRTLAQEQDWQKIKETQQQAEEKLQIYQLASAV--ILLIFSTIGHLHHL---G  132

Query  2783  ASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAVSSM  2604
               ++H L +  FH ++    LL+PGR+++++G + L    PNMN+L+G+G +S++  S +
Sbjct  133   IHYLHPLTNIWFHWALATLALLIPGREILLNGWQGLWHRQPNMNSLIGIGTVSAYLASCV  192

Query  2603  AAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLVVNSDM  2424
             A   P LGW+ FF+EPVML+ F+ LGR LE RA+ KA+  ++GLL++ P  AR ++  + 
Sbjct  193   ALVFPNLGWECFFDEPVMLLGFIFLGRVLESRARNKASEALSGLLSLRPPWAR-IIGKER  251

Query  2423  GEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQ  2244
               Q   +++P + +   + + VL G++ P DG +  G ++VDES  TGE +PV K  G  
Sbjct  252   ENQDDGLKIPSNQVKPQEWVRVLEGEKFPVDGKIIRGETSVDESMLTGESIPVFKSEGDL  311

Query  2243  VAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTYGVMAL  2064
             V+AG+IN+ G++ VE  + G +T +  I+ +VEEAQ+R+APVQ+LAD VSG+F YG+M +
Sbjct  312   VSAGTINVGGVVVVETTQSGLKTVLSQIISMVEEAQTRKAPVQKLADTVSGYFAYGIMTI  371

Query  2063  SAATFMFWNLFGTRVLPATLHQ--GslaslalqlscsvlvvaCPCALGLATPTAVMVgts  1890
             +  TF+FW  +GTRV    L +   S   L+L+L+  VLV+ACPCALGLATPTA++VGT 
Sbjct  372   ALITFIFWYSWGTRVWSNILWELDSSALILSLKLAIDVLVIACPCALGLATPTAILVGTG  431

Query  1889  lgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTST  1710
             +GA +GLL++GG VLE    ++ IVFDKTGTLT G   +TE+V    +D           
Sbjct  432   VGAGQGLLIKGGDVLEQAQNLDMIVFDKTGTLTEGNLQLTEIVNFNQDD-----------  480

Query  1709  CEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGAMAVIE-  1533
               +S+  +L +A+ +E N+NHP+ +A++  AKS+    +  E+      P  G    ++ 
Sbjct  481   --FSDSQLLQIAASLEINSNHPLAQALLRTAKSQQLEFLSTEN--ICNYPSRGIRGDVDG  536

Query  1532  EKKVSVGTLDWVRRHG-VGETRVQEFD---DFKNQSVVYVGVDGVLAGLIYVEDQLREDA  1365
              K    G+  W+   G V +T+++E       +  +V+Y+  D     L    D+LR  A
Sbjct  537   NKNYYCGSESWLEEKGIVLDTKIKEHSTQLQTQGNTVIYLVQDDQPLALFAFADKLRPQA  596

Query  1364  RHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFY-GVKPDEKSKFVSGLQKD-  1191
             +  +  L + G+   LLSGD++N    +AS + I   N +Y GV P EK + +  L+++ 
Sbjct  597   QTTINRLQEMGLNVVLLSGDQENVVRAIASKLSI---NTYYGGVLPQEKGELIRQLKQEY  653

Query  1190  -QKVVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLT  1014
              ++V+AMVGDG+NDA A+  +   +A+  G   A   +SVVL +N+LS ++ A++LSR T
Sbjct  654   PEQVIAMVGDGVNDAPAMGEADFAIAMPQGSEIAVKTASVVLTRNKLSDIITAIKLSRQT  713

Query  1013  MKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLR  840
             +  +KQNL+WA  YN++ +P+AAGILLP    +L P+ AG  M LSSI V+TNSL L+
Sbjct  714   LNKIKQNLFWALSYNLITIPIAAGILLPQYHILLNPATAGGFMALSSIIVVTNSLQLK  771



>ref|WP_008318138.1| heavy metal translocating P-type ATPase [Leptolyngbya sp. PCC 
6406]
Length=805

 Score =   461 bits (1187),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 329/806 (41%), Positives = 464/806 (58%), Gaps = 64/806 (8%)
 Frame = -2

Query  3146  GGMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHL  2967
             GGM C GC  +V+R L +   V SA+VNL TE AVV    E  V         + LA  L
Sbjct  27    GGMKCAGCVRAVERQLTTYEGVLSATVNLVTEVAVVETGPETSVD-------AQALAAKL  79

Query  2966  TSCGFKANVR----DSRR------ENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCL  2817
             T+ GF +  R    D +R       +   T    ++ KR + +A  + LA++  L A   
Sbjct  80    TAAGFPSQPRWSETDPKRPSHPGGSSPAGTEADWVHRKREETRAQTQRLAIALILLAFST  139

Query  2816  VGHLSHFFGAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGL  2637
             +GHL HF       I L+   GFH ++    L  PGR +++DG K L  GAP M+TLVGL
Sbjct  140   LGHLKHFGSLD---IPLISDLGFHFALATIALAGPGRPILVDGWKGLRHGAPTMDTLVGL  196

Query  2636  GALSSFAVSSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLP  2457
             G LS++  S +A   P LGW+ FF+EPVML++F+LLGR LEQRA+ +A+  +  L+ + P
Sbjct  197   GTLSAYLASVVALVWPGLGWECFFDEPVMLLSFILLGRTLEQRARFRASDALRSLMALQP  256

Query  2456  SKARLV--VNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFT  2283
              +ARL+   N D   Q   VE+P   + VG+ + VLPG+ IPADGI+  G++TVDE+  T
Sbjct  257   VQARLIPPANGDAAPQVG-VEIPAGCVQVGEWLRVLPGETIPADGILETGQTTVDEAMVT  315

Query  2282  GEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLAD  2103
             GE LPV K PG  V AG++N  G + ++V   GG+T +  ++RLVE AQ+R+AP+QRLAD
Sbjct  316   GESLPVVKQPGDAVVAGTVNQTGAIALKVTHTGGDTVLAQMIRLVETAQTRKAPIQRLAD  375

Query  2102  KVSGHFTYGVMALSAATFMFWNLFGTRVLPATL-------HQGslaslalql-------s  1965
              ++G+FTYGV+AL+  T+ FW  +G  + P  L       H G L +            +
Sbjct  376   GIAGYFTYGVLALAVLTWGFWYGWGLTLWPEVLPLVLGSGHSGHLMTTQSSALLVSLKLA  435

Query  1964  csvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIG  1785
              +VLVVACPCALGLATPTA++VG+ LGA RGLL+RGG +LE+ S ++T+VFDKTGTLT G
Sbjct  436   IAVLVVACPCALGLATPTAILVGSGLGAERGLLIRGGDILEALSTIDTVVFDKTGTLTQG  495

Query  1784  RPTVTEVVP--QGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKS  1611
             +P V +  P  +G   E                D+L +A+ VE  T HP+  AI  AA++
Sbjct  496   QPQVRDCYPLREGVTGE----------------DLLQMAAAVEQGTQHPLAIAIQRAAQA  539

Query  1610  RNCRIVKAEDGTFIEEPGSGAMAVI----EEKKVSVGTLDWVRRHGVGETRVQEFDDFK-  1446
             ++   + A +  F  E G GA A +    + ++V +G   W+   G+      E      
Sbjct  540   QDLPPLTATE--FQTEAGLGAAATVSWQGQHQRVWLGNAPWLTVQGIELNSAAEAAMSTV  597

Query  1445  --NQSVVYVGVDGVLAGLIYVEDQLREDARHVVESLSKQGITTYLLSGDKKNAAEYVASV  1272
                 + +Y+     + GLI V D LR +A   V +L   GI  ++L+GD+   AE VA  
Sbjct  598   PAGDTAIYLATHVGILGLITVADALRPEAAATVAALQAVGIGVHILTGDRAPVAEAVAEA  657

Query  1271  VGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGINDAAALasshvgvaigggvgaa  1092
             + +P   +   V P  K + V  LQ+    VA VGDGINDA  LA + VG+++  G   A
Sbjct  658   IALPTTAITAEVLPQGKVQVVQTLQQAGHRVAFVGDGINDAPVLAQADVGISLRSGTDIA  717

Query  1091  sdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTML  912
             +  + VVLM NRLS ++ AL+L   T+  ++QNL WA  YN VG+P+AAG LLP TG  L
Sbjct  718   AAAAGVVLMGNRLSDVVAALKLGAATVSKIRQNLGWALVYNAVGIPLAAGALLPTTGLSL  777

Query  911   TPSIAGALMGLSSIGVMTNSLLLRLK  834
             +P++A  LM  SS+ V+ NSLLLR  
Sbjct  778   SPAVAAGLMAASSVTVVVNSLLLRFH  803



>gb|KDO73635.1| hypothetical protein CISIN_1g0027701mg, partial [Citrus sinensis]
Length=645

 Score =   454 bits (1169),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 300/658 (46%), Positives = 413/658 (63%), Gaps = 58/658 (9%)
 Frame = -2

Query  2672  KGAPNMNTLVGLGALSSFAVSSMAAFIPKLGWKA-FFEEPVMLIAFVLLGRNLEQRAKIK  2496
             KG+PNMN+LVG G++ +F +S ++   P+L W A FFEEPVML+ FVLLGR+LE+RA+I+
Sbjct  4     KGSPNMNSLVGFGSIVAFLISLVSLLKPELEWDASFFEEPVMLLGFVLLGRSLEERARIR  63

Query  2495  ATSDMTGLLNVLPSKARLVVNSD---------MGEQTSTVEVPCSNLSVGDQIIVLPGDR  2343
             A+SDM  LL+++ +++RLV+ S          +      VEVP  ++ VGD ++VLPG+ 
Sbjct  64    ASSDMNELLSLVSTQSRLVITSSESGSSADNVLCSDAICVEVPTDDIRVGDSVLVLPGET  123

Query  2342  IPADGIVRAGRSTVDESSFTGEPLPVTKLPGAQVAAGSINLNGMLTVEVQRPGGETAIGD  2163
             IP DG V AGRS VDES  +GE LPV K  G  V+AG+IN +G L +E    G  + I  
Sbjct  124   IPVDGRVLAGRSVVDESMLSGESLPVFKEEGFTVSAGTINWDGPLRIEACSTGSNSMISK  183

Query  2162  IVRLVEEAQSREAPVQRLADKVSGHFTYGVMALSAATFMFWNLFGTRVLPATL------H  2001
             IV +VEEAQ REAP+QRLAD ++G F Y VM LSAATF FW   G+++ P  L       
Sbjct  184   IVSMVEEAQGREAPIQRLADAIAGPFVYSVMTLSAATFAFWYYIGSQIFPDVLLSDMAGP  243

Query  2000  QGslaslalqlscsvlvvaCPCALGLATPTAVMVgtslgatrglllrggSVLESFSMVNT  1821
              G+   L+L+LS  VLVV+CPCALGLATPTA++VGTSLGA +GLL+RGG VLE  + ++ 
Sbjct  244   NGNPLLLSLKLSVDVLVVSCPCALGLATPTAILVGTSLGAKQGLLIRGGDVLERLARIDY  303

Query  1820  IVFDKTGTLTIGRPTVTEVVPQGHNDETNAKRDSTSTCEWSEVDVLTLASGVESNTNHPI  1641
             +  DKTGTLT G+P V  V                ++  + E ++L +A+ VE    HPI
Sbjct  304   LALDKTGTLTEGKPAVFNV----------------ASFVYDESEILKIAAAVEKTATHPI  347

Query  1640  GKAIVEAAKSRNCR--IVKAEDGTFIEEPGSGAMAVIEEKKVSVGTLDWV--RRHGVGE-  1476
              KAIV  A+S N    I + +    + EPG G +  ++ + V+VGTL+WV  R    G+ 
Sbjct  348   AKAIVNKAESLNLTSPITRGQ----LAEPGFGILGEVDGRLVAVGTLEWVYERFQKQGDH  403

Query  1475  TRVQEFDDF-------------KNQSVVYVGVDGV-LAGLIYVEDQLREDARHVVESLSK  1338
             + VQ  +                ++SVVYVG +G  + G I + D LR DA H V SL +
Sbjct  404   SDVQHLEHAVTHQSSELASPSNYSKSVVYVGREGEGIIGAIAISDSLRHDAEHTVRSLQQ  463

Query  1337  QGITTYLLSGDKKNAAEYVASVVGIPRENVFYGVKPDEKSKFVSGLQKDQKVVAMVGDGI  1158
             +GI T LLSGD++ A    A  VGI +E +   + P +KS+ +S LQ     VAMVGDGI
Sbjct  464   KGIKTLLLSGDREEAVAATAKEVGIGKEYINSSLTPQQKSEVISTLQTSGHHVAMVGDGI  523

Query  1157  NDAA--ALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALELSRLTMKTVKQNLWW  984
             NDA   ALA   + + I     AAS  +S++L+ N+LSQ++DAL+L++ TM  V QNL W
Sbjct  524   NDAPSLALADVGIALQIEAQENAASTAASIILLGNKLSQVVDALDLAKATMAKVYQNLSW  583

Query  983   AFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLLLRL-KFASKQKE  813
             A  YN+V +P+AAG LLP     +TPS++G LM LSSI V++NSLLL+  +F S +K+
Sbjct  584   AVAYNVVAIPIAAGALLPQYDFAMTPSLSGGLMALSSIFVVSNSLLLQFHEFESNKKK  641



>ref|WP_040467283.1| hypothetical protein, partial [Geminocystis herdmanii]
Length=768

 Score =   458 bits (1178),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 305/785 (39%), Positives = 463/785 (59%), Gaps = 53/785 (7%)
 Frame = -2

Query  3143  GMTCGGCAASVKRILESQPRVSSASVNLTTETAVVWPVSEAKVVPNWQQQLGEELAKHLT  2964
             GM C GC  +V+R +  Q  + SA+VNL T  A++     + V P       E LA+ LT
Sbjct  23    GMKCAGCVKAVERQITQQQGIISANVNLITSVALI-EYESSIVQP-------ETLAQKLT  74

Query  2963  SCGFKANVR--DSRRENLFETFEKKMNAKRAQLQASGRGLAVSWALCAVCLVGHLSHF-F  2793
             + GF + VR  D   EN  E  ++K   +R + +     L  +  L     +GHL H  F
Sbjct  75    AVGFPSQVRVMDDDLENPQEKIQEK---RRLEQKIQQYQLISAIFLLIFSSIGHLHHLGF  131

Query  2792  GAKASWIHLLHSTGFHMSMCLFTLLVPGRQLIIDGLKSLLKGAPNMNTLVGLGALSSFAV  2613
              +    +H L +  FH  +   +LL+PGR+++++G + L +  PNMN+LVGLG   ++  
Sbjct  132   HS----LHWLTNIWFHWGLATASLLIPGREILLNGWQGLWQKKPNMNSLVGLGTTFAYIA  187

Query  2612  SSMAAFIPKLGWKAFFEEPVMLIAFVLLGRNLEQRAKIKATSDMTGLLNVLPSKARLV--  2439
             S +A   P LGW+ FF+EPVML+ F+ LGR LE RA+ +A   +  LL++ P  ARLV  
Sbjct  188   SCVALLYPSLGWECFFDEPVMLLGFIFLGRVLESRARSRAIESLESLLSLRPQFARLVGK  247

Query  2438  VNSDMGEQTSTVEVPCSNLSVGDQIIVLPGDRIPADGIVRAGRSTVDESSFTGEPLPVTK  2259
             +NS+   Q   +E+P   +   + + VL G++ P DGI+  G +TVDES  TGE LPV K
Sbjct  248   MNSN---QDQGLEIPARQVKPEEWVRVLSGEQFPVDGIIMEGETTVDESLLTGESLPVFK  304

Query  2258  LPGAQVAAGSINLNGMLTVEVQRPGGETAIGDIVRLVEEAQSREAPVQRLADKVSGHFTY  2079
               G +V+AG+IN   ++ +E    G  TA+  I+  VE AQ+R+APVQ+LAD VSG+FTY
Sbjct  305   QKGDKVSAGTINNGDVVILEAVNTGKNTALSQIIATVENAQTRKAPVQKLADTVSGYFTY  364

Query  2078  GVMALSAATFMFWNLFGTRVLPATLHQ--GslaslalqlscsvlvvaCPCALGLATPTAV  1905
              +++++   F FW  +GT++    L +   S   L+L+L+  VLV+ACPCALGLATPTA+
Sbjct  365   TIISIALLVFSFWYFWGTQIWSNLLVELDTSRTILSLKLAIDVLVIACPCALGLATPTAI  424

Query  1904  MVgtslgatrglllrggSVLESFSMVNTIVFDKTGTLTIGRPTVTEVVP-QGHNDETNAK  1728
             +VGT+ GA  GLL++GG VLE    ++ IVFDKTGTLT G P V  VV    H+D+    
Sbjct  425   LVGTTTGAENGLLIKGGDVLEQVKNLSLIVFDKTGTLTQGYPQVENVVTFSQHSDK----  480

Query  1727  RDSTSTCEWSEVDVLTLASGVESNTNHPIGKAIVEAAKSRNCRIVKAEDGTFIEEPGSGA  1548
                         ++L +AS +E + NHP+ KAIV  A++ +  I+  E  +   + G G 
Sbjct  481   ------------EILQIASSLEISANHPLAKAIVNHAQNLSLEILPME--SVANQAGKGV  526

Query  1547  MAVIEEKKVSVGTLDWVRRHG--VGETRVQEFDDF--KNQSVVYVGVDGVLAGLIYVEDQ  1380
                       +G   W+R +   +  T + + + +  + ++VVY+G +  L GLI + DQ
Sbjct  527   KGKFGGDWFYLGNRSWLRENSLELNSTIIIQSEQWAREGKTVVYLGKNSDLIGLITLSDQ  586

Query  1379  LREDARHVVESLSKQGITTYLLSGDKKNAAEYVASVVGIPRENVFYG-VKPDEKSKFVSG  1203
             +R DA   V++L   G+   ++SGD+    +Y+A  +GI     +YG + P +KS  +S 
Sbjct  587   IRPDAESTVKTLQNMGLDVIMMSGDQALTTQYIAEKLGI---KTYYGALTPSQKSDLISK  643

Query  1202  LQKDQK-VVAMVGDGINDAAALasshvgvaigggvgaasdvssvVLMQNRLSQLLDALEL  1026
             LQ+  K +VAMVGDGINDA A+ ++   +A+  G   A   + +VL   +L  ++ A+ L
Sbjct  644   LQQQSKNIVAMVGDGINDAPAMTTAQFSIALNQGSEIAIKTAGIVLTTGKLKDVVTAINL  703

Query  1025  SRLTMKTVKQNLWWAFGYNIVGLPVAAGILLPFTGTMLTPSIAGALMGLSSIGVMTNSLL  846
             S+LT++ ++QNL+WA  YN++ +P+A+G LLP    +L P+ AGALM LSSI V+TNSLL
Sbjct  704   SKLTLRKIQQNLFWALSYNLMAIPLASGFLLPKYQILLNPATAGALMALSSIIVVTNSLL  763

Query  845   LRLKF  831
             L+ +F
Sbjct  764   LKYQF  768



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10811635872240