BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2118_g1_i1 len=630 path=[1:0-71 73:72-629]

Length=630
                                                                      Score     E

ref|XP_006343547.1|  PREDICTED: uncharacterized protein LOC102583496    115   3e-29   
ref|XP_009781627.1|  PREDICTED: uncharacterized protein LOC104230499    114   1e-28   
ref|XP_004242667.1|  PREDICTED: uncharacterized protein LOC101265142    110   3e-27   
ref|XP_009615940.1|  PREDICTED: uncharacterized protein LOC104108572    107   5e-26   
ref|XP_010657294.1|  PREDICTED: uncharacterized protein LOC100267059    105   3e-25   
ref|XP_003545460.1|  PREDICTED: uncharacterized protein LOC100777315    104   9e-25   
gb|KHN16212.1|  hypothetical protein glysoja_043092                     103   2e-24   
gb|AFK42804.1|  unknown                                                 102   5e-24   
ref|XP_007141547.1|  hypothetical protein PHAVU_008G205400g             101   9e-24   
ref|XP_007146194.1|  hypothetical protein PHAVU_006G020400g             101   1e-23   
gb|KHN43689.1|  hypothetical protein glysoja_043212                     100   2e-23   
gb|ACU20475.1|  unknown                                               99.8    5e-23   Glycine max [soybeans]
ref|XP_007049254.1|  Uncharacterized protein TCM_002274               98.6    2e-22   
ref|XP_010252670.1|  PREDICTED: uncharacterized protein LOC104594184  97.8    3e-22   
ref|XP_002302844.1|  hypothetical protein POPTR_0002s22060g           97.4    4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011039345.1|  PREDICTED: uncharacterized protein LOC105135933  97.4    4e-22   
ref|XP_004492326.1|  PREDICTED: uncharacterized protein LOC101497586  94.4    5e-21   
ref|XP_002321167.1|  hypothetical protein POPTR_0014s16050g           93.6    9e-21   Populus trichocarpa [western balsam poplar]
gb|KDP30860.1|  hypothetical protein JCGZ_13803                       92.8    2e-20   
ref|XP_004491205.1|  PREDICTED: uncharacterized protein LOC101492272  91.7    4e-20   
ref|XP_006469542.1|  PREDICTED: uncharacterized protein LOC102619171  91.3    8e-20   
ref|XP_006447719.1|  hypothetical protein CICLE_v10017035mg           92.4    9e-20   
ref|XP_008229847.1|  PREDICTED: uncharacterized protein LOC103329196  90.5    2e-19   
ref|XP_004293443.1|  PREDICTED: uncharacterized protein LOC101312994  90.1    2e-19   
ref|XP_007216675.1|  hypothetical protein PRUPE_ppa1027173mg          89.7    4e-19   
ref|XP_003622974.1|  hypothetical protein MTR_7g058970                87.8    2e-18   
ref|XP_002534514.1|  conserved hypothetical protein                   86.7    3e-18   Ricinus communis
ref|XP_008455967.1|  PREDICTED: uncharacterized protein LOC103496030  87.0    3e-18   
gb|AES79192.2|  hypothetical protein MTR_7g058970                     87.0    4e-18   
ref|XP_003519497.1|  PREDICTED: uncharacterized protein LOC100796492  86.3    5e-18   
ref|XP_010046026.1|  PREDICTED: uncharacterized protein LOC104434866  86.3    6e-18   
gb|AFK44944.1|  unknown                                               84.3    3e-17   
gb|KFK31776.1|  hypothetical protein AALP_AA6G157200                  83.2    6e-17   
ref|XP_010557691.1|  PREDICTED: uncharacterized protein LOC104826613  83.2    6e-17   
ref|XP_009365182.1|  PREDICTED: uncharacterized protein LOC103955039  83.6    7e-17   
gb|KFK28292.1|  hypothetical protein AALP_AA8G497400                  82.8    9e-17   
ref|XP_010435463.1|  PREDICTED: uncharacterized protein LOC104719278  82.8    1e-16   
ref|XP_010440761.1|  PREDICTED: uncharacterized protein LOC104724008  82.0    1e-16   
ref|NP_974854.1|  uncharacterized protein                             82.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124259.1|  PREDICTED: uncharacterized protein LOC103849195  82.0    2e-16   
ref|XP_010532988.1|  PREDICTED: uncharacterized protein LOC104808855  81.6    2e-16   
ref|XP_008381793.1|  PREDICTED: uncharacterized protein LOC103444614  82.0    2e-16   
ref|XP_002868433.1|  hypothetical protein ARALYDRAFT_915700           81.6    3e-16   
ref|NP_565314.1|  uncharacterized protein                             80.1    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883662.1|  hypothetical protein ARALYDRAFT_480112           79.7    1e-15   
gb|KGN46586.1|  hypothetical protein Csa_6G110050                     79.7    1e-15   
ref|XP_003617162.1|  hypothetical protein MTR_5g088550                79.0    3e-15   
ref|XP_004144535.1|  PREDICTED: uncharacterized protein LOC101211016  78.2    7e-15   
ref|XP_008455515.1|  PREDICTED: uncharacterized protein LOC103495667  79.0    8e-15   
ref|XP_006282472.1|  hypothetical protein CARUB_v10005863mg           79.0    1e-14   
ref|XP_011100609.1|  PREDICTED: uncharacterized protein LOC105178762  76.3    2e-14   
emb|CDX93064.1|  BnaA03g37860D                                        75.9    2e-14   
ref|XP_009136150.1|  PREDICTED: uncharacterized protein LOC103860315  75.5    3e-14   
emb|CDY50046.1|  BnaC03g44900D                                        75.1    9e-14   
ref|XP_008342225.1|  PREDICTED: uncharacterized protein LOC103405030  74.3    1e-13   
gb|EYU42732.1|  hypothetical protein MIMGU_mgv1a017827mg              73.2    3e-13   
ref|XP_010674723.1|  PREDICTED: uncharacterized protein LOC104890820  71.6    1e-12   
ref|XP_010112813.1|  hypothetical protein L484_020045                 70.1    3e-12   
ref|XP_010035451.1|  PREDICTED: uncharacterized protein LOC104424666  70.5    3e-12   
ref|XP_010666063.1|  PREDICTED: uncharacterized protein LOC104883274  70.1    5e-12   
ref|XP_006856831.1|  hypothetical protein AMTR_s00055p00169650        63.9    6e-10   
gb|KGN43444.1|  hypothetical protein Csa_7G037480                     55.8    3e-07   
ref|XP_006298887.1|  hypothetical protein CARUB_v10015007mg           54.3    1e-06   



>ref|XP_006343547.1| PREDICTED: uncharacterized protein LOC102583496 [Solanum tuberosum]
Length=101

 Score =   115 bits (289),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 74/103 (72%), Gaps = 2/103 (2%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            MWR+L  I QNL NMGKSPRVADE+M             Q      S++  G+FRAPL+L
Sbjct  1    MWRLLVSIRQNLQNMGKSPRVADENMTNICRGENNRSTRQHNWTGFSIIC-GVFRAPLAL  59

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            FSCL+ P  NG+ DGVWV+G+F+Q+SEMNHLMVSDSMRYAILM
Sbjct  60   FSCLNHPRLNGT-DGVWVSGEFSQISEMNHLMVSDSMRYAILM  101



>ref|XP_009781627.1| PREDICTED: uncharacterized protein LOC104230499 [Nicotiana sylvestris]
Length=102

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            MW IL  + +NL NMGKSPRV DE+M+    +  A     R+      ++YGI RAP+ L
Sbjct  1    MWNILVTMRKNLQNMGKSPRVGDENMINIRVDQTAGGRSSRQNWHGFSIIYGILRAPIYL  60

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            FSCL+ P  NG+ DGVWV+GDF+Q+SEMNHLMVSDSMRYAILM
Sbjct  61   FSCLNHPRINGT-DGVWVSGDFSQVSEMNHLMVSDSMRYAILM  102



>ref|XP_004242667.1| PREDICTED: uncharacterized protein LOC101265142 [Solanum lycopersicum]
Length=102

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            M  +L  I QNL NMGKSPRVADE+M         +   ++       ++ G+FRAPL+L
Sbjct  1    MLSLLVSIRQNLENMGKSPRVADENMTNICRGGTTSRSTRQHNWNGFSIICGVFRAPLAL  60

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            FSCL+ P  NG+ DGVWV+G+F+Q+SEMNHLMVSDSMRYAILM
Sbjct  61   FSCLNHPRINGT-DGVWVSGEFSQISEMNHLMVSDSMRYAILM  102



>ref|XP_009615940.1| PREDICTED: uncharacterized protein LOC104108572 [Nicotiana tomentosiformis]
Length=101

 Score =   107 bits (267),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 2/103 (2%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            MW IL  + QNL NMGKSP+V DE+M+    +  A    ++     S++  G+ RAPL L
Sbjct  1    MWSILVTMRQNLQNMGKSPKVGDENMINIRVDQTAGGRSRQNWHGFSIIC-GVLRAPLYL  59

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            FSCL+ P  NG+ DGVWV+GDF+Q+SEMNHLMVSDSMRYAILM
Sbjct  60   FSCLNHPRINGT-DGVWVSGDFSQVSEMNHLMVSDSMRYAILM  101



>ref|XP_010657294.1| PREDICTED: uncharacterized protein LOC100267059 [Vitis vinifera]
Length=107

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 70/108 (65%), Gaps = 6/108 (6%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvs-----vvvYGIFR  337
            MW +LA + +N  N+ KSPRVADE+M     +    + G+   RR         VY I R
Sbjct  1    MWHMLAAMRRNFQNIRKSPRVADENMFGGGNQAELPIFGRDMERRARGWDGFSAVYSIVR  60

Query  338  APLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             PLSL SC S P  NG+ DGVWV+GDFA +SEMNHLMVSDSMRYAILM
Sbjct  61   VPLSLLSCFSHPHVNGA-DGVWVSGDFAHISEMNHLMVSDSMRYAILM  107



>ref|XP_003545460.1| PREDICTED: uncharacterized protein LOC100777315 [Glycine max]
 gb|KHN26012.1| hypothetical protein glysoja_038234 [Glycine soja]
Length=103

 Score =   104 bits (259),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            MWR+LA +++NL N  KS +VADESM  A   +      + R +    +V  I +AP+S+
Sbjct  1    MWRLLAAVARNLQNTRKSSKVADESMFEAGNGVELFGHERGRRQHGWGLVCSILQAPISI  60

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             SC+S+P  N   DGVWVTG+F+Q+SEMNHLMVSDSMRYAILM
Sbjct  61   LSCVSQPQVNNGSDGVWVTGEFSQVSEMNHLMVSDSMRYAILM  103



>gb|KHN16212.1| hypothetical protein glysoja_043092 [Glycine soja]
Length=107

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 77/108 (71%), Gaps = 6/108 (6%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrv-----svvvYGIFR  337
            MWR++A +++ L N  KS RVADE+M  AA  +  A+  + RGRR        ++Y I  
Sbjct  1    MWRLVAALTRKLQNTKKSSRVADENMFEAANGVEIAIFRRDRGRRDHGWSGISLIYSILH  60

Query  338  APLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            AP+S+ SC+S P ANGS DGVWVTG+F Q+SEMNHLMV+DSMRYAILM
Sbjct  61   APISILSCVSHPQANGS-DGVWVTGEFVQISEMNHLMVNDSMRYAILM  107



>gb|AFK42804.1| unknown [Lotus japonicus]
Length=100

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            MWR++A +++NL N  KS RVADESM  A  +    +   +       ++Y I  AP+S+
Sbjct  1    MWRLVAAVTRNLQNTKKSSRVADESMFEAGHDRG--IRRSQHDWSGFSLIYAILHAPISI  58

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             SC+S P ANG +DG WV+G+F+Q+SEMNH+MV+DSMRYAILM
Sbjct  59   LSCVSHPQANG-VDGAWVSGEFSQISEMNHIMVNDSMRYAILM  100



>ref|XP_007141547.1| hypothetical protein PHAVU_008G205400g [Phaseolus vulgaris]
 gb|ESW13541.1| hypothetical protein PHAVU_008G205400g [Phaseolus vulgaris]
Length=102

 Score =   101 bits (252),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 71/103 (69%), Gaps = 1/103 (1%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            MWR+LA + +N  N  KS +VADESM  A   +      + R +    +V  I +AP+S+
Sbjct  1    MWRLLAAVRRNFQNTRKSSKVADESMFEAGNGVELFGDDRGRRQHGWGLVCSILQAPISI  60

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             SC+S P  NGS DGVWVTG+F+Q+SEMNHLMVSDSMRYAILM
Sbjct  61   LSCVSHPQVNGS-DGVWVTGEFSQVSEMNHLMVSDSMRYAILM  102



>ref|XP_007146194.1| hypothetical protein PHAVU_006G020400g [Phaseolus vulgaris]
 gb|ESW18188.1| hypothetical protein PHAVU_006G020400g [Phaseolus vulgaris]
Length=107

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvs-----vvvYGIFR  337
            MW +L V+++ L N  KS RVADE+M  AA E+  A+    RGRR        ++Y I  
Sbjct  1    MWHLLTVVTRKLQNTKKSSRVADENMFEAANEVELAMFRHDRGRREHGWSGISLIYTILH  60

Query  338  APLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            AP+S+ SC+S P ANGS DGVWV+G+F Q+SEMNHLMV+DSMRYAILM
Sbjct  61   APISILSCVSHPQANGS-DGVWVSGEFVQISEMNHLMVNDSMRYAILM  107



>gb|KHN43689.1| hypothetical protein glysoja_043212 [Glycine soja]
Length=107

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvs-----vvvYGIFR  337
            MWR++A +++ L N  K  RVADE+M  AA  +  A+    RGRR        ++YGI  
Sbjct  1    MWRLVAALTRKLQNTKKGSRVADENMFEAANGVELAMFRHDRGRRDHGWSGISLIYGILH  60

Query  338  APLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            AP+S+ SC+S P ANGS DGVWV+G+F Q+SEMNHLMV+DSMRYAILM
Sbjct  61   APISILSCVSHPQANGS-DGVWVSGEFVQISEMNHLMVNDSMRYAILM  107



>gb|ACU20475.1| unknown [Glycine max]
Length=107

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 76/108 (70%), Gaps = 6/108 (6%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvs-----vvvYGIFR  337
            MWR++A +++ L N  K  RVADE+M  AA  +  A+    RGRR        ++YGI  
Sbjct  1    MWRLVAALTRKLQNTKKGSRVADENMSEAANGVELAMFRHDRGRRDHGWSGISLIYGILH  60

Query  338  APLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            AP+S+ SC+S P ANGS DGVWV+G+F Q+SEMNHLMV+DSMRYAILM
Sbjct  61   APISILSCVSHPQANGS-DGVWVSGEFVQISEMNHLMVNDSMRYAILM  107



>ref|XP_007049254.1| Uncharacterized protein TCM_002274 [Theobroma cacao]
 gb|EOX93411.1| Uncharacterized protein TCM_002274 [Theobroma cacao]
Length=110

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 69/111 (62%), Gaps = 9/111 (8%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvs--------vvvYG  328
            MWR+L V+ +NL N+ KSPRVADE+M+                             V+  
Sbjct  1    MWRMLVVLRRNLQNIKKSPRVADENMVGGVNTNNNNGAEMPIFIDRRPRGSWNGLSVICS  60

Query  329  IFRAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            + RAPLSL SC S+P  NG+ DGVWV+ +FAQ+SEMNHLMVSDSMRYAILM
Sbjct  61   VVRAPLSLVSCFSQPHVNGA-DGVWVSSEFAQISEMNHLMVSDSMRYAILM  110



>ref|XP_010252670.1| PREDICTED: uncharacterized protein LOC104594184 [Nelumbo nucifera]
Length=107

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 70/108 (65%), Gaps = 6/108 (6%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvs-----vvvYGIFR  337
            MWR+LA + QNL N+  S RVADES+L         +      RR        V+  I R
Sbjct  1    MWRLLAAMKQNLQNIRTSARVADESVLGGGDGAQFPMFAHDVERRRRGWNGLSVLCNIVR  60

Query  338  APLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            APLS  SC+S P  NG+ DGVWV+G+FA++SE+NHLMVSDSMRYAILM
Sbjct  61   APLSFLSCISNPHVNGA-DGVWVSGEFARISELNHLMVSDSMRYAILM  107



>ref|XP_002302844.1| hypothetical protein POPTR_0002s22060g [Populus trichocarpa]
 gb|EEE82117.1| hypothetical protein POPTR_0002s22060g [Populus trichocarpa]
Length=106

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 69/107 (64%), Gaps = 5/107 (5%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVL----GQrrgrrvsvvvYGIFRA  340
            MW  LA + +N+ N+ KSPRVADESM          +L     + +       ++ I  A
Sbjct  1    MWHKLARLRRNVQNIRKSPRVADESMFGGMNGAEFPILVRDMNRAQRWNSLSALFRIVLA  60

Query  341  PLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            P S+ SC S+P  NG+ DG+WVTG+FAQ+SEMNHLMV+DSMRYAILM
Sbjct  61   PFSILSCSSQPHVNGA-DGLWVTGEFAQLSEMNHLMVNDSMRYAILM  106



>ref|XP_011039345.1| PREDICTED: uncharacterized protein LOC105135933 [Populus euphratica]
Length=106

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 69/107 (64%), Gaps = 5/107 (5%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVL----GQrrgrrvsvvvYGIFRA  340
            MW  LA + +N+ N+ KSPRVADESM          +L     + +       ++ I  A
Sbjct  1    MWHKLARLRRNVQNIRKSPRVADESMFGGMNGAEFPILVRDMNRAQRWNSLSALFRIVLA  60

Query  341  PLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            P S+ SC S+P  NG+ DG+WVTG+FAQ+SEMNHLMV+DSMRYAILM
Sbjct  61   PFSIISCSSQPHVNGA-DGLWVTGEFAQLSEMNHLMVNDSMRYAILM  106



>ref|XP_004492326.1| PREDICTED: uncharacterized protein LOC101497586 [Cicer arietinum]
Length=107

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 73/108 (68%), Gaps = 6/108 (6%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLG-----QrrgrrvsvvvYGIFR  337
            MW ++A + +NL NM KS +VADE+M  A  E+  A+ G     ++ G     ++  I +
Sbjct  1    MWHLVAAVRRNLHNMKKSSKVADENMFEAGNEVEVAIFGGERGRRQHGWSGFSIICAILQ  60

Query  338  APLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            AP+S+ SC+S P  NG  DGVW  G+FAQ+SE+NH+MV+DSMRYAILM
Sbjct  61   APISILSCVSNPRVNGP-DGVWANGEFAQISEINHIMVNDSMRYAILM  107



>ref|XP_002321167.1| hypothetical protein POPTR_0014s16050g [Populus trichocarpa]
 gb|EEE99482.1| hypothetical protein POPTR_0014s16050g [Populus trichocarpa]
Length=107

 Score = 93.6 bits (231),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 64/107 (60%), Gaps = 4/107 (4%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVL----GQrrgrrvsvvvYGIFRA  340
            MWR LA +  N+ N+ KSPRVADESM          +L     + +       +  I  A
Sbjct  1    MWRKLARLRSNVQNIRKSPRVADESMFGVMNGAEFPILVRDMNRTQSWNALSALLRIVLA  60

Query  341  PLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            P S+ SC S  P     DG+WVTG+FAQ+SEMNHLMV+DSMRYAILM
Sbjct  61   PFSIPSCFSSQPHVHGADGLWVTGEFAQLSEMNHLMVNDSMRYAILM  107



>gb|KDP30860.1| hypothetical protein JCGZ_13803 [Jatropha curcas]
Length=112

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 67/112 (60%), Gaps = 9/112 (8%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESML----aaaaeipaaVLGQrrgrrvsvvvYGIFR-  337
            MWR +A I +N+ N+ KSPRVADESM              +  +    R  +    IFR 
Sbjct  1    MWRSVARIRRNMHNLRKSPRVADESMFGGMNINNGTEFPIIFARETAGRQRIGFSAIFRI  60

Query  338  --APLSLFSCLSRPPANGSMDGVWVTG--DFAQMSEMNHLMVSDSMRYAILM  481
              AP SL SC S  P    +DG+WV+G  +FAQ+SEMNHLMV+DSMRYAILM
Sbjct  61   VLAPFSLLSCFSSQPHANGVDGLWVSGRHEFAQISEMNHLMVNDSMRYAILM  112



>ref|XP_004491205.1| PREDICTED: uncharacterized protein LOC101492272 [Cicer arietinum]
Length=100

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 68/104 (65%), Gaps = 5/104 (5%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            MW+IL  +++NL N  KS +VADE+M     E       Q     V      I +AP+S+
Sbjct  1    MWQILVAMTRNLNNTRKSSKVADENMFQQGNEHERVRRSQNGWGGVIS---NILQAPISI  57

Query  353  FSCLSRPPANGSMDGVWVTG-DFAQMSEMNHLMVSDSMRYAILM  481
             SC+S P  NGS DGV+VTG +F+Q+SEMNHLMVSDSMRYAILM
Sbjct  58   LSCVSHPRVNGS-DGVFVTGGEFSQISEMNHLMVSDSMRYAILM  100



>ref|XP_006469542.1| PREDICTED: uncharacterized protein LOC102619171 [Citrus sinensis]
 gb|KDO58460.1| hypothetical protein CISIN_1g034207mg [Citrus sinensis]
Length=101

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 67/109 (61%), Gaps = 14/109 (13%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLG------QrrgrrvsvvvYGIF  334
            MWR+L           KSPRVADE+ML  A  +P  V G      +        ++Y + 
Sbjct  1    MWRML--------RPRKSPRVADETMLNGAHPLPMFVHGMNRRSRRDALNLAFSIIYTVV  52

Query  335  RAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            R P+ +FSC S+P  NG+ DG WV+G+F Q+SEMNHLMVSDS+RYAILM
Sbjct  53   RVPVEVFSCFSQPHVNGAADGSWVSGEFTQISEMNHLMVSDSLRYAILM  101



>ref|XP_006447719.1| hypothetical protein CICLE_v10017035mg [Citrus clementina]
 gb|ESR60959.1| hypothetical protein CICLE_v10017035mg [Citrus clementina]
Length=157

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 67/111 (60%), Gaps = 14/111 (13%)
 Frame = +2

Query  167  SSMWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLG------QrrgrrvsvvvYG  328
              MWR+L           KSPRVADE+ML  A  +P  V G      +        ++Y 
Sbjct  55   KKMWRML--------RPRKSPRVADETMLNGAHPLPMFVHGMNRRSRRDALNLAFSIIYT  106

Query  329  IFRAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            + R P+ +FSC S+P  NG+ DG WV+G+F Q+SEMNHLMVSDS+RYAILM
Sbjct  107  VVRVPVEVFSCFSQPHVNGAADGSWVSGEFTQISEMNHLMVSDSLRYAILM  157



>ref|XP_008229847.1| PREDICTED: uncharacterized protein LOC103329196 [Prunus mume]
Length=118

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 67/118 (57%), Gaps = 15/118 (13%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVL---------------GQrrgrr  307
            MWR LA + QNL N+ KSPRVADESM+     +    +                + R  +
Sbjct  1    MWRGLATMRQNLQNIRKSPRVADESMVIGGGNLAELPIFAGHGHEHQMDRRSSSRVRWIK  60

Query  308  vsvvvYGIFRAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
               V+Y +   P S  SC S+P      DGVW +G+FAQ++EMNHLMVSDSMRYAILM
Sbjct  61   GFSVLYSVVLVPFSALSCFSQPDHVHGADGVWASGEFAQITEMNHLMVSDSMRYAILM  118



>ref|XP_004293443.1| PREDICTED: uncharacterized protein LOC101312994 [Fragaria vesca 
subsp. vesca]
Length=107

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 69/108 (64%), Gaps = 6/108 (6%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaa---eipaaVLGQrrgr--rvsvvvYGIFR  337
            M  +LA + QN+ NM KSPRVADESM+            + G+   R  +   V+  +  
Sbjct  1    MRHMLATMRQNIQNMRKSPRVADESMVNIERGNLAEELQIYGRSSSRGWKGFSVIVSVVI  60

Query  338  APLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             P S+ SC S+P  +G+ DGVW +GDFAQ++E+NHLMVSDSMRYAILM
Sbjct  61   LPFSVLSCFSQPHVHGA-DGVWTSGDFAQITEINHLMVSDSMRYAILM  107



>ref|XP_007216675.1| hypothetical protein PRUPE_ppa1027173mg [Prunus persica]
 gb|EMJ17874.1| hypothetical protein PRUPE_ppa1027173mg [Prunus persica]
Length=118

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 67/118 (57%), Gaps = 15/118 (13%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVL---------------GQrrgrr  307
            MWR LA + QNL N+ KSPRVADESM+     +    +                + R  +
Sbjct  1    MWRGLATMRQNLQNIRKSPRVADESMVIGGGNLAELPIFAGHGHQHQMDRRSSSRVRWIK  60

Query  308  vsvvvYGIFRAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
               V+Y +   P S  SC S+P      DGVW +G+FAQ++EMNHLMVSDSMRYAILM
Sbjct  61   GFSVLYSVVLVPFSALSCFSQPDHVLGADGVWASGEFAQITEMNHLMVSDSMRYAILM  118



>ref|XP_003622974.1| hypothetical protein MTR_7g058970 [Medicago truncatula]
Length=125

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 10/112 (9%)
 Frame = +2

Query  173  MWRILAVISQ-NLGNMGKSPRVADESMLaaaaeipaaVL--GQrrgrrv------svvvY  325
            MW ++A + + N+  M KS +VADE+M           +  G+R  R+         V+Y
Sbjct  15   MWHLVAAVRRINIYKMKKSSKVADENMFEEGNRGVEVAMFGGERGRRQHGHGWSGFSVIY  74

Query  326  GIFRAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             I +AP+S+ SCLS P  NGS DGVW TG+F Q+SE+NH+MV+DSMRYAILM
Sbjct  75   AILQAPISILSCLSNPRVNGS-DGVWSTGEFGQISEINHIMVNDSMRYAILM  125



>ref|XP_002534514.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27871.1| conserved hypothetical protein [Ricinus communis]
Length=92

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 60/93 (65%), Gaps = 5/93 (5%)
 Frame = +2

Query  215  MGKSPRVADESMLaaaaeipaaVLGQrrgrrvs----vvvYGIFRAPLSLFSCLSRPPAN  382
            M KSPRVADESM           + +    R        ++ I  APLSL SC S+P AN
Sbjct  1    MRKSPRVADESMFINNGAEFPIFVREMDRSRHRWSGLSAIFSIVLAPLSLLSCFSQPHAN  60

Query  383  GSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            G+ DG+WV+G+ AQ+SEMNHLMV+DSMRYAILM
Sbjct  61   GA-DGLWVSGELAQLSEMNHLMVNDSMRYAILM  92



>ref|XP_008455967.1| PREDICTED: uncharacterized protein LOC103496030 [Cucumis melo]
Length=106

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 60/106 (57%), Gaps = 3/106 (3%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            MWR+ AVI   L N   + R+ADESM     + P         R  S  ++ I RAP S+
Sbjct  1    MWRVFAVIRPTLHNFTNTHRIADESMFTTTDQFPTYAAAANNRRTFSTAIFNIIRAPFSI  60

Query  353  FSCLSRPPANGSMDGVWVTGDF---AQMSEMNHLMVSDSMRYAILM  481
             SC + P  + S D  W++GD    + +SE+NHLMVSD MRYAILM
Sbjct  61   LSCFAPPSVHRSPDAFWLSGDHYFASTISEINHLMVSDGMRYAILM  106



>gb|AES79192.2| hypothetical protein MTR_7g058970 [Medicago truncatula]
Length=121

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 10/112 (9%)
 Frame = +2

Query  173  MWRILAVISQ-NLGNMGKSPRVADESMLaaaaeipaaVL--GQrrgrrv------svvvY  325
            MW ++A + + N+  M KS +VADE+M           +  G+R  R+         V+Y
Sbjct  11   MWHLVAAVRRINIYKMKKSSKVADENMFEEGNRGVEVAMFGGERGRRQHGHGWSGFSVIY  70

Query  326  GIFRAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             I +AP+S+ SCLS P  NGS DGVW TG+F Q+SE+NH+MV+DSMRYAILM
Sbjct  71   AILQAPISILSCLSNPRVNGS-DGVWSTGEFGQISEINHIMVNDSMRYAILM  121



>ref|XP_003519497.1| PREDICTED: uncharacterized protein LOC100796492 [Glycine max]
 gb|KHN38420.1| hypothetical protein glysoja_004085 [Glycine soja]
Length=107

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 74/109 (68%), Gaps = 8/109 (7%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsv---vvYGIFRAP  343
            MWR+LA +++NL +  KS +VADESM    +     + G  RGRR      +V  I +AP
Sbjct  1    MWRVLAAVTRNLQSTRKSSKVADESMF--ESGNGVELFGHERGRRSQHGWGLVCSILQAP  58

Query  344  LSLFSCLSRPPANGS-MDGVWV-TGDF-AQMSEMNHLMVSDSMRYAILM  481
            +S+ SC+S P  N +  DG+WV TG+F +Q+SEMNHLMVSDSMRYAILM
Sbjct  59   ISILSCVSHPQVNNNGSDGIWVTTGEFSSQVSEMNHLMVSDSMRYAILM  107



>ref|XP_010046026.1| PREDICTED: uncharacterized protein LOC104434866 [Eucalyptus grandis]
Length=108

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 68/111 (61%), Gaps = 11/111 (10%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvY-------GI  331
            MW++L+V+ +NL N  KS RVADE M  +      AV  Q          +       G+
Sbjct  1    MWQMLSVVRRNLQNRRKSSRVADEGM--SGGGQNGAVFAQELDGLAPRRGWSGLSIICGL  58

Query  332  FRAPLSLFSCLSRPPANGSMDGVWVTG-DFAQMSEMNHLMVSDSMRYAILM  481
             +AP ++ SCLS P  NG+ DGVW +G +F Q+SEMNHLMV+DSMRYAILM
Sbjct  59   VQAPFTVLSCLSHPHVNGA-DGVWASGHEFVQISEMNHLMVNDSMRYAILM  108



>gb|AFK44944.1| unknown [Medicago truncatula]
Length=104

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 70/109 (64%), Gaps = 11/109 (10%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaa-aaeipaaVLGQrrgrrvsv----vvYGIFR  337
            MW +L    +NL N  KS +VADE+M       +   + G  R RR       +V+ I +
Sbjct  1    MWHLL----RNLNNTRKSSKVADENMFQQGNNIVEVQIFGHERRRRSQHGWGNIVFSILQ  56

Query  338  APLSLFSCLSRPPANGSMDGVWVTG-DFAQMSEMNHLMVSDSMRYAILM  481
            AP+S+ SC+S P  NGS DG WV+G +F+Q+SEMNHLMV+DSMRYAILM
Sbjct  57   APISILSCVSHPQVNGS-DGAWVSGGEFSQISEMNHLMVNDSMRYAILM  104



>gb|KFK31776.1| hypothetical protein AALP_AA6G157200 [Arabis alpina]
Length=93

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 70/103 (68%), Gaps = 10/103 (10%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            M +IL+V+ +NL N+GKSPRVADES L + + +   V G+ R   V      + R PLS+
Sbjct  1    MLKILSVLRRNLQNLGKSPRVADESGLPSPSTV---VNGEERRNGV------MMRFPLSI  51

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             SC + P ++ + DGVWV+GD+ + SE+NHLMV D MRYA+LM
Sbjct  52   MSCFAVPRSSRT-DGVWVSGDYGRASEVNHLMVCDGMRYALLM  93



>ref|XP_010557691.1| PREDICTED: uncharacterized protein LOC104826613 [Tarenaya hassleriana]
Length=94

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 68/104 (65%), Gaps = 12/104 (12%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            M+ +L+V+ QNL N+ KSPRVADES     A       G+R G        G+ R PLS+
Sbjct  2    MFEMLSVLRQNLQNLRKSPRVADES-----ASTVIVADGRRDGNGN-----GLMRIPLSI  51

Query  353  FSCLSRPPANGSMDGVWVTGD-FAQMSEMNHLMVSDSMRYAILM  481
             SC + P   G+ DG+WV+GD +A++SE+NHLMVSD MRYAILM
Sbjct  52   LSCFAVPRVRGT-DGLWVSGDYYARVSEVNHLMVSDGMRYAILM  94



>ref|XP_009365182.1| PREDICTED: uncharacterized protein LOC103955039 [Pyrus x bretschneideri]
Length=122

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 67/122 (55%), Gaps = 19/122 (16%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaa-------------------aaeipaaVLGQr  295
            MW +L  + QNL N+ KSPRVADESM+                           ++L  R
Sbjct  1    MWSMLTTMRQNLHNIRKSPRVADESMVNVGAGNPAPAELPIFPAHHDHHHVDRRSLLRIR  60

Query  296  rgrrvsvvvYGIFRAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAI  475
              +  + ++Y +   P S+ SC S+P      DGVW +G+F+Q++EMN LMVSDSMRYAI
Sbjct  61   WIKGFNSLLYSVVLVPFSVISCFSQPHHVHGADGVWASGEFSQITEMNQLMVSDSMRYAI  120

Query  476  LM  481
            LM
Sbjct  121  LM  122



>gb|KFK28292.1| hypothetical protein AALP_AA8G497400 [Arabis alpina]
Length=102

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 63/103 (61%), Gaps = 1/103 (1%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            M  I +++ +NL N  KSPRVADES LA+     +         R   +   I R P S+
Sbjct  1    MTHIFSLLRRNLQNFRKSPRVADESDLASTVVNISGGRTGIAHGRRDRINAVIMRFPFSI  60

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             SC + P  NG+ DG+W++GD+A  SE+NHLMVSD MRYAILM
Sbjct  61   ISCFAVPRVNGT-DGLWMSGDYASGSEINHLMVSDGMRYAILM  102



>ref|XP_010435463.1| PREDICTED: uncharacterized protein LOC104719278 [Camelina sativa]
Length=100

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYG--IFRAPL  346
            M ++L+++ +NL N+ KSPRVADE+ L  +        GQ          +   I R PL
Sbjct  1    MTQMLSILRRNLQNLRKSPRVADETDLQPSTAGS----GQGDIAHGRREGFNAVIMRFPL  56

Query  347  SLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            S+ SC + P  +G+ DG+W++GD+  +SE+NHLMVSD MRYAILM
Sbjct  57   SIISCFAVPSVSGT-DGLWMSGDYGSVSEVNHLMVSDGMRYAILM  100



>ref|XP_010440761.1| PREDICTED: uncharacterized protein LOC104724008 [Camelina sativa]
 ref|XP_010450412.1| PREDICTED: uncharacterized protein LOC104732547 [Camelina sativa]
Length=100

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYG--IFRAPL  346
            M ++L+V+ +NL N+ KSPRVADE+ L  +        GQ          +   I R P 
Sbjct  1    MTQMLSVLRRNLQNLRKSPRVADETDLQPSTAGS----GQGVVAHGRREGFNAVIMRFPF  56

Query  347  SLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            S+ SC + P  +G+ DG+W++GD+  +SE+NHLMVSD MRYAILM
Sbjct  57   SIISCFAVPSVSGT-DGLWMSGDYGSVSEVNHLMVSDGMRYAILM  100



>ref|NP_974854.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAT47801.1| At5g35732 [Arabidopsis thaliana]
 gb|AAU05510.1| At5g35732 [Arabidopsis thaliana]
 gb|AED94010.1| uncharacterized protein AT5G35732 [Arabidopsis thaliana]
Length=100

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 3/103 (3%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            M ++L+V+ +NL N+ KSPRVAD++ L ++        G     R       I R P S+
Sbjct  1    MTQMLSVLRRNLQNLRKSPRVADDTELPSSTSGAGP--GVVANGRRDGFNSVIMRFPFSI  58

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             SC + P  +G+ DG+WV+GD+  +SE+NHLMVSDSMRYAILM
Sbjct  59   ISCFAVPRVSGT-DGLWVSGDYGSISEVNHLMVSDSMRYAILM  100



>ref|XP_009124259.1| PREDICTED: uncharacterized protein LOC103849195 [Brassica rapa]
Length=99

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 69/103 (67%), Gaps = 4/103 (4%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            M ++L+++ +NL N+ KSPRVADE+ +A+  +    V    R    + V   + R P S+
Sbjct  1    MTQMLSILRRNLQNLRKSPRVADETEMASTTQGAGVVAHNERRDGANAV---MMRFPFSI  57

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             SC + P  +G+ DG+W++GD+A +SE+NHLMVSD MRYAILM
Sbjct  58   ISCFAVPRVSGT-DGLWMSGDYASVSEVNHLMVSDGMRYAILM  99



>ref|XP_010532988.1| PREDICTED: uncharacterized protein LOC104808855 [Tarenaya hassleriana]
Length=95

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            M ++L+V+ QNL N+ KSPRVADES L         V         +    G+ R P S+
Sbjct  1    MLQMLSVLRQNLQNLRKSPRVADESALT--------VADDGGRGDGNGNGNGVMRIPSSI  52

Query  353  FSCLSRPPANGSMDGVWVTGDFA-QMSEMNHLMVSDSMRYAILM  481
             SC + P  NG+ DG+W +GD+A ++SE+NHLMV D MRYAILM
Sbjct  53   ISCFAVPRVNGT-DGLWASGDYAARVSEVNHLMVCDGMRYAILM  95



>ref|XP_008381793.1| PREDICTED: uncharacterized protein LOC103444614 [Malus domestica]
Length=122

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 67/122 (55%), Gaps = 19/122 (16%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaa-------------------aaeipaaVLGQr  295
            MW +LA + QNL N+ KSPRVADESM+                           ++   R
Sbjct  1    MWSMLATMRQNLHNIRKSPRVADESMVNVGAGNPAPAELPIFPAHHDHHHVDRRSLPRIR  60

Query  296  rgrrvsvvvYGIFRAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAI  475
              +  + ++Y +   P S+ SC S+P      DGVW +G+F+Q++EMN LMVSDSMRYAI
Sbjct  61   WIKGFNSLLYSVVLVPFSVISCFSQPHHVHGADGVWASGEFSQITEMNQLMVSDSMRYAI  120

Query  476  LM  481
            LM
Sbjct  121  LM  122



>ref|XP_002868433.1| hypothetical protein ARALYDRAFT_915700 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44692.1| hypothetical protein ARALYDRAFT_915700 [Arabidopsis lyrata subsp. 
lyrata]
Length=100

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 3/103 (3%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            M ++L+V+ +NL N+ KSPRVADE+ L ++        G     R       I R P S+
Sbjct  1    MTQMLSVLRRNLQNLRKSPRVADETELPSSNAGAGP--GVVANGRRDGFNSVIMRFPFSI  58

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             SC + P  +G+ DG+W++GD+  +SE+NHLMVSDSMRYAILM
Sbjct  59   ISCFAVPRVSGT-DGLWMSGDYGSVSEINHLMVSDSMRYAILM  100



>ref|NP_565314.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK49611.1|AF372895_1 AT2g04793 [Arabidopsis thaliana]
 gb|AAM10271.1| At2g04793/At2g04793 [Arabidopsis thaliana]
 gb|AAM15337.1| Expressed protein [Arabidopsis thaliana]
 gb|AEC05867.1| uncharacterized protein AT2G04795 [Arabidopsis thaliana]
Length=95

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 63/103 (61%), Gaps = 8/103 (8%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            M ++L+++ +NL N+ KSPRVADES L +         G             I + PLS+
Sbjct  1    MLKMLSILRRNLQNLRKSPRVADESALPSTTVNGDHGGGNGSNGG-------IMKFPLSI  53

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             SC S P  + + DGVWV+GD+ ++SE+NHLMV D MRYA+LM
Sbjct  54   MSCFSVPRVSRA-DGVWVSGDYGRVSEVNHLMVCDGMRYALLM  95



>ref|XP_002883662.1| hypothetical protein ARALYDRAFT_480112 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59921.1| hypothetical protein ARALYDRAFT_480112 [Arabidopsis lyrata subsp. 
lyrata]
Length=95

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 64/103 (62%), Gaps = 8/103 (8%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            M ++L+++ +NL N+ KSPRVADES L +         G            G+ + PLS+
Sbjct  1    MLKMLSILRRNLQNLRKSPRVADESALPSTTVNGDQGRGNGSNG-------GMMKFPLSI  53

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             SC + P  + + DGVWV+GD+ ++S++NHLMV D MRYA+LM
Sbjct  54   MSCFAVPRVSRA-DGVWVSGDYGRVSDVNHLMVCDGMRYALLM  95



>gb|KGN46586.1| hypothetical protein Csa_6G110050 [Cucumis sativus]
Length=105

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 61/106 (58%), Gaps = 4/106 (4%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            MW++ A+I   L N   S R+ADESM  +  + P       R    S + + I RAP S+
Sbjct  1    MWQVFALIRPTLHNFTNSHRIADESMFTSTDQFPIYAAANNRRTFSSSI-FNIIRAPFSI  59

Query  353  FSCLSRPPANGSMDGVWVTGDF---AQMSEMNHLMVSDSMRYAILM  481
             SC + P  + S D  W++GD    + +SE+NHLMVSD MRYAILM
Sbjct  60   LSCFAPPAVHRSPDAFWLSGDHYFASTISEINHLMVSDGMRYAILM  105



>ref|XP_003617162.1| hypothetical protein MTR_5g088550 [Medicago truncatula]
 gb|AET00121.1| hypothetical protein MTR_5g088550 [Medicago truncatula]
Length=111

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 67/107 (63%), Gaps = 11/107 (10%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaa-aaeipaaVLGQrrgrrvsv----vvYGIFR  337
            MW +L    +NL N  KS +VADE+M       +   + G  R RR       +V+ I +
Sbjct  1    MWHLL----RNLNNTRKSSKVADENMFQQGNNIVEVQIFGHERRRRSQHGWGNIVFSILQ  56

Query  338  APLSLFSCLSRPPANGSMDGVWVTG-DFAQMSEMNHLMVSDSMRYAI  475
            AP+S+ SC+S P  NGS DG WV+G +F+Q+SEMNHLMV+DSMRY I
Sbjct  57   APISILSCVSHPQVNGS-DGAWVSGGEFSQISEMNHLMVNDSMRYVI  102



>ref|XP_004144535.1| PREDICTED: uncharacterized protein LOC101211016 [Cucumis sativus]
Length=121

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 61/104 (59%), Gaps = 7/104 (7%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYG------IF  334
            MWR+ A + +NL N+ KSPRVADESM     +    V     G R     YG      + 
Sbjct  1    MWRLAAAVRRNLHNIRKSPRVADESMYGGGVDGGGRVGAVVDGDRREGNSYGFSMIYSLL  60

Query  335  RAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMR  466
            R P S+ SC S+P  NG +DG+WV+G+F ++SE+NHLM S+  R
Sbjct  61   RTPFSILSCFSQPHVNG-VDGMWVSGEFPRISEVNHLMQSNLWR  103



>ref|XP_008455515.1| PREDICTED: uncharacterized protein LOC103495667 [Cucumis melo]
Length=162

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 61/105 (58%), Gaps = 8/105 (8%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLG-------QrrgrrvsvvvYGI  331
            MWR+ A + +NL N+ KSPRVADESM     +    V         +        ++Y +
Sbjct  41   MWRLAAAVRRNLHNIRKSPRVADESMYGGGVDGGGRVAAVVVDGDRREGNSYGFSMIYSL  100

Query  332  FRAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMR  466
             R P S+ SC S+P  NG +DG+WV+G+F ++SE+NHLM S+  R
Sbjct  101  LRTPFSILSCFSQPHVNG-VDGMWVSGEFPRISEVNHLMQSNLWR  144



>ref|XP_006282472.1| hypothetical protein CARUB_v10005863mg [Capsella rubella]
 gb|EOA15370.1| hypothetical protein CARUB_v10005863mg [Capsella rubella]
Length=176

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 7/110 (6%)
 Frame = +2

Query  170  SMWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYG------I  331
             M ++L+VI +NL N+ KSPRVADE+ L  +        G   G  V            I
Sbjct  68   EMTQMLSVIRRNLQNLRKSPRVADETDLQPSTAGSGQGGGGGGGGGVVTHGRRDGFNAVI  127

Query  332  FRAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             R P S+ SC + P  NG+ DG+W++GD+  +SE+N+LMVSD MRYAILM
Sbjct  128  MRFPFSIISCFAVPSVNGT-DGLWMSGDYGSVSEVNNLMVSDGMRYAILM  176



>ref|XP_011100609.1| PREDICTED: uncharacterized protein LOC105178762 [Sesamum indicum]
Length=101

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 62/104 (60%), Gaps = 4/104 (4%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGK-SPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLS  349
            MWRILA + +N  N+ K + RVADE++  A+A    A+    R             AP S
Sbjct  1    MWRILAALRRNFLNIKKNTSRVADENI--ASAATMDAITSPSRLSDGVPFFCCSLIAPFS  58

Query  350  LFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            L SCLS PP +G  DG+WV+ +  Q SE+ HLMV DS+RYAILM
Sbjct  59   LLSCLSHPPIDGP-DGLWVSAELPQTSEVTHLMVRDSLRYAILM  101



>emb|CDX93064.1| BnaA03g37860D [Brassica napus]
Length=91

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 67/103 (65%), Gaps = 12/103 (12%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            M ++L+V+ +NL ++ KSPRVADES L +       V G RR   V      + + PLS+
Sbjct  1    MLKMLSVLRRNLQSLRKSPRVADESALPSTT-----VNGDRRENGV------MMKFPLSI  49

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             SC + P  + + DGVWV+GD+ ++SE+NHLMV D MRYA+LM
Sbjct  50   MSCFAVPRGSRT-DGVWVSGDYGRVSEVNHLMVCDGMRYALLM  91



>ref|XP_009136150.1| PREDICTED: uncharacterized protein LOC103860315 [Brassica rapa]
Length=91

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 67/103 (65%), Gaps = 12/103 (12%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            M ++L+V+ +NL ++ KSPRVADES L +       V G RR   V      + + PLS+
Sbjct  1    MLKMLSVLRRNLQSLRKSPRVADESALPSTT-----VNGDRRENGV------MMKFPLSI  49

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             SC + P  + + DGVWV+GD+ ++SE+NHLMV D MRYA+LM
Sbjct  50   MSCFAVPRGSRA-DGVWVSGDYGRVSEVNHLMVCDGMRYALLM  91



>emb|CDY50046.1| BnaC03g44900D [Brassica napus]
Length=126

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 66/103 (64%), Gaps = 12/103 (12%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            M ++L+V+ +NL ++ KSPRVADES L +       V G RR   V      + + PL +
Sbjct  36   MLKMLSVLRRNLQSLRKSPRVADESALPSTT-----VNGDRRANGV------MMKFPLKI  84

Query  353  FSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             SC + P  + + DGVWV+GD+ ++SE+NHLMV D MRYA+LM
Sbjct  85   MSCFAVPRGSRA-DGVWVSGDYGKVSEVNHLMVCDGMRYALLM  126



>ref|XP_008342225.1| PREDICTED: uncharacterized protein LOC103405030 [Malus domestica]
Length=115

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 59/113 (52%), Gaps = 19/113 (17%)
 Frame = +2

Query  200  QNLGNMGKSPRVADESMLa-------------------aaaeipaaVLGQrrgrrvsvvv  322
            QN+ N+ KSPRVADESM+                           + L  R  +  S V 
Sbjct  3    QNIHNIRKSPRVADESMVNVGAGNPAPAGLPIFPAHHDHRHVDRRSSLRIRWIKGFSSVF  62

Query  323  YGIFRAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            Y +   P S  SC S+P      DGVW +G+F+Q++EMN LMVSDSMRYAILM
Sbjct  63   YSVVLVPFSAISCFSQPHHVHGADGVWASGEFSQITEMNQLMVSDSMRYAILM  115



>gb|EYU42732.1| hypothetical protein MIMGU_mgv1a017827mg [Erythranthe guttata]
Length=100

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 55/104 (53%), Gaps = 5/104 (5%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGK-SPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLS  349
            M RI   + ++  N  K + RVADE+     A          R         G+ RAP S
Sbjct  1    MLRIFVAMKRSFFNSNKNTSRVADENF----ATAAVDTRSPSRWNNGVSFFCGVLRAPFS  56

Query  350  LFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            L SCLS PP+    DGVWV+ +  Q SE+ HLMV DS+RYAILM
Sbjct  57   LLSCLSHPPSINGPDGVWVSAELPQTSEVTHLMVRDSLRYAILM  100



>ref|XP_010674723.1| PREDICTED: uncharacterized protein LOC104890820 [Beta vulgaris 
subsp. vulgaris]
Length=107

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 56/108 (52%), Gaps = 6/108 (6%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvs-----vvvYGIFR  337
            M R      +++    KSP+VADE+M            G+            +++Y I R
Sbjct  1    MSRTFTAFREHILTKRKSPKVADETMFVNGIGARIPTYGEEVDHSRQPWNGFLIIYTIVR  60

Query  338  APLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             P S+ SC S    N + D  WVTGD  + SE++HLMVSDSMRYAILM
Sbjct  61   IPFSILSCFSNRRGN-TADRTWVTGDPMRTSEIDHLMVSDSMRYAILM  107



>ref|XP_010112813.1| hypothetical protein L484_020045 [Morus notabilis]
 gb|EXC34928.1| hypothetical protein L484_020045 [Morus notabilis]
Length=88

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 7/58 (12%)
 Frame = +2

Query  329  IFRAP-LSLFSCLSRPPA------NGSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
            + RAP LSLFSC S+P +      N +  GVW +G+FAQ+SEMNHLMVSDSMRYAILM
Sbjct  31   VVRAPILSLFSCFSQPHSHVNGGNNFTAYGVWASGEFAQISEMNHLMVSDSMRYAILM  88



>ref|XP_010035451.1| PREDICTED: uncharacterized protein LOC104424666 [Eucalyptus grandis]
 gb|KCW46862.1| hypothetical protein EUGRSUZ_K00667 [Eucalyptus grandis]
Length=106

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 60/96 (63%), Gaps = 10/96 (10%)
 Frame = +2

Query  221  KSPRVADESMLaaaaeipaaVL-------GQrrgrrvsvvvYGIFRAPLSLFSCLSRPPA  379
            KS RVADE+ML         +         +R    + V+ +G+FRA +S+ SC S P  
Sbjct  12   KSSRVADEAMLGGGNRADLPIFVRDADGRAERGWSGLPVLFHGVFRAMVSVVSCFSPPHV  71

Query  380  NGSMDGVWVTG-DFA-QMSEMNHLMVSDSMRYAILM  481
            NG+ DGVWV+G +F  Q SEMNHL+VSDSMRYAILM
Sbjct  72   NGT-DGVWVSGHEFGHQASEMNHLIVSDSMRYAILM  106



>ref|XP_010666063.1| PREDICTED: uncharacterized protein LOC104883274 [Beta vulgaris 
subsp. vulgaris]
Length=115

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 62/116 (53%), Gaps = 14/116 (12%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaV------------LGQrrgrrvsv  316
            M R LA + Q++    KSP+VADE+M +  +   + +               R       
Sbjct  1    MLRTLATLRQHMITKRKSPKVADETMFSNISMDASGMPIYGAPHDINRSTSSRHASNGLS  60

Query  317  vvYGIFRAPLSLFSCLSRPPANGSMDGVWVTGDFAQM-SEMNHLMVSDSMRYAILM  481
            V+  IFR P S+ SC S+   N S D +WVTGD  +  SE++HLM+ DSMRYAILM
Sbjct  61   VISTIFRIPFSILSCFSQHHGNAS-DAIWVTGDMVRSPSEIDHLMICDSMRYAILM  115



>ref|XP_006856831.1| hypothetical protein AMTR_s00055p00169650 [Amborella trichopoda]
 gb|ERN18298.1| hypothetical protein AMTR_s00055p00169650 [Amborella trichopoda]
Length=110

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 61/113 (54%), Gaps = 13/113 (12%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPLSL  352
            MW +L  + ++L     S RV DES +A A      +  +            IFRAPL++
Sbjct  1    MWSLLLAMCKSLKG---SSRVVDESNIAVAPVNLPEIQPEIGRNPWKSGFLSIFRAPLAV  57

Query  353  FSCLSRP--------PAN--GSMDGVWVTGDFAQMSEMNHLMVSDSMRYAILM  481
             +C+SR         PA+   S DGVW +G+  ++SEMN+LMV DSMRYAI +
Sbjct  58   LACVSRHEGDFPGEFPASWPESRDGVWFSGEIPRISEMNYLMVRDSMRYAIFV  110



>gb|KGN43444.1| hypothetical protein Csa_7G037480 [Cucumis sativus]
Length=96

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +2

Query  323  YGIFRAPLSLFSCLSRPPANGSMDGVWVTGDFAQMSEMNHLMVSDSMR  466
            Y + R P S+ SC S+P  NG +DG+WV+G+F ++SE+NHLM S+  R
Sbjct  32   YSLLRTPFSILSCFSQPHVNG-VDGMWVSGEFPRISEVNHLMQSNLWR  78



>ref|XP_006298887.1| hypothetical protein CARUB_v10015007mg [Capsella rubella]
 gb|EOA31785.1| hypothetical protein CARUB_v10015007mg [Capsella rubella]
Length=88

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 19/105 (18%)
 Frame = +2

Query  173  MWRILAVISQNLGNMGKSPRVADESMLaaaaeipaaVLGQrrgrrvsvvvYGIFRAPL-S  349
            M ++L+V+ +      KSPRVADES +A +        G  +   V      + + P  S
Sbjct  1    MLKMLSVLRR------KSPRVADESAMAPSTVNE----GDHQEGSV------MMKFPFSS  44

Query  350  LFSCLSRPPANGSMDGVWVTGDFAQM-SEMNHLMVSDSMRYAILM  481
            + SC + P  + + DGVWV+GD+ ++ SE+NHLMV D MRYA+LM
Sbjct  45   IMSCFAVPRVSKT-DGVWVSGDYGKVTSEVNHLMVCDGMRYALLM  88



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 851710770112