BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21214_g3_i1 len=637 path=[686:0-55 742:56-62 4552:63-81 1394:82-597
1910:598-606 4065:607-636]

Length=637
                                                                      Score     E

emb|CDY21275.1|  BnaC03g29590D                                        62.8    2e-09   
emb|CDY61290.1|  BnaCnng37610D                                        62.0    5e-09   
ref|XP_009134275.1|  PREDICTED: lipid transfer protein EARLI 1-like   61.2    7e-09   
gb|KFK31985.1|  hypothetical protein AALP_AA6G185200                  61.2    7e-09   
ref|XP_006289141.1|  hypothetical protein CARUB_v10002564mg           61.2    9e-09   
ref|XP_009388037.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    2e-08   
ref|XP_010455702.1|  PREDICTED: putative lipid-binding protein AIR1   59.7    3e-08   
ref|XP_011076346.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    3e-08   
ref|NP_567391.1|  bifunctional inhibitor/lipid-transfer protein/s...  59.3    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010258985.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    4e-08   
ref|XP_010053451.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    4e-08   
ref|XP_004299469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    5e-08   
ref|XP_010264242.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.9    5e-08   
gb|AAD01800.1|  HyPRP                                                 59.3    5e-08   Fragaria x ananassa
ref|XP_004299470.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.9    5e-08   
ref|XP_004299468.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    5e-08   
ref|XP_010919518.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.5    7e-08   
gb|KCW77749.1|  hypothetical protein EUGRSUZ_D02043                   58.9    7e-08   
dbj|BAF46299.1|  extensin like protein                                58.5    8e-08   Ipomoea nil [qian niu]
ref|XP_010433369.1|  PREDICTED: lipid transfer protein EARLI 1-like   58.5    8e-08   
ref|XP_010088890.1|  hypothetical protein L484_020878                 58.5    8e-08   
ref|XP_011081228.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    9e-08   
ref|XP_009388030.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.5    9e-08   
ref|XP_006355477.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    9e-08   
ref|XP_006289733.1|  hypothetical protein CARUB_v10003301mg           58.2    1e-07   
ref|XP_010433312.1|  PREDICTED: putative lipid-binding protein AIR1   57.8    1e-07   
ref|XP_004298650.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.8    1e-07   
ref|XP_010422224.1|  PREDICTED: lipid transfer protein EARLI 1-like   57.8    1e-07   
ref|XP_010422222.1|  PREDICTED: lipid transfer protein EARLI 1-li...  57.8    1e-07   
ref|XP_008786991.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.4    2e-07   
ref|XP_010455699.1|  PREDICTED: lipid transfer protein EARLI 1-like   57.8    2e-07   
ref|XP_010455698.1|  PREDICTED: lipid transfer protein EARLI 1-like   57.8    2e-07   
ref|XP_008796820.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.4    2e-07   
ref|XP_010539640.1|  PREDICTED: lipid transfer protein EARLI 1-like   57.4    2e-07   
ref|XP_010456924.1|  PREDICTED: putative lipid-binding protein AIR1   57.0    2e-07   
ref|XP_010433325.1|  PREDICTED: putative lipid-binding protein AIR1B  57.0    2e-07   
ref|XP_010433300.1|  PREDICTED: putative lipid-binding protein AIR1   57.0    2e-07   
ref|XP_010433379.1|  PREDICTED: lipid transfer protein EARLI 1-like   57.4    2e-07   
emb|CDX90834.1|  BnaA03g25140D                                        57.4    2e-07   
ref|XP_006847372.1|  hypothetical protein AMTR_s01045p00008470        57.4    2e-07   
ref|XP_010422223.1|  PREDICTED: lipid transfer protein EARLI 1-li...  57.4    2e-07   
gb|EYU18564.1|  hypothetical protein MIMGU_mgv1a016162mg              57.4    2e-07   
ref|XP_010422228.1|  PREDICTED: putative lipid-binding protein AIR1   57.4    2e-07   
ref|XP_010264240.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.4    2e-07   
ref|XP_010422379.1|  PREDICTED: putative lipid-binding protein AIR1   56.6    2e-07   
ref|XP_002874779.1|  hypothetical protein ARALYDRAFT_911652           57.0    2e-07   
gb|EYU24741.1|  hypothetical protein MIMGU_mgv1a016172mg              57.0    3e-07   
ref|XP_010422227.1|  PREDICTED: putative lipid-binding protein AIR1B  56.6    3e-07   
ref|XP_010455703.1|  PREDICTED: putative lipid-binding protein AIR1B  56.6    3e-07   
ref|NP_001152587.1|  cortical cell-delineating protein precursor      56.6    3e-07   Zea mays [maize]
ref|XP_006295216.1|  hypothetical protein CARUB_v10024298mg           56.6    3e-07   
ref|XP_010919520.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.6    4e-07   
ref|XP_008238562.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.6    4e-07   
ref|XP_006289359.1|  hypothetical protein CARUB_v10002845mg           55.8    4e-07   
ref|XP_007209690.1|  hypothetical protein PRUPE_ppa012402mg           57.0    4e-07   
ref|XP_010455705.1|  PREDICTED: pEARLI1-like lipid transfer prote...  56.6    4e-07   
ref|XP_011001498.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.2    4e-07   
ref|XP_006396750.1|  hypothetical protein EUTSA_v10029060mg           56.2    4e-07   
emb|CDP09932.1|  unnamed protein product                              56.6    5e-07   
ref|XP_008808738.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.2    5e-07   
ref|XP_006290087.1|  hypothetical protein CARUB_v10003726mg           55.8    5e-07   
ref|NP_001233824.1|  arachidonic acid-induced DEA1 precursor          56.2    5e-07   
ref|XP_010053452.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.2    5e-07   
gb|ABP35529.1|  proline-rich protein                                  56.2    5e-07   Ipomoea batatas [batate]
ref|XP_010431835.1|  PREDICTED: putative lipid-binding protein AIR1   55.5    5e-07   
ref|NP_566036.1|  protease inhibitor/seed storage/lipid transfer ...  56.2    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010431811.1|  PREDICTED: putative lipid-binding protein AIR1   55.5    6e-07   
ref|XP_008786988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.2    6e-07   
ref|XP_008238565.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  55.8    6e-07   
ref|XP_009346906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.2    6e-07   
ref|XP_009114615.1|  PREDICTED: putative lipid-binding protein AIR1   55.8    6e-07   
ref|XP_009134274.1|  PREDICTED: lipid transfer protein EARLI 1-like   55.8    6e-07   
ref|XP_010506455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  55.8    7e-07   
gb|ABQ88334.1|  lipid transfer protein                                55.8    7e-07   Capsicum annuum
ref|XP_010906606.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  55.8    7e-07   
ref|XP_007155637.1|  hypothetical protein PHAVU_003G218600g           55.8    7e-07   
ref|XP_010431799.1|  PREDICTED: putative lipid-binding protein AIR1   55.1    8e-07   
ref|XP_006290090.1|  hypothetical protein CARUB_v10003735mg           55.5    8e-07   
ref|XP_006477234.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  55.5    8e-07   
emb|CAI51313.1|  arachidonic acid-induced DEA1                        55.8    8e-07   Capsicum chinense [bonnet pepper]
ref|XP_008338137.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  55.5    9e-07   
sp|P14009.1|14KD_DAUCA  RecName: Full=14 kDa proline-rich protein...  55.5    9e-07   Daucus carota [carrots]
ref|XP_006440349.1|  hypothetical protein CICLE_v10022832mg           55.5    1e-06   
ref|NP_001053512.1|  Os04g0554600                                     55.5    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004251936.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  55.1    1e-06   
ref|XP_009346905.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  55.5    1e-06   
ref|XP_009598876.1|  PREDICTED: lipid transfer protein EARLI 1-like   54.7    1e-06   
ref|XP_006397698.1|  hypothetical protein EUTSA_v10001680mg           55.1    1e-06   
ref|XP_002324869.2|  hypothetical protein POPTR_0018s01890g           55.1    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_002874778.1|  hypothetical protein ARALYDRAFT_911651           55.1    1e-06   
gb|EAY95110.1|  hypothetical protein OsI_16927                        55.1    1e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001053511.1|  Os04g0554500                                     55.1    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006289270.1|  hypothetical protein CARUB_v10002736mg           55.1    1e-06   
ref|XP_010422226.1|  PREDICTED: putative lipid-binding protein AIR1   55.1    1e-06   
ref|XP_010456925.1|  PREDICTED: putative lipid-binding protein AIR1   54.7    1e-06   
ref|XP_010906607.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  55.1    1e-06   
ref|XP_006289684.1|  hypothetical protein CARUB_v10003241mg           55.1    1e-06   
ref|XP_004241782.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.7    1e-06   
ref|XP_008362163.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  55.1    1e-06   
ref|XP_006366172.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.7    1e-06   
ref|XP_002454527.1|  hypothetical protein SORBIDRAFT_04g032680        54.7    1e-06   Sorghum bicolor [broomcorn]
ref|XP_011036580.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.7    2e-06   
emb|CBI31906.3|  unnamed protein product                              54.3    2e-06   
ref|XP_010508203.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.7    2e-06   
ref|XP_010433333.1|  PREDICTED: putative lipid-binding protein AIR1   54.7    2e-06   
ref|XP_010933688.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.7    2e-06   
gb|AEX33654.1|  lipid transfer protein                                54.7    2e-06   
gb|KFK37310.1|  hypothetical protein AALP_AA4G240600                  54.7    2e-06   
emb|CDY21277.1|  BnaC03g29610D                                        54.3    2e-06   
ref|XP_009134277.1|  PREDICTED: putative lipid-binding protein AIR1   54.3    2e-06   
ref|XP_008392581.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.7    2e-06   
ref|XP_009333674.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.7    2e-06   
ref|XP_004298648.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.7    2e-06   
ref|XP_002533291.1|  lipid binding protein, putative                  54.3    2e-06   Ricinus communis
ref|XP_010518131.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.7    2e-06   
gb|AFK47889.1|  unknown                                               54.3    2e-06   
ref|XP_002511665.1|  14 kDa proline-rich protein DC2.15 precursor...  54.7    2e-06   Ricinus communis
gb|AIX10944.1|  PRP2-like protein                                     54.7    2e-06   
gb|KDP28790.1|  hypothetical protein JCGZ_14561                       54.7    2e-06   
ref|XP_010053929.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    54.3    2e-06   
ref|XP_009333598.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.3    2e-06   
ref|XP_011018292.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    54.7    2e-06   
ref|XP_011070108.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.3    2e-06   
ref|XP_008808739.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.3    2e-06   
ref|XP_009623719.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.3    3e-06   
ref|XP_002533299.1|  14 kDa proline-rich protein DC2.15 precursor...  54.3    3e-06   Ricinus communis
emb|CDX95635.1|  BnaC03g25160D                                        54.3    3e-06   
ref|XP_010424613.1|  PREDICTED: putative lipid-binding protein AIR1   53.5    3e-06   
ref|XP_006368194.1|  HyPRP family protein                             54.3    3e-06   
ref|XP_009373377.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.3    3e-06   
ref|XP_004516837.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.9    3e-06   
gb|KHN04344.1|  14 kDa proline-rich protein DC2.15                    53.9    3e-06   
ref|XP_008646032.1|  PREDICTED: cortical cell-delineating protein...  53.9    3e-06   
ref|XP_002880164.1|  hypothetical protein ARALYDRAFT_483654           53.9    3e-06   
ref|XP_009375766.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  54.3    3e-06   
ref|XP_004291444.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.9    3e-06   
ref|XP_004976456.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.9    3e-06   
ref|NP_001047650.1|  Os02g0662000                                     53.9    3e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CAA59472.1|  hybrid proline-rich protein                          53.9    3e-06   Catharanthus roseus [chatas]
ref|XP_009333630.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.9    3e-06   
ref|XP_009626056.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.9    3e-06   
gb|AAX20042.1|  proline-rich protein                                  53.9    3e-06   Capsicum annuum
ref|NP_001237995.1|  uncharacterized protein LOC100305616 precursor   53.9    3e-06   
emb|CDP12555.1|  unnamed protein product                              53.5    3e-06   
ref|XP_003608746.1|  14 kDa proline-rich protein DC2.15               53.9    4e-06   
ref|XP_008796819.1|  PREDICTED: lipid transfer protein EARLI 1-like   53.5    4e-06   
ref|XP_009134276.1|  PREDICTED: putative lipid-binding protein AIR1   53.5    4e-06   
ref|XP_006353678.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.5    4e-06   
ref|NP_001237899.1|  uncharacterized protein LOC100527818 precursor   53.5    4e-06   
ref|NP_001152585.1|  LOC100286225 precursor                           53.5    4e-06   Zea mays [maize]
ref|XP_004976453.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.5    4e-06   
ref|XP_006286641.1|  hypothetical protein CARUB_v10002511mg           53.1    4e-06   
ref|XP_002271461.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    53.5    4e-06   Vitis vinifera
ref|NP_001238461.1|  uncharacterized protein LOC100499693 precursor   53.5    4e-06   
ref|XP_008238566.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.5    4e-06   
ref|XP_009133710.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    53.5    4e-06   
ref|XP_008381149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.5    4e-06   
ref|NP_001152584.1|  cortical cell-delineating protein precursor      53.5    5e-06   Zea mays [maize]
ref|XP_009333597.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.5    5e-06   
ref|XP_009376589.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.5    5e-06   
ref|XP_010055513.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.5    5e-06   
gb|AFW63295.1|  cortical cell-delineating protein                     53.5    5e-06   
ref|XP_010933689.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.5    5e-06   
emb|CDX79156.1|  BnaA01g12230D                                        53.5    5e-06   
ref|XP_009333632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.5    5e-06   
ref|XP_006841163.1|  hypothetical protein AMTR_s00086p00157840        53.5    5e-06   
gb|AFK43955.1|  unknown                                               53.1    5e-06   
ref|XP_010258988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.1    6e-06   
ref|XP_010458632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.5    6e-06   
ref|XP_006396747.1|  hypothetical protein EUTSA_v10029313mg           53.1    6e-06   
ref|XP_010906608.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.1    6e-06   
ref|XP_009333675.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.5    6e-06   
ref|XP_009795308.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.1    6e-06   
ref|XP_008392579.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.1    6e-06   
ref|XP_006579357.1|  PREDICTED: uncharacterized protein LOC100499...  53.1    6e-06   
ref|XP_006369032.1|  HyPRP family protein                             53.1    6e-06   
ref|XP_002874775.1|  hypothetical protein ARALYDRAFT_490053           53.5    7e-06   
gb|KFK31980.1|  hypothetical protein AALP_AA6G184800                  53.5    7e-06   
ref|XP_002533293.1|  14 kDa proline-rich protein DC2.15 precursor...  53.1    7e-06   Ricinus communis
dbj|BAA11854.1|  extensin like protein                                53.1    7e-06   Populus nigra [black poplar]
gb|KDP25645.1|  hypothetical protein JCGZ_20801                       53.1    8e-06   
ref|XP_008786990.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.8    8e-06   
ref|XP_010493717.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.1    8e-06   
ref|XP_009600481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.5    8e-06   
dbj|BAA13150.1|  NT16 polypeptide                                     53.5    8e-06   Nicotiana tabacum [American tobacco]
ref|XP_006396746.1|  hypothetical protein EUTSA_v10029045mg           53.1    8e-06   
emb|CAA81526.1|  14 kDa polypeptide                                   52.8    8e-06   Catharanthus roseus [chatas]
ref|XP_004976454.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.8    8e-06   
ref|XP_010055514.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.8    8e-06   
ref|XP_008663526.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.8    9e-06   
ref|XP_009795761.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.1    9e-06   
ref|XP_006652622.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.8    9e-06   
ref|NP_192985.1|  putative lipid transfer protein                     53.1    9e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009795760.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.1    9e-06   
ref|XP_004516836.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  53.1    9e-06   
ref|NP_001235642.1|  uncharacterized protein LOC100500016 precursor   52.8    1e-05   
ref|XP_011039660.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.4    1e-05   
ref|XP_007052129.1|  Bifunctional inhibitor/lipid-transfer protei...  52.8    1e-05   
ref|XP_006600137.1|  PREDICTED: uncharacterized protein LOC100500...  52.4    1e-05   
ref|XP_009801825.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.4    1e-05   
ref|NP_001275620.1|  uncharacterized protein LOC102590907 precursor   52.4    1e-05   
gb|AFK37038.1|  unknown                                               52.4    1e-05   
gb|KHN09805.1|  14 kDa proline-rich protein DC2.15                    52.4    1e-05   
emb|CAN77080.1|  hypothetical protein VITISV_025477                   52.0    1e-05   Vitis vinifera
ref|XP_008448871.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.4    1e-05   
ref|NP_001235888.1|  uncharacterized protein LOC100500033 precursor   52.4    1e-05   
ref|XP_004150818.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.4    1e-05   
ref|XP_002271593.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    52.0    1e-05   Vitis vinifera
ref|XP_010476166.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.4    2e-05   
ref|NP_001237154.1|  uncharacterized protein LOC100500124 precursor   52.0    2e-05   
ref|XP_009801239.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.0    2e-05   
ref|XP_003549906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.0    2e-05   
ref|XP_002446913.1|  hypothetical protein SORBIDRAFT_06g024770        52.0    2e-05   Sorghum bicolor [broomcorn]
gb|AAM63191.1|  putative cell wall-plasma membrane disconnecting ...  51.6    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EYU30296.1|  hypothetical protein MIMGU_mgv1a015783mg              52.4    2e-05   
ref|XP_004976455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.0    2e-05   
ref|XP_011081229.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.0    2e-05   
ref|NP_192992.1|  auxin-Induced in Root cultures 1                    51.6    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011070106.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.0    2e-05   
ref|XP_009589966.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.0    2e-05   
ref|XP_009607067.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.0    2e-05   
ref|XP_003572782.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  51.6    2e-05   
ref|XP_002867769.1|  hypothetical protein ARALYDRAFT_914370           52.0    2e-05   
ref|XP_010093705.1|  hypothetical protein L484_019046                 51.6    2e-05   
gb|ADD11814.1|  hybrid proline-rich protein                           52.0    2e-05   Cajanus cajan
ref|XP_002270769.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    52.0    2e-05   Vitis vinifera
ref|NP_001152564.1|  cortical cell-delineating protein precursor      51.6    2e-05   Zea mays [maize]
ref|XP_009114618.1|  PREDICTED: lipid transfer protein EARLI 1        52.4    2e-05   
ref|XP_011033953.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.0    2e-05   
gb|EYU30303.1|  hypothetical protein MIMGU_mgv1a016181mg              51.6    2e-05   
ref|XP_002464969.1|  hypothetical protein SORBIDRAFT_01g029630        52.0    2e-05   Sorghum bicolor [broomcorn]
ref|XP_007218576.1|  hypothetical protein PRUPE_ppa013120mg           52.0    2e-05   
ref|XP_009796139.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  52.0    2e-05   
gb|EMS62564.1|  14 kDa proline-rich protein DC2.15                    51.6    2e-05   
ref|XP_002285197.1|  PREDICTED: putative lipid-binding protein At...  51.6    2e-05   Vitis vinifera
ref|XP_003608741.1|  Cortical cell-delineating protein                51.6    2e-05   
ref|NP_001235511.1|  uncharacterized protein LOC100500518 precursor   51.6    2e-05   
gb|KHN04346.1|  14 kDa proline-rich protein DC2.15                    51.6    2e-05   
dbj|BAA05471.1|  tumor-related protein                                50.8    2e-05   Nicotiana glauca x Nicotiana langsdorffii
gb|AFK47547.1|  unknown                                               51.6    2e-05   
gb|KDP25650.1|  hypothetical protein JCGZ_20806                       51.6    2e-05   
emb|CDP05328.1|  unnamed protein product                              51.6    2e-05   
ref|NP_001238293.1|  uncharacterized protein LOC100527330 precursor   51.6    2e-05   
gb|ACV74341.1|  proline-rich protein                                  51.6    2e-05   Jatropha curcas
ref|XP_009113072.1|  PREDICTED: lipid transfer protein EARLI 1        51.6    2e-05   
gb|EPS71802.1|  hypothetical protein M569_02964                       51.6    3e-05   
ref|XP_010676151.1|  PREDICTED: putative lipid-binding protein AIR1B  51.6    3e-05   
ref|XP_007039884.1|  Bifunctional inhibitor/lipid-transfer protei...  51.6    3e-05   
ref|XP_009411010.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  51.6    3e-05   
ref|XP_006290213.1|  hypothetical protein CARUB_v10003904mg           50.8    3e-05   
ref|XP_004291445.1|  PREDICTED: uncharacterized protein LOC101307558  52.0    3e-05   
ref|XP_008232588.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  51.6    3e-05   
ref|NP_001235027.1|  uncharacterized protein LOC100500229 precursor   51.2    3e-05   
ref|XP_009382414.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  51.6    3e-05   
gb|ABG91752.1|  HyPRP2                                                51.2    3e-05   Gossypium hirsutum [American cotton]
ref|XP_010430305.1|  PREDICTED: lipid transfer protein EARLI 1        51.6    3e-05   
ref|XP_007039886.1|  14 kDa proline-rich protein DC2.15, putative     51.6    3e-05   
ref|XP_010539616.1|  PREDICTED: lipid transfer protein EARLI 1-like   51.6    3e-05   
ref|XP_002446914.1|  hypothetical protein SORBIDRAFT_06g024780        51.2    3e-05   Sorghum bicolor [broomcorn]
ref|XP_002446915.1|  hypothetical protein SORBIDRAFT_06g024790        51.2    3e-05   Sorghum bicolor [broomcorn]
ref|XP_002533292.1|  14 kDa proline-rich protein DC2.15 precursor...  51.2    3e-05   Ricinus communis
ref|XP_010695115.1|  PREDICTED: putative lipid-binding protein AIR1B  50.8    3e-05   
ref|XP_010258987.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    51.2    4e-05   
gb|ACN26094.1|  unknown                                               51.2    4e-05   Zea mays [maize]
ref|NP_001151721.1|  LOC100285357 precursor                           51.2    4e-05   Zea mays [maize]
ref|XP_010493725.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  51.2    4e-05   
gb|ACN54400.1|  hybrid proline-rich protein                           51.2    4e-05   Gossypium hirsutum [American cotton]
ref|XP_010919517.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  51.6    4e-05   
ref|XP_002454521.1|  hypothetical protein SORBIDRAFT_04g032620        50.8    4e-05   Sorghum bicolor [broomcorn]
ref|XP_010448889.1|  PREDICTED: putative lipid-binding protein AIR1   51.2    4e-05   
ref|XP_004291443.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.8    4e-05   
ref|XP_011081223.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.8    4e-05   
ref|XP_010261664.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  51.2    4e-05   
ref|XP_006440347.1|  hypothetical protein CICLE_v10022825mg           50.8    4e-05   
ref|XP_006302912.1|  hypothetical protein CARUB_v10021046mg           51.6    4e-05   
ref|XP_010473467.1|  PREDICTED: lipid transfer protein EARLI 1-like   51.2    4e-05   
ref|XP_010418243.1|  PREDICTED: lipid transfer protein EARLI 1-like   51.2    4e-05   
ref|XP_004516838.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  51.2    5e-05   
ref|XP_009783445.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  51.2    5e-05   
emb|CDY31241.1|  BnaC08g15360D                                        50.8    5e-05   
emb|CAL07983.1|  arachidonic acid-induced DEA1-like protein           49.7    5e-05   
gb|KCW77747.1|  hypothetical protein EUGRSUZ_D02041                   50.4    5e-05   
ref|XP_002454523.1|  hypothetical protein SORBIDRAFT_04g032640        50.4    5e-05   
gb|AAC60566.1|  proline-rich SAC51                                    50.8    5e-05   
ref|XP_002874777.1|  hypothetical protein ARALYDRAFT_911650           50.8    5e-05   
ref|XP_009619252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.8    6e-05   
ref|XP_002454525.1|  hypothetical protein SORBIDRAFT_04g032660        50.4    6e-05   
ref|XP_003559027.1|  PREDICTED: putative glycine-rich cell wall s...  51.6    6e-05   
emb|CDX94514.1|  BnaC09g23220D                                        51.2    6e-05   
ref|XP_002304421.2|  hypothetical protein POPTR_0003s11070g           50.4    6e-05   
ref|XP_008437113.1|  PREDICTED: pEARLI1-like lipid transfer prote...  50.4    6e-05   
ref|XP_009619251.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.8    6e-05   
ref|XP_010053449.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    50.4    6e-05   
ref|XP_006289038.1|  hypothetical protein CARUB_v10002422mg           50.8    6e-05   
ref|XP_008786992.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.8    6e-05   
ref|XP_011081227.1|  PREDICTED: pEARLI1-like lipid transfer prote...  50.4    6e-05   
ref|XP_009796138.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.8    6e-05   
ref|XP_002454524.1|  hypothetical protein SORBIDRAFT_04g032650        50.4    6e-05   
emb|CDP19512.1|  unnamed protein product                              50.4    6e-05   
gb|AAC62610.1|  similar to the C-terminus of putative plasma memb...  50.1    7e-05   
ref|XP_010553781.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.1    7e-05   
ref|XP_002464967.1|  hypothetical protein SORBIDRAFT_01g029610        50.1    7e-05   
ref|XP_004291441.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.8    7e-05   
ref|XP_004516834.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.1    8e-05   
gb|KFK31986.1|  hypothetical protein AALP_AA6G185300                  49.7    8e-05   
ref|XP_010919519.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.4    8e-05   
ref|XP_003588783.1|  14 kDa proline-rich protein DC2.15               50.4    8e-05   
ref|XP_004986077.1|  PREDICTED: putative glycine-rich cell wall s...  51.2    8e-05   
gb|KFK25909.1|  hypothetical protein AALP_AA8G178400                  50.4    8e-05   
ref|XP_010519362.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.1    8e-05   
ref|XP_009782706.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.4    9e-05   
gb|ACE82175.1|  extensin-like protein                                 50.1    9e-05   
ref|XP_010493734.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.1    9e-05   
ref|XP_006355478.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.1    9e-05   
ref|XP_008807049.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.1    9e-05   
ref|XP_006477231.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.1    9e-05   
ref|XP_009798258.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.1    9e-05   
dbj|BAA99575.1|  DC2.15 like protein                                  49.7    9e-05   
gb|KDP25647.1|  hypothetical protein JCGZ_20803                       50.1    9e-05   
gb|EMT19257.1|  Cortical cell-delineating protein                     49.7    9e-05   
dbj|BAJ96792.1|  predicted protein                                    49.7    9e-05   
ref|XP_009384469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.1    9e-05   
dbj|BAK05563.1|  predicted protein                                    50.8    1e-04   
gb|EMS47202.1|  Cortical cell-delineating protein                     49.7    1e-04   
ref|XP_002874776.1|  hypothetical protein ARALYDRAFT_911648           50.8    1e-04   
ref|XP_008232631.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  50.1    1e-04   
ref|XP_006368193.1|  hypothetical protein POPTR_0001s00400g           49.7    1e-04   
ref|XP_006391856.1|  hypothetical protein EUTSA_v10023747mg           50.1    1e-04   
ref|XP_010493743.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  49.7    1e-04   
ref|XP_004498751.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  49.7    1e-04   
ref|XP_010264241.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  49.7    1e-04   
ref|XP_009397884.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  49.7    1e-04   
ref|XP_006304906.1|  hypothetical protein CARUB_v10011959mg           49.7    1e-04   
emb|CDY31240.1|  BnaC08g15350D                                        49.7    1e-04   
ref|XP_009591583.1|  PREDICTED: pEARLI1-like lipid transfer prote...  49.7    1e-04   
ref|XP_010264239.1|  PREDICTED: putative lipid-binding protein At...  49.7    1e-04   
ref|XP_010053450.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    49.3    1e-04   
ref|NP_176440.1|  bifunctional inhibitor/lipid-transfer protein/s...  50.1    1e-04   
ref|XP_010695114.1|  PREDICTED: lipid transfer protein EARLI 1-like   50.4    1e-04   
ref|XP_010048953.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  49.3    1e-04   
ref|XP_003525817.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  49.7    1e-04   
gb|KDP25648.1|  hypothetical protein JCGZ_20804                       51.2    1e-04   
ref|XP_008658410.1|  PREDICTED: ctenidin-1-like                       51.2    1e-04   
ref|XP_010041843.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  49.3    1e-04   
ref|XP_006417265.1|  hypothetical protein EUTSA_v10009083mg           49.7    1e-04   
ref|XP_008394102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  49.3    1e-04   
ref|XP_002533294.1|  14 kDa proline-rich protein DC2.15 precursor...  49.7    1e-04   
ref|XP_002529775.1|  14 kDa proline-rich protein DC2.15 precursor...  49.7    1e-04   
ref|XP_003549907.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  49.7    1e-04   
ref|XP_008238564.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  49.7    1e-04   
ref|XP_010455696.1|  PREDICTED: lipid transfer protein EARLI 1-like   50.1    1e-04   
ref|XP_008232586.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  49.7    1e-04   
gb|KDO61485.1|  hypothetical protein CISIN_1g047179mg                 49.3    1e-04   
gb|KFK43475.1|  hypothetical protein AALP_AA1G129800                  49.3    1e-04   
ref|XP_007209745.1|  hypothetical protein PRUPE_ppa013010mg           49.7    1e-04   
ref|XP_009135928.1|  PREDICTED: putative lipid-binding protein AIR1   49.3    1e-04   
ref|XP_004291440.1|  PREDICTED: putative lipid-binding protein At...  50.1    1e-04   
ref|XP_006440346.1|  hypothetical protein CICLE_v10022839mg           49.3    2e-04   
ref|XP_008437101.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  49.7    2e-04   
gb|EMS52512.1|  14 kDa proline-rich protein DC2.15                    49.3    2e-04   
emb|CDX77712.1|  BnaC07g19660D                                        48.9    2e-04   
ref|XP_009148613.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  49.3    2e-04   
ref|XP_002309638.1|  hypothetical protein POPTR_0006s27220g           49.3    2e-04   
emb|CDY33497.1|  BnaA06g35760D                                        48.9    2e-04   
ref|NP_001048668.1|  Os03g0103300                                     50.1    2e-04   
ref|XP_006417266.1|  hypothetical protein EUTSA_v10009061mg           49.3    2e-04   
gb|EAY88189.1|  hypothetical protein OsI_09636                        50.1    2e-04   
emb|CDY21034.1|  BnaA08g24910D                                        49.3    2e-04   
ref|XP_006286053.1|  hypothetical protein CARUB_v10007585mg           49.3    2e-04   
gb|ABF93505.1|  retrotransposon protein, putative, Ty1-copia subc...  50.1    2e-04   
gb|KHG02760.1|  14 kDa proline-rich DC2                               48.9    2e-04   
dbj|BAG50511.1|  qLTG-3-1                                             50.1    2e-04   
ref|XP_009110670.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    49.3    2e-04   
ref|XP_010456905.1|  PREDICTED: putative lipid-binding protein AIR1   48.5    2e-04   
gb|KDP25651.1|  hypothetical protein JCGZ_20807                       50.8    2e-04   
gb|ABK28628.1|  unknown                                               48.9    2e-04   
ref|XP_010422217.1|  PREDICTED: lipid transfer protein EARLI 1-like   49.7    2e-04   
ref|XP_008344389.1|  PREDICTED: lipid transfer protein EARLI 1-like   49.3    2e-04   
ref|XP_010041938.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  48.9    2e-04   
dbj|BAJ08379.1|  qLTG3-1                                              50.1    2e-04   
ref|XP_009134272.1|  PREDICTED: lipid transfer protein EARLI 1-like   49.7    2e-04   
ref|NP_192990.1|  bifunctional inhibitor/lipid-transfer protein/s...  48.5    2e-04   
ref|XP_006647641.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  48.9    2e-04   
emb|CDY21274.1|  BnaC03g29580D                                        49.7    2e-04   
emb|CDX94516.1|  BnaC09g23200D                                        48.5    2e-04   
dbj|BAJ08384.1|  qLTG3-1                                              50.1    2e-04   
dbj|BAJ08383.1|  qLTG3-1                                              50.1    2e-04   
dbj|BAJ08381.1|  qLTG3-1                                              50.1    2e-04   
ref|NP_001148300.1|  cortical cell-delineating protein precursor      48.9    2e-04   
ref|XP_010695112.1|  PREDICTED: lipid transfer protein EARLI 1-like   50.4    2e-04   
ref|XP_010099842.1|  hypothetical protein L484_008499                 48.9    2e-04   
dbj|BAJ08382.1|  qLTG3-1                                              50.1    2e-04   
gb|AAA32650.1|  bimodular protein                                     49.3    2e-04   
dbj|BAJ08386.1|  qLTG3-1                                              50.1    2e-04   
ref|XP_003588784.1|  14 kDa proline-rich protein DC2.15               49.3    2e-04   
ref|XP_006398385.1|  hypothetical protein EUTSA_v10001072mg           48.9    2e-04   
gb|AAM63902.1|  AIR1A-like protein                                    48.5    2e-04   
ref|XP_007161198.1|  hypothetical protein PHAVU_001G050300g           48.5    2e-04   
ref|XP_006398386.1|  hypothetical protein EUTSA_v10001071mg           48.9    2e-04   
ref|XP_003609035.1|  Proline-rich protein                             48.5    2e-04   
ref|XP_009110671.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    48.9    2e-04   
ref|XP_006306558.1|  hypothetical protein CARUB_v10012658mg           48.9    2e-04   
dbj|BAJ08385.1|  qLTG3-1                                              50.1    2e-04   
gb|KFK28807.1|  hypothetical protein AALP_AA7G051200                  48.9    3e-04   
ref|XP_008648736.1|  PREDICTED: pEARLI1-like lipid transfer prote...  48.9    3e-04   
gb|KHN04353.1|  14 kDa proline-rich protein DC2.15                    48.9    3e-04   
ref|XP_004165754.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  48.9    3e-04   
emb|CDY33498.1|  BnaA06g35750D                                        48.5    3e-04   
ref|XP_010676148.1|  PREDICTED: pEARLI1-like lipid transfer prote...  49.3    3e-04   
ref|XP_006396753.1|  hypothetical protein EUTSA_v10029038mg           48.9    3e-04   
ref|XP_010455697.1|  PREDICTED: lipid transfer protein EARLI 1-like   48.9    3e-04   
ref|XP_010695178.1|  PREDICTED: pEARLI1-like lipid transfer prote...  50.1    3e-04   
gb|ABQ01426.1|  bimodular protein                                     49.3    3e-04   
ref|XP_004306948.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  48.9    3e-04   
ref|XP_010553463.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  48.9    3e-04   
ref|XP_010695113.1|  PREDICTED: lipid transfer protein EARLI 1-like   49.7    3e-04   
ref|XP_011018291.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    48.5    3e-04   
emb|CDX90833.1|  BnaA03g25130D                                        49.3    3e-04   
ref|XP_003588779.1|  14 kDa proline-rich protein DC2.15               50.1    3e-04   
ref|XP_010422216.1|  PREDICTED: pEARLI1-like lipid transfer prote...  48.9    3e-04   
ref|XP_009101469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  48.1    3e-04   
ref|XP_009795762.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  48.9    3e-04   
emb|CAI48077.1|  extensin-like protein                                48.5    3e-04   
ref|XP_003608743.1|  14 kDa proline-rich protein DC2.15               48.5    3e-04   
ref|XP_002436327.1|  hypothetical protein SORBIDRAFT_10g000510        48.5    3e-04   
ref|XP_006396751.1|  hypothetical protein EUTSA_v10029036mg           48.9    3e-04   
emb|CDP09930.1|  unnamed protein product                              48.5    3e-04   
ref|XP_002467518.1|  hypothetical protein SORBIDRAFT_01g029450        49.7    3e-04   
emb|CDP18670.1|  unnamed protein product                              48.5    4e-04   
ref|XP_007226236.1|  hypothetical protein PRUPE_ppa017473mg           48.1    4e-04   
gb|AFK41425.1|  unknown                                               48.5    4e-04   
ref|XP_003588785.1|  14 kDa proline-rich protein DC2.15               48.5    4e-04   
ref|XP_006355479.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  48.1    4e-04   
ref|XP_010455695.1|  PREDICTED: pEARLI1-like lipid transfer prote...  48.9    4e-04   
ref|XP_010539605.1|  PREDICTED: putative lipid-binding protein AIR1   48.5    4e-04   
ref|XP_010449961.1|  PREDICTED: 36.4 kDa proline-rich protein-like    50.1    4e-04   
ref|NP_192984.1|  azelaic acid induced 1                              48.5    4e-04   
emb|CDY03176.1|  BnaC09g19800D                                        48.1    4e-04   
ref|XP_009346182.1|  PREDICTED: putative lipid-binding protein AIR1   48.1    4e-04   
ref|XP_002271619.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    48.1    4e-04   
ref|XP_008232632.1|  PREDICTED: lipid transfer protein EARLI 1-like   48.9    4e-04   
tpg|DAA37198.1|  TPA: hypothetical protein ZEAMMB73_187029            48.1    5e-04   
ref|XP_004138721.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  48.1    5e-04   
ref|XP_004152432.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  48.1    5e-04   
ref|XP_006289908.1|  hypothetical protein CARUB_v10003523mg           47.8    5e-04   
gb|KDP25644.1|  hypothetical protein JCGZ_20800                       47.8    5e-04   
ref|XP_007218581.1|  hypothetical protein PRUPE_ppa013196mg           48.1    5e-04   
gb|KFK43474.1|  hypothetical protein AALP_AA1G129700                  48.1    5e-04   
ref|XP_009783170.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  47.8    5e-04   
ref|XP_008219516.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  48.1    5e-04   
emb|CDX99404.1|  BnaC01g11480D                                        47.4    5e-04   
ref|XP_008437114.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  47.8    5e-04   
gb|AES59035.2|  Lipid transfer protein                                48.5    5e-04   
ref|XP_004165507.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  47.8    5e-04   
gb|EAY95111.1|  hypothetical protein OsI_16928                        48.1    5e-04   
ref|NP_001053513.2|  Os04g0554800                                     48.1    5e-04   
ref|XP_006380877.1|  hypothetical protein POPTR_0006s01020g           48.9    5e-04   
ref|XP_009617786.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  48.1    5e-04   
ref|XP_006396754.1|  hypothetical protein EUTSA_v10029528mg           48.5    5e-04   
ref|XP_007155641.1|  hypothetical protein PHAVU_003G218900g           47.8    6e-04   
ref|XP_010422221.1|  PREDICTED: lipid transfer protein EARLI 1        48.1    6e-04   
emb|CDY16710.1|  BnaA09g20880D                                        47.4    6e-04   
ref|XP_009782252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  47.8    6e-04   
ref|XP_002511666.1|  14 kDa proline-rich protein DC2.15 precursor...  47.8    6e-04   
emb|CDX90837.1|  BnaA03g25170D                                        47.4    6e-04   
gb|AFK37174.1|  unknown                                               47.4    6e-04   
ref|XP_009787417.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  47.8    6e-04   
ref|XP_010433288.1|  PREDICTED: putative lipid-binding protein AIR1   47.4    6e-04   
ref|XP_002271792.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    47.8    6e-04   
ref|XP_009114316.1|  PREDICTED: pEARLI1-like lipid transfer prote...  47.8    6e-04   
ref|XP_006289530.1|  hypothetical protein CARUB_v10003073mg           48.1    6e-04   
ref|NP_199500.1|  bifunctional inhibitor/lipid-transfer protein/s...  47.4    6e-04   
ref|XP_010433390.1|  PREDICTED: lipid transfer protein EARLI 1-like   48.1    7e-04   
ref|XP_010490022.1|  PREDICTED: 36.4 kDa proline-rich protein-like    47.8    7e-04   
gb|AAM62750.1|  extA                                                  47.4    7e-04   
gb|ABK95045.1|  unknown                                               48.5    7e-04   
ref|XP_009355765.1|  PREDICTED: putative lipid-binding protein AIR1   47.4    7e-04   
emb|CDX98748.1|  BnaA03g45330D                                        47.4    7e-04   
ref|XP_009338026.1|  PREDICTED: vegetative cell wall protein gp1-...  49.3    7e-04   
ref|XP_004152410.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  47.8    7e-04   
emb|CDY33493.1|  BnaA06g35800D                                        47.0    7e-04   
ref|NP_199501.1|  Bifunctional inhibitor/lipid-transfer protein/s...  47.4    7e-04   
ref|XP_006367623.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  47.4    7e-04   
gb|KFK28809.1|  hypothetical protein AALP_AA7G051800                  48.9    7e-04   
ref|XP_003608748.1|  14 kDa proline-rich protein DC2.15               48.1    8e-04   
dbj|BAP16240.1|  Os10g0554800                                         47.8    8e-04   
gb|EAY79472.1|  hypothetical protein OsI_34600                        47.8    8e-04   
ref|XP_007039887.1|  Bifunctional inhibitor/lipid-transfer protei...  47.4    8e-04   
ref|NP_192987.1|  bifunctional inhibitor/lipid-transfer protein/s...  48.1    8e-04   
ref|XP_010440330.1|  PREDICTED: 36.4 kDa proline-rich protein         49.3    8e-04   
tpg|DAA42812.1|  TPA: hypothetical protein ZEAMMB73_664289            48.1    9e-04   
emb|CDY08680.1|  BnaC04g19890D                                        47.4    9e-04   
ref|XP_007218590.1|  hypothetical protein PRUPE_ppa013286mg           47.4    9e-04   
ref|NP_001065343.2|  Os10g0554800                                     47.8    9e-04   
ref|XP_010258990.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  47.4    9e-04   
dbj|BAA13155.1|  glycine-rich polypeptide                             46.6    0.001   
ref|XP_010433400.1|  PREDICTED: lipid transfer protein EARLI 1-like   47.8    0.001   
ref|XP_006445312.1|  hypothetical protein CICLE_v10022835mg           47.0    0.001   
ref|XP_006281689.1|  hypothetical protein CARUB_v10027837mg           47.0    0.001   
emb|CDX94097.1|  BnaC07g37310D                                        47.0    0.001   



>emb|CDY21275.1| BnaC03g29590D [Brassica napus]
Length=135

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 8/87 (9%)
 Frame = -2

Query  387  DTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------L  226
             +CP++ ++L +C  +LK++  I     S   KPCC  L+GL +L+   CLC       L
Sbjct  50   GSCPRKTLKLGVCANVLKDLLKI--ELGSPPVKPCCSLLKGLVDLEAAACLCTALKANVL  107

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             ++ N+ VS+S+L +ACG+K P GF C
Sbjct  108  GIKLNVPVSLSLLLNACGRKTPRGFIC  134



>emb|CDY61290.1| BnaCnng37610D [Brassica napus]
Length=135

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 52/87 (60%), Gaps = 8/87 (9%)
 Frame = -2

Query  387  DTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------L  226
             +CP++ ++L +C  +LK++  I     S   KPCC  L+GL +++   CLC       L
Sbjct  50   GSCPRKTLKLGVCANVLKDLLKI--ELGSPPVKPCCSLLKGLVDIEAAACLCTALKANVL  107

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             ++ N+ VS+S+L +ACG+K P GF C
Sbjct  108  GIKLNVPVSLSLLLNACGRKTPRGFIC  134



>ref|XP_009134275.1| PREDICTED: lipid transfer protein EARLI 1-like [Brassica rapa]
 emb|CDX90835.1| BnaA03g25150D [Brassica napus]
Length=133

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 51/87 (59%), Gaps = 8/87 (9%)
 Frame = -2

Query  387  DTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------L  226
             +CP++ ++L +C  +LK++  I     +   KPCC  L GL +L+   CLC       L
Sbjct  48   GSCPRKTLKLGVCANVLKDLLKI--ELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVL  105

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             ++ N+ VS+S+L +ACG+K P GF C
Sbjct  106  GIKLNVPVSLSLLLNACGRKTPRGFIC  132



>gb|KFK31985.1| hypothetical protein AALP_AA6G185200 [Arabis alpina]
Length=133

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  I L +C  +LK++  I  +  +   KPCC  ++GL +L+   CLC       L +
Sbjct  50   CPKDTIRLGVCANVLKDLLKI--KLGTPPVKPCCSLIDGLVDLEAAACLCTALKANVLGI  107

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + NI +S+++L + CG+K P+GFKC
Sbjct  108  KLNIPISLNLLLNVCGKKVPSGFKC  132



>ref|XP_006289141.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
 gb|EOA22039.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
Length=135

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  ++L +C  +LK++  I     +   KPCC  ++GL +L+   CLC       L 
Sbjct  51   SCPKDTLKLGVCANVLKDLLKI--ELGTPPVKPCCSLIKGLVDLEAAACLCTAIKANVLG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+S+L + CG+K P+GFKC
Sbjct  109  INLNVPVSLSLLLNVCGKKVPSGFKC  134



>ref|XP_009388037.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=129

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L IC  +L+ + ++     +   +PCC  LEGL +L+  VCLC       L 
Sbjct  45   TCPRDALKLGICANVLRGLLNV--TLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLG  102

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            ++ NI VS+S+L + CG+K P GF C
Sbjct  103  LKLNIPVSLSLLINYCGKKVPKGFLC  128



>ref|XP_010455702.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 51/89 (57%), Gaps = 9/89 (10%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
             +DTCPK  ++L +C   L  ++  L    +   KPCC  ++GL +L+  VCLC      
Sbjct  45   AIDTCPKDALKLGVCVQALNLVNVTL---GAPPVKPCCSLIDGLVDLEAAVCLCTALKAS  101

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  N+ +++S+L + C +KPP GF+C
Sbjct  102  ILGININLPINLSLLLNVCSRKPPRGFQC  130



>ref|XP_011076346.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=152

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L +C  +L     ++     T   PCC  L GL +L+  VCLC       L 
Sbjct  68   TCPRDALKLGVCANLLGRAAGVVVGNPPT--TPCCSLLAGLVDLEAAVCLCTAIKANVLG  125

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI VS+S+L +ACG+ PP GF C
Sbjct  126  INLNIPVSLSLLLNACGRTPPTGFTC  151



>ref|NP_567391.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 ref|NP_567392.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 emb|CAB41721.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB41722.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78294.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78295.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AAO23622.1| At4g12520 [Arabidopsis thaliana]
 dbj|BAE99415.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AEE83141.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE83142.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=129

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  ++L +C  +LK++  I  +  +   KPCC  L GL +L+   CLC       L 
Sbjct  45   SCPKDTLKLGVCANVLKDLLKI--QLGTPPVKPCCSLLNGLVDLEAAACLCTALKAKVLG  102

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+S+L + CG+K P+GF C
Sbjct  103  INLNVPVSLSLLLNVCGKKVPSGFVC  128



>ref|XP_010258985.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=137

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 16/93 (17%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSIL----PRFRSTFAKPCCRRLEGLTNLQVGVCLCK-  229
            V  +CP+  ++L +C  +L ++  ++    P++      PCC  +EGL +L+  VCLC  
Sbjct  50   VYPSCPRDTLKLGVCANLLNDLVHLVVGTPPKY------PCCSLIEGLADLEAAVCLCTA  103

Query  228  -----LQVRTNINVSISILSDACGQKPPNGFKC  145
                 L +  N+ VS+S+L + CG+K P+GF+C
Sbjct  104  IKANILGIHLNVPVSLSLLLNYCGKKVPSGFQC  136



>ref|XP_010053451.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=131

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  I+L +C  +LKN+  ++    +    PCC  + GL +L+  VCLC       L 
Sbjct  47   TCPRDTIKLGVCANVLKNLLHLV--VGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLG  104

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+S+L + CG+K P+GF+C
Sbjct  105  LNLNVPVSLSLLLNYCGKKVPSGFQC  130



>ref|XP_004299469.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=152

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L IC  +L N+ ++     +   +PCC  ++GL +L+  VCLC       L 
Sbjct  68   TCPRDALKLGICANVLNNLLNV--TIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILG  125

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +++S+L +ACG + P GF+C
Sbjct  126  INLNIPIALSLLLNACGNQVPRGFQC  151



>ref|XP_010264242.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=133

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 16/93 (17%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSIL----PRFRSTFAKPCCRRLEGLTNLQVGVCLCK-  229
            V  +CP+  ++L +C  +L ++  ++    P++      PCC  +EGL +L+  VCLC  
Sbjct  46   VYPSCPRDTLKLGVCANLLNDLVHLVIGTPPKY------PCCTLIEGLADLEAAVCLCTA  99

Query  228  -----LQVRTNINVSISILSDACGQKPPNGFKC  145
                 L +  N+ VS+S+L + CG+K P+GF+C
Sbjct  100  IKANILGIHLNVPVSLSLLLNYCGKKVPSGFQC  132



>gb|AAD01800.1| HyPRP [Fragaria x ananassa]
 gb|AAS76505.1| HyPRP [Fragaria x ananassa]
Length=156

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L IC  +L N+ ++     +   +PCC  ++GL +L+  VCLC       L 
Sbjct  72   TCPRDALKLGICANVLNNLLNV--TIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILG  129

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +++S+L +ACG + P GF+C
Sbjct  130  INLNIPIALSLLLNACGNQVPRGFQC  155



>ref|XP_004299470.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 3 
[Fragaria vesca subsp. vesca]
Length=144

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L IC  +L N+ ++     +   +PCC  ++GL +L+  VCLC       L 
Sbjct  60   TCPRDALKLGICANVLNNLLNV--TIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILG  117

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +++S+L +ACG + P GF+C
Sbjct  118  INLNIPIALSLLLNACGNQVPRGFQC  143



>ref|XP_004299468.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=166

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L IC  +L N+ ++     +   +PCC  ++GL +L+  VCLC       L 
Sbjct  82   TCPRDALKLGICANVLNNLLNV--TIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILG  139

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +++S+L +ACG + P GF+C
Sbjct  140  INLNIPIALSLLLNACGNQVPRGFQC  165



>ref|XP_010919518.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=128

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +LK   +++ +      KPCC  LEGL +L+  VCLC       L +
Sbjct  46   CPMNTLKLGVCADVLK---ALVVKIGKPPKKPCCTLLEGLVDLEAAVCLCTALKANILGI  102

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + NI + +S+L + CG+K P GF+C
Sbjct  103  KLNIPIDLSLLLNYCGKKAPKGFQC  127



>gb|KCW77749.1| hypothetical protein EUGRSUZ_D02043, partial [Eucalyptus grandis]
Length=147

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  I+L +C  +LKN+  ++    +    PCC  + GL +L+  VCLC       L 
Sbjct  63   TCPRDTIKLGVCANVLKNLLHLV--VGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLG  120

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+S+L + CG+K P+GF+C
Sbjct  121  LNLNVPVSLSLLLNYCGKKVPSGFQC  146



>dbj|BAF46299.1| extensin like protein [Ipomoea nil]
Length=133

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L N+  ++    +   KPCC  +EGL +L+  VCLC       L +
Sbjct  50   CPKDALKLGVCANVLGNLLGLV--VGNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGI  107

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + CG+K P+GF+C
Sbjct  108  NLNVPLSLSLLLNVCGKKVPSGFQC  132



>ref|XP_010433369.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +LK++  I         KPCC  L GL +L+   CLC       L 
Sbjct  51   SCPRDTLKLGVCANVLKDLLKI--ELGKPPVKPCCSLLNGLVDLEAAACLCTALKANVLG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            ++ N+ VS+S+L + CG+K P+GF C
Sbjct  109  IKLNVPVSLSLLLNVCGKKVPSGFVC  134



>ref|XP_010088890.1| hypothetical protein L484_020878 [Morus notabilis]
 gb|EXB37087.1| hypothetical protein L484_020878 [Morus notabilis]
Length=135

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCPK  ++  +C  +L  ++ ++    +    PCC  L+GL +++  VCLC       L 
Sbjct  51   TCPKDTLKFGVCADLLNGLEHVI--VGTPPVTPCCSLLKGLADVEAAVCLCTAIKANVLG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI VS+S+L + CG+K P GF+C
Sbjct  109  INLNIPVSLSLLLNYCGKKAPKGFQC  134



>ref|XP_011081228.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L ++  ++    +    PCC  +EGL +L+  VCLC       L +
Sbjct  50   CPKDTLKLGVCANLLNDLVHLV--VGTPPKTPCCTLIEGLADLEAAVCLCTAIKANVLGI  107

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ VS+S+L + CG+K P+GF+C
Sbjct  108  NLNVPVSLSLLLNYCGKKAPSGFQC  132



>ref|XP_009388030.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=143

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L IC  +L+ + ++     +   +PCC  LEGL +L+  VCLC       L +
Sbjct  60   CPRDALKLGICANVLRGLLNV--TLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLGL  117

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + NI VS+S+L + CG+K P GF C
Sbjct  118  KLNIPVSLSLLINYCGKKVPKGFLC  142



>ref|XP_006355477.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=138

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L N+  ++    +   KPCC  +EGL +L+  +CLC       L +
Sbjct  54   CPIDTLKLGVCANVLGNVLGVV--LGNPPKKPCCSLIEGLVDLEAALCLCTAIKANILGI  111

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L +ACG+K P+GF+C
Sbjct  112  NLNVPLSLSLLLNACGKKAPSGFQC  136



>ref|XP_006289733.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
 gb|EOA22631.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
Length=135

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  ++L +C  +LK++  I     +   KPCC  ++GL +L+   CLC       L 
Sbjct  51   SCPKDTLKLGVCANVLKDLLKI--ELGTPPVKPCCSLIKGLVDLEAAACLCTAIKANVLG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + CG+K P+GF C
Sbjct  109  INLNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_010433312.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L +C  +LK +D  L    +   KPCC  ++GL +L+  VCLC       L 
Sbjct  48   TCPRDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAVCLCTLLKVNILG  104

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +SIL + CG+K P  F+C
Sbjct  105  ININLPIDLSILLNVCGRKAPTNFQC  130



>ref|XP_004298650.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=135

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L    ++     S    PCC  LEGL +L+V VCLC       L 
Sbjct  51   SCPRDTLKLGVCAKLLNG--AVGAVVGSPPDTPCCAVLEGLVDLEVAVCLCTAIKANILG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI VS+S+L D C +K P+GF+C
Sbjct  109  INLNIPVSLSLLLDGCAKKFPSGFQC  134



>ref|XP_010422224.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +LK++  I     +   KPCC  L GL +L+   CLC       L 
Sbjct  51   SCPRDTLKLGVCANVLKDLLKI--ELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + CG+K P+GF C
Sbjct  109  INLNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_010422222.1| PREDICTED: lipid transfer protein EARLI 1-like isoform X1 [Camelina 
sativa]
Length=135

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +LK++  I     +   KPCC  L GL +L+   CLC       L 
Sbjct  51   SCPRDTLKLGVCANVLKDLLKI--ELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + CG+K P+GF C
Sbjct  109  INLNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_008786991.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=126

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +LK   +++        KPCC  LEGL +L+  VCLC       L +
Sbjct  44   CPMNTLKLGVCADVLK---ALIVNIGKPPKKPCCTLLEGLVDLEAAVCLCTALKANILGI  100

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + NI V +S+L + CG+K P GF+C
Sbjct  101  KLNIPVDLSLLLNYCGKKVPKGFQC  125



>ref|XP_010455699.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
 ref|XP_010455700.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +LK++  I     +   KPCC  L GL +L+   CLC       L 
Sbjct  51   SCPRDTLKLGVCANVLKDLLKI--ELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + CG+K P+GF C
Sbjct  109  INLNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_010455698.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +LK++  I     +   KPCC  L GL +L+   CLC       L 
Sbjct  51   SCPRDTLKLGVCANVLKDLLKI--ELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + CG+K P+GF C
Sbjct  109  INLNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_008796820.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=124

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +LK + ++         KPCC  LEGL +L+  VCLC       L +
Sbjct  41   CPMDALKLGVCANVLKGLINL--NLGKPPKKPCCSLLEGLVDLEAAVCLCTALRANILGI  98

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + N+ + +S+L + CG+K P GF+C
Sbjct  99   KLNLPIHLSLLLNYCGKKTPKGFQC  123



>ref|XP_010539640.1| PREDICTED: lipid transfer protein EARLI 1-like [Tarenaya hassleriana]
Length=133

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L IC  +LK +  +  +      KPCC  +EGL +L+   CLC       L +
Sbjct  50   CPRDTLKLGICLNVLKGLVDL--QLGQPPVKPCCSLIEGLADLEAAACLCTVLKANVLGL  107

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + N+ VS+S+L + C +K P+GFKC
Sbjct  108  KLNVPVSLSLLLNVCKRKAPSGFKC  132



>ref|XP_010456924.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
             CPK  ++L +C  +LK +D  L    +   KPCC  ++GL +L+  VCLC       L 
Sbjct  24   ACPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAVCLCTLLKVNILG  80

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + CG+K P  F+C
Sbjct  81   INLNLPIDLSVLLNICGKKAPTNFQC  106



>ref|XP_010433325.1| PREDICTED: putative lipid-binding protein AIR1B [Camelina sativa]
Length=113

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  ++L +C  +LK +D  L    +   KPCC  ++GL +L+   CLC       L 
Sbjct  30   SCPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAACLCTLLKVNILG  86

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ V++S+L + CG+K P  F+C
Sbjct  87   ININLPVNLSVLLNVCGRKAPTNFQC  112



>ref|XP_010433300.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=113

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +LK +D  L    +   KPCC  ++GL +L+  VCLC       L+
Sbjct  30   SCPRDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAVCLCTLLKVNILE  86

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + CG+K P  F C
Sbjct  87   ININLPIDLSVLLNICGRKAPTNFHC  112



>ref|XP_010433379.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +LK++  I     +   KPCC  L GL +L+   CLC       + 
Sbjct  51   SCPRDTLKLGVCANLLKDLLKI--ELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVIG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            ++ N+ VS+S+L + CG+K P+GF C
Sbjct  109  IKLNVPVSLSLLLNVCGRKVPSGFVC  134



>emb|CDX90834.1| BnaA03g25140D [Brassica napus]
Length=133

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 8/83 (10%)
 Frame = -2

Query  375  KRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQVRT  214
            ++ ++L +C  +LK++  I     S   KPCC  L+GL +L+   CLC       L V+ 
Sbjct  52   RKTLKLGVCANVLKDLLKI--ELGSPPVKPCCSLLKGLVDLEAAACLCTALKANVLGVKL  109

Query  213  NINVSISILSDACGQKPPNGFKC  145
            N+ VS+S+L +ACG+K P GF C
Sbjct  110  NVPVSLSLLLNACGRKTPRGFIC  132



>ref|XP_006847372.1| hypothetical protein AMTR_s01045p00008470 [Amborella trichopoda]
 gb|ERN08953.1| hypothetical protein AMTR_s01045p00008470 [Amborella trichopoda]
Length=134

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 49/89 (55%), Gaps = 8/89 (9%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            V   CPK  ++L +C  +L  +  ++    S   K CC  L+GL +L   VCLC      
Sbjct  47   VYPYCPKDTLKLAVCADVLDGVAHLVIGGPSW--KKCCSLLDGLVDLDSAVCLCTALKAN  104

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L ++  I+V++S+L + CG+K P GFKC
Sbjct  105  ILGIKHAIDVALSLLVNTCGKKLPKGFKC  133



>ref|XP_010422223.1| PREDICTED: lipid transfer protein EARLI 1-like isoform X2 [Camelina 
sativa]
Length=135

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +LK++  I     +   KPCC  L GL +L+   CLC       L 
Sbjct  51   SCPRDTLKLGVCANVLKDLLKI--ELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + CG+K P+GF C
Sbjct  109  INLNVPISLSLLLNVCGKKFPSGFVC  134



>gb|EYU18564.1| hypothetical protein MIMGU_mgv1a016162mg [Erythranthe guttata]
Length=132

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCPK  ++L +C  +L ++  ++    S    PCC  + GL +L+  VCLC       L 
Sbjct  48   TCPKDTLKLGVCANLLNDLVHLV--VGSPPKTPCCSLIGGLADLEAAVCLCTAVKANVLG  105

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+S+L + CG+K P+GF+C
Sbjct  106  INLNVPVSLSLLLNYCGKKVPSGFQC  131



>ref|XP_010422228.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
 ref|XP_010422229.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L +C  +LK +D  L    +   KPCC  ++GL +L+  VCLC       L 
Sbjct  48   TCPRDSLQLGVCANVLKLVDLTL---GNPPVKPCCTLIQGLADLEAAVCLCTLLKVNILG  104

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + CG+K P  F+C
Sbjct  105  INLNLPIDLSVLLNVCGRKAPTNFQC  130



>ref|XP_010264240.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=132

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L    ++     +    PCC  LEGL +L+V  CLC       L 
Sbjct  48   SCPRDALKLGVCAKLLNG--AVGAEVGNPPDHPCCTLLEGLVDLEVAACLCTAIKANILG  105

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI VS+S+L + CG+K P+GF+C
Sbjct  106  INLNIPVSLSLLVNTCGKKLPSGFQC  131



>ref|XP_010422379.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
             CPK  ++L +C  +LK +D       +   KPCC  ++GL +L+  VCLC       L 
Sbjct  24   ACPKDSLQLGVCANVLKLVDL---SLGNPPVKPCCSLIQGLADLEAAVCLCTLLKVNILG  80

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + CG+K P  F+C
Sbjct  81   INLNLPIDLSVLLNICGKKAPTNFQC  106



>ref|XP_002874779.1| hypothetical protein ARALYDRAFT_911652 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51038.1| hypothetical protein ARALYDRAFT_911652 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +LK++  I  +  +   KPCC  L+GL +L+   CLC       L 
Sbjct  45   SCPRDTLKLGVCANVLKDLLKI--QLGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLG  102

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
             + N+ VS+S+L + CG+K P+GF C
Sbjct  103  NKLNVPVSLSLLLNVCGRKVPSGFVC  128



>gb|EYU24741.1| hypothetical protein MIMGU_mgv1a016172mg [Erythranthe guttata]
Length=132

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCPK  ++L +C  +L ++  ++    S    PCC  + GL +L+  VCLC       L 
Sbjct  48   TCPKDTLKLGVCANLLNDLVHLV--VGSPPKTPCCSLIGGLVDLEAAVCLCTAVKANVLG  105

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+S+L + CG+K P+GF+C
Sbjct  106  INLNVPVSLSLLLNYCGKKVPSGFQC  131



>ref|XP_010422227.1| PREDICTED: putative lipid-binding protein AIR1B [Camelina sativa]
Length=113

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  ++L +C  +LK +D  L    +   KPCC  ++GL +L+   CLC       L 
Sbjct  30   SCPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAACLCTLLKVNILG  86

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +++S+L + CG+K P  F+C
Sbjct  87   INLNLPINLSVLLNVCGRKAPTNFQC  112



>ref|XP_010455703.1| PREDICTED: putative lipid-binding protein AIR1B [Camelina sativa]
Length=113

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  ++L +C  +LK +D  L    +   KPCC  ++GL +L+   CLC       L 
Sbjct  30   SCPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAACLCTLLKVNLLG  86

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +++S+L + CG+K P  F+C
Sbjct  87   INLNLPINLSVLLNVCGRKAPTNFQC  112



>ref|NP_001152587.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG48385.1| cortical cell-delineating protein precursor [Zea mays]
 gb|AFW59241.1| cortical cell-delineating protein [Zea mays]
Length=134

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +      +PCCR LEGL +L+  VCLC       L +
Sbjct  52   CPRDALKLGVCANVLGLIKA---KVGVPPTEPCCRLLEGLVDLEAAVCLCTAIKGEVLGI  108

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + N+ V +S++ + CG+  P GFKC
Sbjct  109  KLNLPVDLSLILNHCGKTVPTGFKC  133



>ref|XP_006295216.1| hypothetical protein CARUB_v10024298mg [Capsella rubella]
 gb|EOA28114.1| hypothetical protein CARUB_v10024298mg [Capsella rubella]
Length=134

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP   ++L +C  +L  ++ ++     T   PCC  L+GL NL+  VCLC       L 
Sbjct  51   TCPTDTLKLGVCADLLGLVNVLIGSPPKT---PCCSLLQGLANLEAAVCLCTALKANVLG  107

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ V +S+L + CG+K P GF+C
Sbjct  108  INLNVPVDLSLLLNYCGKKLPYGFQC  133



>ref|XP_010919520.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=140

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++  +C  +L+ + ++  +  +   KPCC  LEGL +L+  VCLC       L 
Sbjct  56   SCPRDALKFGVCANVLQGLINV--QLGNPPKKPCCSLLEGLADLEAAVCLCTAIKANILG  113

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
               N+ V +S+L + CG+K P G+KC
Sbjct  114  TNLNVPVDLSLLLNYCGKKVPAGYKC  139



>ref|XP_008238562.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=142

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 50/89 (56%), Gaps = 15/89 (17%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSIL---PRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            TCPK  ++L  C  +L  +  ++   P+F      PCC  +EGL +L   VCLC      
Sbjct  59   TCPKDTLKLGACADLLNGLVHLVVGPPKF------PCCSLIEGLVDLDAAVCLCTAIKAN  112

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  NI VS+S+L + CG++ P+G++C
Sbjct  113  VLGIHLNIPVSLSLLLNYCGKQVPSGYEC  141



>ref|XP_006289359.1| hypothetical protein CARUB_v10002845mg [Capsella rubella]
 gb|EOA22257.1| hypothetical protein CARUB_v10002845mg [Capsella rubella]
Length=113

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCPK  ++L +C  +LK +D  L    +   KPCC  ++GL +L+  VCLC       L 
Sbjct  30   TCPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAVCLCTVLKANVLG  86

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + C +K P  F+C
Sbjct  87   INLNLPIDLSVLLNVCSRKAPKNFQC  112



>ref|XP_007209690.1| hypothetical protein PRUPE_ppa012402mg [Prunus persica]
 gb|EMJ10889.1| hypothetical protein PRUPE_ppa012402mg [Prunus persica]
Length=171

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 50/89 (56%), Gaps = 15/89 (17%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSIL---PRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            TCPK  ++L  C  +L  +  ++   P+F      PCC  +EGL +L   VCLC      
Sbjct  88   TCPKDTLKLGACADLLNGLVHLVVGPPKF------PCCSLIEGLVDLDAAVCLCTAIKAN  141

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  NI VS+S+L + CG++ P+G++C
Sbjct  142  VLGIHLNIPVSLSLLLNYCGKQVPSGYEC  170



>ref|XP_010455705.1| PREDICTED: pEARLI1-like lipid transfer protein 3 [Camelina sativa]
Length=161

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
             CP+  ++L +C  +LK +D  L    +   KPCC  ++GL +L+  VCLC       L 
Sbjct  78   ACPRDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLVDLEAAVCLCTLLKVNILG  134

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + CG+K P  FKC
Sbjct  135  INLNLPIDLSVLLNVCGRKAPTNFKC  160



>ref|XP_011001498.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=132

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L ++ ++     +   +PCC  ++GL +L+  VCLC       L +
Sbjct  49   CPKDALKLGVCAGLLGSLLNV--TVGTPPVQPCCSVIQGLLDLEAAVCLCTAIKANILGI  106

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI VS+S+L + CG+K P GF+C
Sbjct  107  NLNIPVSLSLLLNVCGKKVPKGFQC  131



>ref|XP_006396750.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
 gb|ESQ38203.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
Length=135

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +LK++  I         KPCC  L+GL +L+   CLC       L 
Sbjct  51   SCPRDTLKLGVCANVLKDLLKI--DVGKPPVKPCCSVLKGLVDLEAAACLCTALKANVLG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            ++ N+ +S+S+L + CG+K P+GF C
Sbjct  109  IKLNVPISLSLLLNVCGRKTPSGFIC  134



>emb|CDP09932.1| unnamed protein product [Coffea canephora]
Length=147

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L NI  I     S   +PCC  L+GL +L+  +CLC       L 
Sbjct  64   SCPRDALKLGVCANLL-NIIGI--SIGSPPTEPCCSLLQGLADLEAALCLCTAIKANILG  120

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+S++ + CG+K PNGF+C
Sbjct  121  INLNVPVSLSVILNDCGKKVPNGFQC  146



>ref|XP_008808738.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=131

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L  + ++         KPCC  LEGL +L+  VCLC       L +
Sbjct  48   CPMNALKLGVCANVLNGLINV--SLGKPPKKPCCTLLEGLVDLEAAVCLCTALKANILGI  105

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + N+ V +S+L + CG+K P G+KC
Sbjct  106  KLNLPVDLSLLLNYCGKKVPAGWKC  130



>ref|XP_006290087.1| hypothetical protein CARUB_v10003726mg [Capsella rubella]
 gb|EOA22985.1| hypothetical protein CARUB_v10003726mg [Capsella rubella]
Length=113

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCPK  ++L +C  +LK +D    +  +   KPCC  ++GL +L+  VCLC       L 
Sbjct  30   TCPKDSLKLGVCANVLKLVDL---KLGNPPVKPCCSLIQGLADLEAAVCLCTVLKANVLG  86

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + C +K P  F+C
Sbjct  87   INLNLPIDLSVLLNVCSRKAPKNFQC  112



>ref|NP_001233824.1| arachidonic acid-induced DEA1 precursor [Solanum lycopersicum]
 gb|AAS80139.1| arachidonic acid-induced DEA1 [Solanum lycopersicum]
Length=138

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (59%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L N+  ++    +   KPCC  +EGL +L+  +CLC       L +
Sbjct  54   CPIDTLKLGVCANVLGNLLGVV--LGNPPKKPCCSLIEGLVDLEAALCLCTAIKANILGI  111

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + CG+K P+GF+C
Sbjct  112  NLNVPLSLSLLLNVCGKKAPSGFQC  136



>ref|XP_010053452.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW77751.1| hypothetical protein EUGRSUZ_D02045 [Eucalyptus grandis]
Length=134

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L  + +I+    +    PCC  LEGL +L+  VCLC       L 
Sbjct  50   SCPRDALKLGVCADLLNGLVNIV--VGTPPKTPCCSLLEGLADLEAAVCLCTAIKASVLG  107

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+S+L + CG+  P GF+C
Sbjct  108  INLNVPVSLSLLLNYCGKDVPYGFQC  133



>gb|ABP35529.1| proline-rich protein [Ipomoea batatas]
Length=132

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 50/89 (56%), Gaps = 16/89 (18%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSIL----PRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            CPK  ++L +C  +L N+  ++    P+      KPCC  +EGL +L+  VCLC      
Sbjct  49   CPKDALKLGVCANVLGNLLGLVVGNPPK------KPCCSFIEGLVDLEAAVCLCTAIKAN  102

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  N+ +S+S+  + CG+K P GF+C
Sbjct  103  VLGINLNVPLSLSLFLNVCGKKVPFGFQC  131



>ref|XP_010431835.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
             CPK  ++L +C  +LK +D  L    +   KPCC  ++GL +L+   CLC       L 
Sbjct  24   ACPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLVDLEAAACLCTLLKVNILG  80

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + CG+K P  F+C
Sbjct  81   INVNLPIDLSVLLNICGRKAPTNFQC  106



>ref|NP_566036.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
 gb|AAL11562.1|AF424568_1 At2g45180/T14P1.1 [Arabidopsis thaliana]
 gb|AAB82643.1| expressed protein [Arabidopsis thaliana]
 gb|AAM62919.1| unknown [Arabidopsis thaliana]
 gb|AAV84511.1| At2g45180 [Arabidopsis thaliana]
 dbj|BAF01874.1| putative proline-rich protein [Arabidopsis thaliana]
 dbj|BAF02133.1| putative proline-rich protein [Arabidopsis thaliana]
 dbj|BAE99283.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|ABI93898.1| At2g45180 [Arabidopsis thaliana]
 gb|AEC10522.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
Length=134

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP   ++L +C  +L  ++ ++     T   PCC  L+GL NL+  VCLC       L 
Sbjct  51   TCPTDTLKLGVCADLLGLVNVVVGSPPKT---PCCTLLQGLANLEAAVCLCTALKANVLG  107

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +++L + CG+K P+GF+C
Sbjct  108  INLNVPIDLTLLLNYCGKKVPHGFQC  133



>ref|XP_010431811.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
             CPK  ++L +C  +LK +D  L    +   KPCC  ++GL +L+   CLC       L 
Sbjct  24   ACPKDSLQLGVCSNVLKLVDLTL---GNPPVKPCCSLIQGLVDLEAAACLCTLLKVNILG  80

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + CG+K P  F+C
Sbjct  81   INVNLPIDLSVLLNICGRKAPTNFQC  106



>ref|XP_008786988.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=136

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  +EL +C  +L+ + ++  +  +   KPCC  LE L +L+  VCLC       L 
Sbjct  52   SCPRDALELGVCANVLQGLINL--QLGNPPKKPCCSLLEDLVDLEAAVCLCTAIKANILG  109

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ V +S+L + CG+K P G+ C
Sbjct  110  INLNVPVDLSLLLNYCGKKVPAGYAC  135



>ref|XP_008238565.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=120

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
             CP+  ++L +C  +L  + ++         +PCC  L GL +L+  VCLC       L 
Sbjct  35   ACPRDALKLGVCANVLSGLVNV--NVGQVPVRPCCTILLGLVDLEAAVCLCTSIKARILG  92

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI V++S+L  ACG K P+GF+C
Sbjct  93   INLNIPVALSLLLSACGDKLPDGFQC  118



>ref|XP_009346906.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Pyrus x bretschneideri]
Length=140

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 49/89 (55%), Gaps = 15/89 (17%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSIL---PRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            TCP   ++L +C  +L  +  ++   P+F      PCC  +EGL +L   VCLC      
Sbjct  57   TCPIDTLKLGVCADVLNGLVHLVVGPPKF------PCCSLIEGLVDLDAAVCLCTAIKAN  110

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  N+ VS+S+L + CG++ P G++C
Sbjct  111  VLGIHLNVPVSLSLLLNYCGKQAPTGYEC  139



>ref|XP_009114615.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
Length=129

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 51/89 (57%), Gaps = 9/89 (10%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
             ++TCPK  ++L +C   L  +++ L    +   KPCC  ++GL +L+  VCLC      
Sbjct  43   AIETCPKDTVKLGVCVNALNLLNATL---GAPPVKPCCSLIDGLVDLEAAVCLCTALKAS  99

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  N+ +++S+L + C +K P GF+C
Sbjct  100  ILGININLPINLSLLLNVCNRKAPRGFQC  128



>ref|XP_009134274.1| PREDICTED: lipid transfer protein EARLI 1-like [Brassica rapa]
Length=133

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 8/83 (10%)
 Frame = -2

Query  375  KRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQVRT  214
            ++ ++L +C  +LK++  I     +   KPCC  L+GL +L+   CLC       L ++ 
Sbjct  52   RKTLKLGVCANVLKDLLKI--ELGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLGIKL  109

Query  213  NINVSISILSDACGQKPPNGFKC  145
            N+ VS+S+L +ACG+K P GF C
Sbjct  110  NVPVSLSLLLNACGRKTPRGFIC  132



>ref|XP_010506455.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Camelina sativa]
 ref|XP_010506456.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Camelina sativa]
Length=131

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP   ++L +C  +L  ++ ++     T   PCC  L+GL NL+  VCLC       L 
Sbjct  48   TCPTDTLKLGVCADLLGLVNVLVGSPPKT---PCCSLLQGLANLEAAVCLCTALKANVLG  104

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + CG+K P GF+C
Sbjct  105  INLNVPIDLSLLLNYCGKKLPYGFQC  130



>gb|ABQ88334.1| lipid transfer protein [Capsicum annuum]
Length=142

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (59%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L IC  +L N+  ++    +   KPCC  ++GL +L+  +CLC       L +
Sbjct  58   CPVDALKLGICANVLGNLLGVV--LGNPPKKPCCSLIQGLVDLEAALCLCTALKANILGI  115

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + CG+K P+GF+C
Sbjct  116  NLNVPISLSLLLNVCGKKVPSGFQC  140



>ref|XP_010906606.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=132

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L  + ++         KPCC  LEGL +L+  VCLC       L +
Sbjct  49   CPINTLKLGVCAKVLNGLINV--SLGKPPKKPCCTLLEGLVDLEAAVCLCTALKASILGI  106

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + N+ V +S+L + CG+K P G+KC
Sbjct  107  KLNVPVDLSLLLNYCGKKVPAGWKC  131



>ref|XP_007155637.1| hypothetical protein PHAVU_003G218600g [Phaseolus vulgaris]
 gb|ESW27631.1| hypothetical protein PHAVU_003G218600g [Phaseolus vulgaris]
Length=132

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 51/87 (59%), Gaps = 10/87 (11%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKN-IDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------L  226
            +CP+  ++L +C  +L   I +++    S    PCC  LEGL +L+V VCLC       L
Sbjct  48   SCPRDALKLGVCTNVLNGPIGAVV---GSPLDHPCCSVLEGLLDLEVAVCLCTAIKANIL  104

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             +  NI +S+S++ +AC + PP+ F+C
Sbjct  105  GININIPISLSLILNACEKSPPSDFQC  131



>ref|XP_010431799.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
 ref|XP_010431824.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
             CPK  ++L +C  +LK +D  L    +   KPCC  ++GL +L+   CLC       L 
Sbjct  24   ACPKDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLVDLEAAACLCTLLKVNILG  80

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + CG+K P  F+C
Sbjct  81   INLNLPIDLSVLLNICGRKAPTNFQC  106



>ref|XP_006290090.1| hypothetical protein CARUB_v10003735mg [Capsella rubella]
 gb|EOA22988.1| hypothetical protein CARUB_v10003735mg [Capsella rubella]
Length=113

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L +C  +LK +D  L    +   KPCC  ++GL +L+  VCLC       L 
Sbjct  30   TCPRDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIQGLADLEAAVCLCTMLKVNLLG  86

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + C +K P  F+C
Sbjct  87   INLNLPIDLSVLLNVCSRKAPKNFQC  112



>ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
Length=134

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L +C  +L ++  ++    +    PCC  ++GL +L+  VCLC       L 
Sbjct  50   TCPRDTLKLGVCANVLNDLVHLV--VGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILG  107

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+S+L + CG+K P+GF+C
Sbjct  108  INLNVPVSLSLLLNFCGKKVPSGFQC  133



>emb|CAI51313.1| arachidonic acid-induced DEA1 [Capsicum chinense]
Length=142

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (59%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L IC  +L N+  ++    +   KPCC  ++GL +L+  +CLC       L +
Sbjct  58   CPIDALKLGICANVLGNLLGVV--LGNPPKKPCCSLIQGLVDLEAALCLCTALKANILGI  115

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + CG+K P+GF+C
Sbjct  116  NLNVPISLSLLLNVCGKKVPSGFQC  140



>ref|XP_008338137.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008389722.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=139

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L  + +I         +PCC  ++GL +L+  VCLC       L 
Sbjct  55   SCPRDTLKLGVCANVLNGLLNI--SVGKPPVEPCCSLIQGLADLEAAVCLCTALKANILG  112

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI VS+S+L + CG K P GF+C
Sbjct  113  INLNIPVSLSLLLNVCGNKVPKGFQC  138



>sp|P14009.1|14KD_DAUCA RecName: Full=14 kDa proline-rich protein DC2.15; Flags: Precursor 
[Daucus carota]
 emb|CAA33476.1| unnamed protein product [Daucus carota]
Length=137

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  + +++     T   PCC  LEGL NL+  VCLC       L  
Sbjct  54   CPRDALKLGVCADVLNLVHNVVIGSPPTL--PCCSLLEGLVNLEAAVCLCTAIKANILGK  111

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +++S++ + CG++ PNGF+C
Sbjct  112  NLNLPIALSLVLNNCGKQVPNGFEC  136



>ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|ESR53589.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|KDO61488.1| hypothetical protein CISIN_1g035808mg [Citrus sinensis]
Length=131

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L +C  +L ++  ++    +    PCC  ++GL +L+  VCLC       L 
Sbjct  47   TCPRDTLKLGVCANVLNDLVHLV--VGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILG  104

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+S+L + CG+K P+GF+C
Sbjct  105  INLNVPVSLSLLLNFCGKKVPSGFQC  130



>ref|NP_001053512.1| Os04g0554600 [Oryza sativa Japonica Group]
 emb|CAD41235.2| OSJNBa0010H02.23 [Oryza sativa Japonica Group]
 dbj|BAF15426.1| Os04g0554600 [Oryza sativa Japonica Group]
 gb|EAZ31583.1| hypothetical protein OsJ_15725 [Oryza sativa Japonica Group]
Length=131

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +     A+PCC  LEGL +L+  VCLC       L +
Sbjct  49   CPRDALKLGVCANVLGLIKA---KVGVPPAEPCCPLLEGLVDLEAAVCLCTAIKGNILGI  105

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ V +S++ + CG++ P GFKC
Sbjct  106  NLNLPVDLSLILNYCGKRVPTGFKC  130



>ref|XP_004251936.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=123

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L  ++       S    PCC  ++GLT+L+  VCLC       L +
Sbjct  42   CPKDALKLGVCANVLNLVNV---TVGSPPPLPCCSLIQGLTDLEAAVCLCTAIRANVLGI  98

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI +S+S++ + CG+ PP GF C
Sbjct  99   NLNIPLSLSLVLNNCGRNPPTGFTC  123



>ref|XP_009346905.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Pyrus x bretschneideri]
Length=142

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 49/89 (55%), Gaps = 15/89 (17%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSIL---PRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            TCP   ++L +C  +L  +  ++   P+F      PCC  +EGL +L   VCLC      
Sbjct  59   TCPIDTLKLGVCADVLNGLVHLVVGPPKF------PCCSLIEGLVDLDAAVCLCTAIKAN  112

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  N+ VS+S+L + CG++ P G++C
Sbjct  113  VLGIHLNVPVSLSLLLNYCGKQAPTGYEC  141



>ref|XP_009598876.1| PREDICTED: lipid transfer protein EARLI 1-like, partial [Nicotiana 
tomentosiformis]
Length=93

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 50/85 (59%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L N+  +  +  +   KPCC  ++GL +++  +CLC       L +
Sbjct  10   CPKNTLKLGVCANVLGNLLGL--KIGNIPKKPCCTLIKGLADVEAALCLCTAIKANVLGI  67

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + CG+K P+GF C
Sbjct  68   NLNVPLSLSLLLNVCGKKVPSGFIC  92



>ref|XP_006397698.1| hypothetical protein EUTSA_v10001680mg [Eutrema salsugineum]
 gb|ESQ39151.1| hypothetical protein EUTSA_v10001680mg [Eutrema salsugineum]
Length=134

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (55%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP   ++L +C  +L  ++ +      T   PCC  L+GL NL+  VCLC       L 
Sbjct  51   TCPTDTLKLGVCADLLGLVNVVAGSPPKT---PCCALLKGLANLEAAVCLCTALKANVLG  107

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ V +S+L + CG+K P GF+C
Sbjct  108  INLNVPVDLSLLLNYCGKKLPYGFQC  133



>ref|XP_002324869.2| hypothetical protein POPTR_0018s01890g [Populus trichocarpa]
 gb|ABK95939.1| unknown [Populus trichocarpa]
 gb|EEF03434.2| hypothetical protein POPTR_0018s01890g [Populus trichocarpa]
Length=121

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 13/88 (15%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSIL--PRFRSTFAKPCCRRLEGLTNLQVGVCLCK------  229
            TCP+  ++L  C  IL  ++ ++  P +       CC  LEGL +L+V +CLC       
Sbjct  38   TCPRDTLKLGACADILGLVNVVVGSPPYSK-----CCPLLEGLADLEVALCLCTAIKASV  92

Query  228  LQVRTNINVSISILSDACGQKPPNGFKC  145
            L +  N+ V++S+L  ACG+  P GFKC
Sbjct  93   LGINLNVPVALSVLVSACGKSIPPGFKC  120



>ref|XP_002874778.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51037.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +LK++  I  +  +   KPCC  L+GL +L+   CLC       L 
Sbjct  45   SCPRDTLKLGVCANVLKDLLKI--QLGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLG  102

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
             + N+ VS+S+L + CG+K P+ F C
Sbjct  103  TKLNVPVSLSLLLNVCGRKVPSKFVC  128



>gb|EAY95110.1| hypothetical protein OsI_16927 [Oryza sativa Indica Group]
Length=131

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +     A+PCC  LEGL +L+  VCLC       L +
Sbjct  49   CPRDALKLGVCANVLGLIKA---KVGVPPAEPCCPLLEGLVDLEAAVCLCTAIRGNILGI  105

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ V +S++ + CG++ P GFKC
Sbjct  106  NLNLPVDLSLILNYCGKRVPTGFKC  130



>ref|NP_001053511.1| Os04g0554500 [Oryza sativa Japonica Group]
 emb|CAE01698.2| OSJNBa0010H02.22 [Oryza sativa Japonica Group]
 gb|AAR30140.1| lipid transfer protein-like protein [Oryza sativa Japonica Group]
 dbj|BAF15425.1| Os04g0554500 [Oryza sativa Japonica Group]
 gb|EAY95109.1| hypothetical protein OsI_16926 [Oryza sativa Indica Group]
Length=130

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +     A+PCC  LEGL +L+  VCLC       L +
Sbjct  49   CPRDALKLGVCANVLGLIKA---KVGVPPAEPCCPLLEGLVDLEAAVCLCTAIRGNILGI  105

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ V +S++ + CG++ P GFKC
Sbjct  106  NLNLPVDLSLILNYCGKRVPTGFKC  130



>ref|XP_006289270.1| hypothetical protein CARUB_v10002736mg [Capsella rubella]
 gb|EOA22168.1| hypothetical protein CARUB_v10002736mg [Capsella rubella]
Length=131

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 50/89 (56%), Gaps = 9/89 (10%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
             ++TCPK  ++L +C   L  ++  L    +   KPCC  ++GL +L+  VCLC      
Sbjct  45   AIETCPKDALKLGVCVQALNLVNVTL---GAPPVKPCCSLIDGLVDLEAAVCLCTAIKAS  101

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  N+ +++S+L + C +K P GF+C
Sbjct  102  ILGININLPINLSLLLNVCSRKAPRGFQC  130



>ref|XP_010422226.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 50/89 (56%), Gaps = 9/89 (10%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
             ++TCPK  ++L +C   L  ++  L    +   KPCC  ++GL +L+  VCLC      
Sbjct  45   AIETCPKDALKLGVCVQALNLVNVTL---GAPPVKPCCSLIDGLVDLEAAVCLCTALKAS  101

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  N+ +++S+L + C +K P GF+C
Sbjct  102  ILGININLPINLSLLLNVCSRKAPRGFQC  130



>ref|XP_010456925.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 46/86 (53%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
             CP+  ++L +C  +LK +D  L     T   PCC  ++GL +L+   CLC       L 
Sbjct  24   ACPRDSLQLGVCANVLKLVDITLGNPPVT---PCCSLIQGLADLEAAACLCTLVKVNVLG  80

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + CG+ PP  F+C
Sbjct  81   INLNLPIDLSVLLNVCGRTPPTNFQC  106



>ref|XP_010906607.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=129

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L  + ++     +   +PCC  L GL +L+V VCLC       L +
Sbjct  46   CPIDALKLGVCADVLSGLLNV--TIGTPPKEPCCSLLSGLVDLEVAVCLCTVIKASILGI  103

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI V +S+L + CG+K P+GF+C
Sbjct  104  NLNIPVDLSLLVNYCGKKVPSGFQC  128



>ref|XP_006289684.1| hypothetical protein CARUB_v10003241mg [Capsella rubella]
 ref|XP_006289723.1| hypothetical protein CARUB_v10003290mg [Capsella rubella]
 gb|EOA22582.1| hypothetical protein CARUB_v10003241mg [Capsella rubella]
 gb|EOA22621.1| hypothetical protein CARUB_v10003290mg [Capsella rubella]
Length=140

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L +C  +LK +D    +  +   KPCC  ++GL +L+  VCLC       L 
Sbjct  57   TCPRDALQLGVCANVLKLVDL---KLGNPPVKPCCSLIQGLADLEAAVCLCTALKVNILG  113

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + C +K P  F+C
Sbjct  114  INLNLPIDLSVLLNVCSRKAPKNFQC  139



>ref|XP_004241782.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=126

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 10/86 (12%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCKL-------Q  223
            CP+  ++L +C  +L  ++       S    PCC  LEGL +L+V  CLC          
Sbjct  43   CPRDTLKLGVCADLLGLVNV---AIGSQVTTPCCSLLEGLADLEVAACLCTAIKANVLGI  99

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            V+ +I V++S L  AC +K P GFKC
Sbjct  100  VKLDIPVALSALVSACAKKVPTGFKC  125



>ref|XP_008362163.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=145

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  ++L +C  +L ++ +I+    +    PCC  + GL +L+  VCLC       L 
Sbjct  61   SCPKDTLKLGVCGDLLNDLVTIV--VGTPPKTPCCSLIGGLADLEAAVCLCTAIKANVLG  118

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  ++ VS+S+L + CG+  PNGF+C
Sbjct  119  INLDVPVSLSLLLNYCGKSVPNGFQC  144



>ref|XP_006366172.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=120

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 9/87 (10%)
 Frame = -2

Query  387  DTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------L  226
             TC    ++L +C  IL  ++ I+    S    PCC  ++GLT+L+  VCLC       L
Sbjct  37   QTCSIDTLKLGVCANILNLVNVIV---GSPPTLPCCSLIQGLTDLEAAVCLCTAIRANVL  93

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             +  N+ +S+S++ ++CG+ PP GF C
Sbjct  94   GINLNVPLSLSLILNSCGKNPPTGFTC  120



>ref|XP_002454527.1| hypothetical protein SORBIDRAFT_04g032680 [Sorghum bicolor]
 gb|EES07503.1| hypothetical protein SORBIDRAFT_04g032680 [Sorghum bicolor]
Length=119

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +     A+PCC  LEGL +L+  VCLC       L +
Sbjct  38   CPRDALKLGVCANVLGLIKA---KVAVPPAEPCCPLLEGLVDLEAAVCLCTAIKGNILGI  94

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ + +S++ + CG+  P GFKC
Sbjct  95   NLNLPIDLSLILNYCGKTVPTGFKC  119



>ref|XP_011036580.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=126

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 13/88 (15%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSIL--PRFRSTFAKPCCRRLEGLTNLQVGVCLCK------  229
            TCP+  ++L  C  IL  ++ ++  P +       CC  LEGL +L+V +CLC       
Sbjct  43   TCPRDTLKLGACADILGLVNVVVGTPPYSK-----CCPLLEGLADLEVALCLCTAIKANV  97

Query  228  LQVRTNINVSISILSDACGQKPPNGFKC  145
            L +  N+ V++S+L  ACG+  P GFKC
Sbjct  98   LGINLNVPVALSVLVSACGKSIPPGFKC  125



>emb|CBI31906.3| unnamed protein product [Vitis vinifera]
Length=113

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 10/86 (12%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAK-PCCRRLEGLTNLQVGVCLCK------LQ  223
            CPK  ++L +C  +L ++   L     T  K PCC  + GL +L+  VCLC       L 
Sbjct  30   CPKDTLKLGVCADLLNDL---LHAVVGTPPKSPCCSLIGGLADLEAAVCLCTAIKANVLG  86

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            ++ N+ VS+S+L + CG+K P G++C
Sbjct  87   IKLNVPVSLSLLLNYCGKKVPTGYQC  112



>ref|XP_010508203.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=131

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 49/89 (55%), Gaps = 9/89 (10%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            V  TCP    +L +C  +L  ++ ++    S    PCC  L+GL NL+  VCLC      
Sbjct  45   VKPTCPTDTFKLGVCADLLGLVNVLV---GSPPKTPCCSLLQGLANLEAAVCLCTALKAN  101

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  N+ +++S+L + CG+K P GF+C
Sbjct  102  VLGINLNVPINLSLLLNYCGKKLPYGFQC  130



>ref|XP_010433333.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 50/88 (57%), Gaps = 9/88 (10%)
 Frame = -2

Query  390  VDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------  229
            ++TCPK  ++L +C   L  ++  L    +   KPCC  ++GL +L+  VCLC       
Sbjct  46   IETCPKDALKLGVCVQALNLVNVTL---GAPPVKPCCSLIDGLVDLEAAVCLCTALKASI  102

Query  228  LQVRTNINVSISILSDACGQKPPNGFKC  145
            L +  N+ +++S+L + C +K P GF+C
Sbjct  103  LGININLPINLSLLLNVCSRKAPRGFQC  130



>ref|XP_010933688.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=131

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L  + ++     +   KPCC  L+GL +L+V VCLC       L +
Sbjct  48   CPMNALKLGVCANVLNGLINL--NLGNPPKKPCCTLLQGLADLEVAVCLCTALKANILGI  105

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ + +S+L + CG+  P GF+C
Sbjct  106  SLNVPIDLSLLINYCGKNAPTGFQC  130



>gb|AEX33654.1| lipid transfer protein [Uromyces hobsonii]
Length=137

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L ++  ++    +    PCC  L+GL +L+  +CLC       L +
Sbjct  51   CPKDTLKLGVCANLLNDLVHLV--VGAPPKTPCCTLLKGLADLEAALCLCTAIKANVLGI  108

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ VS+S+L + CG+K P GF+C
Sbjct  109  NLNVPVSLSLLLNYCGKKVPTGFQC  133



>gb|KFK37310.1| hypothetical protein AALP_AA4G240600 [Arabis alpina]
Length=132

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP   ++L +C  +L  ++ ++     T   PCC  L+GL NL+  VCLC       L 
Sbjct  50   TCPTDTLKLGVCADLLGLVNVVVGSPPKT---PCCTLLKGLANLEAAVCLCTALKANVLG  106

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + CG+K P GF+C
Sbjct  107  LNLNVPIDLSLLLNYCGKKLPYGFQC  132



>emb|CDY21277.1| BnaC03g29610D [Brassica napus]
Length=113

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +LK +D  L    +   KPCC  + GL +L+  VCLC       L 
Sbjct  30   SCPRDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIAGLADLEAAVCLCTVLKANILG  86

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            ++ N+ +++S+L + C +K P  F+C
Sbjct  87   IKLNLPINLSVLLNVCSRKAPKNFQC  112



>ref|XP_009134277.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
 emb|CDX90838.1| BnaA03g25180D [Brassica napus]
Length=113

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +LK +D  L    +   KPCC  + GL +L+  VCLC       L 
Sbjct  30   SCPRDSLQLGVCANVLKLVDLTL---GNPPVKPCCSLIAGLADLEAAVCLCTVLKANILG  86

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            ++ N+ +++S+L + C +K P  F+C
Sbjct  87   IKLNLPINLSVLLNVCSRKAPKNFQC  112



>ref|XP_008392581.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=137

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L  + +I         +PCC  ++GL +L+  VCLC       L 
Sbjct  53   SCPRDTLKLGVCANVLNGLLNI--TIGKPPVEPCCSLIQGLADLEAAVCLCTAIKANILG  110

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +S+S+L + CG K P GF+C
Sbjct  111  INLNIPISLSLLLNVCGNKVPKGFQC  136



>ref|XP_009333674.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L  +   +    +    PCC  LEGL +L+V VCLC       L 
Sbjct  52   SCPRDSLKLGVCAKLLNGVVGAV--VGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILG  109

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +++S++ D C +  P GFKC
Sbjct  110  INLNIPIALSLVIDGCAKNVPAGFKC  135



>ref|XP_004298648.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=138

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 49/88 (56%), Gaps = 15/88 (17%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSIL---PRFRSTFAKPCCRRLEGLTNLQVGVCLCK------  229
            CPK  ++L  C  +L  +  ++   P+F      PCC  ++GL +L   VCLC       
Sbjct  56   CPKDTLKLGACADVLNGLVHLVVGPPKF------PCCSLIQGLVDLDAAVCLCTAIKANV  109

Query  228  LQVRTNINVSISILSDACGQKPPNGFKC  145
            L +  N+ VS+S+L + CG+K P+G++C
Sbjct  110  LGINLNVPVSLSLLLNYCGKKVPSGYEC  137



>ref|XP_002533291.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF29085.1| lipid binding protein, putative [Ricinus communis]
Length=114

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 48/86 (56%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  ++L +C  +LK++ S+     +    PCC  + GL +L+   CLC         
Sbjct  29   SCPKDTVKLGVCVNLLKDLLSV--TVGTPPKTPCCSLIAGLVDLEAAACLCTTIKADVAG  86

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            ++ N+ + +S+L + CG+K P GFKC
Sbjct  87   IKLNLPIHLSLLLNYCGKKVPQGFKC  112



>ref|XP_010518131.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=134

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP   ++L +C  +L  ++ ++     T   PCC  L+GL NL+  VCLC       + 
Sbjct  51   TCPTDTLKLGVCADLLGLVNVLIGSPPKT---PCCSLLQGLANLEAAVCLCTAIKANVVG  107

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + CG+K P GF+C
Sbjct  108  INLNVPIDLSLLLNYCGKKLPYGFQC  133



>gb|AFK47889.1| unknown [Medicago truncatula]
Length=111

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L     I     S    PCC  LEGL +L+V VCLC       L 
Sbjct  27   SCPRDALKLGVCANLLNG--PIGAVIGSPPEHPCCSILEGLVDLEVAVCLCTAIKANILG  84

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +S+S++ +AC + PP  F+C
Sbjct  85   IDINIPISLSLILNACEKTPPTDFQC  110



>ref|XP_002511665.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF50334.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=139

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  ++L +C  +L ++  ++    +   +PCC  ++GL +L+  VCLC       L 
Sbjct  55   SCPKNALKLGVCADLLNDLVHLV--VGTPPKEPCCPLIQGLADLEAAVCLCTALKANILG  112

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+S+L + CG+  P GF+C
Sbjct  113  INLNVPVSLSLLLNYCGKGVPAGFQC  138



>gb|AIX10944.1| PRP2-like protein [Gardenia jasminoides]
Length=147

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP   ++L +C  +L  I        S   KPCC  LEGL +L+  VCLC       L 
Sbjct  64   TCPGDALKLGVCADLLGLIGI---SIGSPPTKPCCSLLEGLADLEAAVCLCTAIKANILG  120

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S++ + CG+  P GF+C
Sbjct  121  INLNVPISLSLILNNCGKSVPKGFQC  146



>gb|KDP28790.1| hypothetical protein JCGZ_14561 [Jatropha curcas]
Length=135

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 50/89 (56%), Gaps = 8/89 (9%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            V+ +CP   ++L +C  +L ++  ++    +    PCC  L+GL +L+  VCLC      
Sbjct  48   VLPSCPIDTLKLGVCANLLNDLVHLV--LGTPPKTPCCPLLQGLADLEAAVCLCTALKAS  105

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  N+ +S+S+L + CGQ  P GF+C
Sbjct  106  VLGLNLNVPISLSLLLNYCGQGVPAGFQC  134



>ref|XP_010053929.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW78308.1| hypothetical protein EUGRSUZ_D02488 [Eucalyptus grandis]
Length=133

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L +C  +L ++  ++    +    PCC  +EGL +L+  VCLC       L 
Sbjct  49   TCPRDTLKLGVCANLLNDLLHLV--VGTPPKTPCCSLIEGLADLEAAVCLCTAIKANILG  106

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
               NI +S+S+L + CGQ  P GF+C
Sbjct  107  NNLNIPISLSLLLNYCGQGVPKGFQC  132



>ref|XP_009333598.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L  +   +    +    PCC  LEGL +L+V VCLC       L 
Sbjct  52   SCPRDSLKLGVCAKLLNGVVGAV--VGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILG  109

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +++S++ D C +  P GFKC
Sbjct  110  INLNIPIALSLVIDGCAKNVPAGFKC  135



>ref|XP_011018292.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Populus euphratica]
Length=140

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L ++ ++     S   KPCC  ++GL +L+  VCLC       L +
Sbjct  57   CPKDALKLGVCADLLGSLLNV--TIGSPPVKPCCSVIQGLLDLEAAVCLCTAIKANILGI  114

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI +S+S+L + CG+K P  F+C
Sbjct  115  NLNIPLSLSLLVNVCGKKVPKDFQC  139



>ref|XP_011070108.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=137

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L ++  ++    +    PCC  + GL +L+  VCLC       L +
Sbjct  54   CPKDTLKLGVCANLLNDLVHLV--VGTPPKTPCCSLIGGLADLEAAVCLCTAIKANVLGI  111

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ VS+S+L + CG+K P+GF+C
Sbjct  112  NLNVPVSLSLLLNYCGKKVPSGFQC  136



>ref|XP_008808739.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=126

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLC------KLQV  220
            CP   ++L +C  +L  + +I     +   +PCC  L GL +L+V VCLC       L +
Sbjct  43   CPIDALKLGVCADVLGGLLNI--TIGTPPKEPCCSLLSGLVDLEVAVCLCIAIKASILGI  100

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI V +S+L + CG+K P+GF+C
Sbjct  101  NLNIPVDLSLLVNYCGKKVPSGFQC  125



>ref|XP_009623719.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=135

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 50/85 (59%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L N+  +  +  +   KPCC  ++GL +++  +CLC       L +
Sbjct  52   CPKNTLKLGVCANVLGNLLGL--KIGNIPKKPCCTLIKGLADVEAALCLCTAIKANVLGI  109

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + CG+K P+GF C
Sbjct  110  NLNVPLSLSLLLNVCGKKVPSGFIC  134



>ref|XP_002533299.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29093.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=133

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 50/85 (59%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L ++ ++         +PCC  ++GL +L+  VCLC       L +
Sbjct  50   CPRDALKLGVCANVLGSLLNL--NIGKPPVEPCCSLIQGLVDLEAAVCLCTAIKANILGI  107

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI +S+S+L + CG+K P+GF+C
Sbjct  108  NLNIPLSLSLLLNVCGKKTPSGFQC  132



>emb|CDX95635.1| BnaC03g25160D [Brassica napus]
Length=131

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 9/89 (10%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            V  TCP   ++L +C  +L  I+ ++    S    PCC  L GL N++  VCLC      
Sbjct  45   VKPTCPTDTLKLGVCADLLGLINVLV---GSPPKTPCCALLNGLANVEAAVCLCTALKAN  101

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  N+ V +S+L + CG+K P GF+C
Sbjct  102  VLGINLNVPVDLSLLLNYCGKKLPYGFQC  130



>ref|XP_010424613.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 11/87 (13%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCKLQVRTNI-  208
             CP+  ++L +C  +LK +D  L     T   PCC  ++GL +L+  VCLC L V+ N+ 
Sbjct  24   ACPRDSLQLGVCANVLKLVDITLGNPPVT---PCCSLIQGLADLEAAVCLCTL-VKVNVL  79

Query  207  ------NVSISILSDACGQKPPNGFKC  145
                   + +S+L + CG+ PP  F+C
Sbjct  80   GINLKLPIDLSVLLNVCGRTPPTNFQC  106



>ref|XP_006368194.1| HyPRP family protein [Populus trichocarpa]
 gb|ABK92650.1| unknown [Populus trichocarpa]
 gb|ERP64763.1| HyPRP family protein [Populus trichocarpa]
Length=140

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L ++ ++     S   KPCC  ++GL +L+  +CLC       L +
Sbjct  57   CPKDALKLGVCADLLGSLLNV--TIGSPPVKPCCSVIQGLLDLEAAICLCTAIKANILGI  114

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI +S+S+L + CG+K P  F+C
Sbjct  115  NLNIPISLSLLINVCGKKVPKDFQC  139



>ref|XP_009373377.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009373378.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009346904.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=140

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 49/89 (55%), Gaps = 15/89 (17%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSIL---PRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            TCP+  ++L  C  +L  +  ++   P+F      PCC  +EGL +L   VCLC      
Sbjct  57   TCPRDTLKLGACADVLNGLVHLVVGPPKF------PCCSLIEGLVDLDAAVCLCTAIKAN  110

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             + +  NI +S+S+L + CG++ P G++C
Sbjct  111  VMGINLNIPISLSLLLNYCGKQVPTGYEC  139



>ref|XP_004516837.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=135

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 51/87 (59%), Gaps = 10/87 (11%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKN-IDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------L  226
            +CP+  ++L +C  +L   I +++    S    PCC  LEGL +L+V VCLC       L
Sbjct  51   SCPRDALQLGVCANLLNGPIGAVI---GSPPEHPCCSVLEGLLDLEVAVCLCTAIKANIL  107

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             +  NI +S+S++ +AC + PP+ ++C
Sbjct  108  GININIPISLSLILNACEKTPPSNYQC  134



>gb|KHN04344.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=115

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 50/87 (57%), Gaps = 10/87 (11%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKN-IDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------L  226
            +CP+  ++L +C  +L   I +I+    S    PCC  LEGL +L+V VCLC       L
Sbjct  31   SCPRDALKLGVCANVLNGPIGAIV---GSPPDHPCCSVLEGLLDLEVAVCLCTAIKANIL  87

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             +  NI +S+S++ +AC + PP+ F C
Sbjct  88   GINLNIPISLSLILNACEKSPPSDFLC  114



>ref|XP_008646032.1| PREDICTED: cortical cell-delineating protein-like [Zea mays]
 gb|AFW72681.1| cortical cell-delineating protein [Zea mays]
Length=126

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +  +  A+PCC  LEGL +L+   CLC       L +
Sbjct  45   CPRDALKLGVCANVLGLIKA---KVGAPPAEPCCPLLEGLVDLEAAACLCTAIKGNILGI  101

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ V +S++ + CG+  P GFKC
Sbjct  102  NLNLPVDLSLILNYCGRTVPTGFKC  126



>ref|XP_002880164.1| hypothetical protein ARALYDRAFT_483654 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56423.1| hypothetical protein ARALYDRAFT_483654 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 9/85 (11%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP   ++L +C  +L  ++ ++     T   PCC  L+GL NL+  VCLC       L 
Sbjct  51   TCPTDTLKLGVCAELLGLVNLVVGSPPKT---PCCTLLQGLANLEAAVCLCTALKANVLG  107

Query  222  VRTNINVSISILSDACGQKPPNGFK  148
            +  N+ V +S+L + CG+K P GF+
Sbjct  108  INLNVPVDLSLLLNYCGKKLPYGFQ  132



>ref|XP_009375766.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=142

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  ++L +C  +L ++ +I+    +    PCC  + GLT+L+  VCLC       L 
Sbjct  58   SCPKDTLKLGVCGDLLNDLVTIV--VGTPPKTPCCSLIGGLTDLEAAVCLCTAIKANVLG  115

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  ++ VS+S+L + CG+  P GF+C
Sbjct  116  INLDVPVSLSLLLNYCGKSVPKGFQC  141



>ref|XP_004291444.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=133

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 9/87 (10%)
 Frame = -2

Query  387  DTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------L  226
            + CPK  ++L +C  +L  ++    +  S    PCC  L+GLT+L+  +CLC       L
Sbjct  49   EKCPKDTLKLGVCADLLGLVNL---QIGSPPTTPCCSLLKGLTDLEAALCLCTALKANVL  105

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             +  N+ +S+S+L  AC +  P+GF+C
Sbjct  106  GINLNVPISLSVLVSACQKSVPSGFQC  132



>ref|XP_004976456.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=129

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +      +PCC  LEGL +LQ  VCLC       L +
Sbjct  47   CPRDALKLGVCANVLGLIKA---KIGVPPTEPCCPLLEGLVDLQAAVCLCTAIKGNILGI  103

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ + +S++ + CG+  P GFKC
Sbjct  104  NLNLPIDVSLILNHCGKTVPTGFKC  128



>ref|NP_001047650.1| Os02g0662000 [Oryza sativa Japonica Group]
 gb|AAA65513.1| RCc3 [Oryza sativa Japonica Group]
 dbj|BAD25630.1| root-specific protein RCc3 [Oryza sativa Japonica Group]
 dbj|BAD27673.1| root-specific protein RCc3 [Oryza sativa Japonica Group]
 dbj|BAF09564.1| Os02g0662000 [Oryza sativa Japonica Group]
 gb|EAY86972.1| hypothetical protein OsI_08366 [Oryza sativa Indica Group]
 gb|EAZ24089.1| hypothetical protein OsJ_07827 [Oryza sativa Japonica Group]
 dbj|BAG98613.1| unnamed protein product [Oryza sativa Japonica Group]
Length=133

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +     A+PCC  LEGL +L+  VCLC       L +
Sbjct  52   CPRDALKLGVCANVLGLIKA---KVGVPPAEPCCPLLEGLVDLEAAVCLCTAIRGNILGI  108

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ + +S++ + CG+  P GFKC
Sbjct  109  NLNLPIDLSLILNYCGKTVPTGFKC  133



>emb|CAA59472.1| hybrid proline-rich protein [Catharanthus roseus]
Length=138

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L +C  +L  + S +    +    PCC  +EGL +L+  VCLC       L 
Sbjct  54   TCPRDALKLGVCADLLGGLISAV--IGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVLG  111

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+S+L + C +K P GF C
Sbjct  112  INLNVPVSLSLLLNVCSKKVPEGFIC  137



>ref|XP_009333630.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=135

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 48/86 (56%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L  + +I         +PCC  ++GL +++  VCLC       L 
Sbjct  51   SCPRDTLKLGVCANVLNGLLNI--SVGKPPVEPCCSLIQGLADIEAAVCLCTALKANILG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +S+S+L + CG K P GF+C
Sbjct  109  INLNIPISLSLLLNVCGNKVPKGFQC  134



>ref|XP_009626056.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP   ++L +C  +L  +++++    S    PCC  L GL N++  +CLC       L 
Sbjct  45   TCPIDTLKLGVCADVLGLVNAVI---GSPPVTPCCSLLSGLANVEAALCLCTAIKANILG  101

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + C ++ P+GF+C
Sbjct  102  INLNVPISLSLLLNVCSKEAPSGFQC  127



>gb|AAX20042.1| proline-rich protein [Capsicum annuum]
Length=136

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 9/87 (10%)
 Frame = -2

Query  387  DTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------L  226
            +TCP   ++L +C  +L  +++++    S    PCC  L GL N +  +CLC       L
Sbjct  52   ETCPIDTLKLGVCADVLGLVNAVI---GSPPVTPCCSLLSGLANAEAALCLCTAIKANIL  108

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             +  N+ VS+S+L + C ++ P GF+C
Sbjct  109  GINLNVPVSLSLLLNVCSKEAPAGFQC  135



>ref|NP_001237995.1| uncharacterized protein LOC100305616 precursor [Glycine max]
 gb|ACU13392.1| unknown [Glycine max]
Length=137

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 50/87 (57%), Gaps = 10/87 (11%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKN-IDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------L  226
            +CP+  ++L +C  +L   I +I+    S    PCC  LEGL +L+V VCLC       L
Sbjct  53   SCPRDALKLGVCANVLNGPIGAIV---GSPPDHPCCSVLEGLLDLEVAVCLCTAIKANIL  109

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             +  NI +S+S++ +AC + PP+ F C
Sbjct  110  GINLNIPISLSLILNACEKSPPSDFLC  136



>emb|CDP12555.1| unnamed protein product [Coffea canephora]
 emb|CDP12557.1| unnamed protein product [Coffea canephora]
Length=120

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 46/87 (53%), Gaps = 11/87 (13%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAK-PCCRRLEGLTNLQVGVCLCK------L  226
            TCPK  ++  IC     N+ S++  F       PCC  L+GL +L   VCLCK      L
Sbjct  37   TCPKDALKFGICA----NLLSVIGIFGGPLITIPCCSLLDGLVDLNAAVCLCKAIKGNIL  92

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             +  N+ +S+++  +ACG+  P GF C
Sbjct  93   GIHFNLPLSLAVSMNACGRHTPPGFIC  119



>ref|XP_003608746.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES90943.1| protease inhibitor/seed storage/LTP family protein [Medicago 
truncatula]
 gb|AFK36641.1| unknown [Medicago truncatula]
Length=134

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L     I     S    PCC  LEGL +L+V VCLC       L 
Sbjct  50   SCPRDALKLGVCANLLNG--PIGAVIGSPPEHPCCSILEGLVDLEVAVCLCTAIKANILG  107

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +S+S++ +AC + PP  F+C
Sbjct  108  IDINIPISLSLILNACEKTPPTDFQC  133



>ref|XP_008796819.1| PREDICTED: lipid transfer protein EARLI 1-like [Phoenix dactylifera]
Length=125

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 46/85 (54%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L  + ++     +   KPCC  L+GL +L V +CLC       L +
Sbjct  42   CPMNALKLGVCANVLNGLINL--NLGNPSKKPCCTLLQGLADLDVALCLCTALKANILGI  99

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI + +S+L + CG+  P GF+C
Sbjct  100  NLNIPIDLSLLINYCGKNVPTGFQC  124



>ref|XP_009134276.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
Length=127

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 49/89 (55%), Gaps = 9/89 (10%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
             + TCPK  ++L +C   L  ++  L    +   KPCC  ++GL +L+  VCLC      
Sbjct  41   AIQTCPKDTVKLGVCVNALNLLNVTL---GAPPVKPCCSLIDGLVDLEAAVCLCTALKAS  97

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  N+ +++S+L + C +K P GF+C
Sbjct  98   ILGININLPINLSLLLNVCSRKAPRGFQC  126



>ref|XP_006353678.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=129

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 10/86 (12%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCKL-------Q  223
            CP+  ++L +C  +L  ++       S    PCC  LEGL +L+V  CLC          
Sbjct  46   CPRDTLKLGVCGDLLGLVNV---AIGSQVTTPCCSLLEGLADLEVAACLCTAIKANVLGI  102

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            ++ +I V++S L  AC +K P GFKC
Sbjct  103  IKLDIPVALSALVSACAKKVPTGFKC  128



>ref|NP_001237899.1| uncharacterized protein LOC100527818 precursor [Glycine max]
 gb|ACU17007.1| unknown [Glycine max]
 gb|KHN09797.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=135

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 50/87 (57%), Gaps = 10/87 (11%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKN-IDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------L  226
            +CP+  ++L +C  +L   I +I+    S    PCC  LEGL +L+V VCLC       L
Sbjct  51   SCPRDALKLGVCANVLNGPIGAIV---GSPPDHPCCSVLEGLLDLEVAVCLCTAIKANIL  107

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             +  NI +S+S++ +AC + PP+ F C
Sbjct  108  GINLNIPISLSLILNACEKSPPSDFLC  134



>ref|NP_001152585.1| LOC100286225 precursor [Zea mays]
 gb|ACG48364.1| cortical cell-delineating protein precursor [Zea mays]
Length=125

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +  +  A+PCC  LEGL +L+   CLC       L +
Sbjct  44   CPRDALKLGVCANVLGLIKA---KVGAPPAEPCCPLLEGLVDLEAAACLCTAIKGNILGI  100

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ V +S++ + CG+  P GFKC
Sbjct  101  NLNLPVDLSLILNYCGRTVPXGFKC  125



>ref|XP_004976453.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=131

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +      +PCC  LEGL +LQ  VCLC       L +
Sbjct  49   CPRDALKLGVCTNVLGLIKA---KVGVPPTEPCCPLLEGLVDLQAAVCLCTAIKGNILGI  105

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ + +S++ + CG+  P GFKC
Sbjct  106  NLNLPIDVSLILNHCGKTVPTGFKC  130



>ref|XP_006286641.1| hypothetical protein CARUB_v10002511mg [Capsella rubella]
 gb|EOA19539.1| hypothetical protein CARUB_v10002511mg [Capsella rubella]
Length=110

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  +++ +C  +L  +D  L    +   +PCC  ++GL +L+  VCLC       L 
Sbjct  27   TCPRDALKIGVCVSVLNIVDLTL---GNPPVQPCCSLIQGLADLEAAVCLCTALKASVLG  83

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +++S+L + CG+K P  F+C
Sbjct  84   INLNLPINLSVLLNVCGRKAPTNFQC  109



>ref|XP_002271461.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=132

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 48/85 (56%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L ++   +    +    PCC  + GL +L+  VCLC       L +
Sbjct  49   CPKDTLKLGVCADLLNDLLHAV--VGTPPKSPCCSLIGGLADLEAAVCLCTAIKANVLGI  106

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + N+ VS+S+L + CG+K P G++C
Sbjct  107  KLNVPVSLSLLLNYCGKKVPTGYQC  131



>ref|NP_001238461.1| uncharacterized protein LOC100499693 precursor [Glycine max]
 gb|ACU13264.1| unknown [Glycine max]
 gb|AEM45873.1| proline-rich protein [Glycine max]
Length=131

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (55%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  I+  +C  +L  I+  L +   T   PCC  +EGL +L+  VCLC       L 
Sbjct  48   SCPKDTIKFGVCADVLGLINVQLGKPPKT---PCCNLIEGLADLEAAVCLCTALKANVLG  104

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ V++S+L + CG+  P GF C
Sbjct  105  INLNVPVNLSLLLNYCGKGVPKGFVC  130



>ref|XP_008238566.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=136

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 50/87 (57%), Gaps = 10/87 (11%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKN-IDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------L  226
            +CP+  ++L +C  +LK  + +I+     T   PCC  LEGL +L+V VCLC       L
Sbjct  52   SCPRDALKLGVCANLLKGAVGAIIGNPPDT---PCCALLEGLLDLEVAVCLCTAIKANIL  108

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             +  NI +++S++ D C +  P GF+C
Sbjct  109  GINLNIPIALSLVIDGCAKTFPPGFQC  135



>ref|XP_009133710.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
 emb|CDX83396.1| BnaA03g21100D [Brassica napus]
Length=131

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 48/89 (54%), Gaps = 9/89 (10%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            V  TCP   ++L +C  +L  ++ ++    S    PCC  L GL N++  VCLC      
Sbjct  45   VKPTCPTDTLKLGVCADLLGLVNVLV---GSPPKTPCCALLNGLANVEAAVCLCTALKAN  101

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  N+ V +S+L + CG+K P GF+C
Sbjct  102  VLGINLNVPVDLSLLLNYCGKKLPYGFQC  130



>ref|XP_008381149.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008365739.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=136

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L    ++     +    PCC  LEGL +L+V VCLC       L 
Sbjct  52   SCPRDSLKLGVCAKLLNG--AVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILG  109

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +++S++ D C +  P GFKC
Sbjct  110  INLNIPIALSLVIDGCAKNVPEGFKC  135



>ref|NP_001152584.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG48357.1| cortical cell-delineating protein precursor [Zea mays]
Length=131

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +     A+PCC  LEGL +L+  VCLC       L +
Sbjct  50   CPRDALKLGVCANVLGLIKA---KVGVPPAEPCCPLLEGLVDLEAAVCLCTAIKGQILGI  106

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ + +S++ + CG+  P GFKC
Sbjct  107  NLNLPIDLSLILNYCGRTVPTGFKC  131



>ref|XP_009333597.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=145

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  + +I     +   +PCC  ++GL +L+  VCLC       L +
Sbjct  62   CPRDTLKLGVCANVLNGLLNI--TVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRANILGI  119

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI +S+S+L + CG K P GF+C
Sbjct  120  NLNIPLSLSLLLNVCGNKVPKGFQC  144



>ref|XP_009376589.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009376590.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L    ++     +    PCC  LEGL +L+V VCLC       L 
Sbjct  52   SCPRDSLKLGVCAKLLNG--AVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILG  109

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +++S++ D C +  P GFKC
Sbjct  110  INLNIPIALSLVIDGCAKNVPEGFKC  135



>ref|XP_010055513.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=132

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (58%), Gaps = 10/88 (11%)
 Frame = -2

Query  387  DTCPKRKIELTICEIILKN-IDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------  229
             +CP+  ++L +C  +L   +++I+    +    PCC  LEGL +L+  VCLC       
Sbjct  47   SSCPRDALKLGVCAKVLDGPVNAII---GTPPDMPCCSVLEGLLDLEAAVCLCTAIKANI  103

Query  228  LQVRTNINVSISILSDACGQKPPNGFKC  145
            L +  NI +S+S+L + CG+  P+GF+C
Sbjct  104  LGINLNIPISLSLLINTCGKNVPSGFQC  131



>gb|AFW63295.1| cortical cell-delineating protein [Zea mays]
Length=131

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +     A+PCC  LEGL +L+  VCLC       L +
Sbjct  50   CPRDALKLGVCANVLGLIKA---KVGVPPAEPCCPLLEGLVDLEAAVCLCTAIKGQILGI  106

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ + +S++ + CG+  P GFKC
Sbjct  107  NLNLPIDLSLILNYCGRTVPTGFKC  131



>ref|XP_010933689.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=134

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 46/85 (54%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L  + ++         KPCC  L+GL +L+  VCLC       L +
Sbjct  51   CPMDALKLGVCANVLNGLINV--HLGRPPKKPCCSLLDGLVDLEAAVCLCTALKANVLGI  108

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + N+ + +S+L + CG+  P GF+C
Sbjct  109  KLNLPIHLSLLLNYCGKNTPKGFQC  133



>emb|CDX79156.1| BnaA01g12230D [Brassica napus]
Length=135

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 47/86 (55%), Gaps = 6/86 (7%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCPK  ++L +C   L  ++   P   +    PCC  ++GL +L+  VCLC       L 
Sbjct  49   TCPKDTLKLGVCVNALNLLNDDGPALGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVLG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +++S+L + C +K P GF+C
Sbjct  109  ININLPINLSLLLNVCKRKSPPGFQC  134



>ref|XP_009333632.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L    ++     +    PCC  LEGL +L+V VCLC       L 
Sbjct  52   SCPRDSLKLGVCAKLLNG--AVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILG  109

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +++S++ D C +  P GFKC
Sbjct  110  INLNIPIALSLVIDGCAKNVPEGFKC  135



>ref|XP_006841163.1| hypothetical protein AMTR_s00086p00157840 [Amborella trichopoda]
 gb|ERN02838.1| hypothetical protein AMTR_s00086p00157840 [Amborella trichopoda]
Length=140

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L +C  +L  +  ++    S     CC  L GL +L V VCLC       L 
Sbjct  56   TCPRDALKLDVCADLLGGLVHLV--VGSGARSRCCTLLSGLADLDVAVCLCIAIRANILG  113

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI V++S+L + CG+  PNGF+C
Sbjct  114  INLNIPVALSLLVNQCGRTLPNGFQC  139



>gb|AFK43955.1| unknown [Lotus japonicus]
Length=128

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L  C  +L  ++ +L    S+    CC  LEGL +L+  VCLC       L +
Sbjct  46   CPKDTLKLGACADLLGLVNVVLGSPASS---KCCALLEGLADLEAAVCLCTAVKANVLGI  102

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ V++S+L  AC +  P+GF+C
Sbjct  103  NLNVPVTLSVLLSACQKTVPSGFQC  127



>ref|XP_010258988.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=126

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  ++L +C  +L    +I     +    PCC  LEGL +L+V  CLC       L 
Sbjct  42   SCPKDALKLGVCAKLLNG--AIGAEVGNPPDHPCCALLEGLVDLEVAACLCTAIKANILG  99

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  +I +S+S+L + CG+K P+ F C
Sbjct  100  INLDIPISLSLLVNTCGKKLPSDFLC  125



>ref|XP_010458632.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 48/89 (54%), Gaps = 16/89 (18%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKP----CCRRLEGLTNLQVGVCLCK-----  229
            CPK  ++  +C+ +LK +      F  T  KP    CC  ++GL NL+  VCLC      
Sbjct  60   CPKDTLKFAVCDNVLKTV------FHYTLGKPPVEPCCSLIQGLANLEAAVCLCTALKAN  113

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  ++ +++S+L + C ++ P GF+C
Sbjct  114  VLGINLDVPITLSLLLNVCSKELPPGFQC  142



>ref|XP_006396747.1| hypothetical protein EUTSA_v10029313mg [Eutrema salsugineum]
 gb|ESQ38200.1| hypothetical protein EUTSA_v10029313mg [Eutrema salsugineum]
Length=129

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 50/88 (57%), Gaps = 9/88 (10%)
 Frame = -2

Query  390  VDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------  229
            ++TCPK  ++L +C   L  ++  L    +   +PCC  ++GL +L+  VCLC       
Sbjct  44   IETCPKDALKLGVCVNALNLLNVTL---GAPPVQPCCSLIDGLVDLEAAVCLCTALKASI  100

Query  228  LQVRTNINVSISILSDACGQKPPNGFKC  145
            L +  N+ +++S+L + C +K P GF+C
Sbjct  101  LGININLPINLSLLLNVCSRKAPRGFQC  128



>ref|XP_010906608.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=129

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L  + ++     +   +PCC  L GL +L+  VCLC       L +
Sbjct  46   CPIDALKLGVCADVLSGLLNV--TIGTPPKEPCCSLLSGLVDLEAAVCLCTAIKANILGI  103

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI V +S+L + CG+K P+GF+C
Sbjct  104  NLNIPVDLSLLLNYCGKKVPSGFQC  128



>ref|XP_009333675.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=153

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  + +I     +   +PCC  ++GL +L+  VCLC       L +
Sbjct  70   CPRDTLKLGVCANVLNGLLNI--TVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRANILGI  127

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI +S+S+L + CG K P GF+C
Sbjct  128  NLNIPLSLSLLLNVCGNKVPRGFQC  152



>ref|XP_009795308.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=132

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 50/85 (59%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L N+  ++    +   KPCC  ++G+ +L+  VCLC       L +
Sbjct  49   CPIDTLKLGVCANVLGNLLGLV--IGNPPKKPCCTLIQGVADLEAAVCLCTAIKANILGI  106

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + CG+K P+GF+C
Sbjct  107  NLNVPLSLSLLLNVCGKKVPSGFQC  131



>ref|XP_008392579.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=136

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L    ++     +    PCC  LEGL  L+V VCLC       L 
Sbjct  52   SCPRDSLKLGVCAKLLNR--AVGAVVGNPPDHPCCALLEGLVELEVAVCLCTAIKANILG  109

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +++S++ D C +  P+GFKC
Sbjct  110  INLNIPIALSLIIDGCAKNVPSGFKC  135



>ref|XP_006579357.1| PREDICTED: uncharacterized protein LOC100499693 isoform X1 [Glycine 
max]
Length=131

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  I+  +C  +L  I+  L +   T   PCC  ++GL +L+  VCLC       L 
Sbjct  48   SCPKDTIKFGVCADVLGLINVQLGKPPKT---PCCNLIQGLADLEAAVCLCTALKANVLG  104

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ V++S+L + CG+  P GF C
Sbjct  105  INLNVTVNLSLLLNYCGKGVPKGFVC  130



>ref|XP_006369032.1| HyPRP family protein [Populus trichocarpa]
 gb|ERP65601.1| HyPRP family protein [Populus trichocarpa]
Length=132

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L ++ ++     +   +PCC  ++GL +L+  VCLC       L +
Sbjct  49   CPKDALKLGVCADLLGSLLNV--TVGTPPVEPCCSLIQGLLDLEAAVCLCTAIKANILGI  106

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI VS+S+L + CG+K P  F+C
Sbjct  107  NLNIPVSLSLLLNVCGKKVPKDFQC  131



>ref|XP_002874775.1| hypothetical protein ARALYDRAFT_490053 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51034.1| hypothetical protein ARALYDRAFT_490053 [Arabidopsis lyrata subsp. 
lyrata]
Length=168

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L ++ +I  +     A+PCC  ++GL +L   +CLC       L +
Sbjct  85   CPIDALKLGVCANVLSSLLNI--QLGQPSAQPCCSLIQGLVDLDAAICLCTALRANVLGI  142

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + C +K P+GF+C
Sbjct  143  NLNVPISLSVLLNVCNRKVPSGFQC  167



>gb|KFK31980.1| hypothetical protein AALP_AA6G184800 [Arabis alpina]
Length=166

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 50/85 (59%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L  + +I  +     ++PCC  ++GL +L+  VCLC       L +
Sbjct  83   CPIDALKLGVCANVLSGLLNI--QLGQQSSQPCCSLVQGLVDLEAAVCLCTALRANILGI  140

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L +AC +K P+GF+C
Sbjct  141  NLNVPISLSLLLNACNKKRPSGFEC  165



>ref|XP_002533293.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29087.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=136

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +LK++ S+          PCC  +  L +L+  VCLC       L +
Sbjct  53   CPKDTLKLGVCVDLLKDLLSV--TIGKPPKSPCCSLIGDLVDLEAAVCLCTTIKASLLGI  110

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ V +S+L + CG+K P GFKC
Sbjct  111  NLNVPVDLSLLLNYCGKKVPEGFKC  135



>dbj|BAA11854.1| extensin like protein [Populus nigra]
 dbj|BAA11855.1| extensin like protein [Populus nigra]
Length=141

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L ++ ++     +   KPCC  ++GL +L+  VCLC       L +
Sbjct  58   CPKDALKLGVCADLLGSLLNV--TVGTPPVKPCCSVIQGLLDLEAAVCLCTAIKANILGI  115

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI +S+S+L + CG+K P  F+C
Sbjct  116  NLNIPLSLSLLLNVCGKKVPKDFQC  140



>gb|KDP25645.1| hypothetical protein JCGZ_20801 [Jatropha curcas]
Length=138

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L ++ +I         KPCC  LEGL +L+  VCLC       L +
Sbjct  55   CPRDALKLGVCAKVLGSLLNI--TIGDPPVKPCCSLLEGLVDLEAAVCLCTAIKANILGI  112

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + C +K P+ F+C
Sbjct  113  NLNVPLSLSLLLNVCSKKVPSDFQC  137



>ref|XP_008786990.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=127

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L  + ++         KPCC  ++GL +L+  VCLC       L +
Sbjct  44   CPIDTLKLGVCANVLNGLINL--NLGKPPKKPCCSLIKGLADLEAAVCLCTALKANILGI  101

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + NI V +S+L + CG+K P GF+C
Sbjct  102  KLNIPVDLSLLINYCGKKVPTGFQC  126



>ref|XP_010493717.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
 ref|XP_010476165.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 48/89 (54%), Gaps = 16/89 (18%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKP----CCRRLEGLTNLQVGVCLCK-----  229
            CPK  ++  +C+ +LK +      F  T  KP    CC  ++GL NL+  VCLC      
Sbjct  60   CPKDTLKFAVCDNVLKTV------FHYTLGKPPVEPCCSLIQGLANLEAAVCLCTALKAN  113

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  ++ +++S+L + C ++ P GF+C
Sbjct  114  VLGINLDLPITLSLLLNVCSKELPPGFQC  142



>ref|XP_009600481.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=170

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 46/85 (54%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  +  ++     T   PCC  + GL +L+  VCLC       L +
Sbjct  88   CPRDALKLGVCANLLGGLVGVIVGSPPTL--PCCSLIAGLADLEAAVCLCTAIRANVLGI  145

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S++ + CG+ PP GF C
Sbjct  146  NLNVPLSLSLVLNNCGRNPPTGFTC  170



>dbj|BAA13150.1| NT16 polypeptide [Nicotiana tabacum]
Length=170

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 46/85 (54%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  +  ++     T   PCC  + GL +L+  VCLC       L +
Sbjct  88   CPRDALKLGVCANLLGGLVGVIVGSPPTL--PCCSLIAGLADLEAAVCLCTAIRANVLGI  145

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S++ + CG+ PP GF C
Sbjct  146  NLNVPLSLSLVLNNCGRNPPTGFTC  170



>ref|XP_006396746.1| hypothetical protein EUTSA_v10029045mg [Eutrema salsugineum]
 gb|ESQ38199.1| hypothetical protein EUTSA_v10029045mg [Eutrema salsugineum]
Length=147

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  +++ +C  +LK +D  L    +   KPCC  +EGL +L+  VCLC       L 
Sbjct  64   SCPRDALKIGLCANVLKLVDLTL---GNPPVKPCCTLIEGLADLEAAVCLCTALKANILG  120

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + C ++ P  F+C
Sbjct  121  INLNLPISLSVLLNVCSREAPKDFQC  146



>emb|CAA81526.1| 14 kDa polypeptide [Catharanthus roseus]
Length=138

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L +C  +L  + S +    +    PCC  +EGL +L+  VCLC       L 
Sbjct  54   TCPRDALKLGVCADLLGGLISAV--IGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVLG  111

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+++L + C +K P GF C
Sbjct  112  INLNVPVSLTLLLNVCSKKVPEGFIC  137



>ref|XP_004976454.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=127

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 46/85 (54%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +      +PCC  LEGL +L+  VCLC       L +
Sbjct  45   CPRDALKLGVCANVLGLIKA---KVGVPPTEPCCPLLEGLVDLEAAVCLCTAIKGNILGI  101

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ + +S++ + CG+  P GFKC
Sbjct  102  NLNLPIDVSLILNHCGKTVPTGFKC  126



>ref|XP_010055514.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW71995.1| hypothetical protein EUGRSUZ_E00448 [Eucalyptus grandis]
Length=135

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
             CP+  ++L +C  +L N+ ++          PCC  L GL +L+  VCLC       L 
Sbjct  51   ACPRDALKLGVCADVLGNLLNV--TVGKPPVTPCCSLLNGLVDLEAAVCLCTAIKANILG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +S+S+L + C ++ P GFKC
Sbjct  109  INLNIPISLSLLLNVCSKQVPPGFKC  134



>ref|XP_008663526.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Zea mays]
 gb|AFW59244.1| hypothetical protein ZEAMMB73_930140 [Zea mays]
Length=128

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 48/85 (56%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +      +PCC  L+GL +L+  VCLC       L +
Sbjct  46   CPRDALKLGVCANVLGLIKA---KVGVPPTEPCCPLLKGLVDLEAAVCLCTAIKGEVLGI  102

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + N+ V +S++ + CG++ P GFKC
Sbjct  103  KLNLPVDLSLILNHCGKRVPTGFKC  127



>ref|XP_009795761.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Nicotiana sylvestris]
Length=146

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 46/85 (54%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  ++  +   +     T   PCC  + GL +L+  VCLC       L +
Sbjct  64   CPRDALKLGVCASLVGGLVGAVIGTPPTM--PCCSLITGLADLEAAVCLCTAIRANVLGI  121

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S++ + CG+ PPNGF C
Sbjct  122  NLNVPLSLSLVLNNCGRNPPNGFTC  146



>ref|XP_006652622.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Oryza brachyantha]
Length=124

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +     A+PCC  L+GL +L+   CLC       L +
Sbjct  42   CPRDALKLGVCANVLGLIKA---KVGVPPAEPCCPLLDGLVDLEAAACLCTAIRGNVLGI  98

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ V +S++ + CG++ P GFKC
Sbjct  99   NLNLPVDLSLILNYCGKRVPTGFKC  123



>ref|NP_192985.1| putative lipid transfer protein [Arabidopsis thaliana]
 sp|Q39176.1|ERLI1_ARATH RecName: Full=Lipid transfer protein EARLI 1; AltName: Full=Protein 
EARLY ARABIDOPSIS ALUMINUM INDUCED 1; Short=pEARLI1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL06564.1|AF412111_1 AT4g12480/T1P17_70 [Arabidopsis thaliana]
 gb|AAC37471.1| pEARLI 1 [Arabidopsis thaliana]
 emb|CAB41718.1| pEARLI 1 [Arabidopsis thaliana]
 emb|CAB78291.1| pEARLI 1 [Arabidopsis thaliana]
 gb|AAM91484.1| AT4g12480/T1P17_70 [Arabidopsis thaliana]
 dbj|BAF02055.1| pEARLI 1 [Arabidopsis thaliana]
 gb|AEE83138.1| putative lipid transfer protein [Arabidopsis thaliana]
Length=168

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 48/85 (56%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   + L +C  +L ++ +I  +     A+PCC  ++GL +L   +CLC       L +
Sbjct  85   CPIDALRLGVCANVLSSLLNI--QLGQPSAQPCCSLIQGLVDLDAAICLCTALRANVLGI  142

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + C +K P+GF+C
Sbjct  143  NLNVPISLSVLLNVCNRKVPSGFQC  167



>ref|XP_009795760.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Nicotiana sylvestris]
Length=158

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 46/85 (54%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  ++  +   +     T   PCC  + GL +L+  VCLC       L +
Sbjct  76   CPRDALKLGVCASLVGGLVGAVIGTPPTM--PCCSLITGLADLEAAVCLCTAIRANVLGI  133

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S++ + CG+ PPNGF C
Sbjct  134  NLNVPLSLSLVLNNCGRNPPNGFTC  158



>ref|XP_004516836.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=157

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP   ++L +C  +L  + +I  +       PCC  LEGLT+LQ   CLC       L 
Sbjct  73   SCPSDTLKLGVCANVLNGLLNI--KLGQPPVAPCCSLLEGLTDLQAAACLCTALKANILG  130

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + C +K P  F+C
Sbjct  131  INLNLPISLSLLLNVCSKKVPRDFQC  156



>ref|NP_001235642.1| uncharacterized protein LOC100500016 precursor [Glycine max]
 gb|ACU14605.1| unknown [Glycine max]
Length=137

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L  +++ L +   T   PCC  L+GL +L+  VCLC       L 
Sbjct  53   SCPRDALKLGVCANVLNLVNATLGQPPVT---PCCSLLDGLADLEAAVCLCTALKANILG  109

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + C +K P  F+C
Sbjct  110  INLNLPISLSLLLNVCSRKAPRDFQC  135



>ref|XP_011039660.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=123

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 48/89 (54%), Gaps = 15/89 (17%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSIL---PRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            TCPK  ++L +C  +L  ++ +    PR +      CC  LEGL +++V +CLC      
Sbjct  41   TCPKDTLKLGVCADLLGPVNVVAGTPPRSK------CCSLLEGLADMEVALCLCTAIKAN  94

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L    N+ V++S +  ACG+  P GF+C
Sbjct  95   VLGTNLNVPVALSAIVSACGKSIPPGFQC  123



>ref|XP_007052129.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96286.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=139

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L ++  ++    +    PCC  ++GL +L+  VCLC       L 
Sbjct  55   SCPRDTLKLGVCANVLNDLIHLV--VGTPPKTPCCPLIQGLADLEAAVCLCTAIKANILG  112

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ VS+S+L + CG+  P GF+C
Sbjct  113  INLNVPVSLSLLLNYCGKNVPKGFQC  138



>ref|XP_006600137.1| PREDICTED: uncharacterized protein LOC100500016 isoform X1 [Glycine 
max]
 gb|KHN09802.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=137

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L  +++ L +   T   PCC  L+GL +L+  VCLC       L 
Sbjct  53   SCPRDALKLGVCANVLNLVNATLGQPPVT---PCCSLLDGLVDLEAAVCLCTALKANILG  109

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + C +K P  F+C
Sbjct  110  INLNLPISLSLLLNVCSRKAPRDFQC  135



>ref|XP_009801825.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=133

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 48/85 (56%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L  +++++    S    PCC  L GL N++  +CLC       L +
Sbjct  51   CPIDTLKLGVCADVLGLVNAVI---GSPPVAPCCSLLSGLANVEAALCLCSAIKANILGI  107

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + C ++ P+GF+C
Sbjct  108  NLNVPISLSLLLNVCSKEAPSGFQC  132



>ref|NP_001275620.1| uncharacterized protein LOC102590907 precursor [Solanum tuberosum]
 gb|AFW90552.1| 14 kDa proline-rich protein [Solanum tuberosum]
Length=133

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 9/87 (10%)
 Frame = -2

Query  387  DTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------L  226
            +TCP   ++L +C  +L  ++ I+    S    PCC  L GL N +  +CLC       L
Sbjct  49   ETCPIDTLKLGVCADVLGLVNVIV---GSPPVTPCCSLLSGLANAEAAICLCTALKANIL  105

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             +  N+ +S+S+L + C ++ P GF+C
Sbjct  106  GINLNLPISLSLLLNVCSKEAPAGFQC  132



>gb|AFK37038.1| unknown [Lotus japonicus]
Length=132

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  I+L +C  +L  I+  L +   T   PCC  LEGL +L+  VCLC       L 
Sbjct  49   SCPRDTIKLGVCADVLGLINVQLGKPPKT---PCCSLLEGLVDLEAAVCLCTALKANVLG  105

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +++S++ + CG+  P GF C
Sbjct  106  INLNLPINLSLILNYCGKGVPKGFVC  131



>gb|KHN09805.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=131

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  I+  +C  +L  I+  L +   T   PCC  ++GL +L+  VCLC       L 
Sbjct  48   SCPKDTIKFGVCADVLGLINVQLGKPPKT---PCCNLIQGLADLEAAVCLCTALKANVLG  104

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ V++S+L + CG+  P GF C
Sbjct  105  INLNVPVNLSLLLNYCGKGVPKGFVC  130



>emb|CAN77080.1| hypothetical protein VITISV_025477 [Vitis vinifera]
Length=120

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (53%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++  +C  +L  + S++    S  +  CC  LEGL +L+   CLC       L +
Sbjct  37   CPRDTLKFGVCADLLGGLVSLVAG--SPPSSKCCAVLEGLADLEAAACLCTAIKASVLGI  94

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
               + V+IS+L  ACG+  P GFKC
Sbjct  95   NVKVPVAISLLISACGKSIPXGFKC  119



>ref|XP_008448871.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=134

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 52/90 (58%), Gaps = 10/90 (11%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKN-IDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK----  229
            VV +CP+  ++L +C  +L   + +++    +T    CC  L+GL +L+  VCLC     
Sbjct  47   VVKSCPRDALKLGVCTKLLNGPVSALVGSLPNT---QCCSLLDGLIDLEAAVCLCTAIKA  103

Query  228  --LQVRTNINVSISILSDACGQKPPNGFKC  145
              L +  NI +S+S+L + CG+K P+ F+C
Sbjct  104  NVLGININIPISLSLLVNVCGKKVPSEFQC  133



>ref|NP_001235888.1| uncharacterized protein LOC100500033 precursor [Glycine max]
 gb|ACU14667.1| unknown [Glycine max]
Length=131

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 48/88 (55%), Gaps = 9/88 (10%)
 Frame = -2

Query  390  VDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------  229
            + +CPK  I+  +C  +L  I+  L +   T   PCC  ++GL +L+  VCLC       
Sbjct  46   LASCPKDTIKFGVCADVLGLINVQLGKPPKT---PCCNLIQGLADLEAAVCLCTALKANV  102

Query  228  LQVRTNINVSISILSDACGQKPPNGFKC  145
            L +  N+ V++S+L + CG+  P GF C
Sbjct  103  LGINLNVPVNLSLLLNYCGKGVPKGFVC  130



>ref|XP_004150818.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 ref|XP_004163648.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN55887.1| hypothetical protein Csa_3G027210 [Cucumis sativus]
Length=136

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 52/90 (58%), Gaps = 10/90 (11%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKN-IDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK----  229
            VV +CP+  ++L +C  +L   + +++    +T    CC  L+GL +L+  VCLC     
Sbjct  49   VVKSCPRDALKLGVCTKLLNGPVSALVGSLPNT---QCCSLLDGLIDLEAAVCLCTAIKA  105

Query  228  --LQVRTNINVSISILSDACGQKPPNGFKC  145
              L +  NI +S+S+L + CG+K P+ F+C
Sbjct  106  NVLGININIPISLSLLVNVCGKKVPSEFQC  135



>ref|XP_002271593.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN80709.1| hypothetical protein VITISV_033376 [Vitis vinifera]
 emb|CBI31903.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L    ++     +    PCC  LEGL +L+V  CLC       L 
Sbjct  48   SCPRDALKLGVCAKLLNG--TVGAVVGTPPVTPCCSLLEGLLDLEVAACLCTAIKANILG  105

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  +I VS+S+L + CG+K P  F+C
Sbjct  106  IHLDIPVSLSLLVNICGKKLPKDFQC  131



>ref|XP_010476166.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L  +  +         +PCC  ++GL NL+  VCLC       L +
Sbjct  60   CPKDTLKLGVCANVLNGLLDL--TLGKPPVEPCCSLIQGLANLEAAVCLCTALKANVLGI  117

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + C ++ P+GF+C
Sbjct  118  NLNLPISLSLLLNVCSKQLPSGFQC  142



>ref|NP_001237154.1| uncharacterized protein LOC100500124 precursor [Glycine max]
 gb|ACU15034.1| unknown [Glycine max]
Length=136

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L  ++  L +   T   PCC  L+GL +L+  VCLC       L 
Sbjct  53   SCPRDALKLGVCANVLNLVNVTLGQPPVT---PCCTLLDGLVDLEAAVCLCTALKANILG  109

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L D C +K P  F+C
Sbjct  110  INLNLPISLSLLLDVCSRKVPRDFQC  135



>ref|XP_009801239.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=129

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 44/86 (51%), Gaps = 10/86 (12%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCKL-------Q  223
            CP+  ++L +C  +L  ++       S    PCC  L+GL +L+V  CLC          
Sbjct  46   CPRDTLKLGVCADVLGLVNV---AIGSQVTSPCCSLLQGLADLEVAACLCTAIKANVLGI  102

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            V+ +I V++S L  AC +  P GFKC
Sbjct  103  VKLDIPVALSALVSACAKTIPTGFKC  128



>ref|XP_003549906.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
 gb|KHN09800.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L  +++ L +   T   PCC  L+GL +L+  VCLC       L 
Sbjct  53   SCPRDALKLGVCANVLNLVNATLGQPPVT---PCCTLLDGLVDLEAAVCLCTALKANILG  109

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + C +K P  F+C
Sbjct  110  INLNLPISLSLLLNVCSRKAPRDFQC  135



>ref|XP_002446913.1| hypothetical protein SORBIDRAFT_06g024770 [Sorghum bicolor]
 gb|EES11241.1| hypothetical protein SORBIDRAFT_06g024770 [Sorghum bicolor]
Length=130

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +      +PCC  L+GL NL+  VCLC       L +
Sbjct  48   CPRDALKLGVCANLLGLIKA---KVGVPPTEPCCPLLKGLVNLEAAVCLCTAIKGSILGI  104

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ V +S++ + CG+  P GFKC
Sbjct  105  NLNLPVDLSLILNHCGKTVPTGFKC  129



>gb|AAM63191.1| putative cell wall-plasma membrane disconnecting CLCT protein 
(AIR1A) [Arabidopsis thaliana]
Length=111

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (52%), Gaps = 10/87 (11%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCKLQ------  223
            TCPK  IE+  C  +L  +D  L    +   KPCC  ++GL +L+  VCLC         
Sbjct  27   TCPKNSIEIGTCVTVLNLVDLTL---GNPPVKPCCSLIQGLADLEAAVCLCTALKASILG  83

Query  222  -VRTNINVSISILSDACGQKPPNGFKC  145
             V  N+ +++S+L + C +  P  F+C
Sbjct  84   IVNINLPINLSVLLNVCSRNAPKSFQC  110



>gb|EYU30296.1| hypothetical protein MIMGU_mgv1a015783mg [Erythranthe guttata]
Length=146

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 46/86 (53%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  ++L +C  +L  +  +     S    PCC  +EGL +L+  VCLC       L 
Sbjct  62   TCPRDALKLGVCADLLGGLIGL--TIGSPPKTPCCSLIEGLADLEAAVCLCTAIKANVLG  119

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + C +  P GF+C
Sbjct  120  INLNVPISLSLLLNVCSKNIPPGFQC  145



>ref|XP_004976455.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=123

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 48/87 (55%), Gaps = 11/87 (13%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +      +PCC  LEGL +L+  VCLC       L +
Sbjct  39   CPRDALKLGVCANVLGLIKA---KVGVPPTEPCCPLLEGLVDLEAAVCLCTAIKGNILGI  95

Query  219  RTN--INVSISILSDACGQKPPNGFKC  145
              N  I+VS+S++ + CG+  P GFKC
Sbjct  96   NLNLPIDVSLSLILNHCGKTVPTGFKC  122



>ref|XP_011081229.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L ++  ++    +    PCC  ++GL +L+  VCLC       L  
Sbjct  50   CPKDTLKLGVCANLLNDLVHLV--VGTPPKTPCCTLIKGLADLEAAVCLCTAIKANVLGN  107

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI +S+S+L + CG+K P GF+C
Sbjct  108  DLNIPLSLSLLLNYCGKKVPTGFQC  132



>ref|NP_192992.1| auxin-Induced in Root cultures 1 [Arabidopsis thaliana]
 sp|Q9S7I2.1|AIR1_ARATH RecName: Full=Putative lipid-binding protein AIR1; AltName: Full=Auxin-induced 
in root cultures protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK95273.1|AF410287_1 AT4g12550/T1P17_140 [Arabidopsis thaliana]
 gb|AAD12258.1| putative cell wall-plasma membrane disconnecting CLCT protein 
[Arabidopsis thaliana]
 emb|CAB41725.1| putative cell wall-plasma membrane disconnecting CLCT protein 
(AIR1A) [Arabidopsis thaliana]
 emb|CAB78298.1| putative cell wall-plasma membrane disconnecting CLCT protein 
(AIR1A) [Arabidopsis thaliana]
 gb|AAM10352.1| AT4g12550/T1P17_140 [Arabidopsis thaliana]
 gb|AEE83146.1| auxin-Induced in Root cultures 1 [Arabidopsis thaliana]
Length=111

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (52%), Gaps = 10/87 (11%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCKLQ------  223
            TCPK  IE+  C  +L  +D  L    +   KPCC  ++GL +L+  VCLC         
Sbjct  27   TCPKNSIEIGTCVTVLNLVDLTL---GNPPVKPCCSLIQGLADLEAAVCLCTAVKASILG  83

Query  222  -VRTNINVSISILSDACGQKPPNGFKC  145
             V  N+ +++S+L + C +  P  F+C
Sbjct  84   IVNINLPINLSVLLNVCSRNAPKSFQC  110



>ref|XP_011070106.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=127

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (53%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L  +  I     +    PCC  +EGL +L+  VCLC       L +
Sbjct  44   CPKDTLKLGVCADLLGGLLGI--TIGTPPKTPCCTLIEGLADLEAAVCLCTAIKANILGI  101

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + C +K P GF C
Sbjct  102  NLNVPLSLSLLLNVCSKKVPKGFVC  126



>ref|XP_009589966.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum]
Length=130

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 50/85 (59%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L N+  ++    +   KPCC  ++G+ +L+  +CLC       L +
Sbjct  47   CPIDTLKLGVCANVLGNLLGLV--IGNPPKKPCCTLIQGVADLEAAICLCTAIKANILGI  104

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + CG++ P+GF+C
Sbjct  105  NLNVPLSLSLLLNVCGKQVPSGFQC  129



>ref|XP_009607067.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=129

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 44/86 (51%), Gaps = 10/86 (12%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCKL-------Q  223
            CP+  ++L +C  +L  ++       S    PCC  L+GL +L+V  CLC          
Sbjct  46   CPRDTLKLGVCADVLGLVNV---AVGSQVTSPCCSLLQGLADLEVAACLCTAIKANVLGI  102

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            V+ +I V++S L  AC +  P GFKC
Sbjct  103  VKLDIPVALSALVSACAKTIPTGFKC  128



>ref|XP_003572782.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Brachypodium 
distachyon]
Length=123

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L  C  +L  + +         A+PCC  L GL +L+  VCLC       L +
Sbjct  41   CPKNALKLAACADVLGLVSA---EVGHPPAEPCCSILGGLADLEAAVCLCTAIKANVLGI  97

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              +I V +S+L + CG+  P+GF C
Sbjct  98   SLDIPVKLSLLVNYCGKSLPSGFIC  122



>ref|XP_002867769.1| hypothetical protein ARALYDRAFT_914370 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44028.1| hypothetical protein ARALYDRAFT_914370 [Arabidopsis lyrata subsp. 
lyrata]
Length=133

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCPK  ++L +C   L  ++ +     +    PCC  ++GL +L+  VCLC       L 
Sbjct  49   TCPKDALKLGVCVNALNLLNDV--TLGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVLG  106

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + C +K P+GF+C
Sbjct  107  INLNLPIDLSLLLNVCSRKAPHGFQC  132



>ref|XP_010093705.1| hypothetical protein L484_019046 [Morus notabilis]
 gb|EXB54485.1| hypothetical protein L484_019046 [Morus notabilis]
Length=114

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +LK    ++    S    PCC  LEGL +L+  VCLC       L +
Sbjct  31   CPRDALKLGVCADVLKGPVGVV--VGSPPDVPCCSLLEGLIDLEAAVCLCTAIKANILGI  88

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI +S+S+L   C +  P+GF+C
Sbjct  89   NLNIPISLSLLISTCRKDIPSGFQC  113



>gb|ADD11814.1| hybrid proline-rich protein [Cajanus cajan]
Length=131

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCPK  ++  +C  +L  ++  L +   T   PCC  +EGL +L+  VCLC       L 
Sbjct  48   TCPKDTLKFGVCANLLGLVNVNLGKPPKT---PCCSLIEGLADLEAAVCLCTALKANVLG  104

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ V +S+L + CG+K P  F C
Sbjct  105  INLNVPVKLSLLLNVCGKKTPKDFIC  130



>ref|XP_002270769.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN65287.1| hypothetical protein VITISV_042739 [Vitis vinifera]
Length=135

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCPK  ++L +C  +L  +  I     +    PCC  ++GL +L+  VCLC       L 
Sbjct  51   TCPKDTLKLGVCANLLGGL--IGAVVGTPPKTPCCSLIQGLADLEAAVCLCTAIKANVLG  108

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +S+S+L + C +K P GF+C
Sbjct  109  INLNIPLSLSLLLNVCSKKVPPGFQC  134



>ref|NP_001152564.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG43950.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG48252.1| cortical cell-delineating protein precursor [Zea mays]
 gb|AFW59243.1| cortical cell-delineating protein [Zea mays]
Length=131

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I +   +      +PCC  L+GL +L+  VCLC       L +
Sbjct  49   CPRDALKLGVCANVLGLIKA---KVGVPPTEPCCPLLKGLVDLEAAVCLCTAIKGEVLGI  105

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
            + N+ V +S++ + CG+  P GFKC
Sbjct  106  KLNLPVDLSLILNHCGKTVPTGFKC  130



>ref|XP_009114618.1| PREDICTED: lipid transfer protein EARLI 1 [Brassica rapa]
 emb|CDY16712.1| BnaA09g20900D [Brassica napus]
Length=169

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP   ++L +C  +L  + +I  +     A+PCC  ++GL +L+  +CLC       L +
Sbjct  86   CPIDVLKLGVCGNVLSGLLNI--QLGQPSAQPCCSLVQGLVDLEAAICLCTALKVNVLGI  143

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + C +K P+GF+C
Sbjct  144  NLNVPISLSVLLNKCNKKVPSGFEC  168



>ref|XP_011033953.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=137

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L +C  +L ++ ++     +   KPCC  ++GL +L+  VCLC       L +
Sbjct  54   CPKDALKLGVCADLLGSLLNV--TVGNPPVKPCCSVIQGLLDLESAVCLCTAIKANILGI  111

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              NI +S+S+L + CG+K P  F+C
Sbjct  112  NLNIPLSLSLLLNVCGKKVPKDFQC  136



>gb|EYU30303.1| hypothetical protein MIMGU_mgv1a016181mg [Erythranthe guttata]
Length=131

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 46/89 (52%), Gaps = 8/89 (9%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            V  +CP+  ++L IC  +L    S+     S    PCC  L GL +L+  VCLC      
Sbjct  44   VKGSCPRDALKLGICAKLLNG--SVGAELGSPPDHPCCSVLGGLLDLEAAVCLCTALKAN  101

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  +I +S+S+L + CG+  P  FKC
Sbjct  102  ILGINIDIPISLSLLINTCGKTLPEDFKC  130



>ref|XP_002464969.1| hypothetical protein SORBIDRAFT_01g029630 [Sorghum bicolor]
 gb|EER91967.1| hypothetical protein SORBIDRAFT_01g029630 [Sorghum bicolor]
Length=155

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 49/93 (53%), Gaps = 13/93 (14%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSI----LPRFRSTFAKPCCRRLEGLTNLQVGVCLCKLQVRT  214
            CP   ++L  C  +L  + S+      R  ++  +PCC+ L GL +L   VCLC   +R 
Sbjct  62   CPVNALKLGACASVLGGLVSLELGQQQRPATSSTQPCCQLLGGLADLDAAVCLCT-ALRA  120

Query  213  NI--------NVSISILSDACGQKPPNGFKC*R  139
            N+        +V +S+L + CG+K P GF+C R
Sbjct  121  NVLGVVQLRAHVELSVLVNYCGKKLPQGFQCAR  153



>ref|XP_007218576.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
 gb|EMJ19775.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
Length=139

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 16/90 (18%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSIL----PRFRSTFAKPCCRRLEGLTNLQVGVCLCK----  229
            +CPK  ++L +C  +L  +  ++    P+       PCC  + GL +++  VCLC     
Sbjct  55   SCPKDTLKLGVCGALLNGLVHLVVGTPPK------TPCCSLIGGLADVEAAVCLCTAIKA  108

Query  228  --LQVRTNINVSISILSDACGQKPPNGFKC  145
              L +  N+ VS+S+L + CG+  P GF+C
Sbjct  109  NVLGINLNVPVSLSLLLNYCGKSVPTGFQC  138



>ref|XP_009796139.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 45/85 (53%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  +   +     T   PCC  + GL +L+  VCLC       L +
Sbjct  76   CPRDALKLGVCANLLGGLVGAVIGTPPTM--PCCSLIAGLADLEAAVCLCTAIRANVLGI  133

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S++ + CG+ PP GF C
Sbjct  134  NLNVPLSLSLVLNNCGRNPPTGFTC  158



>gb|EMS62564.1| 14 kDa proline-rich protein DC2.15 [Triticum urartu]
Length=126

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (53%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CPK  ++L  C  +L     +L +     A+PCC  L GL +L+  VCLC       L +
Sbjct  44   CPKNALKLAACADVL---GLVLAQVGQPPAEPCCSILGGLADLEAAVCLCTAIKANVLGI  100

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              +I V +S+L + CG+  P+GF C
Sbjct  101  SLDIPVKLSLLVNYCGKNLPSGFIC  125



>ref|XP_002285197.1| PREDICTED: putative lipid-binding protein At4g00165 [Vitis vinifera]
Length=128

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (53%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++  +C  +L  + S++    S  +  CC  LEGL +L+   CLC       L +
Sbjct  45   CPRDTLKFGVCADLLGGLVSLVAG--SPPSSKCCAVLEGLADLEAAACLCTAIKASVLGI  102

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
               + V+IS+L  ACG+  P GFKC
Sbjct  103  NVKVPVAISLLISACGKSIPPGFKC  127



>ref|XP_003608741.1| Cortical cell-delineating protein [Medicago truncatula]
 gb|AES90938.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK48033.1| unknown [Medicago truncatula]
Length=132

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP+  I+  +C  +L  I+  L +   T   PCC  ++GL NL+  VCLC       L 
Sbjct  49   TCPRDTIKFGVCADVLGLINVELGKPPKT---PCCSLIDGLANLEAAVCLCTALKANVLG  105

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +++S++ + CG+  P GF C
Sbjct  106  INLNLPINLSLVLNYCGKGVPKGFVC  131



>ref|NP_001235511.1| uncharacterized protein LOC100500518 precursor [Glycine max]
 gb|ACU15619.1| unknown [Glycine max]
 gb|KHN09806.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=131

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  ++  +C  +L  I+  L +   T   PCC  ++GL +L+  VCLC       L 
Sbjct  48   SCPKDTVKFGVCADVLGLINVQLGKPPKT---PCCSLIQGLADLEAAVCLCTALKANVLG  104

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ V++S+L + CG+  P GF C
Sbjct  105  INLNVPVNLSLLLNYCGKGVPKGFVC  130



>gb|KHN04346.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L  +++ L +   T   PCC  L+GL +L+  VCLC       L 
Sbjct  53   SCPRDALKLGVCANVLNLVNATLGQPPVT---PCCTLLDGLVDLEAAVCLCTALKANILG  109

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + C +K P  F+C
Sbjct  110  INLNLPISLSLLLNVCSRKVPRNFQC  135



>dbj|BAA05471.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=87

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 45/85 (53%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  ++  +   +     T   PCC  + GL +L+  VCLC       L +
Sbjct  5    CPRDALKLGVCANLVGGLVGAIVGSPPTL--PCCSLIAGLADLEAAVCLCTAIRANVLGI  62

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S++ + CG+ PP GF C
Sbjct  63   NLNVPLSLSLVLNNCGRNPPTGFTC  87



>gb|AFK47547.1| unknown [Lotus japonicus]
Length=139

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  I+L +C  +L  I+  L +   T   PCC  L+GL +L+  VCLC       L 
Sbjct  56   SCPRDTIKLGVCADVLGLINVQLGKPPKT---PCCSLLQGLADLEAAVCLCTALRANVLG  112

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI +++S++ + CG+  P GF C
Sbjct  113  INLNIPINLSLILNYCGKGVPKGFVC  138



>gb|KDP25650.1| hypothetical protein JCGZ_20806 [Jatropha curcas]
Length=130

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 46/86 (53%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
             CP+  ++L +C  +LK + ++     +    PCC  L  L +L+  VCLC       L 
Sbjct  46   ACPRDTLKLGVCADVLKGLLNV--TVGTPPKTPCCSLLGDLVDLEAAVCLCTTIKASLLG  103

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ + +S+L + CG+K P GFKC
Sbjct  104  INLNLPIDLSLLLNYCGKKVPEGFKC  129



>emb|CDP05328.1| unnamed protein product [Coffea canephora]
Length=129

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 46/85 (54%), Gaps = 9/85 (11%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L  I        +    PCC  L+GL +L+  +CLC       L +
Sbjct  47   CPRDALKLGVCANVLGLIRV---SIGAPPTLPCCSLLQGLADLEAALCLCTAIRANILGI  103

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ V++S++ + CG+ PPNGF C
Sbjct  104  NLNLPVTLSLVLNNCGRNPPNGFIC  128



>ref|NP_001238293.1| uncharacterized protein LOC100527330 precursor [Glycine max]
 gb|ACU16403.1| unknown [Glycine max]
Length=136

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CP+  ++L +C  +L  +++ L +   T   PCC  L+GL +L+  VCLC       L 
Sbjct  53   SCPRDALKLGVCANVLNLVNATLGQPPVT---PCCTLLDGLVDLEAAVCLCTALKANILG  109

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +S+S+L + C +K P  F+C
Sbjct  110  INLNLPISLSLLLNVCSRKVPRNFQC  135



>gb|ACV74341.1| proline-rich protein [Jatropha curcas]
Length=138

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -2

Query  381  CPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQV  220
            CP+  ++L +C  +L ++ +I         KPCC  LEGL +L+  VCLC       L +
Sbjct  55   CPRDALKLGVCAKVLGSLLNI--TIGDPPVKPCCSLLEGLVDLEAAVCLCTAIKANILGI  112

Query  219  RTNINVSISILSDACGQKPPNGFKC  145
              N+ +S+S+L + C +K P  F+C
Sbjct  113  TLNVPLSLSLLLNVCSKKVPFDFQC  137



>ref|XP_009113072.1| PREDICTED: lipid transfer protein EARLI 1 [Brassica rapa]
 emb|CDY19562.1| BnaC09g13410D [Brassica napus]
 emb|CDY12952.1| BnaA09g13220D [Brassica napus]
Length=147

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 47/89 (53%), Gaps = 8/89 (9%)
 Frame = -2

Query  393  VVDTCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK-----  229
            V   CP+  ++L +C  +L  + +I         KPCC  ++GL +L+   CLC      
Sbjct  61   VTAKCPRDALKLGVCANVLSGLLNI--TLGKPPVKPCCTLIKGLADLEAAACLCTALKAN  118

Query  228  -LQVRTNINVSISILSDACGQKPPNGFKC  145
             L +  NI +S+S+L + C +K P GF+C
Sbjct  119  ILGINLNIPISLSLLLNVCSKKVPPGFQC  147



>gb|EPS71802.1| hypothetical protein M569_02964 [Genlisea aurea]
Length=146

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            TCP   ++L +C  +L ++  ++    +   +PCC  ++GL +L+  VCLC       L 
Sbjct  62   TCPIDTLKLGVCANLLGDLLGVV--IGTPPKEPCCSVIQGLVDLEAAVCLCTAIKADILG  119

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  NI VS+S+L + C +K P GF C
Sbjct  120  INLNIPVSLSVLLNVCSKKVPPGFIC  145



>ref|XP_010676151.1| PREDICTED: putative lipid-binding protein AIR1B [Beta vulgaris 
subsp. vulgaris]
Length=131

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 49/87 (56%), Gaps = 9/87 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCKL-------  226
            TCP   ++L +C  +L N+  +  +  +   +PCC  ++GL +L+  VCLC +       
Sbjct  46   TCPIDTLKLGVCANLLGNLLHL--QIGTPPVQPCCSLIQGLVDLEAAVCLCTVIRANVLD  103

Query  225  QVRTNINVSISILSDACGQKPPNGFKC  145
             +  N+ V++S+L + CG++ P GF C
Sbjct  104  LINLNLPVNLSLLLNVCGRQVPRGFVC  130



>ref|XP_007039884.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY24385.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=134

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 9/86 (10%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
            +CPK  ++L +C  +L  + +++     T   PCC  L GL + +  VCLC       L 
Sbjct  51   SCPKDTLKLGVCADLLNLMHAVVGNPAKT---PCCSLLAGLADAEATVCLCTTIKASVLG  107

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
               NI VS+S+L + CG+  P G++C
Sbjct  108  ANLNIPVSLSLLLNYCGKNIPAGYQC  133



>ref|XP_009411010.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=137

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 8/86 (9%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
             CP   ++L  C  +L  +  I  +      +PCC  ++GL +L+  VCLC       L 
Sbjct  53   ACPVDALKLGGCANVLDGL--IHAKVGEPPKEPCCSLIDGLVDLEAAVCLCTAIKANVLG  110

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
            +  N+ +++S+L + CG++ P GFKC
Sbjct  111  IHLNLPINLSLLLNYCGKQSPTGFKC  136



>ref|XP_006290213.1| hypothetical protein CARUB_v10003904mg [Capsella rubella]
 gb|EOA23111.1| hypothetical protein CARUB_v10003904mg [Capsella rubella]
Length=106

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (55%), Gaps = 10/86 (12%)
 Frame = -2

Query  384  TCPKRKIELTICEIILKNIDSILPRFRSTFAKPCCRRLEGLTNLQVGVCLCK------LQ  223
             CP+  ++L +C  +L  ++    +F ++  KPCC  ++GL +L   VCLC       L 
Sbjct  24   ACPRDSLQLGVCAKVLLQVEL---KFNTSL-KPCCSLIQGLADLDAAVCLCDVLKTKVLG  79

Query  222  VRTNINVSISILSDACGQKPPNGFKC  145
               N+ ++ S+L   CG++ PN F+C
Sbjct  80   TPLNLPLNPSVLLSVCGREAPNNFQC  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897557564400