BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21180_g1_i2 len=1254 path=[1232:0-437 1670:438-571 1804:572-597
1830:598-863 2096:864-900 2133:901-1253]

Length=1254
                                                                      Score     E

ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    346   2e-109   
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    341   1e-107   
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    337   3e-106   
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    337   3e-106   
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    334   5e-105   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    328   1e-102   
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    330   4e-102   
ref|XP_009761202.1|  PREDICTED: pectinesterase                          323   6e-101   
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    323   7e-101   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    325   2e-100   
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    322   3e-100   
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     322   3e-100   
ref|XP_002512459.1|  Pectinesterase precursor, putative                 320   1e-99    Ricinus communis
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    320   1e-99    
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     319   1e-99    
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     319   2e-99    
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    320   2e-99    
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    317   1e-98    
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     315   3e-98    
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    316   3e-98    
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    316   3e-98    
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    317   4e-98    
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    314   2e-97    
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         314   3e-97    
ref|XP_002314364.1|  putative pectinesterase family protein             314   3e-97    Populus trichocarpa [western balsam poplar]
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    313   8e-97    
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         312   1e-96    
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    311   1e-96    
emb|CBI39537.3|  unnamed protein product                                317   2e-96    
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    311   3e-96    
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     310   4e-96    
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     310   5e-96    
emb|CBI22967.3|  unnamed protein product                                323   7e-96    
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    310   2e-95    
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    310   2e-95    
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    312   2e-95    
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     308   2e-95    
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             309   2e-95    
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    308   4e-95    
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     308   4e-95    
emb|CDO98834.1|  unnamed protein product                                308   6e-95    
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             308   6e-95    
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    308   7e-95    
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    307   9e-95    
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    308   9e-95    
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    307   1e-94    
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                305   2e-94    
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    309   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872255.1|  pectinesterase family protein                      308   3e-94    
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                306   3e-94    
emb|CDP21547.1|  unnamed protein product                                308   3e-94    
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             306   3e-94    
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             309   4e-94    
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    305   5e-94    
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    309   5e-94    
ref|XP_002516960.1|  Pectinesterase precursor, putative                 305   6e-94    Ricinus communis
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    305   7e-94    
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             305   8e-94    
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                     304   1e-93    
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             309   1e-93    
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             305   1e-93    
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                     303   1e-93    
ref|XP_002884519.1|  pectinesterase family protein                      306   2e-93    
ref|XP_003555613.2|  PREDICTED: probable pectinesterase/pectinest...    304   2e-93    
emb|CDX99968.1|  BnaC09g03330D                                          306   2e-93    
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    303   4e-93    
ref|NP_001049858.1|  Os03g0300500                                       303   5e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                     301   8e-93    
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    303   8e-93    
dbj|BAC42986.1|  putative pectinesterase                                305   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          302   1e-92    
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             303   1e-92    
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    305   2e-92    Arabidopsis thaliana [mouse-ear cress]
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    305   4e-92    
ref|XP_006349952.1|  PREDICTED: probable pectinesterase/pectinest...    296   5e-92    
emb|CDY05188.1|  BnaC05g46150D                                          301   6e-92    
emb|CDY27751.1|  BnaA05g31600D                                          301   6e-92    
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    299   9e-92    
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                300   1e-91    
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    299   1e-91    
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                298   2e-91    
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                     298   2e-91    
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     298   2e-91    
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                     298   2e-91    
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                298   2e-91    
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                     298   3e-91    
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    305   6e-91    
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21     297   6e-91    
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    297   6e-91    
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     297   8e-91    
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         297   1e-90    
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...    297   1e-90    
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             296   1e-90    
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    296   1e-90    
ref|XP_004296866.1|  PREDICTED: probable pectinesterase/pectinest...    296   1e-90    
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...    295   5e-90    
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     298   5e-90    
ref|XP_010667122.1|  PREDICTED: pectinesterase                          295   8e-90    
ref|XP_010315470.1|  PREDICTED: pectinesterase                          295   9e-90    
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             297   1e-89    
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             294   1e-89    
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    296   1e-89    
emb|CDO98832.1|  unnamed protein product                                293   2e-89    
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    296   3e-89    
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    293   3e-89    
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    293   3e-89    
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    295   8e-89    
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    295   9e-89    
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    291   1e-88    
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    291   2e-88    
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    290   2e-88    
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    293   2e-88    
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    290   3e-88    
gb|EMT00224.1|  Putative pectinesterase/pectinesterase inhibitor 21     289   3e-88    
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    294   4e-88    
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    293   8e-88    
ref|XP_004252915.1|  PREDICTED: pectinesterase                          288   1e-87    
gb|KHN26239.1|  Putative pectinesterase/pectinesterase inhibitor 21     288   2e-87    
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                288   3e-87    
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg                288   3e-87    
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    287   4e-87    
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             287   4e-87    
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    287   6e-87    
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    290   7e-87    
ref|XP_003516937.1|  PREDICTED: probable pectinesterase/pectinest...    287   7e-87    
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    288   8e-87    
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    286   1e-86    
emb|CDY68790.1|  BnaAnng28400D                                          290   1e-86    
emb|CDX80613.1|  BnaC07g28310D                                          289   1e-86    
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    286   1e-86    
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    286   2e-86    
tpg|DAA44942.1|  TPA: hypothetical protein ZEAMMB73_754551              285   3e-86    
ref|XP_002865716.1|  pectinesterase family protein                      285   3e-86    
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    285   4e-86    
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900          284   5e-86    Sorghum bicolor [broomcorn]
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             285   6e-86    Populus trichocarpa [western balsam poplar]
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    284   6e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    285   9e-86    
emb|CDX74137.1|  BnaA03g29100D                                          287   2e-85    
ref|XP_006382447.1|  pectin methylesterase family protein               283   2e-85    
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    283   3e-85    
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             282   3e-85    
ref|XP_003557034.1|  PREDICTED: putative pectinesterase/pectinest...    277   5e-85    
ref|XP_003591168.1|  Pectinesterase                                     282   5e-85    
emb|CDO98833.1|  unnamed protein product                                281   5e-85    
gb|KHN02946.1|  Pectinesterase/pectinesterase inhibitor                 281   6e-85    
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    281   7e-85    
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...    281   1e-84    
ref|XP_003529556.1|  PREDICTED: pectinesterase/pectinesterase inh...    281   1e-84    
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    281   1e-84    
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21     280   1e-84    
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    281   2e-84    
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                     280   2e-84    
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...    281   2e-84    
ref|XP_009594458.1|  PREDICTED: pectinesterase                          283   3e-84    
ref|XP_003591164.1|  Pectinesterase                                     280   3e-84    
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28     280   4e-84    
dbj|BAK06954.1|  predicted protein                                      279   4e-84    
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    279   5e-84    
gb|EPS72184.1|  pectinesterase family protein                           278   7e-84    
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    279   7e-84    
dbj|BAC42959.2|  putative pectin methylesterase                         278   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003604119.1|  Pectinesterase                                     280   2e-83    
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                286   2e-83    
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    278   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    283   2e-83    
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...    278   3e-83    
ref|XP_003591166.1|  Pectinesterase                                     277   4e-83    
gb|AAF63815.1|  pectin methylesterase, putative                         276   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882495.1|  pectinesterase family protein                      276   1e-82    
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    276   1e-82    
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    276   1e-82    
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...    276   2e-82    
ref|XP_004487827.1|  PREDICTED: pectinesterase/pectinesterase inh...    276   2e-82    
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg             275   2e-82    
ref|XP_004515520.1|  PREDICTED: probable pectinesterase/pectinest...    275   2e-82    
ref|XP_004495691.1|  PREDICTED: probable pectinesterase/pectinest...    275   2e-82    
gb|AEL79481.1|  pectin methylesterase-like protein                      274   3e-82    
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     275   3e-82    
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    275   3e-82    
emb|CDY33925.1|  BnaA02g30620D                                          274   6e-82    
emb|CDY34927.1|  BnaA01g32580D                                          273   8e-82    
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    275   8e-82    
ref|XP_004508195.1|  PREDICTED: pectinesterase/pectinesterase inh...    273   1e-81    
gb|EPS59322.1|  pectinesterase                                          272   1e-81    
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...    273   1e-81    
ref|XP_002461260.1|  hypothetical protein SORBIDRAFT_02g043780          273   2e-81    Sorghum bicolor [broomcorn]
ref|XP_003626199.1|  Pectinesterase                                     273   2e-81    
gb|EPS70728.1|  pectinesterase                                          272   2e-81    
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             273   2e-81    
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             272   4e-81    
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    273   4e-81    
gb|EAZ05229.1|  hypothetical protein OsI_27427                          271   5e-81    Oryza sativa Indica Group [Indian rice]
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...    272   6e-81    
ref|XP_003550542.1|  PREDICTED: pectinesterase/pectinesterase inh...    271   6e-81    
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    271   9e-81    
ref|XP_004515516.1|  PREDICTED: probable pectinesterase/pectinest...    271   1e-80    
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg                273   2e-80    
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...    270   2e-80    
gb|EAZ41174.1|  hypothetical protein OsJ_25671                          270   2e-80    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060715.1|  Os07g0691100                                       269   3e-80    Oryza sativa Japonica Group [Japonica rice]
gb|EMS57827.1|  putative pectinesterase/pectinesterase inhibitor 21     267   3e-80    
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    269   4e-80    
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    268   5e-80    
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor                 269   5e-80    
emb|CDY24663.1|  BnaA05g30620D                                          269   5e-80    
ref|XP_004958780.1|  PREDICTED: probable pectinesterase/pectinest...    268   9e-80    
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg             271   1e-79    
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   269   1e-79    
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg             271   1e-79    
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg             271   1e-79    
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg             271   1e-79    
gb|AGT17860.1|  pollen-specific pectin methylesterase                   268   1e-79    
ref|XP_003604120.1|  Pectinesterase                                     268   2e-79    
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          267   2e-79    
ref|XP_009419138.1|  PREDICTED: pectinesterase-like                     266   2e-79    
ref|XP_003534836.1|  PREDICTED: pectinesterase/pectinesterase inh...    267   2e-79    
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     265   7e-79    
emb|CDY05295.1|  BnaC05g45080D                                          265   1e-78    
ref|XP_008370617.1|  PREDICTED: pectinesterase                          266   2e-78    
dbj|BAO02509.1|  predicted pectin esterase ortholog                     264   3e-78    
ref|XP_003559753.1|  PREDICTED: pectinesterase-like                     264   4e-78    
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     263   4e-78    
gb|EPS69059.1|  hypothetical protein M569_05708                         272   7e-78    
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                     263   7e-78    
gb|KHN03341.1|  Pectinesterase/pectinesterase inhibitor                 263   8e-78    
tpg|DAA64233.1|  TPA: pectinesterase                                    263   9e-78    
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                     261   2e-77    
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                     261   2e-77    
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative               261   4e-77    Ricinus communis
ref|XP_006658993.1|  PREDICTED: probable pectinesterase/pectinest...    261   6e-77    
ref|XP_007144961.1|  hypothetical protein PHAVU_007G198100g             260   1e-76    
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor                 260   1e-76    
ref|XP_007138937.1|  hypothetical protein PHAVU_009G250600g             259   3e-76    
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g             259   4e-76    
emb|CAB65290.2|  pectin methyl-esterase PER                             259   5e-76    Medicago truncatula
ref|XP_010932334.1|  PREDICTED: pectinesterase-like                     259   6e-76    
gb|EPS58111.1|  pectinesterase                                          252   7e-76    
ref|XP_008800480.1|  PREDICTED: probable pectinesterase/pectinest...    258   9e-76    
gb|KEH37212.1|  pectinesterase/pectinesterase inhibitor                 259   9e-76    
ref|XP_006342828.1|  PREDICTED: pectinesterase-like                     257   9e-76    
gb|KHN03958.1|  Putative pectinesterase/pectinesterase inhibitor 21     257   1e-75    
ref|XP_007031044.1|  Pectinesterase, putative                           258   2e-75    
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    257   2e-75    
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    257   2e-75    
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor                 257   2e-75    
gb|KHN43318.1|  Putative pectinesterase/pectinesterase inhibitor 21     255   6e-75    
gb|EPS65387.1|  pectinesterase                                          255   7e-75    
ref|XP_007154304.1|  hypothetical protein PHAVU_003G107300g             255   8e-75    
ref|XP_008783344.1|  PREDICTED: pectinesterase-like                     254   1e-74    
ref|XP_003553713.1|  PREDICTED: putative pectinesterase/pectinest...    255   1e-74    
ref|XP_009407600.1|  PREDICTED: pectinesterase-like                     254   2e-74    
gb|KHN20255.1|  Putative pectinesterase/pectinesterase inhibitor 21     251   2e-74    
ref|XP_009134931.1|  PREDICTED: probable pectinesterase/pectinest...    254   2e-74    
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    254   2e-74    
ref|XP_010937248.1|  PREDICTED: pectinesterase-like                     253   3e-74    
emb|CDX74078.1|  BnaA03g29690D                                          253   6e-74    
gb|KEH37213.1|  pectinesterase/pectinesterase inhibitor                 251   1e-73    
emb|CAB65291.1|  pectin methyl-esterase PEF1                            251   2e-73    Medicago truncatula
ref|XP_010939847.1|  PREDICTED: pectinesterase-like                     251   3e-73    
ref|XP_004298145.1|  PREDICTED: putative pectinesterase/pectinest...    250   6e-73    
ref|XP_008812392.1|  PREDICTED: pectinesterase-like                     248   5e-72    
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063              248   5e-72    
ref|XP_009405157.1|  PREDICTED: putative pectinesterase/pectinest...    248   1e-71    
ref|XP_008797350.1|  PREDICTED: pectinesterase 3                        247   1e-71    
ref|XP_009417804.1|  PREDICTED: pectinesterase-like                     247   1e-71    
ref|NP_001151322.1|  pectinesterase-1 precursor                         245   4e-71    Zea mays [maize]
ref|XP_010917368.1|  PREDICTED: pectinesterase 3 isoform X2             246   4e-71    
ref|XP_010917367.1|  PREDICTED: pectinesterase 3 isoform X1             246   4e-71    
ref|XP_007144962.1|  hypothetical protein PHAVU_007G198100g             244   8e-71    
ref|XP_002275819.3|  PREDICTED: pectinesterase-like                     244   9e-71    Vitis vinifera
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250          244   1e-70    
ref|XP_011005056.1|  PREDICTED: putative pectinesterase/pectinest...    244   2e-70    
ref|XP_006381543.1|  hypothetical protein POPTR_0006s13690g             244   2e-70    
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28     242   8e-70    
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28     241   1e-69    
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    241   3e-69    
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative               240   4e-69    Ricinus communis
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850          239   5e-69    Sorghum bicolor [broomcorn]
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    239   9e-69    
gb|KDP43631.1|  hypothetical protein JCGZ_16918                         238   1e-68    
gb|ACF79975.1|  unknown                                                 238   2e-68    
ref|XP_003632385.1|  PREDICTED: pectinesterase-like                     238   2e-68    
emb|CBI26012.3|  unnamed protein product                                238   3e-68    
ref|XP_002275000.1|  PREDICTED: pectinesterase                          238   3e-68    
ref|XP_002324181.2|  pectinesterase family protein                      237   7e-68    
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    237   1e-67    
emb|CAN67129.1|  hypothetical protein VITISV_040170                     244   1e-67    
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    236   2e-67    
ref|XP_010656076.1|  PREDICTED: putative pectinesterase/pectinest...    236   2e-67    
ref|XP_006578909.1|  PREDICTED: probable pectinesterase/pectinest...    236   2e-67    
ref|XP_007136533.1|  hypothetical protein PHAVU_009G053000g             235   3e-67    
dbj|BAA89480.1|  pectin methylesterase                                  235   4e-67    
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     234   6e-67    
ref|XP_010465322.1|  PREDICTED: pectinesterase 1-like                   234   7e-67    
gb|KHN04165.1|  Putative pectinesterase/pectinesterase inhibitor 28     231   9e-67    
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                     233   2e-66    
sp|Q42920.1|PME_MEDSA  RecName: Full=Pectinesterase/pectinesteras...    229   2e-66    
ref|XP_002528620.1|  Pectinesterase-4 precursor, putative               232   3e-66    
ref|XP_010487229.1|  PREDICTED: pectinesterase 1-like                   233   4e-66    
ref|XP_003526711.1|  PREDICTED: probable pectinesterase/pectinest...    232   5e-66    
ref|XP_004298254.1|  PREDICTED: putative pectinesterase/pectinest...    231   1e-65    
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                     230   2e-65    
ref|XP_002303172.1|  hypothetical protein POPTR_0003s01580g             230   2e-65    
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                     229   4e-65    
ref|XP_004151535.1|  PREDICTED: putative pectinesterase/pectinest...    229   4e-65    
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    229   5e-65    
ref|XP_004156120.1|  PREDICTED: putative pectinesterase/pectinest...    229   6e-65    
ref|XP_007148762.1|  hypothetical protein PHAVU_005G012000g             228   9e-65    
ref|XP_010501837.1|  PREDICTED: pectinesterase 1-like                   229   1e-64    
ref|XP_008242146.1|  PREDICTED: pectinesterase-like                     228   2e-64    
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...    228   3e-64    
ref|XP_010276571.1|  PREDICTED: uncharacterized protein LOC104611288    232   3e-64    
ref|NP_001052981.1|  Os04g0458900                                       226   4e-64    
ref|XP_007012506.1|  Pectinesterase                                     227   4e-64    
emb|CAH67075.1|  OSIGBa0097P08.5                                        226   5e-64    
gb|EAY94391.1|  hypothetical protein OsI_16158                          226   6e-64    
gb|EAY94388.1|  hypothetical protein OsI_16156                          226   6e-64    
ref|XP_008466374.1|  PREDICTED: pectinesterase-like isoform X1          226   7e-64    
ref|XP_010043041.1|  PREDICTED: putative pectinesterase/pectinest...    225   8e-64    
ref|XP_009391197.1|  PREDICTED: pectinesterase 3                        226   1e-63    
ref|XP_010273980.1|  PREDICTED: putative pectinesterase/pectinest...    226   1e-63    
ref|XP_010542351.1|  PREDICTED: pectinesterase 1                        226   1e-63    
gb|KHN26532.1|  Pectinesterase/pectinesterase inhibitor                 227   1e-63    
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg             225   1e-63    
ref|XP_004149498.1|  PREDICTED: probable pectinesterase/pectinest...    225   2e-63    
ref|XP_007203102.1|  hypothetical protein PRUPE_ppa023802mg             226   2e-63    
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                     225   2e-63    
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...    225   2e-63    
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...    225   2e-63    
gb|KGN49779.1|  hypothetical protein Csa_5G119700                       224   2e-63    
ref|XP_010107091.1|  putative pectinesterase/pectinesterase inhib...    225   2e-63    
gb|EPS66234.1|  hypothetical protein M569_08543                         225   3e-63    
ref|XP_011093900.1|  PREDICTED: pectinesterase-like                     224   3e-63    
ref|XP_008466391.1|  PREDICTED: pectinesterase-like isoform X3          224   4e-63    
gb|EPS69324.1|  hypothetical protein M569_05439                         224   5e-63    
ref|XP_011008693.1|  PREDICTED: pectinesterase-like                     223   5e-63    
ref|XP_010273801.1|  PREDICTED: pectinesterase                          224   6e-63    
ref|XP_002265217.1|  PREDICTED: pectinesterase 3                        224   6e-63    
ref|XP_007051270.1|  Plant invertase/pectin methylesterase inhibi...    223   6e-63    
gb|EYU28291.1|  hypothetical protein MIMGU_mgv1a003232mg                224   7e-63    
ref|XP_010273808.1|  PREDICTED: pectinesterase 3                        224   8e-63    
ref|XP_003578154.1|  PREDICTED: pectinesterase-like                     224   1e-62    
ref|XP_002304257.2|  pectinesterase family protein                      223   2e-62    
gb|AFW03475.1|  pectin methylesterase 1                                 223   2e-62    
ref|XP_009339254.1|  PREDICTED: putative pectinesterase/pectinest...    222   3e-62    
ref|XP_003609936.1|  Pectinesterase                                     222   3e-62    
ref|XP_006407095.1|  hypothetical protein EUTSA_v10022003mg             222   3e-62    
gb|EYU45917.1|  hypothetical protein MIMGU_mgv1a003666mg                221   4e-62    
ref|NP_001274969.1|  pectin methyl esterase                             221   4e-62    
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                     221   5e-62    
ref|XP_008356804.1|  PREDICTED: putative pectinesterase/pectinest...    221   6e-62    
ref|XP_008466382.1|  PREDICTED: pectinesterase-like isoform X2          221   6e-62    
ref|XP_008375414.1|  PREDICTED: putative pectinesterase/pectinest...    221   6e-62    
ref|XP_010029515.1|  PREDICTED: pectinesterase 3-like                   221   8e-62    
gb|AFB77929.1|  pectin methylesterase                                   221   9e-62    
ref|XP_006297279.1|  hypothetical protein CARUB_v10013297mg             221   9e-62    
gb|KDP33981.1|  hypothetical protein JCGZ_07552                         221   1e-61    
ref|XP_002298185.1|  hypothetical protein POPTR_0001s21650g             220   1e-61    
ref|XP_010267633.1|  PREDICTED: probable pectinesterase/pectinest...    221   1e-61    
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                     220   1e-61    
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     220   1e-61    
ref|XP_006338009.1|  PREDICTED: putative pectinesterase/pectinest...    220   1e-61    
ref|XP_002885032.1|  hypothetical protein ARALYDRAFT_318218             220   2e-61    
ref|XP_008391931.1|  PREDICTED: putative pectinesterase/pectinest...    220   2e-61    
ref|XP_008231878.1|  PREDICTED: probable pectinesterase/pectinest...    219   2e-61    
ref|XP_009351999.1|  PREDICTED: probable pectinesterase/pectinest...    220   3e-61    
ref|XP_006465803.1|  PREDICTED: pectinesterase 3-like                   219   3e-61    
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     219   3e-61    
ref|XP_006452912.1|  hypothetical protein CICLE_v10007819mg             219   3e-61    
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     219   3e-61    
ref|XP_010247944.1|  PREDICTED: probable pectinesterase/pectinest...    216   3e-61    
ref|XP_003588521.1|  Pectinesterase                                     219   4e-61    
gb|AFW03480.1|  pectin methylesterase 1                                 219   4e-61    
ref|XP_007149854.1|  hypothetical protein PHAVU_005G104100g             216   4e-61    
ref|XP_009355064.1|  PREDICTED: putative pectinesterase/pectinest...    218   5e-61    
gb|KHG08631.1|  Pectinesterase 3                                        218   6e-61    
ref|XP_009386320.1|  PREDICTED: pectinesterase-like                     219   6e-61    
ref|XP_004149499.1|  PREDICTED: putative pectinesterase/pectinest...    218   7e-61    
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                     218   8e-61    
ref|XP_007035986.1|  Plant invertase/pectin methylesterase inhibi...    218   9e-61    
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             218   1e-60    
ref|XP_006426799.1|  hypothetical protein CICLE_v10025232mg             218   1e-60    
emb|CDP19930.1|  unnamed protein product                                218   1e-60    
ref|XP_007024771.1|  Pectin methylesterase 3 isoform 2                  216   1e-60    
ref|XP_004499740.1|  PREDICTED: putative pectinesterase/pectinest...    218   1e-60    
ref|XP_004229041.1|  PREDICTED: pectinesterase-like                     218   1e-60    
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                     217   1e-60    
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    217   2e-60    
ref|XP_002298186.1|  hypothetical protein POPTR_0001s21630g             216   2e-60    
gb|EYU25006.1|  hypothetical protein MIMGU_mgv1a022121mg                217   2e-60    
emb|CAB95025.1|  pectin methylesterase                                  217   2e-60    
ref|XP_006828611.1|  hypothetical protein AMTR_s00129p00070300          218   2e-60    
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    217   3e-60    
ref|XP_011046152.1|  PREDICTED: pectinesterase-like                     216   3e-60    
ref|XP_010049073.1|  PREDICTED: probable pectinesterase/pectinest...    216   3e-60    
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg                216   3e-60    
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                     216   4e-60    
gb|EYU25005.1|  hypothetical protein MIMGU_mgv1a003670mg                216   4e-60    
gb|KDP28007.1|  hypothetical protein JCGZ_19087                         216   4e-60    
ref|NP_001289259.1|  probable pectinesterase/pectinesterase inhib...    217   4e-60    
ref|XP_004956918.1|  PREDICTED: putative pectinesterase/pectinest...    217   4e-60    
ref|XP_011072690.1|  PREDICTED: pectinesterase 3-like                   216   4e-60    
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               216   4e-60    
ref|XP_006474558.1|  PREDICTED: probable pectinesterase/pectinest...    216   5e-60    
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     216   5e-60    
dbj|BAF42038.1|  pectin methylesterase 1                                216   6e-60    
gb|KFK28345.1|  hypothetical protein AALP_AA8G504100                    219   6e-60    
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                     215   7e-60    
gb|KDP40628.1|  hypothetical protein JCGZ_24627                         216   8e-60    
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  215   8e-60    
gb|AFQ23194.1|  pectin methylesterase                                   215   9e-60    
ref|XP_002265171.1|  PREDICTED: pectinesterase                          216   9e-60    
ref|XP_009357300.1|  PREDICTED: probable pectinesterase/pectinest...    216   1e-59    
ref|XP_006651293.1|  PREDICTED: probable pectinesterase/pectinest...    208   1e-59    
gb|KHG23523.1|  putative pectinesterase/pectinesterase inhibitor ...    214   1e-59    
ref|XP_008245555.1|  PREDICTED: putative pectinesterase/pectinest...    214   1e-59    
ref|XP_009359677.1|  PREDICTED: putative pectinesterase/pectinest...    215   1e-59    
gb|KHG26122.1|  putative pectinesterase/pectinesterase inhibitor ...    214   2e-59    
ref|XP_007219746.1|  hypothetical protein PRUPE_ppa024156mg             214   2e-59    
ref|XP_008380988.1|  PREDICTED: probable pectinesterase/pectinest...    215   2e-59    
ref|XP_008376726.1|  PREDICTED: probable pectinesterase/pectinest...    215   2e-59    
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     214   2e-59    
ref|XP_010437784.1|  PREDICTED: putative pectinesterase/pectinest...    214   2e-59    
ref|XP_010526136.1|  PREDICTED: probable pectinesterase/pectinest...    214   3e-59    
ref|XP_004498516.1|  PREDICTED: probable pectinesterase/pectinest...    214   3e-59    
ref|XP_002875955.1|  pectinesterase family protein                      214   3e-59    
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3              213   3e-59    
ref|XP_002304256.1|  pectinesterase family protein                      214   3e-59    
gb|KHN04169.1|  Putative pectinesterase/pectinesterase inhibitor 21     212   4e-59    
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020          214   4e-59    
gb|ABZ89800.1|  pectin methylesterase-like protein                      214   4e-59    
ref|XP_003627458.1|  Pectinesterase                                     214   4e-59    
ref|XP_008646066.1|  PREDICTED: uncharacterized protein LOC100384...    214   4e-59    
gb|ABG46324.1|  putative pectin methylesterase                          209   4e-59    
gb|EMS65303.1|  putative pectinesterase/pectinesterase inhibitor 21     208   5e-59    
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24     213   5e-59    
ref|XP_007012502.1|  Pectin methylesterase 3                            213   5e-59    
ref|XP_008804471.1|  PREDICTED: pectinesterase-like                     213   5e-59    
ref|NP_190491.1|  putative pectinesterase/pectinesterase inhibito...    214   5e-59    
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...    213   5e-59    
gb|AAO85706.1|  pectin methyl-esterase                                  213   6e-59    
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...    213   6e-59    
ref|XP_010940182.1|  PREDICTED: pectinesterase 3-like                   216   6e-59    
ref|XP_010038523.1|  PREDICTED: pectinesterase-like                     213   6e-59    
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    213   6e-59    
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     213   7e-59    
ref|XP_009773400.1|  PREDICTED: pectinesterase 1                        213   7e-59    
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...    213   8e-59    
ref|XP_009135375.1|  PREDICTED: pectinesterase 1-like                   213   8e-59    
ref|XP_004235526.1|  PREDICTED: pectinesterase 3                        212   8e-59    
ref|XP_010247575.1|  PREDICTED: probable pectinesterase/pectinest...    216   8e-59    
emb|CDY36608.1|  BnaC06g06610D                                          213   9e-59    
ref|XP_008466403.1|  PREDICTED: pectinesterase-like                     212   9e-59    
ref|XP_011046142.1|  PREDICTED: pectinesterase-like                     212   1e-58    
ref|XP_008460354.1|  PREDICTED: pectinesterase 3                        212   1e-58    
ref|XP_011036546.1|  PREDICTED: pectinesterase 3-like                   213   1e-58    
ref|XP_003598363.1|  Pectinesterase                                     212   1e-58    
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    212   1e-58    
gb|AFI23414.1|  pectin methylesterase                                   212   1e-58    
ref|XP_009800039.1|  PREDICTED: pectinesterase-like                     212   1e-58    
ref|XP_011079312.1|  PREDICTED: pectinesterase 1-like                   212   1e-58    
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     212   1e-58    
ref|XP_004144445.1|  PREDICTED: pectinesterase 3-like                   212   1e-58    
ref|XP_006841646.1|  hypothetical protein AMTR_s00003p00238240          211   2e-58    
emb|CDY24071.1|  BnaA06g00690D                                          212   2e-58    
ref|XP_009596446.1|  PREDICTED: probable pectinesterase/pectinest...    212   2e-58    
ref|XP_006279604.1|  hypothetical protein CARUB_v10026136mg             212   2e-58    
emb|CDY19737.1|  BnaA09g03900D                                          210   2e-58    
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             212   2e-58    
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   212   2e-58    
ref|XP_004240956.1|  PREDICTED: probable pectinesterase/pectinest...    212   2e-58    
ref|XP_004303759.1|  PREDICTED: pectinesterase 3-like                   212   2e-58    
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         211   2e-58    
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     211   2e-58    
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   212   2e-58    
ref|XP_008228105.1|  PREDICTED: pectinesterase                          211   2e-58    
ref|XP_008337792.1|  PREDICTED: probable pectinesterase/pectinest...    212   3e-58    
emb|CDO97788.1|  unnamed protein product                                212   3e-58    
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             211   3e-58    
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    211   3e-58    
ref|XP_010687597.1|  PREDICTED: pectinesterase                          211   3e-58    
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             211   3e-58    
ref|XP_002865971.1|  pectinesterase family protein                      211   3e-58    
ref|XP_007220895.1|  hypothetical protein PRUPE_ppa003047mg             211   4e-58    
ref|XP_010266532.1|  PREDICTED: probable pectinesterase/pectinest...    211   4e-58    
ref|XP_006661265.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    211   5e-58    
ref|XP_006342896.1|  PREDICTED: pectinesterase 3-like                   210   5e-58    
gb|ABQ42392.1|  pectin methylesterase-like protein                      211   5e-58    
emb|CDX75763.1|  BnaC03g38460D                                          211   5e-58    
ref|XP_009589773.1|  PREDICTED: pectinesterase-like                     210   5e-58    
ref|XP_010106130.1|  putative pectinesterase/pectinesterase inhib...    210   5e-58    
ref|XP_008234745.1|  PREDICTED: probable pectinesterase/pectinest...    211   5e-58    
gb|KDP33985.1|  hypothetical protein JCGZ_07556                         211   5e-58    
ref|XP_010501045.1|  PREDICTED: pectinesterase 2-like                   211   5e-58    
ref|NP_200149.1|  pectin methylesterase PCR fragment F                  210   7e-58    
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    210   7e-58    
ref|XP_010029513.1|  PREDICTED: pectinesterase 3-like                   210   8e-58    
ref|XP_003602238.1|  Pectinesterase                                     210   9e-58    
ref|XP_009147579.1|  PREDICTED: pectinesterase 1                        210   1e-57    



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   346 bits (887),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 245/338 (72%), Gaps = 8/338 (2%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I SSTKA++ +C+PT ++E C K L A A N+TD KELV+V F +  + +++ +K S TL
Sbjct  60    ITSSTKAIQAICQPTDYKETCEKSLEAEAGNTTDPKELVKVGFKIATRSLNEAIKNSTTL  119

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +  AKDPRT++A + C+ELL+ +IDD+ ++ +R+     +   LD ++ D+K+WLSGALT
Sbjct  120   KELAKDPRTNQALQNCRELLEYAIDDLNQSFERIGTFQMS--KLDDFVADLKIWLSGALT  177

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RKLLA  791
             +E TCL+GF  T GD+  +M++ L +AQQ+T N L +V+E+   L SL + G++ R+LL 
Sbjct  178   YEQTCLDGFENTTGDAGVRMQEFLKSAQQMTTNGLGIVNELSTILGSLQLPGMSGRRLLE  237

Query  792   DS-RSLPVWATAAQRRLLEA---PVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIH  959
             D  R +P W +  +RRL++A    + PD+VVA+DGSGKYKTIN A+ D+PLKSNK+FVIH
Sbjct  238   DDDREMPSWVSDGKRRLMQAGAAAMKPDLVVAQDGSGKYKTINAALADVPLKSNKTFVIH  297

Query  960   IKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKN  1139
             +KAG+YKE VV+ K M ++   GDGPTKT+++GS +++ G QT +T T    G+ F  ++
Sbjct  298   VKAGIYKEIVVIPKHMTHLTMYGDGPTKTVVTGSLNFIDGIQTFKTATFSAIGANFYARD  357

Query  1140  IGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +G ENTAG   HQAVALRVQSD++IF NCQID YQDTL
Sbjct  358   MGFENTAGAAKHQAVALRVQSDRSIFFNCQIDGYQDTL  395



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   341 bits (875),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/338 (49%), Positives = 243/338 (72%), Gaps = 8/338 (2%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I SSTKA++ +C+PT ++E C K L A A N+TD KELV+V F +  + +++ ++ S TL
Sbjct  59    ISSSTKAIQAICQPTDYKETCEKSLMAEAGNTTDPKELVKVGFKIATRSLNEAIRNSTTL  118

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             Q  +KDPRT++A + C+ELL+ +IDD+  + +R+     +   LD ++ D+K+WLSGALT
Sbjct  119   QELSKDPRTNQALQNCRELLEYAIDDLNESFERIGTFQMS--KLDEFVADLKIWLSGALT  176

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RKLLA  791
             +E TCL+GF  T GD+  +M++ L +AQ++T N L +V+E+   L SL I G+  R+LL 
Sbjct  177   YEQTCLDGFENTTGDAGTRMQEFLKSAQEMTTNGLGIVNELSTILGSLQIPGMTGRRLLE  236

Query  792   DS-RSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIH  959
             D    +P W +  +RRL++A    + PD++VA+DGSGKYKTIN A+ D+PLKSNK+FVI+
Sbjct  237   DDDHEMPSWISDGKRRLMQAGAAGMKPDLIVAQDGSGKYKTINAALADVPLKSNKTFVIY  296

Query  960   IKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKN  1139
             +KAG+YKE VV+ K M ++   GDGPTKT+++GS +++ G QT +T T    G+ F  ++
Sbjct  297   VKAGIYKEIVVIPKHMTHLTMYGDGPTKTVVTGSLNFIDGIQTFKTATFSAIGANFYARD  356

Query  1140  IGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +G ENTAG   HQAVALRVQSD++IF+NCQID YQDTL
Sbjct  357   MGFENTAGSAKHQAVALRVQSDRSIFYNCQIDGYQDTL  394



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   337 bits (865),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 172/342 (50%), Positives = 241/342 (70%), Gaps = 12/342 (4%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++ ++TKA++ +C+PT +RE C   L SAA N++D KEL++ AFNV +  IS  ++ S T
Sbjct  56    SVSTTTKAIQAICQPTDYRETCENSLTSAAGNTSDPKELIKAAFNVAIDHISAAIRNSST  115

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L+  AKD RT++A   C ELL+ +IDD+K + DR+         LD Y++D+K+WLSGA+
Sbjct  116   LKELAKDSRTNQALSNCDELLKYAIDDLKESFDRIGPFEYE--KLDEYVDDLKIWLSGAI  173

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA-GLNRKLL  788
             T+E TCL+GF  T G++  +MK +L ++Q+LT N L MV EI   L S ++   ++R+LL
Sbjct  174   TYEQTCLDGFENTTGEAGLRMKAMLRSSQELTSNGLAMVTEISSILASYNLPFNVSRRLL  233

Query  789   A----DSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKS  947
             +    D   L  W +  +RRLL+A    +  DVVVAKDGSGKY+T+NEA+ DIP K NK+
Sbjct  234   SSEDGDDTELS-WLSDGKRRLLQATGKTIKADVVVAKDGSGKYRTVNEALKDIPKKGNKT  292

Query  948   FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGF  1127
             FVI+IK GVYKE V+  K M +V+ +GDGPTKT I+GS +++ G QT +T TV V GS F
Sbjct  293   FVIYIKQGVYKEQVMFAKSMTHVMIIGDGPTKTRITGSLNFIDGVQTFKTATVSVIGSNF  352

Query  1128  MGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             + K+IG EN+AGP+ HQAVALRVQSD +IF+NC +D YQDTL
Sbjct  353   IAKDIGFENSAGPQKHQAVALRVQSDMSIFYNCHMDGYQDTL  394



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   337 bits (865),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/347 (49%), Positives = 233/347 (67%), Gaps = 17/347 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I +S KA++ +C+PT ++E CV  L SA  N++D KELV  AF V + +IS  ++ S TL
Sbjct  58    ISTSVKAIQAICQPTDYKEACVNSLTSAKANTSDPKELVRTAFQVAINQISSALQNSTTL  117

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +   KDPRT  A + C EL+  +IDD++ + +++       + +D Y+ D+K+WLSGALT
Sbjct  118   RDLEKDPRTKGALENCHELMDYAIDDLRNSFNKL--GVFDISKIDDYVEDLKIWLSGALT  175

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+GF  T GD+ +KMK LL +A +LT N L M+DEI   L +L I G++R+LL+D
Sbjct  176   YQETCLDGFENTTGDAGEKMKALLKSAGELTSNGLAMIDEISSVLTNLQIPGISRRLLSD  235

Query  795   S------RS-----LPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPL  932
                    RS      P WA+  QR+L +A    + P+V+VA+DGSGKYKTINEA+ +IP 
Sbjct  236   ESGKGEYRSDEGGLYPSWASVGQRKLFQATPDTIKPNVIVAQDGSGKYKTINEALVEIPK  295

Query  933   KSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIV  1112
               N +FV+++K GVYKE V  TK M NV+ +GDGPTKT ISGS +++ G  T  T TV  
Sbjct  296   NGNTTFVLYVKEGVYKEQVNFTKSMTNVMLIGDGPTKTTISGSLNFIDGIGTFRTATVAA  355

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              GS FM K+IG EN AG   HQAVALRV SD AIF+NC++D YQDTL
Sbjct  356   VGSNFMAKDIGFENNAGASKHQAVALRVGSDMAIFYNCRMDGYQDTL  402



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   334 bits (857),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 167/338 (49%), Positives = 235/338 (70%), Gaps = 10/338 (3%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             +S K+++ +C+PT +RE CVK LSAA  NSTD K+L+   F V + ++   ++ S  ++ 
Sbjct  60    TSMKSIQSICEPTDYRETCVKSLSAAGGNSTDPKDLIRTGFQVAINQVKAAIENSTVVKD  119

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFE  620
              AKDPR+ +A + CQ LL+ SIDD++ + +R+   A   +NLD YM D+ VWLSGA+TF+
Sbjct  120   LAKDPRSKQALETCQHLLEYSIDDLQSSFERL--GAFDVSNLDKYMADLHVWLSGAITFQ  177

Query  621   NTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLADSR  800
              +CL+GF  T G +A KMK++L  +++LT N L MV EI   L SL+I  ++R+LL + +
Sbjct  178   ESCLDGFENTTGAAAKKMKQILQGSRELTSNGLAMVTEISSLLGSLNIPDVSRRLLTEEQ  237

Query  801   ----SLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIH  959
                   P W    +R+LL A    + PDVVVA+DGSGKYKTI EA+ ++P K+NK+FVI+
Sbjct  238   DGIPEFPSWVDEGRRKLLAAAPKDIKPDVVVAQDGSGKYKTIREALNEVPKKNNKTFVIY  297

Query  960   IKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKN  1139
             IK GVYKE V++ KK  NV+ +GDGPTKT+I+GS +YV G QT  T T    GS F+ K+
Sbjct  298   IKEGVYKEKVLVDKKTTNVMIIGDGPTKTVITGSLNYVDGVQTCNTATFTAIGSYFIAKD  357

Query  1140  IGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             I  EN+AG E HQAVALRVQSD ++ +NC +DA+QDTL
Sbjct  358   IKFENSAGAEKHQAVALRVQSDMSVIYNCHMDAFQDTL  395



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   328 bits (841),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 235/350 (67%), Gaps = 20/350 (6%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             K + +S KA+E +C+P  ++E CVK L +A  N TD KEL++  FNV MK+IS+  +KS 
Sbjct  44    KEVSASMKAIEAMCQPADYKESCVKSLETAGPNVTDPKELIKAGFNVAMKKISEAAEKSV  103

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM--VDHAGAGANLDLYMNDIKVWLS  602
             TL+  AKDPRTS+A + C+EL++ +IDD++ + D++  +D +     +D ++ D+K WL 
Sbjct  104   TLKELAKDPRTSQALQNCKELMEYAIDDLQSSFDKLGGLDMS----KVDDFLADLKTWLG  159

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL--N  776
              ++T++ TCL+GF  T  D+ +KM+K L    +LT N L MV EI   L +L++  L  N
Sbjct  160   ASITYQETCLDGFENTTSDAGEKMRKALNATAELTSNGLAMVTEISSVLANLNLNFLSGN  219

Query  777   RKLLADSR-------SLPVWATAAQRRLLEAPV----TPDVVVAKDGSGKYKTINEAIPD  923
             R+LL DS          P+W    +RRLL+A V     PD+VVAKDGSGKYKTI EA+ D
Sbjct  220   RRLLQDSEVQVLGHGEFPMWMDPVRRRLLQAKVGVNLKPDLVVAKDGSGKYKTITEALKD  279

Query  924   IPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGT  1103
             IPL+SNK+FV+++K GVY+E ++  KKM  +  +GDGPTKT I  + +YV G  T +T T
Sbjct  280   IPLRSNKTFVLYVKEGVYREQIIFDKKMWRLTLIGDGPTKTRIVYNSNYVDGVNTFKTAT  339

Query  1104  VIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             V V G  F+ K+IG EN AG   HQAVALRVQSD ++F+NC +D YQDTL
Sbjct  340   VAVLGEQFLAKDIGFENDAGAIKHQAVALRVQSDFSVFYNCHMDGYQDTL  389



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   330 bits (845),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 167/341 (49%), Positives = 237/341 (70%), Gaps = 13/341 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             I +STKA++ +C+PT +RE C K LS+A N+TD KEL+++ F   + EI KV+  S T++
Sbjct  166   ISTSTKAIKAICQPTDYRETCEKSLSSA-NTTDPKELIKIGFQAAISEIKKVIANSSTVK  224

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTF  617
               AKDP   +A + C EL+  +IDD+K + +++ +   +   LD Y+ ++K+WL GA+T+
Sbjct  225   EVAKDPMARQALENCHELMDYAIDDLKNSFNQLGEFDFS--KLDEYIENLKIWLGGAITY  282

Query  618   ENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL------NR  779
             + TCL+GF+ T G++  KM+ LL T+Q+LT N L MV EI   L +L+I  +       R
Sbjct  283   QQTCLDGFMNTTGEAGKKMQALLKTSQELTSNGLAMVSEISSILGNLNIQNIGEISTGQR  342

Query  780   KLLADSRSLPVWATAAQR-RLLEAPVT--PDVVVAKDGSGKYKTINEAIPDIPLKSNKSF  950
             +L A++   P+W ++ QR R+ + P T  P+VVVAKDGSGKY +INEA+ ++P  +  +F
Sbjct  343   RLFAEN-GFPMWVSSEQRSRIRQTPATIKPNVVVAKDGSGKYTSINEALQEVPKDNPTTF  401

Query  951   VIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFM  1130
             VI+IKAGVYKE V++TK M NV+F+GDG TKT I+G  +Y  G  T  T TV V G GF+
Sbjct  402   VIYIKAGVYKEQVIVTKSMTNVMFIGDGRTKTKITGDLNYADGTGTFRTATVGVVGDGFI  461

Query  1131  GKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              K+IG ENTAG   HQAVALRVQSDQ+IF+NCQ+D YQDTL
Sbjct  462   AKDIGFENTAGAIKHQAVALRVQSDQSIFYNCQMDGYQDTL  502



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   323 bits (827),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 159/339 (47%), Positives = 232/339 (68%), Gaps = 14/339 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             I +STK+V+ +C+PT ++E C K L++A N++D KEL++VAF  T+ +I   MK +  +Q
Sbjct  48    ISTSTKSVQAMCQPTDYKEACEKSLASAKNTSDPKELIKVAFESTITDIKNAMKNTSLIQ  107

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLS  602
              AAKDPRT +A + C+ LL  SIDD++R+ D++          D+     Y +D+K W+S
Sbjct  108   EAAKDPRTKDALQTCESLLNVSIDDLRRSFDKV-------GTFDINKIKDYTDDLKTWIS  160

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRK  782
              ++T++ TCL+ F  T G++ +KMKKLL TA +LT N L MV    + L +L I G++R+
Sbjct  161   ASITYQETCLDAFENTTGETGEKMKKLLKTAGELTSNGLAMVSSFGEMLTNLHIPGISRR  220

Query  783   LLA-DSRSLPVWATAAQRRLLE-APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             LL  DS     +  A  RRLL+ +   P+ VVA+DGSG+YKTI EA+  +P K+N+++VI
Sbjct  221   LLTTDSEYTSAFVEAGSRRLLQVSGAKPNAVVAQDGSGQYKTIKEALKAVPPKNNQTYVI  280

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGK  1136
              IKAG YKE V + + M+NVVF+G+GPTKT I+G++++  G  T  T TV V G GF+ +
Sbjct  281   LIKAGEYKEMVDIPRSMINVVFIGEGPTKTKITGNKNFADGTGTYHTATVAVNGDGFVAR  340

Query  1137  NIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +IG ENTAG + HQAVALRV +D+ +F+NC ID YQDTL
Sbjct  341   DIGFENTAGAKKHQAVALRVSADKTVFYNCNIDGYQDTL  379



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   323 bits (829),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 162/348 (47%), Positives = 234/348 (67%), Gaps = 15/348 (4%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             ++ I +S KA++ +C+PT ++E C+K LS AA N+TD K+LV++AF +  K+I + + +S
Sbjct  50    DEQIQTSMKAIKAICQPTDYKETCIKSLSSAAGNTTDPKDLVKIAFKIATKQIKEAVNRS  109

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
               L+   KDPR S+A   C+EL+  +ID++  + D +        +  L   ++K+WLS 
Sbjct  110   VVLKELEKDPRASKALANCRELMDYAIDELNSSFDELGSIDIDDIDDAL--ENLKIWLSA  167

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKL  785
             +LT++ TCL+GF  T G++ + M+K L TA +LT N L MV E+   L SL +    R L
Sbjct  168   SLTYQETCLDGFQNTTGNAGESMRKALKTAGELTQNGLAMVTEVASILTSLQMPSKRRLL  227

Query  786   LADSRS---------LPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIP  929
              ++ +S          P W +AA+RRLL A    + P++ VAKDGSGKYKTI+EA+  +P
Sbjct  228   SSEQQSQCPFAMEDEFPTWTSAAKRRLLAASRANIKPNITVAKDGSGKYKTISEALRHVP  287

Query  930   LKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVI  1109
               SN++FVIHIKAGVY E V + + M +++ +GDGPTKT I+G++++V G  T +T TV 
Sbjct  288   KNSNETFVIHIKAGVYHEQVQINRSMTHLMIIGDGPTKTKITGNKNFVDGTPTFKTATVA  347

Query  1110  VKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             V G GFM K+IG EN+AGPE HQAVALRVQSD +IF+NCQID YQDTL
Sbjct  348   VIGDGFMAKDIGFENSAGPEKHQAVALRVQSDMSIFYNCQIDGYQDTL  395



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   325 bits (832),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 228/339 (67%), Gaps = 7/339 (2%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  422
             GN  I +S KA++ VC PT +++ C + L+  A N+TD  ELV+ AF+VTMK+I++  KK
Sbjct  50    GNGEITASVKAIKEVCAPTDYKKTCEETLTKNAKNTTDPMELVKTAFDVTMKQIAEAAKK  109

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S+TL    KDPRT  A   C+EL+  +ID++K + + +         LD  + ++++WLS
Sbjct  110   SQTLVELQKDPRTKMALDQCRELMNYAIDELKSSFEELGKFEFH--KLDEALINLRIWLS  167

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-R  779
              A++ E TCLEGF  T+G++ + MKK L TA QLT N L MV E+ + +  LDI GLN R
Sbjct  168   AAISHETTCLEGFEQTQGNAGETMKKALKTAIQLTHNGLAMVSEMSNFVGQLDIPGLNSR  227

Query  780   KLLADSRSLPVWATAAQRRLLEA-PVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             +LL  S   P W     R LL A  V PD+VVA+DGSG+YKTINEA+ +IP K N +FV+
Sbjct  228   RLL--SSDYPSWVGPRSRHLLAATEVKPDIVVAQDGSGQYKTINEALDNIPKKRNSTFVV  285

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGK  1136
             HIKAG+YKE + + + M N+VF+GDGP KTIISG + +  G  T  T TV + G  F+ K
Sbjct  286   HIKAGLYKEYIQVNRSMTNLVFIGDGPDKTIISGDKGFKDGITTFRTQTVAIIGDNFIAK  345

Query  1137  NIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             NIG ENTAG   HQAVA+RVQSD A+FHNC+ D YQDTL
Sbjct  346   NIGFENTAGAIKHQAVAVRVQSDMAVFHNCRFDGYQDTL  384



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   322 bits (824),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/342 (47%), Positives = 232/342 (68%), Gaps = 12/342 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S KA+E +C+PT ++E CV+ L  A  N+ D KEL++ +F   MK I++  KKS  L
Sbjct  53    VSASIKAIEGICQPTDYKEACVRSLREAGANTADPKELIKASFKAAMKHIAEAAKKSTVL  112

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +   K PR  +A   C++L+  +I+D++R+ D++ +   +   LD  + D+KVWLS  +T
Sbjct  113   KELEKTPRAQQALSNCKKLMGFAINDLERSFDKLGELEFS--KLDDALADLKVWLSAVVT  170

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             +++TCL+GF  T G++  KM++ L ++++LT N L MVDEI  AL  +++   NRKLL+D
Sbjct  171   YQDTCLDGFQNTTGNAGHKMREALKSSEELTSNVLAMVDEISLALAKMNLTNFNRKLLSD  230

Query  795   SR------SLPVWATAAQRRLLE---APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKS  947
                        +WAT+ +R+LL    A + P++VVAKDGSG+++TINEA+  IPL S K+
Sbjct  231   DNVIGHGDDFSMWATSLKRKLLSKTVAKLKPNLVVAKDGSGRFRTINEALKHIPLNSRKT  290

Query  948   FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGF  1127
             FV+HIKAGVYKE VV  +KM NV+ VGDGPTKT IS +++Y  G  T +T TV V G  F
Sbjct  291   FVLHIKAGVYKEQVVFDEKMTNVMLVGDGPTKTRISFNKNYADGTTTFKTATVSVFGDNF  350

Query  1128  MGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             + ++IG EN+AG   HQAVAL V+SD AIFHNC +D YQDTL
Sbjct  351   IARDIGFENSAGAIKHQAVALMVRSDMAIFHNCHMDGYQDTL  392



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   322 bits (824),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 165/340 (49%), Positives = 231/340 (68%), Gaps = 10/340 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I +STKAV+ +C+PT ++E C K LS A TN++D +EL++  F+V + EI   +  S  L
Sbjct  50    ISTSTKAVQALCQPTDYKETCEKALSEAGTNTSDPRELIKSGFHVAVNEIKWAIGNSTQL  109

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             + AA DP   +A   C EL+  +IDD+  + DR+ D+      L+ Y+ D+K+WLSGALT
Sbjct  110   KEAASDPMAKQALDACGELMDYAIDDLVISFDRITDNFDV-QKLNDYVEDLKIWLSGALT  168

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TC++GF    GD+ +KM KLL T+++LT N L+MV E++  + S  +  + R+LL +
Sbjct  169   YQETCIDGFENVTGDTGEKMAKLLKTSKELTSNGLDMVSEVNSIMTSFGLPAVGRRLLTE  228

Query  795   SRSL----PVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
               +     P W    +R LL+A    V  DVVVAKDGSGKYKT+ EA+ D+P KSNK+FV
Sbjct  229   ESNQQEEEPSWV-GDRRGLLQATGATVKADVVVAKDGSGKYKTVTEALNDVPKKSNKTFV  287

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             IH+KAGVY+E V++ K M  V+ +GDGPTKT I+  ++YV G  T +T TV V GS F+ 
Sbjct  288   IHVKAGVYQEQVMVDKSMTWVMMIGDGPTKTKITAGKNYVDGTPTFKTATVSVIGSNFIA  347

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             K+IG EN+AG   HQAVALRVQSD +IF+NCQ+D YQDTL
Sbjct  348   KDIGFENSAGAAKHQAVALRVQSDMSIFYNCQMDGYQDTL  387



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   320 bits (821),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/349 (46%), Positives = 230/349 (66%), Gaps = 16/349 (5%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             +K + +S KA++ +C+PT++++ C + L+ +A N+TD KEL+++AF +  K+I    KKS
Sbjct  53    SKEVSASMKAIKTLCQPTYYKQTCERSLAKSAGNTTDPKELIKIAFKLAEKQIDSASKKS  112

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
              TL    KDPRT  A   C+EL+  SI++++ +L+++ D   +   LD  M DIK WLS 
Sbjct  113   LTLLELEKDPRTRGALNSCKELMTMSINELRSSLEKVADFDFS--QLDELMADIKTWLSA  170

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKL  785
             A+T+E TCL+ F  T  ++ +KMKK L TA +++ N L++V  I   L  L I G++R+L
Sbjct  171   AITYEETCLDAFENTTTNAGEKMKKALKTAMEMSSNGLDIVSGISSVLTDLQIPGVSRRL  230

Query  786   LAD----------SRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDI  926
             L D          S++ P W     RRLL AP   + PD+VVAKDGSG YKTI EA+P I
Sbjct  231   LQDDIPVAGHGDISQAFPAWIDPGTRRLLSAPPSNIKPDLVVAKDGSGDYKTILEALPQI  290

Query  927   PLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTV  1106
             P KSN++FV++IK G+Y+E V   + M N+V +GDGP KT I+GS+++V G  T  T TV
Sbjct  291   PKKSNETFVLYIKEGIYEEYVEFNRSMTNLVVIGDGPDKTRITGSKNFVDGINTYRTATV  350

Query  1107  IVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              V G  F+ +NIG EN+AG   HQAVALRV SD A+F+NC +D YQDTL
Sbjct  351   AVIGDNFVARNIGFENSAGAIKHQAVALRVSSDYAVFYNCSMDGYQDTL  399



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   320 bits (820),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/340 (48%), Positives = 225/340 (66%), Gaps = 14/340 (4%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             +++KA+  +C+PT + E C   L+A A N TD K+LVE++F   M  + +    S  LQ 
Sbjct  60    TTSKAIRAICRPTDYAEECQSSLAARAGNVTDPKKLVELSFTSAMDSLREAFNHSSVLQE  119

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRM--VDHAGAGANLDLYMNDIKVWLSGALT  614
             AAKDPRTSEA + C+ELL  +IDD+K ++ R   VD A     +   ++D+KVWLS  +T
Sbjct  120   AAKDPRTSEALENCKELLDYAIDDLKNSVARFGGVDMA----KMSDVVDDLKVWLSATIT  175

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+GF  T GD+AD M K L ++  LT N L ++D I   L S  ++ L R+LL+D
Sbjct  176   YQQTCLDGFDNTTGDAADNMSKALNSSSALTSNALAIIDGISSVLASFQLSSLGRRLLSD  235

Query  795   SRS----LPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
                     P W    +R+LL      + PDV VA+DGSGKYKTI +A+  +P K N +FV
Sbjct  236   DEGERGEFPSWVGNDKRKLLALSTKDIKPDVTVAQDGSGKYKTITQALSAVPKKGNATFV  295

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             I+IK GVYKENV++ + M NV+  GDGPTKT I+GS +YV G  T +T T+ V G GF+G
Sbjct  296   IYIKEGVYKENVMVDRSMTNVMMFGDGPTKTKITGSLNYVDGTSTFKTATLAVVGDGFIG  355

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             KN+G+ENTAG   HQAVALRVQSD+++F+ CQ+D YQDTL
Sbjct  356   KNLGVENTAGAAKHQAVALRVQSDKSVFYLCQMDGYQDTL  395



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/336 (48%), Positives = 224/336 (67%), Gaps = 14/336 (4%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             + ++ +STK+V+ +C+PT ++E C K L+ A N  D KEL++VAFN T+ ++S V+K S 
Sbjct  40    DSHLSTSTKSVQAICQPTDYKETCEKSLANAKNINDPKELIKVAFNATINDLSNVIKNSA  99

Query  429   TL-QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
             +L   A KDPRT +A + CQ LL  +IDD+ R+ D+        + +  Y +D+K WLS 
Sbjct  100   SLIDEAKKDPRTKDALQTCQGLLDVAIDDLTRSFDKF--DKFEVSKIKDYTDDLKTWLSS  157

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKL  785
             A+T++ TCL+ F  T GD+ +KMKKLL  A +LT N L MV    + + +L+I G+NR+L
Sbjct  158   AITYQETCLDAFENTTGDTGEKMKKLLKNAGELTSNGLAMVSSFGEVVANLNIPGVNRRL  217

Query  786   LADSRSLPVWATAAQRRLLEAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIK  965
             L            A  R+L   + P+V+VA DGSG+YK+INEA+  +P K+ + +VI IK
Sbjct  218   LD-----------AHERMLSDSLKPNVIVAIDGSGQYKSINEALNAVPKKNTQKYVIFIK  266

Query  966   AGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIG  1145
             AGVY E+V + +KM N++F+G+GPTKT I+GS +Y  G  T +T T  V G  FM K+IG
Sbjct  267   AGVYNEHVEIPRKMNNIIFIGEGPTKTKITGSLNYADGTGTFKTATFAVNGDYFMAKDIG  326

Query  1146  IENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              ENTAGP  HQAVALRV  D AIFHNCQID YQDTL
Sbjct  327   FENTAGPVKHQAVALRVSGDMAIFHNCQIDGYQDTL  362



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/339 (46%), Positives = 231/339 (68%), Gaps = 14/339 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             I +STK+V+ +C+PT ++E C K L++A N++D KEL++VAF  T+ +I   MK +  +Q
Sbjct  48    ISTSTKSVKAMCQPTDYKEACEKSLASAKNTSDPKELIKVAFESTITDIKNAMKNTSLIQ  107

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLS  602
              AAKDPRT +A + C+ LL  SIDD++R+ D++          D+     Y +D+K W+S
Sbjct  108   EAAKDPRTKDALQTCESLLNVSIDDLRRSFDKV-------GTFDINKIKDYTDDLKTWIS  160

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRK  782
              ++T++ TCL+ F  T G++ +KMKKLL TA +LT N L MV    + L +L + G++R+
Sbjct  161   ASITYQETCLDAFENTTGETGEKMKKLLKTAGELTSNGLAMVTSFGEMLTNLHVPGISRR  220

Query  783   LLA-DSRSLPVWATAAQRRLLE-APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             LL  DS     +  A  RRLL+ +   P+ VVA+DGSG+YKTI EA+  +P K+N+++VI
Sbjct  221   LLTTDSEYTSAFVEAGSRRLLQVSGAKPNAVVAQDGSGQYKTIKEALKAVPPKNNQTYVI  280

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGK  1136
              IKAG YKE V + + + NVVF+G+GPTKT I+G++++  G  T  T TV V G GF+ +
Sbjct  281   LIKAGEYKEMVDIPRSITNVVFIGEGPTKTKITGNKNFADGTGTYHTATVAVNGDGFVAR  340

Query  1137  NIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +IG ENTAG + HQAVALRV +D+ +F+NC ID YQDTL
Sbjct  341   DIGFENTAGAKKHQAVALRVSADKTVFYNCNIDGYQDTL  379



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score =   320 bits (819),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/338 (49%), Positives = 230/338 (68%), Gaps = 10/338 (3%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             +++KA++ +C+PT ++++C   L+ AA N++D K LVE AFNVT+  I      S  LQA
Sbjct  65    TTSKAIKSICQPTDYKDICESSLTHAAGNTSDPKALVEAAFNVTIDYIRDAFNHSSVLQA  124

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFE  620
             AAKDPRTS+A   C+ELL  ++D+++ +  +      +   +D  ++D+K+WLS A+T++
Sbjct  125   AAKDPRTSDALDDCKELLDYAVDELRNSFTKFGQLEIS--KIDEIIDDLKIWLSAAVTYQ  182

Query  621   NTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLL----  788
              TCL+GF    GD+A+ MKK L  +Q LT N+L ++DEI   L +  I  L+R+LL    
Sbjct  183   ETCLDGFENISGDAAESMKKALNGSQALTSNSLAIIDEISSVLSTFQIPFLSRRLLSEEE  242

Query  789   ADSRSLPVWATAAQRRLLEAPV---TPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIH  959
             AD    P W T  +RRLL   +    PD+VVA+DGSG Y+TI EA+  IP  SN +FVI+
Sbjct  243   ADDGEYPSWVTNGKRRLLALTMDQMKPDIVVAQDGSGNYETIKEALAAIPKNSNTTFVIY  302

Query  960   IKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKN  1139
             IK GVYKE V L K M NV+ +GDGPTKT I+G+ +Y+ G  T +T T  V G GF+ K+
Sbjct  303   IKEGVYKEQVWLDKSMTNVMMIGDGPTKTRITGNLNYIDGTTTFKTATFAVVGEGFIAKD  362

Query  1140  IGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +G EN+AGPE HQAVALRVQSD++IF+NCQ+D YQDTL
Sbjct  363   LGFENSAGPEKHQAVALRVQSDRSIFYNCQMDGYQDTL  400



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   317 bits (812),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 231/336 (69%), Gaps = 9/336 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S K V+  C+PT ++E C   LS+ A    D KEL+ +AFN+T+K I+  +  S  L
Sbjct  39    LSTSVKNVQDFCRPTDYKETCENTLSSVAGPDADPKELLNLAFNITVKHINDAIDHSTVL  98

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
               AAKDP TSEA + C+ELL  +IDD++R++DR+ D + A  NLD +++D+K+WLS  +T
Sbjct  99    SEAAKDPSTSEALENCRELLDYAIDDLRRSVDRLGDFSVA--NLDKFLDDLKIWLSATIT  156

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TC++GF GT  ++ + M+K+L ++ +LT N L +V+   D L SL++  +NRKLLA+
Sbjct  157   YQETCVDGFEGTTTNAGESMRKMLNSSSELTSNILAIVNNFDDTLSSLNLP-INRKLLAE  215

Query  795   SRSLPVWATAAQRRLLE---APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIK  965
                 P + T  +RRLL    A + P+VVVA+DGSG  KTI EAI  +P K    F+IHIK
Sbjct  216   G--YPSYVTPGKRRLLATSTADLKPNVVVAQDGSGDVKTIGEAISRVPNKGADIFIIHIK  273

Query  966   AGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIG  1145
              G YKE V + K   NV+ +GDGPTKT I+GS +YV G +T +T TV V G GF+ K++ 
Sbjct  274   EGEYKEKVHVNKSATNVMLIGDGPTKTKITGSLNYVDGTRTFDTATVAVVGDGFVAKDLW  333

Query  1146  IENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             IEN+AG E HQAVALRVQSD ++F+NC+ID YQDTL
Sbjct  334   IENSAGAEKHQAVALRVQSDMSVFYNCRIDGYQDTL  369



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   315 bits (808),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 221/333 (66%), Gaps = 14/333 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL-  434
             + +STK+V+ +C+PT ++E C K L+ A N  D KEL++VAFN T+ ++S V+K S +L 
Sbjct  43    LSTSTKSVQAICQPTDYKETCEKSLANAKNINDPKELIKVAFNATINDLSDVIKNSASLI  102

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
               A KDPRT +A + CQ L+  +IDD+ R+ D+        + +  Y +D+K WLS A+T
Sbjct  103   DEAKKDPRTKDALQTCQGLVDVAIDDLTRSFDKF--DKFEVSKIKDYTDDLKTWLSSAIT  160

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+ F  T GD+ +KMKKLL  A +LT N L MV    + + +L+I G+NR+LL  
Sbjct  161   YQETCLDAFENTTGDTGEKMKKLLKNAGELTSNGLAMVSSFGEVVANLNIPGVNRRLLD-  219

Query  795   SRSLPVWATAAQRRLLEAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGV  974
                       A  R+L   + P+VVVA DGSG+YK+INEA+  +P  + + +VI IKAGV
Sbjct  220   ----------AHERMLSDSLKPNVVVAIDGSGQYKSINEALNAVPKMNTQRYVIFIKAGV  269

Query  975   YKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIEN  1154
             Y E+V + +KM N+VF+G+GPTKT I+GS +Y  G  T +T T  V G  FM K+IG EN
Sbjct  270   YNEHVEIPRKMNNIVFIGEGPTKTKITGSLNYADGTGTFKTATFAVNGDYFMAKDIGFEN  329

Query  1155  TAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             TAGP  HQAVALRV  D AIFHNCQID YQDTL
Sbjct  330   TAGPVKHQAVALRVSGDMAIFHNCQIDGYQDTL  362



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   316 bits (810),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 163/340 (48%), Positives = 227/340 (67%), Gaps = 10/340 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I +STKAV+ +C+PT ++E C K LS A TN++D +EL++  FNV + EI   +  S TL
Sbjct  53    ISTSTKAVKALCQPTDYQETCEKALSEAGTNTSDPRELIKAGFNVAVNEIKWAIGNSTTL  112

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             + AA DP   +A   C EL+  +IDD+  +  R+ D+      LD Y+ D+KVWLSGALT
Sbjct  113   KEAASDPMAKQALDACGELMDYAIDDLVISFQRITDNFDM-QKLDDYIEDLKVWLSGALT  171

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TC++GF    GD+ +KM KLL T+++LT N L MV E+   L S  +  + R+L+ +
Sbjct  172   YQETCIDGFENVTGDTGEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPAIGRRLMTE  231

Query  795   ----SRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
                  R  P W    +R LL+A    +  D VVAKDGSGKYKT+  A+ D+P KSNK+FV
Sbjct  232   ESNEQREEPSWVRD-RRGLLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFV  290

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             I++KAGVY+E V++ K M  V+ +GDGPTKT I+  ++Y+ G  T +T TV V GS F+ 
Sbjct  291   IYVKAGVYQEQVMVEKSMTWVMMIGDGPTKTKITAGKNYIDGTPTFKTATVSVIGSNFIA  350

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             K+IG EN+AG   HQAVALRVQSD ++F+NCQ+D YQDTL
Sbjct  351   KDIGFENSAGAAKHQAVALRVQSDMSVFYNCQMDGYQDTL  390



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   316 bits (810),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 163/340 (48%), Positives = 227/340 (67%), Gaps = 10/340 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I +STKAV+ +C+PT ++E C K LS A TN++D +EL++  FNV + EI   +  S TL
Sbjct  50    ISTSTKAVKALCQPTDYQETCEKALSEAGTNTSDPRELIKAGFNVAVNEIKWAIGNSTTL  109

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             + AA DP   +A   C EL+  +IDD+  +  R+ D+      LD Y+ D+KVWLSGALT
Sbjct  110   KEAASDPMAKQALDACGELMDYAIDDLVISFQRITDNFDM-QKLDDYIEDLKVWLSGALT  168

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TC++GF    GD+ +KM KLL T+++LT N L MV E+   L S  +  + R+L+ +
Sbjct  169   YQETCIDGFENVTGDTGEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPAIGRRLMTE  228

Query  795   ----SRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
                  R  P W    +R LL+A    +  D VVAKDGSGKYKT+  A+ D+P KSNK+FV
Sbjct  229   ESNEQREEPSWVRD-RRGLLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFV  287

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             I++KAGVY+E V++ K M  V+ +GDGPTKT I+  ++Y+ G  T +T TV V GS F+ 
Sbjct  288   IYVKAGVYQEQVMVEKSMTWVMMIGDGPTKTKITAGKNYIDGTPTFKTATVSVIGSNFIA  347

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             K+IG EN+AG   HQAVALRVQSD ++F+NCQ+D YQDTL
Sbjct  348   KDIGFENSAGAAKHQAVALRVQSDMSVFYNCQMDGYQDTL  387



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   317 bits (811),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/347 (46%), Positives = 235/347 (68%), Gaps = 15/347 (4%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             + I SS KA++ +C+PT +++ CV  L S A N+TD K+LV+ AF   M+ +S   K S 
Sbjct  50    QEISSSMKAIQAICQPTDYKDACVNSLTSKAGNTTDPKDLVQAAFASAMEHLSAAAKNST  109

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
              LQ   KDPR S+A + C++L+  +IDD+K++ +++ D   +   +D  + DIK+WLS  
Sbjct  110   LLQELNKDPRASQALQNCEDLVNYAIDDLKKSFNQVGDFDYS--KMDNIIADIKIWLSAV  167

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLL  788
             +T++ TCL+GF  T GD+ +KM+++L T+ +L+ N L +V E+   L +L +A LNR+LL
Sbjct  168   ITYQETCLDGFENTTGDAGEKMRQILKTSMELSSNGLAIVGEVSSILSNLQLANLNRRLL  227

Query  789   ADSRS---------LPVWATAAQRRLLEAPVT---PDVVVAKDGSGKYKTINEAIPDIPL  932
             +D  +          P W+ +  R+LL+A V+   P++ VAKDGSG +KTINEAI  +P 
Sbjct  228   SDDPADPDNHIDDEFPYWSHSEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPK  287

Query  933   KSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIV  1112
              SN++F+++IK G+Y+E V + K   N++ VGDGPTKT I+GS ++V G  T +T TV V
Sbjct  288   FSNQTFILYIKKGIYEEQVQINKTFTNLMMVGDGPTKTKITGSLNFVDGTPTFKTATVAV  347

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              G GF+ K IG EN+AG   HQAVALRVQSD++IF+NCQ+D YQDTL
Sbjct  348   LGDGFIAKGIGFENSAGAAKHQAVALRVQSDRSIFYNCQMDGYQDTL  394



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   314 bits (804),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 169/348 (49%), Positives = 233/348 (67%), Gaps = 23/348 (7%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             +STKA++ +C+PT +++ C + LS AA N TD KEL++V F VTM  +  V++KS TL+ 
Sbjct  50    TSTKAIQAICQPTDYKKTCEESLSGAAGNVTDPKELIKVGFQVTMDMLRGVIEKSTTLKD  109

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFE  620
              AKDP T +A + C+ELL+ +IDD+  + DR+   A   + LDLY+ D+KVWLS A+T+E
Sbjct  110   LAKDPSTGDALQNCKELLEYAIDDLGDSFDRI--GAFDMSKLDLYVEDLKVWLSAAMTYE  167

Query  621   NTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI----------AG  770
              TCL+GF  T GD+ +KM++ L T+Q+LT N L MVD++     +L++          AG
Sbjct  168   QTCLDGFENTTGDAGEKMREFLKTSQELTNNGLAMVDQVSTMFGALNVKSGRRLLEATAG  227

Query  771   LNRKLLADSRSLPVWATAAQRRLLEAPVTP-----DVVVAKDGSGKYKTINEAIPDIPLK  935
                K    ++ +P W     RRL  A  TP     DVVVAK G GKY T+NEA+ DIP K
Sbjct  228   TGAKKFQKAKVIPAWID--NRRLDLATATPQTLKPDVVVAKKGGGKYTTVNEALKDIP-K  284

Query  936   SN--KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVI  1109
              N  K FVI++K GVY+E+V+  K M NV+ +GDGPTKTII+G +++  G +T +T TV 
Sbjct  285   DNAVKVFVIYVKEGVYEEHVLFDKHMTNVMLIGDGPTKTIITGRKNFAEGTKTMQTATVG  344

Query  1110  VKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             V G  F+ K+IG ENTAG   HQAVALRVQSD +IF+NC++D YQDTL
Sbjct  345   VVGDYFIAKDIGFENTAGAVGHQAVALRVQSDLSIFYNCKMDGYQDTL  392



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   314 bits (804),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/337 (47%), Positives = 228/337 (68%), Gaps = 7/337 (2%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I +S+K+V+ +C+PT +RE+C K L  AA N+TD  +LV+  F VT+  + + ++ S TL
Sbjct  52    ITTSSKSVQSICQPTDYREICEKSLRKAAGNTTDPHKLVQAGFQVTIDALQQALQNSSTL  111

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +  AKDP   +A   C+EL+ D+I D+K + +  V H    + +D Y+ ++K+WLS  +T
Sbjct  112   KEVAKDPMAKQALDNCKELMDDAIHDLKVSFEE-VGHFDV-SKMDEYLENLKIWLSATIT  169

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RKLLA  791
             ++ TCL+GF  T G +  KMK++L  + QL+ N L M+  +   L  L++AGL  R+LL 
Sbjct  170   YQQTCLDGFDNTTGPAGAKMKEILTLSSQLSSNGLAMITGLSSMLKDLNLAGLTGRRLLK  229

Query  792   DSRSLPVWATAAQRRLL-EAP--VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHI  962
             D+   P W +  +RRLL + P  V PD+VVAKDGSG+YKTINEA+  IP   N +FVI+I
Sbjct  230   DNSEFPSWLSHEKRRLLAQTPDTVKPDIVVAKDGSGQYKTINEAVHKIPKNQNTTFVIYI  289

Query  963   KAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNI  1142
             K G+YKE V +++ + +++ +GDG TKT I+G  +Y  G QT +T TV V G+ F+ K+I
Sbjct  290   KKGIYKEQVTISRSVTHIMMIGDGATKTRITGDLNYAAGVQTLQTSTVSVSGNHFIAKDI  349

Query  1143  GIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G ENTAG   HQAVALRVQSD +IF+NCQ+D YQDTL
Sbjct  350   GFENTAGAIGHQAVALRVQSDMSIFYNCQMDGYQDTL  386



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   314 bits (804),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 158/338 (47%), Positives = 226/338 (67%), Gaps = 8/338 (2%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I +++K+++ +C+PT +RE C + LS AA N+TD  +LV+  F VT++ +   + +S TL
Sbjct  53    ISTTSKSIKAICQPTDYRETCEESLSKAAGNTTDPSKLVQAGFKVTIEALQNAINRSTTL  112

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +  AKDP  S+A   C+EL+ D+I +++ + D +   +   +  D Y+N++KVWLS  +T
Sbjct  113   KELAKDPMASQALDNCRELMDDAIAELEHSFDLI--ESFQASQFDEYVNNLKVWLSATIT  170

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL-NRKLLA  791
             ++ TCL+GF  T G + +KMK+LL+ + QLT N L MVD +   L  L+I GL +R+LL 
Sbjct  171   YQRTCLDGFENTTGSAGEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIPGLTSRRLLE  230

Query  792   DSRSLPVWATAAQRRLL--EAPVT--PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIH  959
                  P W    +R LL  E P T   D +VA+DGSG+YKTI EAI  IP K N++FVI+
Sbjct  231   ADDEFPSWVNGGKRMLLLKETPATIKADAIVAQDGSGQYKTIAEAIEKIPKKKNETFVIY  290

Query  960   IKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKN  1139
             IK GVYKE V L +   +V+ +GDGPTKT I+G+ +Y  G QT +T TV + G  FM K+
Sbjct  291   IKEGVYKEQVSLARSHTHVLMIGDGPTKTKITGNLNYANGVQTFKTATVSISGDHFMAKD  350

Query  1140  IGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             IG EN+AG   HQAVALRVQ+D ++F+NCQID YQDTL
Sbjct  351   IGFENSAGAIGHQAVALRVQADMSVFYNCQIDGYQDTL  388



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   313 bits (801),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 157/338 (46%), Positives = 227/338 (67%), Gaps = 8/338 (2%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I +++K+++ +C+PT +RE C + LS AA N+TD  +LV+  F VT++ +   + +S TL
Sbjct  53    ISTTSKSIKAICQPTDYRETCEESLSKAAGNTTDPSKLVQAGFKVTIEALQNAINRSTTL  112

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +  AKDP  S+A   C+EL+ D+I +++ + D +   +   +  D Y+N++KVWLS  +T
Sbjct  113   KELAKDPMASQALDNCRELMDDAIAELEHSFDLI--ESFQASQFDEYVNNLKVWLSATIT  170

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL-NRKLLA  791
             ++ TCL+GF  T G + +KMK+LL+ + QLT N L MVD +   L  L+I GL +R+LL 
Sbjct  171   YQRTCLDGFDNTTGSAGEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIPGLTSRRLLE  230

Query  792   DSRSLPVWATAAQRRLL--EAPVT--PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIH  959
                  P W    +R LL  E P T   D +VA+DGSG+YKTI EAI  IP K+N++FV++
Sbjct  231   ADDEFPSWVNGGKRMLLLKETPATIKADAIVAQDGSGQYKTIAEAIEKIPKKNNETFVLY  290

Query  960   IKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKN  1139
             IK GVYKE V L +   +V+ +GDGPTKT I+G+ +Y  G QT +T TV + G  FM K+
Sbjct  291   IKEGVYKEQVSLARSHTHVLMIGDGPTKTKITGNLNYANGVQTFKTATVSISGDHFMAKD  350

Query  1140  IGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             IG EN+AG   HQAVALRVQ+D ++F+NCQID YQDTL
Sbjct  351   IGFENSAGAIGHQAVALRVQADMSVFYNCQIDGYQDTL  388



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   312 bits (800),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/337 (46%), Positives = 228/337 (68%), Gaps = 7/337 (2%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I +S+K+V+ +C+PT +RE+C K LS AA N+TD  +LV+  F VT+  + + ++ S TL
Sbjct  52    ISTSSKSVQAICQPTDYREICGKSLSKAAGNTTDPLKLVQAGFQVTIDALQQALQNSSTL  111

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +  AKDP   +A   C+EL+ D+I D+K + +  V+H      +D Y+ ++K WLS  +T
Sbjct  112   KDVAKDPMAKQALDNCKELMDDAIHDLKVSFEE-VEHFDVN-KMDEYLANLKTWLSATIT  169

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RKLLA  791
             ++ TCL+GF  T G +  KMK++L  + QL+ N L ++  +   L  L++AG   R+LL 
Sbjct  170   YQQTCLDGFDNTTGPAGAKMKEILTLSSQLSSNGLALITGLSSTLKDLNLAGFTGRRLLK  229

Query  792   DSRSLPVWATAAQRRLL-EAP--VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHI  962
             D+   P W +  +RRLL + P  + PD+VVAKDGSG+YKTINEA+  IP K N +FVI+I
Sbjct  230   DNSEFPSWLSHEKRRLLAQTPDTIKPDIVVAKDGSGQYKTINEAVHKIPKKQNTTFVIYI  289

Query  963   KAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNI  1142
             K G+YK+ V +++ + +++ +GDG TKT I+G  +Y  G QT +T TV V GS F+ K+I
Sbjct  290   KKGIYKQQVTISRSLSHIMMIGDGATKTKITGDLNYAAGVQTFKTSTVSVSGSHFIAKDI  349

Query  1143  GIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G ENTAG   HQAVALRVQSD +IF+NCQ+D YQDTL
Sbjct  350   GFENTAGAIGHQAVALRVQSDMSIFYNCQMDGYQDTL  386



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   311 bits (798),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 228/338 (67%), Gaps = 15/338 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             + +STK+V+ +C+PT ++E C K L++A N++D KEL++VAF  T+ +I   +K +  ++
Sbjct  47    VSTSTKSVKAICQPTDYKETCEKSLASAKNTSDPKELIKVAFESTITDIKNAIKNTDLIK  106

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLS  602
              AAKDPRT EA   C+ LL  SIDD++R+ D++          D+     Y +D+K W+S
Sbjct  107   DAAKDPRTKEALHTCEGLLDVSIDDLRRSFDKV-------GTFDINKIKDYTDDLKTWIS  159

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRK  782
              ++T++ TCL+ F  T GD+ +KMKKLL TA +LT N L M+    D L S++I G++R+
Sbjct  160   ASITYQETCLDAFQNTSGDTGEKMKKLLKTAGELTSNGLAMITSFGDMLTSMNIPGISRR  219

Query  783   LLADSRSLPVWATAAQRRLLEAPVT-PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIH  959
             LLA+  +   +     RRLL+   T P+ VVA DGSG++KTI EA+  +P K+ + +VI 
Sbjct  220   LLANDYT--SFVEDGSRRLLQVSSTKPNAVVALDGSGQFKTIKEALKGVPPKNIQPYVIL  277

Query  960   IKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKN  1139
             IKAG YKE V + + + NVVF+G+GPTKT I+G+++Y  G  T  T TV V G GF+ ++
Sbjct  278   IKAGEYKEIVDVPRGVTNVVFIGEGPTKTKITGNKNYADGTATFHTATVAVNGDGFVARD  337

Query  1140  IGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             IG ENTAG   HQAVALRV +D+A+F+NC ID YQDTL
Sbjct  338   IGFENTAGAMKHQAVALRVSADKAVFYNCNIDGYQDTL  375



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   317 bits (812),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/347 (46%), Positives = 235/347 (68%), Gaps = 15/347 (4%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             + I SS KA++ +C+PT +++ CV  L S A N+TD K+LV+ AF   M+ +S   K S 
Sbjct  50    QEISSSMKAIQAICQPTDYKDACVNSLTSKAGNTTDPKDLVQAAFASAMEHLSAAAKNST  109

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
              LQ   KDPR S+A + C++L+  +IDD+K++ +++ D   +   +D  + DIK+WLS  
Sbjct  110   LLQELNKDPRASQALQNCEDLVNYAIDDLKKSFNQVGDFDYS--KMDNIIADIKIWLSAV  167

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLL  788
             +T++ TCL+GF  T GD+ +KM+++L T+ +L+ N L +V E+   L +L +A LNR+LL
Sbjct  168   ITYQETCLDGFENTTGDAGEKMRQILKTSMELSSNGLAIVGEVSSILSNLQLANLNRRLL  227

Query  789   ADSRS---------LPVWATAAQRRLLEAPVT---PDVVVAKDGSGKYKTINEAIPDIPL  932
             +D  +          P W+ +  R+LL+A V+   P++ VAKDGSG +KTINEAI  +P 
Sbjct  228   SDDPADPDNHIDDEFPYWSHSEGRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPK  287

Query  933   KSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIV  1112
              SN++F+++IK G+Y+E V + K   N++ VGDGPTKT I+GS ++V G  T +T TV V
Sbjct  288   FSNQTFILYIKKGIYEEQVQINKTFTNLMMVGDGPTKTKITGSLNFVDGTPTFKTATVAV  347

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              G GF+ K IG EN+AG   HQAVALRVQSD++IF+NCQ+D YQDTL
Sbjct  348   LGDGFIAKGIGFENSAGAAKHQAVALRVQSDRSIFYNCQMDGYQDTL  394



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   311 bits (798),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/350 (44%), Positives = 229/350 (65%), Gaps = 16/350 (5%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKK  422
             G+  + +S KA++ +C+PT ++E C+  LS+ + N+TD K+L++  F V MK +S+  KK
Sbjct  50    GSHEVSASMKAIKSICQPTDYKEECINSLSSESGNTTDPKKLIQAGFKVAMKYLSEAAKK  109

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S  LQ   KDPR S+A   C++L+++SIDD+K ++D++ +   +    D  + D+K+WLS
Sbjct  110   SVVLQDLEKDPRASKALGHCKQLMENSIDDLKHSVDKLGEFDIS--KFDQMLMDLKIWLS  167

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRK  782
               +T++ TCL+GF  T G++A+KMKK L T+ +L+ N L MV EI      L ++ + R+
Sbjct  168   ATVTYQETCLDGFQNTTGEAAEKMKKALKTSMRLSSNGLTMVSEISSVFSDLQLSSMGRR  227

Query  783   LLADSRS--LPV--------WATAAQRRLL---EAPVTPDVVVAKDGSGKYKTINEAIPD  923
             L +D     LPV        W     RRL+      V P++VVAKDGSGKY TINEA+ D
Sbjct  228   LFSDEEESELPVLGHSDEAEWFGGGVRRLMAVHPTKVKPNIVVAKDGSGKYTTINEALKD  287

Query  924   IPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGT  1103
             IP +S  +FVI+IK GVYKE V + + M N++ +GDG  KT I+G ++++ G+ TS T T
Sbjct  288   IPRRSENTFVIYIKEGVYKEYVTIERNMTNLLIIGDGANKTRITGDKNFIDGFPTSLTAT  347

Query  1104  VIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             V+V G  F  ++IG ENTAG   HQAVALRV +D+AIF+ C +D YQDTL
Sbjct  348   VVVLGDHFRARDIGFENTAGAHKHQAVALRVNADEAIFYRCAMDGYQDTL  397



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   310 bits (794),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 157/341 (46%), Positives = 226/341 (66%), Gaps = 15/341 (4%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             N  I +STK+V+ +C+PT ++E C K L++A N++D KEL++VAF  T+ +I   +K + 
Sbjct  40    NGGISTSTKSVQAMCQPTDYKEACEKSLASAKNTSDPKELIKVAFESTITDIKNAIKNTD  99

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKV  593
              ++ AA DPRT EA   C  LL  SIDD++R+ D++          D+     Y +D+K 
Sbjct  100   LIKDAANDPRTKEALNTCDGLLDVSIDDLRRSFDKV-------GTFDINKIKDYTDDLKT  152

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             W+S ++T++ TCL+ F  T GD+ +KMKKLL TA +LT N L M+    D L +++I G+
Sbjct  153   WISASITYQETCLDAFQNTSGDTGEKMKKLLKTAGELTSNGLAMITSFGDMLTNMNIPGI  212

Query  774   NRKLLADSRSLPVWATAAQRRLLEAPVT-PDVVVAKDGSGKYKTINEAIPDIPLKSNKSF  950
             +R+LLAD  +   +     RRLL+   T P+ VVA DGSG++KTI EA+  +P K+ + +
Sbjct  213   SRRLLADDYT--SFVEDGSRRLLQVSNTKPNAVVALDGSGQFKTIKEALKGVPPKNIQPY  270

Query  951   VIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFM  1130
             VI IKAG YKE V + + + NVVF+G+GPTKT I+G+++Y  G  T  T TV V G GF+
Sbjct  271   VILIKAGEYKEMVDIPRGVTNVVFIGEGPTKTKITGNKNYADGTATFHTSTVAVNGDGFV  330

Query  1131  GKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              K+IG ENTAG   HQAVALRV +D+ +F+NC ID YQDTL
Sbjct  331   AKDIGFENTAGAMKHQAVALRVSADKTVFYNCNIDGYQDTL  371



>ref|XP_009774523.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=558

 Score =   310 bits (795),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 153/337 (45%), Positives = 224/337 (66%), Gaps = 11/337 (3%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             N  + +STK V+ +C+PT ++E C K LS+A N++D KEL++ AF+ T+ EI+  +K S 
Sbjct  40    NSQVSTSTKNVQAMCQPTQYKETCEKSLSSAKNTSDPKELIKTAFDSTINEIASSIKNSA  99

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
               + AA DPRT +A K+C E+L  SI++IKR+ ++  D +   + +  Y+ D++ WLS A
Sbjct  100   PFKEAANDPRTKDALKVCDEVLDRSIEEIKRSFNKF-DSSDVKSLVKDYIYDLRSWLSSA  158

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RKL  785
             +TFE TC++ F  T GD+ +KMK LL  A +L+ N L++V      +  L I G+N R+L
Sbjct  159   VTFETTCIDAFANTTGDTGEKMKNLLKNAHELSTNALDIVSSFEKQVEDLQILGINNRRL  218

Query  786   LADSRSLPVWATAAQRRLLE-APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHI  962
             L           A  RRLL+ AP+ P+VVVA+DGSG++K+INEA+  +P  + + +VI I
Sbjct  219   LT--------VEAGNRRLLQVAPLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFI  270

Query  963   KAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNI  1142
             KAG+Y E V +   M NVVF+G+GP KT I+G+++Y+ G     T TV + G GF+ K+I
Sbjct  271   KAGIYNEYVQVANTMTNVVFIGEGPNKTKITGNKNYLDGLPVFSTATVAISGQGFVAKDI  330

Query  1143  GIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G EN+AGP  HQAVALRV ++ A+F NCQID YQ TL
Sbjct  331   GFENSAGPLKHQAVALRVSAEMAVFQNCQIDGYQYTL  367



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   323 bits (829),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 164/336 (49%), Positives = 225/336 (67%), Gaps = 17/336 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I +S KA++ +C+PT ++E CV  L SA  N++D KELV  AF V + +IS  ++ S TL
Sbjct  40    ISTSVKAIQAICQPTDYKEACVNSLTSAKANTSDPKELVRTAFQVAINQISSALQNSTTL  99

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +   KDPRT  A + C EL+  +IDD++ + +++       + +D Y+ D+K+WLSGALT
Sbjct  100   RDLEKDPRTKGALENCHELMDYAIDDLRNSFNKL--GVFDISKIDDYVEDLKIWLSGALT  157

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+GF  T GD+ +KMK LL +A +LT N L M+DEI   L +L I G++R+LL  
Sbjct  158   YQETCLDGFENTTGDAGEKMKALLKSAGELTSNGLAMIDEISSVLTNLQIPGISRRLLV-  216

Query  795   SRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIK  965
                        QR+L +A    + P+V+VA+DGSGKYKTINEA+ +IP   N +FV+++K
Sbjct  217   ----------GQRKLFQATPDTIKPNVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYVK  266

Query  966   AGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIG  1145
              GVYKE V  TK M NV+ +GDGPTKT ISGS +++ G  T  T TV   GS FM K+IG
Sbjct  267   EGVYKEQVNFTKSMTNVMLIGDGPTKTTISGSLNFIDGIGTFRTATVAAVGSNFMAKDIG  326

Query  1146  IENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              EN AG   HQAVALRV SD AIF+NC++D YQDTL
Sbjct  327   FENNAGASKHQAVALRVGSDMAIFYNCRMDGYQDTL  362



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   310 bits (793),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/358 (47%), Positives = 237/358 (66%), Gaps = 25/358 (7%)
 Frame = +3

Query  246   GNKN-----IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEIS  407
             G+KN     + +STKA++ +C+PT ++E C + L SAA NST+ K+L++  FNVTM ++ 
Sbjct  41    GHKNSDGGHVTTSTKAIKAICQPTDYKETCERSLESAAGNSTEPKDLIKAGFNVTMDKLR  100

Query  408   KVMKKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDI  587
              ++K S TLQ  AKD  T++A + C+ELL+ +IDDI  +  ++     +   +D Y  D+
Sbjct  101   AIIKNSTTLQELAKDESTNQALENCKELLEYAIDDITTSFQKLGPFDIS--KIDDYAEDL  158

Query  588   KVWLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA  767
             KVWLS A+T++ TCL+GF  T+GD+ +KMK  L T QQLT N L MV EI   L SL++ 
Sbjct  159   KVWLSAAITYQQTCLDGFQNTKGDAGEKMKHFLNTTQQLTSNGLAMVTEITSVLGSLNLK  218

Query  768   GLNRKLLADS----------RSLPVWATAAQRRLLEAPVTP-----DVVVAKDGSGKYKT  902
                R+LLA            + +P W    +R L  + VTP     D VVAKDGSG+Y+T
Sbjct  219   ANRRRLLAGGGGGSNAKNAPKVIPTWINN-KRSLDVSTVTPQSIKPDAVVAKDGSGQYET  277

Query  903   INEAIPDIPLK-SNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGG  1079
             I EA+  IP   ++K+FVI++K GVY E V++ K M NV+ +GDG TKT ++GS+++  G
Sbjct  278   IGEAVKMIPKNNADKTFVIYVKEGVYSEYVMIDKYMTNVMLIGDGATKTKVTGSKNFAAG  337

Query  1080  YQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              QT +T TV+V G  F+ K+IGIEN+AG E HQAVALRVQSD +IF+ CQ+D YQDTL
Sbjct  338   VQTFQTATVVVVGDYFIAKDIGIENSAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTL  395



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   310 bits (793),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 167/358 (47%), Positives = 237/358 (66%), Gaps = 25/358 (7%)
 Frame = +3

Query  246   GNKN-----IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEIS  407
             G+KN     + +STKA++ +C+PT ++E C + L SAA NST+ K+L++  FNVTM ++ 
Sbjct  41    GHKNSDGGHVTTSTKAIKAICQPTDYKETCERSLESAAGNSTEPKDLIKAGFNVTMDKLR  100

Query  408   KVMKKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDI  587
              ++K S TLQ  AKD  T++A + C+ELL+ +IDD+  +  ++     +   +D Y  D+
Sbjct  101   AIIKNSTTLQELAKDESTNQALENCKELLEYAIDDLTTSFQKLGPFDIS--KIDDYAEDL  158

Query  588   KVWLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA  767
             KVWLS A+T++ TCL+GF  T+GD+ DKMK+ L T QQLT N L MV EI   L SL++ 
Sbjct  159   KVWLSAAITYQQTCLDGFQNTKGDAGDKMKRFLNTTQQLTSNGLAMVTEITSVLGSLNLK  218

Query  768   GLNRKLLADS----------RSLPVWATAAQRRLLEAPVTP-----DVVVAKDGSGKYKT  902
                R+LLA            + +P W    +R L  + VTP     D VVAKDGSG+Y+T
Sbjct  219   ANRRRLLAGGGGGGNAKNAPKVIPTWINN-KRSLDVSTVTPQSIKPDAVVAKDGSGQYET  277

Query  903   INEAIPDIPLK-SNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGG  1079
             I EA+  IP   ++K+FVI++K GVY E V++ K M NV+ +GDG  KT ++GS+++  G
Sbjct  278   IGEAVKMIPKNNADKTFVIYVKEGVYSEYVMIDKYMTNVMLIGDGAXKTKVTGSKNFAAG  337

Query  1080  YQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              QT +T TV+V G  F+ K+IGIEN+AG E HQAVALRVQSD +IF+ CQ+D YQDTL
Sbjct  338   VQTFQTATVVVVGDYFIAKDIGIENSAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTL  395



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/336 (48%), Positives = 220/336 (65%), Gaps = 6/336 (2%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S KA++ VC PT +++ C   L   A N++D  ELV+ AF VTMK+I++   KSKTL
Sbjct  54    VTASVKAIKEVCAPTDYKKTCEDTLRKNANNTSDPLELVKTAFEVTMKQIAEAAAKSKTL  113

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
                 KDPRT  A   C+EL+  + D++K + D +         LD  + ++++WLS A++
Sbjct  114   IEIQKDPRTKMALDQCKELMDYAFDELKSSFDELGKFEFH--KLDEALINLRIWLSAAIS  171

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
              E TCLEGF  T+G++ + MKK L TA QLT N L +V E+ D +  + I+GLN + L  
Sbjct  172   HETTCLEGFEQTQGNAGETMKKALKTAIQLTHNGLAIVTEMSDFVGQMQISGLNSRRLLS  231

Query  795   SRSLPVWATAAQRRLLEAPVT---PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIK  965
             S   P W  A  RRLL A VT   PD+VVA+DGSG+Y TINEA+  +P K N +FV+HIK
Sbjct  232   SNGYPSWVDARARRLLAATVTDVKPDIVVAQDGSGQYATINEALEHVPKKKNVTFVVHIK  291

Query  966   AGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIG  1145
             AGVYKE + + K M ++VF+GDGP KTIISG + +  G  T  T TV + G  F+ K+IG
Sbjct  292   AGVYKEYIQVNKSMTDLVFIGDGPDKTIISGDKGFKDGITTYRTQTVAIVGDRFIAKDIG  351

Query  1146  IENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              ENTAG   HQAVA+RVQSD ++F+NC+ D YQDTL
Sbjct  352   FENTAGAIKHQAVAVRVQSDMSVFYNCRFDGYQDTL  387



>ref|XP_009596737.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=558

 Score =   308 bits (790),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/337 (45%), Positives = 226/337 (67%), Gaps = 11/337 (3%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             N  + +STK V+ +C+PT ++E C K LS+A N++D KEL++ AF+ ++ EI+  +K S 
Sbjct  40    NSQVSTSTKNVQAMCQPTQYKETCEKSLSSAKNTSDPKELIKTAFDSSVNEIASSIKNSA  99

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
               + AA DPRT +A K+C E+L  SI++IKR+ ++  D +   + +  Y+ D++ WLS A
Sbjct  100   PFKEAANDPRTKDALKVCDEVLDRSIEEIKRSFNKF-DSSDLKSLVKDYIYDLRSWLSSA  158

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RKL  785
             +TFE TC++ F  T GD+ +KMK LL  A +L+ N L++V    + + +L I G+N R+L
Sbjct  159   VTFETTCIDAFANTTGDTGEKMKNLLKNAHELSTNALDIVSSFEEQVENLQILGINNRRL  218

Query  786   LADSRSLPVWATAAQRRLLE-APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHI  962
             L           A  RRLL+ AP+ P+VVVA+DGSG++K+INEA+  +P  + + +VI I
Sbjct  219   LT--------VEAGNRRLLQVAPLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVILI  270

Query  963   KAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNI  1142
             KAG+Y E V +   M NVVF+G+GP KT I+G+++Y+ G     T TV + G GF+ K+I
Sbjct  271   KAGIYNEYVQVANTMTNVVFIGEGPNKTKITGNKNYLDGLPVFSTATVAISGQGFVAKDI  330

Query  1143  GIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G EN+AGP  HQAVALRV ++ A+F NCQID YQ TL
Sbjct  331   GFENSAGPLKHQAVALRVSAEMAVFQNCQIDGYQYTL  367



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   309 bits (791),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/355 (47%), Positives = 230/355 (65%), Gaps = 24/355 (7%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G +   +STKA++ +C+PT +++ C   LS  A+N TD KELV+  F V + ++ +V+K 
Sbjct  43    GGEQTSTSTKAIQSICQPTDYKKTCEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKN  102

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM--VDHAGAGANLDLYMNDIKVW  596
             S TL+  AKDPR ++A + C+ELL+ +IDD+  + D++   D       LD Y+ D+KVW
Sbjct  103   STTLKELAKDPRANQALQNCKELLEYAIDDLGDSFDKLGPFDFT----KLDAYVEDLKVW  158

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LS A+T+E TCL+GF  T GD+ +KM++ L T+Q+LT N L MV E+     SL+I    
Sbjct  159   LSAAMTYEQTCLDGFENTTGDAGEKMRQFLKTSQELTSNGLAMVSEVSTLFKSLNIKTGR  218

Query  777   RKLLA-----------DSRSLPVWATAAQRRLLEA-PVT--PDVVVAKDGSGKYKTINEA  914
             R L A            ++ +P W    +  L  A P+T  PDVVV+K G GKYKTINEA
Sbjct  219   RLLQAAATATDEKRFQRAKIIPAWIDHRRLDLATATPLTLKPDVVVSKKGDGKYKTINEA  278

Query  915   IPDIPLKSN--KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQT  1088
             + DIP K+N  K FVI++K GVY E+V   K M NV+ +GDGPTKT+I+G R+Y  G QT
Sbjct  279   LKDIP-KNNEVKVFVIYVKEGVYDEHVFFNKHMTNVMLIGDGPTKTVITGRRNYADGTQT  337

Query  1089  SETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               T TV V G  F+ K++G ENTAG   HQAVALRVQSD +IF+NC +D YQDTL
Sbjct  338   YLTATVGVVGDYFIAKDVGFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTL  392



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score =   308 bits (789),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 164/348 (47%), Positives = 224/348 (64%), Gaps = 15/348 (4%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             NK   SS KA+E +C+ T ++E C   L  AA +++D KEL++  F V   ++ +V++ S
Sbjct  41    NKGTASSKKAIETICQTTSYKETCQSSLEKAAGDTSDPKELIKAGFQVAADKLDEVIQNS  100

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
              TL+  AKDP  S+A  +C+E+L  S +D+  A+D+M     +   ++ Y+ D+KVWLS 
Sbjct  101   NTLKDLAKDPMASQALDVCKEMLDTSTEDLLAAVDKMGPFDAS--KMNEYVEDLKVWLSA  158

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKL  785
             A+  + TCL+ F GT+G++ +KMK  L TAQ+LT N L MV EI   L SL+     R+L
Sbjct  159   AVNHQQTCLDAFEGTKGEAGEKMKGFLKTAQELTSNGLAMVSEISSLLGSLNSNSHRRRL  218

Query  786   LADS---------RSLPVWATAAQRRLLEA---PVTPDVVVAKDGSGKYKTINEAIPDIP  929
             L  S         + LP W  A +  LL A    + P+VVVA+DG+GKYK+I EA+ ++P
Sbjct  219   LGSSSGGQSKRVYKPLPSWIGARKLDLLTATPQSLKPNVVVAQDGTGKYKSITEALKEVP  278

Query  930   LKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVI  1109
              KS + FVI+IK GVYKE V++ K+M NVV +GDGPTKT ISGS++Y  G  T  T T  
Sbjct  279   KKSAQPFVIYIKEGVYKEYVIVDKEMTNVVMIGDGPTKTRISGSKNYADGTATMYTATFA  338

Query  1110  VKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               G  F+ K IG ENTAG   HQAVALRVQSD +IF+NC IDAYQDTL
Sbjct  339   AVGDYFVAKGIGFENTAGAAKHQAVALRVQSDFSIFYNCYIDAYQDTL  386



>ref|XP_011091007.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=568

 Score =   308 bits (789),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 158/350 (45%), Positives = 231/350 (66%), Gaps = 22/350 (6%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             NI  S KA+  +C+ T++++ C+  LS AT S+DTK+L+  +F   M+E+  V+K+S TL
Sbjct  37    NINPSQKAIVDLCQNTYYQQTCINSLSKATISSDTKDLIRTSFRTAMEELGNVIKQSATL  96

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM--VDHAGAGANLDLYMNDIKVWLSGA  608
             Q A+K+P T+EA++ CQ+LL DSI D+++ L+R   VD +    NL+L ++DIK WL+GA
Sbjct  97    QEASKNPETAEAYRTCQKLLNDSILDLQKTLERTESVDIS----NLNLLIDDIKTWLTGA  152

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLL  788
             LT++ TCL+ F   EGD+A+KM + +   ++LT N L + +   D L+  D  G  R+LL
Sbjct  153   LTYQETCLDCFEDAEGDAAEKMMEFMKLGKELTINGLALANGFSDLLLPND-HGAGRRLL  211

Query  789   ADSRSLPV-------------WATAAQRRLLEAP--VTPDVVVAKDGSGKYKTINEAIPD  923
             ADS  + +             +AT  +R L  AP  + P V VAKDGSG + TI EA+  
Sbjct  212   ADSNKMGLINKADYIGEHWLNYATRTRRLLYAAPGDIKPHVTVAKDGSGNFMTIGEALKS  271

Query  924   IPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGT  1103
             +PL  N +++I+IKAGVY+EN+++   M +V+F+GDGP  T I+G++S VGG +T  T T
Sbjct  272   VPLSCNDTYIIYIKAGVYQENIIVGTSMWSVMFIGDGPNATKITGNKSKVGGTETFWTAT  331

Query  1104  VIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             V V G  F+ K+IG EN+AG   HQAVALR   D++IF NCQID YQDT+
Sbjct  332   VGVDGDNFIAKDIGFENSAGASMHQAVALRASGDKSIFFNCQIDGYQDTV  381



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   308 bits (788),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 155/335 (46%), Positives = 227/335 (68%), Gaps = 5/335 (1%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             + SS+KA++ +C+ T ++E C   LS A N++D +ELV+VAF  T+  + +V+K S  LQ
Sbjct  51    VTSSSKAIQSLCQHTDYKETCEDSLSKAKNTSDPRELVKVAFQTTVDNLGEVIKNSSLLQ  110

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTF  617
              AAKDPRTS+A  IC+E+L  +IDD KR+ D++ D   +   LD Y  D+K WLSGA+T 
Sbjct  111   NAAKDPRTSDALDICKEVLNTAIDDFKRSFDKVQDFDIS--KLDDYAADLKTWLSGAITL  168

Query  618   ENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLADS  797
             + TCL+ F  T GD+ +KMK+L+ TA QL+ N L +V +  + L +L I GL+R+LL+  
Sbjct  169   QQTCLDAFENTTGDTGEKMKQLMRTAVQLSSNGLAIVTDFSEILGTLAIPGLSRRLLSAE  228

Query  798   RSLPVWATAAQRRLLE---APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKA  968
             +         +RRLL+   + + P+ ++A+DGSG +KTI +AI  +P  +   FVI IKA
Sbjct  229   KRKLDEENFVERRLLQVDPSSIKPNAIIAQDGSGTFKTIRDAINTVPKNNTTPFVILIKA  288

Query  969   GVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGI  1148
             GVYKE +++ +++ NVV +G+GP  T I+ +++YV G  T  T TV + G G + ++IGI
Sbjct  289   GVYKEVILIPRRINNVVIMGEGPNVTKITANKNYVDGIGTFHTATVAINGDGCILRDIGI  348

Query  1149  ENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             EN+AGPE HQAVALRV  D+ I +NCQID YQDTL
Sbjct  349   ENSAGPEKHQAVALRVSGDRTIVYNCQIDGYQDTL  383



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   308 bits (789),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 167/356 (47%), Positives = 232/356 (65%), Gaps = 26/356 (7%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G +   +STKA++ +C+PT +++ C   LS  A+N TD KELV+  F V + ++ +V+K 
Sbjct  46    GGEQTSTSTKAIQSICQPTDYKKTCEDNLSKVASNVTDPKELVKAGFQVAIGQLREVIKN  105

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM--VDHAGAGANLDLYMNDIKVW  596
             S TL+A AKD R ++A + C+ELL+ +IDD+  + D++   D       LD Y+ D+KVW
Sbjct  106   STTLKALAKDSRANQALQNCKELLEYAIDDLGDSFDKLGPFDFT----KLDSYVEDLKVW  161

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LS A+T+E TCL+GF  T GD+  KM++ L T+Q+LT N L MV E+     +L+I    
Sbjct  162   LSAAMTYEQTCLDGFQNTTGDAGAKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIK-TG  220

Query  777   RKLLADSRS------------LPVWATAAQRRLLEA-PVT--PDVVVAKDGSGKYKTINE  911
             R+LL D+ +            +P W    +  L  A P+T  PDVVV+K G GKYKTINE
Sbjct  221   RRLLQDAATATDENRFQRAKIIPAWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINE  280

Query  912   AIPDIPLKSN--KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQ  1085
             A+ DIP K+N  K FVI++K GVY E+V   K M NV+ +GDGPTKT+I+G ++Y  G Q
Sbjct  281   ALKDIP-KNNEVKVFVIYVKEGVYDEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQ  339

Query  1086  TSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             T +T TV V G  F+ K++G ENTAG   HQAVALRVQSD +IF+NC +D YQDTL
Sbjct  340   TYQTATVAVVGDYFIAKDVGFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTL  395



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   308 bits (788),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 166/355 (47%), Positives = 231/355 (65%), Gaps = 24/355 (7%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G +   +STKA++ +C+PT +++ C   LS  A+N TD KELV+  F V + ++ +V+K 
Sbjct  44    GGEQTSTSTKAIQSICQPTDYKKTCEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKN  103

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM--VDHAGAGANLDLYMNDIKVW  596
             S TL+  AKDP +++A + C+ELL+ +IDD+  + D++   D       LD Y+ D+KVW
Sbjct  104   STTLKELAKDPSSNQALQNCKELLEYAIDDLGDSFDKLGPFDFT----KLDAYVEDLKVW  159

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LS A+T+E TCL+GF  T GD+ +KM++ L T+Q+LT N L MV E+     +L+I    
Sbjct  160   LSAAMTYEQTCLDGFENTTGDAGEKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIKTGR  219

Query  777   RKLLA-----------DSRSLPVWATAAQRRLLEA-PVT--PDVVVAKDGSGKYKTINEA  914
             R L A            ++ +P W    +  L  A P+T  PDVVV+K G GKYKTINEA
Sbjct  220   RLLQAAATATDEKRFQKAKIIPAWIDHRKLDLATATPLTLKPDVVVSKKGDGKYKTINEA  279

Query  915   IPDIPLKSN--KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQT  1088
             + DIP K+N  K FVI++K GVY E+V   K M NV+ +GDGPTKT+I+G ++Y  G QT
Sbjct  280   LKDIP-KNNEVKVFVIYVKEGVYDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGTQT  338

Query  1089  SETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              +T TV V G  F+ K+IG ENTAG   HQAVALRVQSD +IF+NC +D YQDTL
Sbjct  339   YQTATVAVVGDYFIAKDIGFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTL  393



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   307 bits (787),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 168/348 (48%), Positives = 231/348 (66%), Gaps = 18/348 (5%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             K   +++KA+E VC+PT ++E C   LS  A N TD KELV++ F + ++++ +V+  S 
Sbjct  45    KKPATTSKAIETVCQPTDYKETCQNALSEKAGNVTDPKELVKIGFQIAIEKLQEVINNSD  104

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
             TL+  AKD   ++A + C+EL++ SIDD+KR+ D++         L  Y+ D+KVWLS +
Sbjct  105   TLKEIAKDNLGNQALQNCRELIEYSIDDLKRSADKIGPFEVT--KLKEYVEDLKVWLSAS  162

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLL  788
             L +E TCL+GF  T G++  KMK  L T+Q+LT N L M  EI +   +  +    R+LL
Sbjct  163   LQYEQTCLDGFDNTPGEAGAKMKNFLKTSQELTKNALAMATEIGNLFRTSSLKS-QRRLL  221

Query  789   ADS--------RSLPVWATAAQRRLLEA-PVT--PDVVVAKDGSGKYKTINEAIPDIPLK  935
             AD+        + +P W    +  +  A P++  PDV+VAKDGSGKYKT+NEA+ DIP K
Sbjct  222   ADTPMDPKKAPKIIPSWIEGRKLDIATANPISLKPDVIVAKDGSGKYKTVNEALKDIP-K  280

Query  936   SN--KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVI  1109
              N  K+FVI+IK GVY E VVL K M NV+F+GDGPTKT I+G+++Y  G QT +T TV 
Sbjct  281   DNVLKTFVIYIKEGVYSEQVVLDKHMTNVMFIGDGPTKTKITGNKNYADGVQTFKTATVA  340

Query  1110  VKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             V G  F+ K+IG ENTAG   HQAVALRVQSD +IF+NCQID YQDTL
Sbjct  341   VIGDYFIAKDIGFENTAGARGHQAVALRVQSDLSIFYNCQIDGYQDTL  388



>ref|XP_008810219.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=589

 Score =   308 bits (788),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 158/347 (46%), Positives = 230/347 (66%), Gaps = 18/347 (5%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             ++   +++KA++ +C+PT ++E+C   L+ AA N++D K LVE AFNVT+  I      S
Sbjct  59    SRGFTTTSKAIKSICQPTDYKEICESSLTKAAGNASDPKVLVEAAFNVTISYIRDAFDHS  118

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM----VDHAGAGANLDLYMNDIKV  593
               LQA AKDPRTS+A   C++LL  +ID+++ +  +     ++H      +D  ++D+K+
Sbjct  119   SVLQATAKDPRTSDALDDCKKLLDYAIDELRNSFTKFGQLDMNH------VDDVIDDLKI  172

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WLS A+T++ TCL+GF    GD+A+ M++ L ++Q LT N L ++DEI   L ++ +  L
Sbjct  173   WLSAAVTYQETCLDGFENITGDAAESMREALNSSQALTSNALAIIDEISSVLSTVRVPFL  232

Query  774   NRKLLAD----SRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPL  932
              R+ L+     S   P W    +RRLL      + P+++VA+DGSG YKTI EA+  IP 
Sbjct  233   KRRFLSHEEEGSGEYPSWVANGKRRLLALAADQIKPNIIVAQDGSGNYKTIKEALGAIPK  292

Query  933   KSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIV  1112
              SN  FVI+IK GVYKE V L K MMNV+ +GDGPTKT I+G+ +Y+ G  T +T T  V
Sbjct  293   NSNSIFVIYIKEGVYKEQVWLDKSMMNVMMIGDGPTKTRITGNLNYIDGTTTFKTATFAV  352

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              G GF+ KN+G EN+AG E HQAVALRVQSD++IF+NCQ+D +QDTL
Sbjct  353   VGDGFIAKNLGFENSAGAEKHQAVALRVQSDRSIFYNCQMDGFQDTL  399



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   307 bits (787),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 232/347 (67%), Gaps = 13/347 (4%)
 Frame = +3

Query  246   GNKN--IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVM  416
             GNK+  I SS KA++ +C+PT +++ CV  L A   NS+D KELV+  F   MK I    
Sbjct  48    GNKSHEISSSMKAIKAICQPTDYKQECVASLKATGNNSSDPKELVQAGFKAAMKLIQAAA  107

Query  417   KKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVW  596
              KS  L    KDPR S+A   C+EL+  +ID++K +++++ +   +   LD  + DI++W
Sbjct  108   NKSVALNQLEKDPRASKALAGCKELMDFAIDELKYSMNKLGEFDIS--KLDEMLIDIRIW  165

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LS  +T++ TCL+GF  T G++A+KMKK L T+ +L+ N L MV +I   L  L I G++
Sbjct  166   LSATITYQETCLDGFANTTGNAAEKMKKALKTSMKLSSNGLAMVSQISSMLSELQIPGIS  225

Query  777   RKLLADSRSL-----PVWATAAQRRLLEA--PVTPDVVVAKDGSGKYKTINEAIPDIP-L  932
             R+ L +   L     P WA    RRLL A   V P+VVVAKDGSG++KTI EAI  +P  
Sbjct  226   RRRLLEIPVLGHDDYPDWANPGMRRLLAAGSKVKPNVVVAKDGSGQFKTIQEAIDQVPKR  285

Query  933   KSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIV  1112
             K+N ++VIHIKAGVY+E V++ K + +++ +GDGP KTII+G+++++ G  T +T TV V
Sbjct  286   KNNATYVIHIKAGVYQEYVLVKKTLTHLMLIGDGPKKTIITGNKNFIDGTPTFKTATVAV  345

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
                 FM ++IG ENTAGP+ HQAVALRVQ+D+A+F+NC++  YQDTL
Sbjct  346   TAEHFMARDIGFENTAGPQKHQAVALRVQADKAVFYNCEMHGYQDTL  392



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   305 bits (782),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 158/343 (46%), Positives = 227/343 (66%), Gaps = 15/343 (4%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             N  + +STKAV  +C PT ++E C   L+ A N+TD KEL++VAFN  +  I+  +K S 
Sbjct  25    NGGVSTSTKAVHAICTPTDYKETCESSLAGA-NTTDPKELIKVAFNAAVNNIADAIKNST  83

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
              ++ AA D  T +A  +C ++L+ ++DD++RA D++ +       +D Y+ D+KVWLS  
Sbjct  84    LMKDAAADNSTKDALDVCNDVLESAVDDLRRAGDKVGEFDAT--KMDEYVEDLKVWLSAV  141

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHD-------ALVSLDIA  767
             +T++ TC++ F  T GD+A+KMK LL TA++L+ N+L MV +I           +    A
Sbjct  142   ITYQETCIDAFENTTGDTAEKMKNLLKTARELSSNSLAMVSDISSILGQLQLGNLGGGGA  201

Query  768   GLNRKLLADSRSLPVWATAAQRRLLEA-PVTPDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
                R+L+++    P W    + RLL A P+ P+ VVA+DGSG++KTI EAI  IP K+N+
Sbjct  202   SSGRRLMSEEEE-PYWT---KGRLLAANPLKPNAVVAQDGSGQFKTIKEAINTIPKKNNQ  257

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
             +F+I+IKAG+YKE+V + KK+  VVF+GDGP KT I+GS+S+ GG +T +T TV V G  
Sbjct  258   TFIIYIKAGLYKEHVEIPKKVNKVVFIGDGPFKTRITGSKSFAGGVKTFQTATVAVNGEE  317

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F  KNI  ENTAG E HQAVALRV +D+AIF N  ID YQDTL
Sbjct  318   FTAKNIAFENTAGAEGHQAVALRVSADKAIFQNVAIDGYQDTL  360



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   309 bits (791),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 162/343 (47%), Positives = 226/343 (66%), Gaps = 11/343 (3%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G   + +S KAV+ VC PT +R+ C   L     N+TD  ELV+ AFNVTMK+I+   KK
Sbjct  47    GKAEVNASVKAVKDVCAPTDYRKTCEDTLIKNGKNTTDPMELVKTAFNVTMKQITDAAKK  106

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S+T+    KD RT  A   C+EL+  ++D++  + + +         LD  + ++++WLS
Sbjct  107   SQTIMELQKDSRTRMALDQCKELMDYALDELSNSFEELGKFEFH--LLDEALINLRIWLS  164

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-R  779
              A++ E TCLEGF GT+G++ + MKK L TA +LT N L ++ E+ + +  + I GLN R
Sbjct  165   AAISHEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSR  224

Query  780   KLLADSRSLPVWATAAQRRLLEAP-----VTPDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
             +LLA+    P W     R+LL+A      V PD+VVA+DGSG+YKTINEA+  +P K N 
Sbjct  225   RLLAEG--FPSWVDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNT  282

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
             +FV+HIKAG+YKE V + K M ++VF+GDGP KTIISG+++Y  G  T  T TV + G+ 
Sbjct  283   TFVVHIKAGLYKEYVQVNKTMSHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGNY  342

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F+ KNIG ENTAG   HQAVA+RVQSD++IF NC+ D YQDTL
Sbjct  343   FIAKNIGFENTAGAIKHQAVAVRVQSDESIFFNCRFDGYQDTL  385



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   308 bits (789),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 164/344 (48%), Positives = 226/344 (66%), Gaps = 15/344 (4%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G   I +S KA++ VC PT ++E C   L   A N++D  ELV+ AFN TMK+IS V KK
Sbjct  45    GEGEITTSVKAIKDVCAPTDYKETCEDTLRKDAKNTSDPLELVKTAFNATMKQISDVAKK  104

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRA---LDRMVDHAGAGANLDLYMNDIKV  593
             S+T+    KDPRT  A   C+EL+  +I ++ ++   L R   H      +D  +  +++
Sbjct  105   SQTMIELQKDPRTKMALDQCKELMDYAIGELSKSFEELGRFEFH-----KVDEALIKLRI  159

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WLS  ++ E TCL+GF GT+G++ + +KK L TA QLT N L MV E+ + L  + I  +
Sbjct  160   WLSATISHEQTCLDGFQGTQGNAGETIKKALKTAVQLTHNGLAMVSEMSNYLGQMQIPEM  219

Query  774   N-RKLLADSRSLPVWATAAQRRLLEAPVTP---DVVVAKDGSGKYKTINEAIPDIPLKSN  941
             N R+LL  S+  P W     RRLL AP++    D+VVA+DGSG+YKTINEA+  +P K N
Sbjct  220   NSRRLL--SQEFPSWMDGRARRLLNAPMSEVKLDIVVAQDGSGQYKTINEALNYVPKKKN  277

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGS  1121
              +FV+HIKAG+YKE V + + M ++VF+GDGP KT+ISGS+SY  G  T +T TV + G 
Sbjct  278   TTFVVHIKAGIYKEYVQVNRSMTHLVFIGDGPEKTVISGSKSYKDGITTYKTATVAIVGD  337

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              F+ KNIG ENTAG   HQAVA+RV SD++IF+NC+ D YQDTL
Sbjct  338   HFIAKNIGFENTAGAIKHQAVAIRVLSDESIFYNCKFDGYQDTL  381



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   306 bits (783),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 223/344 (65%), Gaps = 14/344 (4%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             G   + +STKAV+ +C PT ++E C   LS A N+TD KEL+ +AFN  +  I   +K S
Sbjct  47    GGGGVSTSTKAVQAICSPTDYKETCESSLSGA-NTTDPKELIRLAFNAAVNNIGDAIKNS  105

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
                + AA D  T +AF IC ++L  +IDD+KRA D++ +       +D Y+ D+KVWLS 
Sbjct  106   TLFKDAAADSSTKDAFDICDDVLGSAIDDLKRAGDKVGEFDAT--KVDEYVEDLKVWLSA  163

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL----  773
              +T++ TC++ F  T GD+A+KMK LL TA++L+ N L MV ++   +  L +  L    
Sbjct  164   VITYQETCIDAFENTTGDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGST  223

Query  774   NRKLLADSRSLPVWATAAQ-RRLLEA---PVTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
             +R+LL++    P W  +   RRLL A   P+ P+ VVA DGSG++KTI +AI  IP K+ 
Sbjct  224   SRRLLSED---PYWIKSPHTRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNT  280

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGS  1121
             + FVI IKAG+YKE+V + KK+  VV +G+GP KT I+GS+SY GG +T  T TV V G 
Sbjct  281   QPFVIFIKAGLYKEHVEIPKKVNGVVMIGEGPLKTRITGSKSYAGGVKTFHTATVAVNGE  340

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              FM K+IG ENTAG E HQAVALRV  D+AIF N  ID YQDTL
Sbjct  341   DFMAKDIGFENTAGAEGHQAVALRVSGDRAIFLNVAIDGYQDTL  384



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score =   308 bits (790),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/343 (45%), Positives = 221/343 (64%), Gaps = 13/343 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             +  S KA++ +C+PT ++E C+K L A A NSTD KEL++ AF  T   I++  K S  L
Sbjct  43    VSDSQKAIQTICEPTDYKETCIKTLQAEAGNSTDPKELIQAAFKATTNYINEAAKNSTVL  102

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             Q   KDPRT  A + C+EL   +++D++R+  +        +N+D  + DIKVWLSGALT
Sbjct  103   QELQKDPRTKLALENCKELAHQAVEDLERSFAKF--QTFDFSNIDDMLADIKVWLSGALT  160

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL-NRKLLA  791
             ++ TCL+GF G EGD+ +KM++ L T+ +LT N L M+++I   L SL++    NR+LL+
Sbjct  161   YQQTCLDGFEGAEGDAGEKMRQSLETSMELTSNGLAMINDISSVLTSLELPAFTNRRLLS  220

Query  792   DS------RSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
             D         LP W    +RRLL A    V PD++VAKDGSG + TINEA+ +I     K
Sbjct  221   DDILGHGMDILPSWIDEGRRRLLRAKPRKVKPDLIVAKDGSGNFTTINEALLNITKNEEK  280

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
              FV++IK GVY+E V   K ++++  +GDGPTKT I+G  +++ G  T  T TV V G  
Sbjct  281   EFVLYIKEGVYEEKVTFHKNLLHLTVIGDGPTKTRITGKLNFIDGVPTYHTATVAVLGDF  340

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F+ K+IG EN AGPE HQAVA+RV +D+ IF+NC  D +QDTL
Sbjct  341   FIAKDIGFENAAGPEKHQAVAVRVGADKTIFYNCHFDGFQDTL  383



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   306 bits (783),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 166/356 (47%), Positives = 231/356 (65%), Gaps = 26/356 (7%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G +   +STKA++ +C+PT +++ C   LS  A+N TD KELV+  F V + ++ +V+K 
Sbjct  43    GGEQTSTSTKAIQSICQPTDYKKTCEDNLSKVASNVTDPKELVKAGFQVAIGQLREVIKN  102

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM--VDHAGAGANLDLYMNDIKVW  596
             S TL+  AKD R ++A + C+ELL+ +IDD+  + D++   D       LD Y+ D+KVW
Sbjct  103   STTLKELAKDSRANQALQNCKELLEYAIDDLGDSFDKLGPFDFT----KLDSYVEDLKVW  158

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LS A+T+E TCL+GF  T GD+  KM++ L T+Q+LT N L MV E+     +L+I    
Sbjct  159   LSAAMTYEQTCLDGFQNTTGDAGAKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIK-TG  217

Query  777   RKLLADSRS------------LPVWATAAQRRLLEA-PVT--PDVVVAKDGSGKYKTINE  911
             R+LL D+ +            +P W    +  L  A P+T  PDVVV+K G GKYKTINE
Sbjct  218   RRLLQDAATATDENRFQRAKIIPAWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINE  277

Query  912   AIPDIPLKSN--KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQ  1085
             A+ DIP K+N  K FVI++K GVY E+V   K M NV+ +GDGPTKT+I+G ++Y  G Q
Sbjct  278   ALKDIP-KNNEVKVFVIYVKEGVYDEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQ  336

Query  1086  TSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             T +T TV V G  F+ K++G ENTAG   HQAVALRVQSD +IF+NC +D YQDTL
Sbjct  337   TYQTATVAVVGDYFIAKDVGFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTL  392



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   309 bits (792),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 163/339 (48%), Positives = 222/339 (65%), Gaps = 11/339 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I +S KAV+ VC PT +R+ C   L     N+TD  ELV+ AF+ TMK+I+ V KKS+T+
Sbjct  51    ITASVKAVKDVCAPTDYRKTCEDTLIQNGQNTTDPMELVKTAFSATMKQITDVAKKSQTM  110

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
                 KDPRT  A   C EL+  ++ ++  + + +         LD  + ++++WLS A++
Sbjct  111   MELQKDPRTRMALDQCTELMDYALGELSSSFEELGKFEFH--KLDEALINLRIWLSAAIS  168

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RKLLA  791
              E TCLEGF GT+G++ + MKK L TA +LT N L ++ E+ + +  + I GLN R+LLA
Sbjct  169   HEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLA  228

Query  792   DSRSLPVWATAAQRRLLEAP-----VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             +    P W     RRLL+A      V PD+VVA+DGSG+Y TIN+A+  +P K N +FV+
Sbjct  229   EG--FPSWVDQRGRRLLQAAAAYSDVKPDIVVAQDGSGQYTTINDALMFVPKKKNTTFVV  286

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGK  1136
             HIKAG+YKE V + K M ++VF+GDGP KTIISG++SY  G  T  T TV + G  F+ K
Sbjct  287   HIKAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGNKSYKDGITTYRTATVAIVGDYFIAK  346

Query  1137  NIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             NIG ENTAG   HQAVALRVQSD+AIF NC+ D YQDTL
Sbjct  347   NIGFENTAGAIKHQAVALRVQSDEAIFFNCRFDGYQDTL  385



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   305 bits (782),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 166/357 (46%), Positives = 229/357 (64%), Gaps = 28/357 (8%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G +   +STKA++ +C+PT +++ C   LS  A+N TD KELV+  F V + ++ +V+K 
Sbjct  44    GGEQTSTSTKAIQSICQPTDYKKTCEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKN  103

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM--VDHAGAGANLDLYMNDIKVW  596
             S TL+  AKDP  ++A + C+ELL+ +IDD+  + D++   D       LD Y+ D+KVW
Sbjct  104   STTLKELAKDPSANQALQNCKELLEYAIDDLGDSFDKLGPFDFT----KLDAYVGDLKVW  159

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LS A+T+E TCL+GF  T GD+ +KM++ L T+Q+LT N L MV E+     +L+I    
Sbjct  160   LSAAMTYEQTCLDGFENTTGDAGEKMRQFLKTSQELTSNGLAMVSEVSTLFKTLNIKTGR  219

Query  777   RKLLA-----------DSRSLPVWATAAQRRL---LEAPVT--PDVVVAKDGSGKYKTIN  908
             R L A            ++ +P W     RRL      P+T  PDVVV+  G GKYKTIN
Sbjct  220   RLLQAAATATDENRFQRAKIIPAWID--HRRLDLATATPLTLKPDVVVSNKGDGKYKTIN  277

Query  909   EAIPDIPLKSN--KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGY  1082
             EA+ DIP K+N  K FVI++K GVY E+V   K M NV+ +GDGPTKT+I+G ++Y  G 
Sbjct  278   EALKDIP-KNNEVKVFVIYVKEGVYDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGT  336

Query  1083  QTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             QT +T TV V G  F+ K+IG ENTAG   HQAVALRVQSD +IF+NC +D YQDTL
Sbjct  337   QTYQTATVAVVGDYFIAKDIGFENTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTL  393



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   309 bits (791),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 226/344 (66%), Gaps = 19/344 (6%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             + I +S KA++ VC PT +++ C   L   A +++D  ELV  AFN TMK+IS V KKS 
Sbjct  47    EEITASVKAIKDVCAPTDYKKTCEDTLRKDAKDTSDPLELVRTAFNATMKQISNVAKKSL  106

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMND-----IKV  593
             T+    KDPRT  A   C EL+  +I ++ ++ D +          +L+  D     +KV
Sbjct  107   TMIELQKDPRTKMALDQCTELMDFAIGELSKSFDEL-------GRFELHKVDDALIKLKV  159

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WLS  ++ E TCL+GF GT+GD+ + MKK L TA QLT N L MV E+ + L  +++  +
Sbjct  160   WLSATISHEQTCLDGFQGTQGDAGETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEM  219

Query  774   N-RKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
             N R+LL  S+  P W     RRLL AP   V PD+VVA+DGSG+YKTINEA+ ++P K+N
Sbjct  220   NSRRLL--SQEFPSWVDGRVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALRNVPKKNN  277

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGS  1121
              +FV+HIK+G YKE V + + M N+VF+GDGPTK+IISG++S+  G  T  T TV + G 
Sbjct  278   ATFVVHIKSGTYKEYVQVNRTMPNLVFIGDGPTKSIISGNKSFKDGITTYRTATVAIIGD  337

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              F+ KN+G ENTAG  N+QAVA+RV SD++IF+NC+ D YQDTL
Sbjct  338   NFIAKNMGFENTAGALNYQAVAVRVLSDESIFYNCRFDGYQDTL  381



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   305 bits (782),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 153/338 (45%), Positives = 227/338 (67%), Gaps = 8/338 (2%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +STK+++ +C+PT +++ C   L+ AA N++D  +LV+  F V +  +   ++ S TL
Sbjct  61    LSTSTKSIQAICQPTDYKQTCEDSLNKAAGNTSDPHKLVQAGFQVAIDALKVAIENSTTL  120

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +  AKDP   +A   C+EL+  +I D+K +  ++ D   +   LD Y+ ++K+WLS  +T
Sbjct  121   KEVAKDPMAKQALDNCKELMNTAISDLKTSFQQVGDFDIS--KLDEYVANLKIWLSATIT  178

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RKLLA  791
             ++ TCL+GF  T G +  KMK++L T+ QLT N L MV  +   L  LD++GL  RKLLA
Sbjct  179   YQQTCLDGFDNTTGPAGQKMKEILSTSSQLTSNGLAMVTGLSSILQDLDLSGLTGRKLLA  238

Query  792   DSR-SLPVWATAAQRRLL-EAPVT--PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIH  959
                 + P W + A+RRLL + P T  P++VVA+DGSG+YKTINEAI +IP   N +FV++
Sbjct  239   QGNDNFPSWLSPAKRRLLAQTPATIKPNMVVAQDGSGQYKTINEAIKNIPKSGNSTFVLY  298

Query  960   IKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKN  1139
             IK GVYKE V  ++ + +++ +GDGPTKT I+G  S+ GG Q  +T TV V GS FM K+
Sbjct  299   IKEGVYKEVVTFSRSLTHIMLIGDGPTKTKITGDLSFAGGVQIYKTATVSVSGSHFMAKD  358

Query  1140  IGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             IG EN+AG   HQA+AL+VQSD ++F+NCQID YQ+TL
Sbjct  359   IGFENSAGATGHQAIALKVQSDMSVFYNCQIDGYQNTL  396



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   305 bits (781),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 160/345 (46%), Positives = 226/345 (66%), Gaps = 17/345 (5%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             +STKA++ +C+PT ++E C K L SA  NST+ KEL++  F V M ++ +V+K S TLQ 
Sbjct  50    TSTKAIQAICQPTDYKETCQKSLESAGVNSTEPKELIKAGFKVAMDKLHEVIKNSTTLQE  109

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFE  620
              AKDP  ++A + C+ELL  +I D+  + D++     +   +D Y  D+K+WLS A+T+E
Sbjct  110   LAKDPGANQALENCKELLDYAIGDLAASFDKLGPFDIS--KIDAYAEDLKIWLSAAMTYE  167

Query  621   NTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA---  791
              TCL+GF  T GD+ +KMK+LL + Q+LT N L MV EI   L S ++    R+LLA   
Sbjct  168   QTCLDGFQNTTGDAGEKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVKQSQRRLLAAGA  227

Query  792   -------DSRSLPVW---ATAAQRRLLEAPVTPDVVVAKDGSGKYKTINEAIPDIPLK-S  938
                      + +PVW    T    R     + PDV VAKDGSG+ K+I EA+  IP   +
Sbjct  228   GGGTKKNTPKVIPVWIDKRTMDVARATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNA  287

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKG  1118
             +K+FVI++K GVY E V++ K M NV+ +GDGPTKT I+G+++Y  G +T +T TV V G
Sbjct  288   DKTFVIYVKEGVYNEYVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTKTFQTATVAVVG  347

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               F+ K+IG EN+AG + HQAVALRVQSD +IF+NCQ+D YQDTL
Sbjct  348   DYFVAKDIGFENSAGAKGHQAVALRVQSDLSIFYNCQMDGYQDTL  392



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   305 bits (780),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 163/349 (47%), Positives = 223/349 (64%), Gaps = 16/349 (5%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             NK   SS KA+E +C+ T ++E C   L  AA +++D KEL++  F V   ++ +V+K S
Sbjct  41    NKGTSSSKKAIETICQTTSYKETCQSSLEKAAGDTSDPKELIKTGFQVAADKLDEVIKNS  100

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
              TL+  AKDP  S+A  +C+E+L  + +D+  A+D+M     +   ++ Y+ D+KVWLS 
Sbjct  101   NTLKDLAKDPMASQALDVCKEMLDTAAEDLLGAVDKMGPFDAS--KMNEYVEDLKVWLSA  158

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKL  785
             A+  + TCL+ F GT+G++ +KMK  L TAQ+LT N L MV EI   L S++     R+L
Sbjct  159   AVNHQQTCLDAFEGTKGEAGEKMKGFLKTAQELTSNGLAMVSEISSLLGSVNSNTHRRRL  218

Query  786   LADS----------RSLPVWATAAQRRLLEA---PVTPDVVVAKDGSGKYKTINEAIPDI  926
             L  S          + LP W  A +  LL A    + P+VVVA+DG+GKYK+I EA+ ++
Sbjct  219   LGSSSGDQKSKRVYKPLPSWIGARKLDLLTATPQSLKPNVVVAQDGTGKYKSIQEALKEV  278

Query  927   PLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTV  1106
             P KS + FVI+IK GVYKE V++ K M NVV +GDGPTKT ISGS++Y  G  T  T T 
Sbjct  279   PKKSAQPFVIYIKEGVYKEYVIVDKDMTNVVMIGDGPTKTRISGSKNYADGTTTMYTATF  338

Query  1107  IVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
                G  F+ K IG ENTAG   HQAVALRVQSD +IF+NC IDAYQDTL
Sbjct  339   AAVGDYFVAKGIGFENTAGAAKHQAVALRVQSDFSIFYNCYIDAYQDTL  387



>ref|XP_011071427.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   304 bits (778),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 217/331 (66%), Gaps = 6/331 (2%)
 Frame = +3

Query  267   STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  446
             STKAV+ +C PT ++E C   LS A N+TD KELV+ AF  T K I +V+K S   Q AA
Sbjct  39    STKAVQSICAPTDYKETCESSLSHA-NTTDPKELVKAAFEFTEKNIGEVIKNSSLFQEAA  97

Query  447   KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENT  626
             KD  T +A +ICQE+L  +IDD+KR+ D   +     AN   Y+ D+K WLS  +T   T
Sbjct  98    KDNGTKQALEICQEVLDTAIDDLKRSFDTFGEFDATKANE--YVEDLKTWLSAVITNHET  155

Query  627   CLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RKLLADSRS  803
             C++ F  T GD+ +KMK L+ T ++++ N L MV  +   L SL I GL+ RKLL++   
Sbjct  156   CIDAFENTTGDTGEKMKHLMKTTREMSSNGLAMVTNMSSILASLQIGGLSSRKLLSEEEG  215

Query  804   LPVWATAAQRRLLEAP-VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGVYK  980
               ++ +  QRRLL A  + P+ VVA DGSG++ TI+ AI  +P K+N++FVI++KAG+YK
Sbjct  216   -ALFLSNNQRRLLAASSLKPNAVVALDGSGQFNTISAAIASVPPKNNQTFVIYVKAGLYK  274

Query  981   ENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIENTA  1160
             E V + KKM  +V +GDGP KT ISG ++Y  G +T  T TV V    FM K+IG ENTA
Sbjct  275   EYVQIPKKMNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVAVSADEFMAKDIGFENTA  334

Query  1161  GPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             GP+ HQAVALRV  D+A+F N  ID YQDTL
Sbjct  335   GPQGHQAVALRVSGDRAVFFNVHIDGYQDTL  365



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   309 bits (791),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/341 (47%), Positives = 224/341 (66%), Gaps = 9/341 (3%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G + I +S KA++ VC PT +++ C   L   A N++D  ELV+ AFNVTMK+IS V KK
Sbjct  44    GEEEITTSVKAIKEVCAPTDYKKTCEDTLRKDAQNTSDPLELVKTAFNVTMKQISDVAKK  103

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S+T+    KDPR   A   C+EL+  +I ++  + + +         +D  +  +++WLS
Sbjct  104   SQTMIELQKDPRAKMALDQCKELMDYAIGELSNSFEELGKFEFH--KIDEALVKLRLWLS  161

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-R  779
               ++ E TCLEGF GT+GD+ + +KK L TA QLT N L MV E+   L  L I  ++ R
Sbjct  162   ATISHEETCLEGFQGTQGDAGETIKKALKTAVQLTHNGLAMVSEMSSYLGQLQIPEMSSR  221

Query  780   KLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSF  950
             +LL  S+  P W  A  RRLL AP   V PD+VVA+DGSG+YKTINEA+ ++P K N +F
Sbjct  222   RLL--SQDFPSWMDARARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALLNVPKKKNTTF  279

Query  951   VIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFM  1130
             V+HIK G+YKE V + + M ++VF+GDG  KT+I+G ++Y  G  T +T TV + G  F+
Sbjct  280   VVHIKGGIYKEYVQVNRSMTHLVFIGDGSDKTVITGDKNYKDGITTYKTATVAIVGDHFI  339

Query  1131  GKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              KNIG ENTAGP  HQAVA+RV +DQ+IF+NC+ D YQDTL
Sbjct  340   AKNIGFENTAGPIKHQAVAIRVLADQSIFYNCRFDGYQDTL  380



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   305 bits (780),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 160/345 (46%), Positives = 228/345 (66%), Gaps = 17/345 (5%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             +STKA++ +C+PT ++E C K L SA  NST+ KEL++  F V M ++ +V+K S TLQ 
Sbjct  50    TSTKAIQAICQPTDYKETCQKSLESAGVNSTEPKELIKAGFKVAMDKLHEVIKNSTTLQE  109

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFE  620
              AKDP  ++A + C+ELL  +I D+  + D++     +   +D Y  D+K+WLS A+T+E
Sbjct  110   LAKDPGANQALENCKELLDYAIGDLAASFDKLGPFDIS--KIDAYAEDLKIWLSAAMTYE  167

Query  621   NTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA---  791
              TCL+GF  T GD+ +KMK+LL + Q+LT N L MV EI   L S ++    R+LLA   
Sbjct  168   QTCLDGFQNTTGDAGEKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVKQSQRRLLAAGA  227

Query  792   --DSRS-----LPVWATAAQ---RRLLEAPVTPDVVVAKDGSGKYKTINEAIPDIPLK-S  938
               D++      +PVW         R     + PDV VAKDGSG+ K+I EA+  IP   +
Sbjct  228   GGDTKKNTPKIIPVWIDKRAMDVSRATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNA  287

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKG  1118
             +K+FVI++K GVY E+V++ K M NV+ +GDGPTKT I+G+++Y  G +T +T TV V G
Sbjct  288   DKTFVIYVKEGVYNEHVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTKTFQTATVAVVG  347

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               F+ K+IG EN+AG + HQAVALRVQSD +IF+NCQ+D YQDTL
Sbjct  348   DYFVAKDIGFENSAGAKGHQAVALRVQSDLSIFYNCQMDGYQDTL  392



>ref|XP_011071421.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   303 bits (777),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 217/331 (66%), Gaps = 6/331 (2%)
 Frame = +3

Query  267   STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  446
             STKAV+ +C PT ++E C   LS A N+TD KELV+ AF  T K I +V+K S   Q AA
Sbjct  39    STKAVQSICAPTDYKETCESSLSDA-NTTDPKELVKAAFEFTEKNIGEVIKNSSLFQEAA  97

Query  447   KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENT  626
             KD  T +A +ICQE+L  +IDD+KR+ D   +     AN   Y+ D+K WLS  +T   T
Sbjct  98    KDNGTKQALEICQEVLDTAIDDLKRSFDTFGEFDATKANE--YVEDLKTWLSAVITNHET  155

Query  627   CLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RKLLADSRS  803
             C++ F  T GD+ +KMK L+ T ++++ N L MV  +   L SL I GL+ RKLL++   
Sbjct  156   CIDAFENTTGDTGEKMKHLMKTTREMSSNGLAMVTNMSSILASLQIGGLSSRKLLSEEEG  215

Query  804   LPVWATAAQRRLLEAP-VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGVYK  980
               ++ +  QRRLL A  + P+ VVA DGSG++ TI+ AI  +P K+N++FVI++KAG+YK
Sbjct  216   -ALFLSNNQRRLLAASSLKPNAVVALDGSGQFNTISAAIASVPPKNNQTFVIYVKAGLYK  274

Query  981   ENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIENTA  1160
             E V + KKM  +V +GDGP KT ISG ++Y  G +T  T TV V    FM K+IG ENTA
Sbjct  275   EYVQIPKKMNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVAVSADEFMAKDIGFENTA  334

Query  1161  GPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             GP+ HQAVALRV  D+A+F N  ID YQDTL
Sbjct  335   GPQGHQAVALRVSGDRAVFFNVHIDGYQDTL  365



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   306 bits (785),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/346 (47%), Positives = 226/346 (65%), Gaps = 17/346 (5%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G   I +S KAV+ VC PT +R+ C   L     N+TD  ELV+ AF+VTMK+I+   KK
Sbjct  47    GKGEITASVKAVKDVCAPTDYRKTCEDTLIKNGKNTTDPMELVKTAFSVTMKQITDAAKK  106

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVD---HAGAGANLDLYMNDIKV  593
             S+T+    KDPRT  A   C+EL+  ++ ++  + + +     H      LD  + ++++
Sbjct  107   SQTMMELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFHL-----LDEALINLRI  161

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WLS A++ E TCLEGF GT+G++ + MKK L TA +LT N L ++ E+ + +  + I GL
Sbjct  162   WLSAAISHEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGL  221

Query  774   N-RKLLADSRSLPVWATAAQRRLLEAP-----VTPDVVVAKDGSGKYKTINEAIPDIPLK  935
             N R+LLA+    P W     R+LL+A      V PD+VVA+DGSG+Y TINEA+  +P K
Sbjct  222   NSRRLLAEG--FPSWLDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYTTINEALQFVPKK  279

Query  936   SNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVK  1115
              N +FV+HIKAG+YKE V + K M ++VF+GDGP KTIISG+++Y  G  T  T TV + 
Sbjct  280   KNTTFVVHIKAGLYKEYVQVNKSMTHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIV  339

Query  1116  GSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G+ F+ KNIG ENTAG   HQAVALRVQSD++IF NC+ D YQDTL
Sbjct  340   GNYFIAKNIGFENTAGAIKHQAVALRVQSDESIFFNCRFDGYQDTL  385



>ref|XP_003555613.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=585

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/351 (44%), Positives = 234/351 (67%), Gaps = 20/351 (6%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++ SS KAV+ +CKPT + + C K LSA A N+TD +EL+++AFN+T+K+I   +KK+  
Sbjct  51    HVASSVKAVKTLCKPTDYPKECEKSLSAEAGNTTDPRELIKIAFNITIKKIGNGLKKTDI  110

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             +     DP +  A   C++L+  SID+ KR+L+RM        NLD  +N ++VWLSGA+
Sbjct  111   MHKVENDPISKMALDTCKQLMDLSIDEFKRSLERMGKFDLN--NLDNILNSLRVWLSGAI  168

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-AGLNRKLL  788
             T+++TCL+GF  T  ++ +KMK LL ++  ++ N L ++ E+ D +  +++    +R+L+
Sbjct  169   TYQDTCLDGFKNTTNEAGNKMKNLLTSSMHMSSNALAIISEVADIVAKMNVNKDGHRELV  228

Query  789   ADSRS----------LPVW----ATAAQRRLLEAP--VTPDVVVAKDGSGKYKTINEAIP  920
              DSR           +P W        +R L E+P  V P+VVVAKDGSGKYK+IN+A+ 
Sbjct  229   EDSRGGEHVFGHEEVIPSWVEEDGVGVRRLLHESPHKVKPNVVVAKDGSGKYKSINQALK  288

Query  921   DIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETG  1100
              +P ++ K FVI+IK GVY E V +TKKM +VVFVGDG +KT I+G++++V G  T  T 
Sbjct  289   KVPARNQKPFVIYIKEGVYHEYVEVTKKMTHVVFVGDGGSKTRITGNKNFVDGINTYRTA  348

Query  1101  TVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +V + G  F+  NIG EN+AGPE HQAVA+RVQ+D++IF+ C +D YQDTL
Sbjct  349   SVAILGDYFIAINIGFENSAGPEKHQAVAIRVQADRSIFYKCSMDGYQDTL  399



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   306 bits (785),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 225/344 (65%), Gaps = 19/344 (6%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             + I +S KA++ VC PT +++ C   L   A +++D  ELV  AFN TMK+IS V KKS 
Sbjct  47    EEITASVKAIKDVCAPTDYKKTCEDTLRKDAKDTSDPLELVRTAFNATMKQISNVGKKSL  106

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMND-----IKV  593
             T+    KDPRT  A   C EL+  +I ++ ++ D +          +L+  D     +KV
Sbjct  107   TMIELQKDPRTKMALDQCTELMDYAIGELSKSFDEL-------GRFELHKVDDALIKLKV  159

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WLS  ++ E TCL+GF GT+GD+ + MKK L TA QLT N L MV E+ + L  +++  +
Sbjct  160   WLSATISHEQTCLDGFQGTQGDAGETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEM  219

Query  774   N-RKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
             N R+LL  S+  P W     RRLL AP   V PD+VVA+DGSG+YKTINEA+ ++P K+N
Sbjct  220   NSRRLL--SQEFPSWVDGRVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALQNVPKKNN  277

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGS  1121
              +FVIHIK+G YKE V + + M N+VF+GDGP K+IISG++S+  G  T  T TV + G 
Sbjct  278   ATFVIHIKSGTYKEYVQVNRTMPNLVFIGDGPDKSIISGNKSFKDGITTYRTATVAIIGD  337

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              F+ KN+G ENTAG  N+QAVA+RV SD++IF+NC+ D YQDTL
Sbjct  338   NFIAKNMGFENTAGALNYQAVAVRVLSDESIFYNCRFDGYQDTL  381



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   303 bits (775),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 155/336 (46%), Positives = 231/336 (69%), Gaps = 9/336 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
               SS K ++  C PT ++E C   LSAA  NSTD KELV +AF +T+ +I +    S  L
Sbjct  39    FSSSQKNIKDFCNPTDYQETCESTLSAAAGNSTDPKELVNLAFQITIDQIKEAFNHSTVL  98

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
               AAK+PRTS+A + C+ELL  +IDD++ ++D++     +   LD +++D+KVW+S ++T
Sbjct  99    SEAAKNPRTSDALENCRELLDYAIDDLRSSIDQL--EGFSLIKLDKFLDDLKVWISASIT  156

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+GF  T  ++A+ M+K L ++ ++T N L +V  + + L SL++ G++RKLLA+
Sbjct  157   YQETCLDGFENTTTNAAESMRKALNSSAEMTSNILAIVINLDNTLDSLNL-GISRKLLAE  215

Query  795   SRSLPVWATAAQRRLLE---APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIK  965
                 P W +  +RRLL+   A + P+V VA+DG+G  KTIN+A+  +P KSN +FVI+IK
Sbjct  216   E--YPSWVSLGKRRLLQLSPAELKPNVTVAQDGTGDVKTINDALLRVPKKSNHTFVIYIK  273

Query  966   AGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIG  1145
              GVYKE V + + + NV+ VGDG  KT I+GS +Y+ G  T +T TV V G GF+GK++ 
Sbjct  274   EGVYKEKVQVNRSLTNVIMVGDGTNKTKITGSLNYIDGTATFKTATVAVIGDGFIGKDLW  333

Query  1146  IENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             IEN+AG   HQAVALRVQSD+++F+N +ID YQDTL
Sbjct  334   IENSAGAAKHQAVALRVQSDKSVFYNVRIDGYQDTL  369



>ref|NP_001049858.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|ABF95479.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11772.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|EAY89657.1| hypothetical protein OsI_11188 [Oryza sativa Indica Group]
 gb|EAZ26616.1| hypothetical protein OsJ_10519 [Oryza sativa Japonica Group]
Length=565

 Score =   303 bits (775),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 152/339 (45%), Positives = 224/339 (66%), Gaps = 10/339 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S K+++  C+P  +RE C   L   A N+T+  +L +  F  T + I K +++S  L
Sbjct  39    LSTSVKSIKSFCQPVDYRETCETTLEQTAGNATNPTDLAKAIFKATSERIEKAVRESAVL  98

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
                  DPRTS+A K C+ELL  +IDD+K   D++       +N    ++D+K WLS ALT
Sbjct  99    NDLKNDPRTSDALKDCEELLDYAIDDLKTTFDKL--GGFQTSNFKRAVDDVKTWLSSALT  156

Query  615   FENTCLEGFL-GTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA  791
             ++ TCL+GF   T  ++++KM+K L ++Q+LT N L +VD+  D L +LDI G +R+LL 
Sbjct  157   YQETCLDGFENSTSTEASEKMRKALKSSQELTENILAIVDQFADTLANLDITGFSRRLLG  216

Query  792   DSRSLPVWATAAQRRLLEA-----PVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             D   +PVW + A+RRLLEA        PDV VA DGSG +KTINEA+  +P+KS  ++V+
Sbjct  217   DD-GVPVWMSNAKRRLLEATPGSKEFKPDVTVAADGSGDFKTINEALAKVPVKSTGTYVM  275

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGK  1136
             ++KAG YKE V + + + N+V +GDG TKTII+G++S++    T +T T+   G+GF  +
Sbjct  276   YVKAGTYKEYVSVARNVTNLVMIGDGATKTIITGNKSFMLNITTKDTATMEAIGNGFFMR  335

Query  1137  NIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              IG+ENTAG +NHQAVALRVQSDQ+ F+ CQ D +QDTL
Sbjct  336   GIGVENTAGSKNHQAVALRVQSDQSAFYECQFDGHQDTL  374



>ref|XP_011071429.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   301 bits (772),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 218/330 (66%), Gaps = 7/330 (2%)
 Frame = +3

Query  267   STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  446
             STKAV++VC PT +++ C + LS A N+TD KEL++ AF  T K I  V+K S   + AA
Sbjct  40    STKAVQNVCAPTDYKDTCEQSLSNA-NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEAA  98

Query  447   KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENT  626
              D  T +A  ICQE+L  +IDD+KR+ D++ +   + AN   Y+ D+K WLS  +T   T
Sbjct  99    NDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDASKANE--YLEDLKTWLSAVITNHET  156

Query  627   CLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL-NRKLLADSRS  803
             C++ F  T GD+ +KMK +L TA+Q++ N L MV  +     SL +    +RKLL++  +
Sbjct  157   CIDAFENTTGDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSTASRKLLSEEEA  216

Query  804   LPVWATAAQRRLLEAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGVYKE  983
               ++ +  QRRL+   + P+ VVA+DGSG++KTI+ AI  +P K+N+ FVIH+KAGVYKE
Sbjct  217   -DLFISIKQRRLMG--LQPNAVVAQDGSGQFKTISAAIATVPQKNNQPFVIHVKAGVYKE  273

Query  984   NVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIENTAG  1163
              V + KK+  +V +GDGP KT ISG ++Y  G +T  T TV V    F  K+IG ENTAG
Sbjct  274   YVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNADEFFAKDIGFENTAG  333

Query  1164  PENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             P+ HQAVALRV  D+AIFHN  ID YQDTL
Sbjct  334   PQGHQAVALRVSGDRAIFHNVHIDGYQDTL  363



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   303 bits (777),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 161/345 (47%), Positives = 226/345 (66%), Gaps = 17/345 (5%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             N  I +S KAV+ +C PT +++ C   L     N+TD  ELV+ AF+VTMK+I+   KKS
Sbjct  50    NGQITASVKAVKDICAPTDYKKTCEYSLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKS  109

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRA---LDRMVDHAGAGANLDLYMNDIKVW  596
             +T+    KDPRT  A   C+EL+  ++ ++  +   L ++  H      LD  + ++++W
Sbjct  110   QTIIDLQKDPRTRMALDQCKELMDYALGELSNSFEELGKLEFH-----KLDEVLINLRIW  164

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LS A++ E TCLEGF GT+G++ + MKK L TA +LT N L ++ E+ + +  +DI GLN
Sbjct  165   LSAAISHEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQIDIPGLN  224

Query  777   -RKLLADSRSLPVWATAAQRRLLEAP-----VTPDVVVAKDGSGKYKTINEAIPDIPLKS  938
              R+LLA  + +P W     RRLL+A        PD+VVA+DGSG+Y TIN+A+  +P K 
Sbjct  225   SRRLLA--QEIPSWVDQRGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKKK  282

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKG  1118
             N +FV+HIKAG+YKE V + K M ++VF+GDGP KTIISGS++Y  G  T  T TV + G
Sbjct  283   NTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIVG  342

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               F+ KNIG  NTAG   HQAVA+RVQSD++IF NC+ D YQDTL
Sbjct  343   DYFIAKNIGFVNTAGAIKHQAVAIRVQSDESIFFNCRFDGYQDTL  387



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/343 (47%), Positives = 225/343 (66%), Gaps = 11/343 (3%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G   + +S KAV+ VC PT +R+ C   L     N+TD  ELV+ AFNVTMK+I+   KK
Sbjct  47    GKAEVNASVKAVKDVCAPTDYRKTCEDTLIKNGKNTTDPMELVKTAFNVTMKQITDAAKK  106

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S+T+    KD RT  A   C+EL+  ++D++  + + +         LD  + ++++WLS
Sbjct  107   SQTIMELQKDSRTRMALDQCKELMDYALDELSNSFEELGKFEFH--LLDEALINLRIWLS  164

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-R  779
              A++ E TCLEGF GT+G++ + MKK L TA +LT N L ++ E+ + +  + I GLN R
Sbjct  165   AAISHEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSR  224

Query  780   KLLADSRSLPVWATAAQRRLLEAP-----VTPDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
             +LLA+    P W     R+LL+A      V PD+VVA+DGSG+YKTINEA+  +P K N 
Sbjct  225   RLLAEG--FPSWVDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNT  282

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
             +FV+HIKAG+YKE V + K M ++VF+GDGP KTIISG+++Y  G     T TV + G+ 
Sbjct  283   TFVVHIKAGLYKEYVQVNKTMSHLVFIGDGPDKTIISGNKNYKDGITAYRTATVAIVGNY  342

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F+ KNIG ENTAG   HQAVA+RVQSD++IF NC+ D YQ+TL
Sbjct  343   FIAKNIGFENTAGAIKHQAVAVRVQSDESIFFNCRFDGYQNTL  385



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score =   302 bits (774),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/343 (44%), Positives = 228/343 (66%), Gaps = 11/343 (3%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLS--AATNSTDTKELVEVAFNVTMKEISKVMKK  422
             + ++  S KA++ +C+PT ++E CV  L+  A +N+TD KELV+++F V ++++ KV  +
Sbjct  59    DNHVQDSMKAIKTICQPTDYKEACVSSLTSVAGSNTTDPKELVKLSFEVALEKVKKVAGQ  118

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAG-ANLDLYMNDIKVWL  599
             S  L+   KDP T +A  IC E++  +ID++K ++D++    G   +N++  + +I+ WL
Sbjct  119   SALLKEVEKDPGTRQALSICDEIMDYAIDELKNSIDQV---GGFDLSNMEEIIENIRSWL  175

Query  600   SGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNR  779
             S A+T++ TC++ F  T   + ++MKK++ TA +LT NTL +V E+ D   S  I   NR
Sbjct  176   SAAITYQETCVDAFENTTSKAGEQMKKVMKTATKLTSNTLAIVTELSDVFASFKIPNFNR  235

Query  780   KLLADS-RSLPVWATAAQRRLL----EAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
             +LL+ S    P W + ++RRL      A   PDVVVA+DGSG   T+NEA+  +P    K
Sbjct  236   RLLSTSNEGFPEWVSQSKRRLFTEDTPAESIPDVVVAQDGSGNCTTVNEALALVPAYGIK  295

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
              FVI++K G+YKENV + K M NV  +GDGPTK++I+   ++V G +T  T TV V G+G
Sbjct  296   PFVIYVKEGIYKENVNIEKNMTNVFMIGDGPTKSVITAGLNFVDGVKTFNTATVGVVGNG  355

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F+ KN+G EN+AG E HQAVALRV+SD +IF+NCQ+D YQDTL
Sbjct  356   FVAKNMGFENSAGAEKHQAVALRVESDFSIFYNCQMDGYQDTL  398



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/339 (46%), Positives = 224/339 (66%), Gaps = 11/339 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I +S KAV+ VC PT +++ C   L     N+TD  ELV+ AF+VTMK+I+   KKS+T+
Sbjct  51    INASVKAVKDVCAPTDYKKTCEDTLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKSQTM  110

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
                 KDPRT  A   C+EL+  ++ ++  + + +         LD  + ++++WLS A++
Sbjct  111   MELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFH--KLDEALINLRIWLSAAIS  168

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RKLLA  791
              E TCLEGF GT+G++ + MKK L TA +LT N L ++ E+ + +  ++I GLN R+LLA
Sbjct  169   HEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMEIPGLNSRRLLA  228

Query  792   DSRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
               + +P W     RRLL+         PD+VVA+DGSG+Y TIN+A+ ++P K N +FV+
Sbjct  229   --QEIPSWVDQRGRRLLQDAAAYSDSKPDIVVAQDGSGQYTTINDALKNVPKKKNTTFVV  286

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGK  1136
             HIKAG+YKE V + K M ++VF+GDGP KTIISG+++Y  G  T  T TV + G  F+ K
Sbjct  287   HIKAGLYKEYVQVNKSMTHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGDYFIAK  346

Query  1137  NIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             NIG  NTAGP  HQAVA+RVQSD++IF NC+ D YQDTL
Sbjct  347   NIGFVNTAGPIKHQAVAVRVQSDESIFFNCRFDGYQDTL  385



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   305 bits (782),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/341 (47%), Positives = 225/341 (66%), Gaps = 9/341 (3%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G++ I +S KA++ VC PT ++E C   L   A +++D  ELV+ AFN TMK+IS V KK
Sbjct  46    GDEEITTSVKAIKDVCAPTDYKETCEDTLRKDAKDTSDPLELVKTAFNATMKQISDVAKK  105

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S+T+    KDPR   A   C+EL+  +I ++ ++ + +         +D  +  +++WLS
Sbjct  106   SQTMIELQKDPRAKMALDQCKELMDYAIGELSKSFEELGKFEFH--KVDEALVKLRIWLS  163

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-R  779
               ++ E TCL+GF GT+G++ + +KK L TA QLT N L MV E+ + L  + I  +N R
Sbjct  164   ATISHEQTCLDGFQGTQGNAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMNSR  223

Query  780   KLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSF  950
             +LL  S+  P W  A  RRLL AP   V PD+VVA+DGSG+YKTINEA+  +P K N +F
Sbjct  224   RLL--SQEFPSWMDARARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALNFVPKKKNTTF  281

Query  951   VIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFM  1130
             V+HIK G+YKE V + + M ++VF+GDGP KT+ISGS+SY  G  T +T TV + G  F+
Sbjct  282   VVHIKEGIYKEYVQVNRSMTHLVFIGDGPDKTVISGSKSYKDGITTYKTATVAIVGDHFI  341

Query  1131  GKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              KNI  ENTAG   HQAVA+RV +D++IF+NC+ D YQDTL
Sbjct  342   AKNIAFENTAGAIKHQAVAIRVLADESIFYNCKFDGYQDTL  382



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   305 bits (780),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 162/344 (47%), Positives = 223/344 (65%), Gaps = 23/344 (7%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I +S KA++ VC PT +++ C   L   A N++D  ELV+ AFN TMK+IS V KKS+T+
Sbjct  52    ITASVKAIKDVCAPTDYKKTCEDTLKKDAKNTSDPLELVKTAFNATMKQISDVAKKSQTM  111

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM-------VDHAGAGANLDLYMNDIKV  593
                 KDPRT  A   C+EL+  ++ ++ ++ + +       VD A         +  +K+
Sbjct  112   IDLQKDPRTKMALDQCKELMDYAVGELSKSFEELGKFELNKVDEA---------LVKLKI  162

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WLS  ++ E TCLEGF GT+GD+ + +KK L TA QLT N L MV E+ + L  + I  L
Sbjct  163   WLSATISHEQTCLEGFQGTQGDAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEL  222

Query  774   N-RKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
             N R+LL  S+  P W     R+LL AP   V PD+VVA+DGSG+Y TINEA+  +P K N
Sbjct  223   NSRRLL--SQEFPSWMDGRARKLLTAPMSEVKPDIVVAQDGSGQYATINEAMNHVPKKKN  280

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGS  1121
              +FV+HIKAG+YKE V + + M ++VF+GDGP KT+ISGS+S+  G  T  T TV + G 
Sbjct  281   MTFVVHIKAGIYKEFVQVNRSMTHLVFIGDGPDKTVISGSKSFKDGITTYRTTTVAIVGD  340

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              F+ KN+G ENTAG   HQAVA+RV SD++IF+NC+ D YQDTL
Sbjct  341   HFIAKNMGFENTAGAIKHQAVAIRVLSDESIFYNCRFDGYQDTL  384



>ref|XP_006349952.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Solanum tuberosum]
Length=430

 Score =   296 bits (757),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/334 (45%), Positives = 217/334 (65%), Gaps = 11/334 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             I SS+K+V+ +C+PT ++E C K L +A N++D KEL++ AF+ TM EIS  +K S   +
Sbjct  44    ISSSSKSVQAMCQPTQYKEACEKSLGSAKNTSDPKELIKTAFDNTMTEISNSIKNSAPFK  103

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTF  617
              AA DPRT  A K+C E+L  SI++ KR+  + +D       +  Y+ D++ WLS A+TF
Sbjct  104   EAANDPRTKNALKVCDEVLDRSIEEFKRSFSQ-IDSNDLNKLIKEYIYDVRSWLSSAVTF  162

Query  618   ENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL-NRKLLAD  794
             E TC++ F  T GD+ +KMK +L TA +L+   L++V    + +  L   G+ NR+LL  
Sbjct  163   EETCIDAFANTTGDTGEKMKSILKTASELSSVALDIVSSFEEQMAGLQGLGIANRRLLV-  221

Query  795   SRSLPVWATAAQRRLLE-APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAG  971
                    A A  RRLL+ A + P+VVVA+DGSG++K+INEA+  +P  + + +VI IKAG
Sbjct  222   -------AEAGNRRLLQIATLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAG  274

Query  972   VYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIE  1151
             +Y ENV +   M NVVF+G+G  KT I+G+++Y+ G     T TV + G GFM K+IG E
Sbjct  275   IYNENVEVANTMTNVVFIGEGSNKTKITGNKNYLDGLPIFLTATVSISGQGFMAKDIGFE  334

Query  1152  NTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             N+AGP   +AVALRV ++  +F NCQID YQ TL
Sbjct  335   NSAGPLKKEAVALRVSAEMIVFQNCQIDGYQSTL  368



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score =   301 bits (771),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 225/346 (65%), Gaps = 17/346 (5%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  422
             GN  I +S KAV+ +C PT +++ C   L     N+TD  ELV+ AF+VTMK+I+   KK
Sbjct  49    GNGQITASVKAVKDICAPTDYKKTCEDSLIKNGKNTTDPMELVKTAFSVTMKQITDAAKK  108

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRA---LDRMVDHAGAGANLDLYMNDIKV  593
             S+T+    KDPRT  A   C+EL+  ++ ++  +   L ++  H      LD  + ++++
Sbjct  109   SQTIIDLQKDPRTRMALDQCKELMDYALGELSNSFEELGKLEFH-----KLDEVLINLRI  163

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WLS A++ E TCLEGF GT+G++ + MKK L TA +LT N L ++ E+ + +  +DI GL
Sbjct  164   WLSAAISHEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMDIPGL  223

Query  774   N-RKLLADSRSLPVWATAAQRRLLEAP-----VTPDVVVAKDGSGKYKTINEAIPDIPLK  935
             N R LLA  + +P W      RLL+A        PD+VVA+DGSG+Y TIN+A+  +P K
Sbjct  224   NSRGLLA--QEIPSWVDQRGPRLLQAASGYSDAKPDIVVAQDGSGQYATINDALKHVPKK  281

Query  936   SNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVK  1115
              N +FV+HIKAG+YKE V + K M ++VF+GDGP KTIISGS++Y  G  T  T TV + 
Sbjct  282   KNTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIV  341

Query  1116  GSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  F+ KNIG  NTAG   HQAVA+RVQSD++IF NC+ D YQDTL
Sbjct  342   GDYFIAKNIGFVNTAGAIKHQAVAIRVQSDESIFFNCRFDGYQDTL  387



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score =   301 bits (771),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 160/345 (46%), Positives = 225/345 (65%), Gaps = 17/345 (5%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             N  I +S KAV+ +C PT +++ C   L     N+TD  ELV+ AF+VTMK+I+   KKS
Sbjct  50    NGQITASVKAVKDICAPTDYKKTCEYSLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKS  109

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRA---LDRMVDHAGAGANLDLYMNDIKVW  596
             +T+    KDPRT  A   C+EL+  ++ ++  +   L ++  H      LD  + ++++W
Sbjct  110   QTIIDLQKDPRTRMALDQCKELMDYALGELSNSFEELGKLEFH-----KLDEVLINLRIW  164

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LS A++ E TCLEGF GT+G++ + MKK L TA +LT N L ++ E+ + +  +DI GLN
Sbjct  165   LSAAISHEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQIDIPGLN  224

Query  777   R-KLLADSRSLPVWATAAQRRLLEAP-----VTPDVVVAKDGSGKYKTINEAIPDIPLKS  938
               +LLA  + +P W     RRLL+A        PD+VVA+DGSG+Y TIN+A+  +P K 
Sbjct  225   SCRLLA--QEIPSWVNQRGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKKK  282

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKG  1118
             N +FV+HIKAG+YKE V + K M ++VF+GDGP KTIISGS++Y  G  T  T TV + G
Sbjct  283   NTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIVG  342

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               F+ KNIG  NTAG   HQAVA+RVQSD++IF NC+ D YQDTL
Sbjct  343   DYFIAKNIGFVNTAGAIKHQAVAIRVQSDESIFFNCRFDGYQDTL  387



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   299 bits (766),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 162/352 (46%), Positives = 230/352 (65%), Gaps = 19/352 (5%)
 Frame = +3

Query  246   GNKN---IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKV  413
             GNK    +G+  KA+E +C+PT ++E C   L   A ++TD K+L++  F V   ++++V
Sbjct  38    GNKKPAKVGAKKKAIETICQPTTYKETCQSSLEKEAGDTTDPKDLIKAGFKVAADKVNEV  97

Query  414   MKKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKV  593
             +K S TL+  AKDP TS+A  +C+ELL+ +++D+  A+D+M     +   +D Y+ D+KV
Sbjct  98    IKNSNTLKEHAKDPMTSQALGVCKELLETAVEDLLGAVDKMGPFDAS--KIDDYLADLKV  155

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WLS A+  + TCL+ F  T+G++ +KMK  L TAQ+LT N L MV EI   LV       
Sbjct  156   WLSAAVNHQATCLDAFKDTKGEAGEKMKGFLKTAQELTSNGLAMVSEI-SRLVGSPKLNS  214

Query  774   NRKLLADSRS---------LPVWATAAQRRLLEA---PVTPDVVVAKDGSGKYKTINEAI  917
             +R+L++ S+          +P W +     LL A    + P+VVVAKDG+GKYKTINEA+
Sbjct  215   HRRLMSSSKGGQRNRNYKPVPGWMSDRDLDLLTATPESLKPNVVVAKDGTGKYKTINEAL  274

Query  918   PDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSET  1097
              ++P KS ++FVI+IK GVY+E V++ K+M NVV +GDGPT T ISGS+S+  G  T +T
Sbjct  275   KEVPQKSKEAFVIYIKKGVYEETVIVDKQMTNVVMIGDGPTMTRISGSKSHADGVTTMKT  334

Query  1098  GTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              T    G+ F+ K IG ENTAG   HQAVALRVQSD +IF NC +DAYQDTL
Sbjct  335   ATFAALGNYFVAKGIGFENTAGHVKHQAVALRVQSDFSIFFNCHMDAYQDTL  386



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 164/358 (46%), Positives = 225/358 (63%), Gaps = 25/358 (7%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             G   + +STKAV+ +C PT ++E C   L+ A N+TD KEL+ +AFN  +  I   +K S
Sbjct  47    GGGGVSTSTKAVQAICSPTDYKETCESSLAGA-NTTDPKELIRLAFNAAVNNIGDAIKNS  105

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
                + AA D  T +AF IC ++L  +IDD+KRA D++ +       +D Y+ D+KVWLS 
Sbjct  106   TLFKDAAADSSTKDAFDICDDVLGSAIDDLKRAGDKVGEFDAT--KVDEYVEDLKVWLSA  163

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL----  773
              +T++ TC++ F  T GD+A+KMK LL TA++L+ N L MV ++   +  L +  L    
Sbjct  164   VITYQETCIDAFENTTGDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGST  223

Query  774   NRKLLA-DSRSL-------------PVWATAAQ-RRLLEA---PVTPDVVVAKDGSGKYK  899
             +R+LL+ + R L             P W  +   RRLL A   P+ P+ VVA DGSG++K
Sbjct  224   SRRLLSKEERVLYGGDPTDYAPGEDPYWIKSPHSRRLLSAAAAPLKPNAVVALDGSGQFK  283

Query  900   TINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGG  1079
             TI +AI  IP K+ + FVI IKAG+YKE+V + KK+  VV +G+GP KT I+GS+SY GG
Sbjct  284   TIKDAINTIPKKNTQPFVIFIKAGLYKEHVEIPKKVNGVVMIGEGPLKTRITGSKSYAGG  343

Query  1080  YQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              +T  T TV V G  FM K+IG ENTAG E HQAVALRV  D+AIF N  ID YQDTL
Sbjct  344   VKTFHTATVAVNGEDFMAKDIGFENTAGAEGHQAVALRVSGDRAIFLNVAIDGYQDTL  401



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   299 bits (766),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 230/347 (66%), Gaps = 13/347 (4%)
 Frame = +3

Query  246   GNKN--IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVM  416
             GNK+  I SS KA++ +C+PT +++ C+  L A   NS+D +ELV+  F   MK I    
Sbjct  48    GNKSHEISSSMKAIKAICQPTDYKQECIASLKATGNNSSDPQELVQAGFKAAMKLIQAAA  107

Query  417   KKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVW  596
              KS  L+   KDPRTS+A   C+EL+  +ID++K +++++ +       LD  + DI++W
Sbjct  108   NKSVDLKQLEKDPRTSKALAGCKELMDFAIDELKYSMNKLGEFDIT--KLDEMLIDIRIW  165

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LS  +T++ TCL+GF  T G++A+KMKK L T+ +L+ N L MV +    L  L I G++
Sbjct  166   LSATITYQETCLDGFQNTTGNAAEKMKKALKTSMKLSSNGLAMVSQFSSMLTELQIPGIS  225

Query  777   RKLLADSRSL-----PVWATAAQRRLLEA--PVTPDVVVAKDGSGKYKTINEAIPDIP-L  932
             R+ L +   L     P WA    RRLL A   V P+VVVAKDGSG+++TI  A+  +P  
Sbjct  226   RRRLLEIPVLGHDDYPDWANPGMRRLLAAGSRVKPNVVVAKDGSGQFRTIQAALDQVPKR  285

Query  933   KSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIV  1112
             K+N ++VIHIKAGVY+E + + K + +++ +GDGP KTII+G++++V G  T +T TV V
Sbjct  286   KNNATYVIHIKAGVYQEYLQIKKTVTHLMLIGDGPKKTIITGNKNFVDGTPTFKTATVAV  345

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
                 FM ++IG ENTAGP+ HQAVALRVQ+D+A+F+NC++  YQDTL
Sbjct  346   TAEHFMARDIGFENTAGPQKHQAVALRVQADKAVFYNCEMHGYQDTL  392



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   298 bits (764),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/337 (46%), Positives = 222/337 (66%), Gaps = 18/337 (5%)
 Frame = +3

Query  267   STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  446
             + KAV  +C PT ++E C   LS A N+TD KEL++VAFN  +  I + +K S  L+ AA
Sbjct  55    ANKAVHAICSPTDYKETCESSLSGA-NTTDPKELIKVAFNAAVNNIGEAIKNSALLKDAA  113

Query  447   KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENT  626
              D  T +A  IC ++L+ +IDD+KRA D++   +   + +D Y+ D+KVWLS  +T++ T
Sbjct  114   ADNSTKDALDICNDVLESAIDDLKRAGDKV--GSFDASKVDEYVEDLKVWLSAVITYQET  171

Query  627   CLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL------NRKLL  788
             C++ F  T GD+A+KMK LL TA++L+ N L MV ++   +  L +  L      +R+L 
Sbjct  172   CIDAFENTTGDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLF  231

Query  789   ADSRSLPVWATAAQRRLL--EAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHI  962
             ++   +       +RR+L  +A   P+ VVA+DGSG++KTI EAI  +P  + K+FVI+I
Sbjct  232   SNDDWI-------KRRVLRGKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTFVIYI  284

Query  963   KAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNI  1142
             KAGVYKE+V + KKM  +VF+GDGP KT I+GS+S+ GG +T +T TV V    F  KNI
Sbjct  285   KAGVYKEHVEIPKKMNKIVFIGDGPLKTRITGSKSFAGGVKTFQTATVAVNSEEFTAKNI  344

Query  1143  GIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G ENTAG E HQAVALRV  D+A+F+N  ID YQDTL
Sbjct  345   GFENTAGAEGHQAVALRVSGDKAVFYNVAIDGYQDTL  381



>ref|XP_011071426.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 217/330 (66%), Gaps = 7/330 (2%)
 Frame = +3

Query  267   STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  446
             STKAV+++C PT +++ C + LS A N+TD KEL++ AF  T K I  V+K S   + AA
Sbjct  40    STKAVQNICAPTDYQDTCEQSLSNA-NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEAA  98

Query  447   KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENT  626
              D  T +A  ICQE+L  +IDD+KR+ D++ +     AN   Y+ D+K WLS  +T   T
Sbjct  99    NDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANE--YLEDLKTWLSAVITNHET  156

Query  627   CLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-AGLNRKLLADSRS  803
             C++ F  T GD+ +KMK +L TA+Q++ N L MV  +     SL + +  +RKLL++  +
Sbjct  157   CIDAFENTTGDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSSASRKLLSEEEA  216

Query  804   LPVWATAAQRRLLEAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGVYKE  983
               ++ +  QR L+   + P+ VVA+DGSG++KTI+ AI  +P K+N+ FVIH+KAGVYKE
Sbjct  217   -DLFISMKQRSLMG--LQPNAVVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKE  273

Query  984   NVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIENTAG  1163
              V + KK+  +V +GDGP KT ISG ++Y  G +T  T TV V    F  K+IG ENTAG
Sbjct  274   YVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTYHTATVSVNADEFFAKDIGFENTAG  333

Query  1164  PENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             P+ HQAVALRV  D+AIFHN  ID YQDTL
Sbjct  334   PQGHQAVALRVSGDRAIFHNVHIDGYQDTL  363



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 221/338 (65%), Gaps = 18/338 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL-  434
             I +S K+V  +C+ T ++E CVK L+ A N+ D K+L++VAF  T+ ++  V+K S  L 
Sbjct  45    ISTSAKSVNVICQQTDYKETCVKSLAKANNTNDPKDLLKVAFGATINDLFDVIKNSALLI  104

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
               A+KDPRT +A K C +LL  +IDD++R+ D +            Y +D+K WLS ++T
Sbjct  105   NEASKDPRTKDALKTCGDLLDVAIDDVRRSFDEI--GVFDATKFKDYADDLKTWLSASIT  162

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDAL--VSLDIAGLNRKLL  788
             ++ TCL+ F  T G++ +KM+KLL  A +LT N+L MV      L  ++L I G+NR+LL
Sbjct  163   YQETCLDAFENTTGETGEKMRKLLKNAGELTSNSLAMVSSFGQVLTDLNLKIPGVNRRLL  222

Query  789   ADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIH  959
                        A +R L E     + P+VVVA DGSG+YK+INEA+  +P K+ + FVI 
Sbjct  223   ----------NAHERMLNEVNSNGLKPNVVVAIDGSGQYKSINEALRAVPKKNTQKFVIF  272

Query  960   IKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKN  1139
             IKAG+YKE + + KKM ++VF+G+GPTKT I+G++++  G  T +T TV + G  FM K+
Sbjct  273   IKAGIYKEYIDIPKKMNHIVFIGEGPTKTKITGNKNFADGIGTFQTATVAINGDNFMAKD  332

Query  1140  IGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             IGIENTAG   HQAVALRV  D+AIFHNCQ D YQDTL
Sbjct  333   IGIENTAGAIKHQAVALRVSGDKAIFHNCQFDGYQDTL  370



>ref|XP_011071425.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 216/330 (65%), Gaps = 7/330 (2%)
 Frame = +3

Query  267   STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  446
             STKAV+ VC PT +++ C + LS A N+TD KEL++ AF  T K I  V+K S   + AA
Sbjct  40    STKAVQSVCAPTDYKDTCEQSLSHA-NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEAA  98

Query  447   KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENT  626
              D  T +A  ICQE+L  +IDD+KR+ D++ +     AN   Y+ D+K WLS  +T   T
Sbjct  99    NDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANE--YLEDLKTWLSAVITNHET  156

Query  627   CLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-AGLNRKLLADSRS  803
             C++ F  T GD+ +KMK +L TA+Q++ N L MV  +     SL + +  +RKLL++  +
Sbjct  157   CIDAFENTTGDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSSASRKLLSEEEA  216

Query  804   LPVWATAAQRRLLEAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGVYKE  983
               ++ +  QR L+   + P+ VVA+DGSG++KTI+ AI  +P K+N+ FVIH+KAGVYKE
Sbjct  217   -DLFISMKQRSLMG--LQPNAVVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKE  273

Query  984   NVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIENTAG  1163
              V + KK+  +V +GDGP KT ISG ++Y  G +T  T TV V    F  K+IG ENTAG
Sbjct  274   YVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNADEFFAKDIGFENTAG  333

Query  1164  PENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             P+ HQAVALRV  D+AIFHN  ID YQDTL
Sbjct  334   PQGHQAVALRVSGDRAIFHNVHIDGYQDTL  363



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/339 (46%), Positives = 220/339 (65%), Gaps = 20/339 (6%)
 Frame = +3

Query  267   STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  446
             + KAV  +C PT ++E C   LS A N+TD KEL++VAFN  +  I + +K S  L+ AA
Sbjct  55    ANKAVHAICSPTDYKETCESSLSGA-NTTDPKELIKVAFNAAVNNIGEAIKNSALLKDAA  113

Query  447   KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENT  626
              D  T +A  IC ++L+ +IDD+KRA D++   A     +D Y+ D+KVWLS  +T++ T
Sbjct  114   ADNSTKDALDICNDVLESAIDDLKRAGDKV--GAFDATKVDEYVEDLKVWLSAVITYQET  171

Query  627   CLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL------NRKLL  788
             C++ F  T GD+A+KMK LL TA++L+ N L MV ++   +  L +  L      +R+L 
Sbjct  172   CIDAFENTTGDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLF  231

Query  789   ADSRSLPVWATAAQRRLLE----APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             ++   +        RR+L+    A   P+ VVA+DGSG++KTI EAI  +P  + K+FVI
Sbjct  232   SNDDWI-------NRRVLKGRGKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTFVI  284

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGK  1136
             +IKAGVYKE+V + KKM  +VF+GDGP KT I+GS+S+ GG +T +T TV V    F  K
Sbjct  285   YIKAGVYKEHVEIPKKMNKIVFIGDGPLKTRITGSKSFAGGVKTFQTATVAVNAEEFTAK  344

Query  1137  NIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             NIG ENTAG E HQAVALRV  D+A+F+N  ID YQDTL
Sbjct  345   NIGFENTAGAEGHQAVALRVSGDKAVFYNVAIDGYQDTL  383



>ref|XP_011071655.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   298 bits (762),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 217/330 (66%), Gaps = 7/330 (2%)
 Frame = +3

Query  267   STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  446
             STKAV+++C PT +++ C + LS A N+TD KEL++ AF  T K I  V+K S   + AA
Sbjct  40    STKAVQNICAPTDYQDTCEQSLSNA-NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEAA  98

Query  447   KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENT  626
              D  T +A  ICQE+L  +IDD+KR+ D++ +     AN   Y+ D+K WLS  +T   T
Sbjct  99    NDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANE--YLEDLKTWLSAVITNHET  156

Query  627   CLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-AGLNRKLLADSRS  803
             C++ F  T GD+ +KMK +L TA+Q++ N L MV  +     SL + +  +RKLL++  +
Sbjct  157   CIDAFENTTGDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQVGSSASRKLLSEEEA  216

Query  804   LPVWATAAQRRLLEAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGVYKE  983
               ++ +  QR L+   + P+ VVA+DGSG++KTI+ AI  +P K+N+ FVIH+KAGVYKE
Sbjct  217   -DLFISMKQRSLMG--LQPNAVVAQDGSGQFKTISAAIASVPQKNNQPFVIHVKAGVYKE  273

Query  984   NVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIENTAG  1163
              V + KK+  +V +GDGP KT ISG ++Y  G +T  T TV V    F  K+IG ENTAG
Sbjct  274   YVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNADEFFAKDIGFENTAG  333

Query  1164  PENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             P+ HQAVALRV  D+AIFHN  ID YQDTL
Sbjct  334   PQGHQAVALRVSGDRAIFHNVHIDGYQDTL  363



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   305 bits (780),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 161/344 (47%), Positives = 226/344 (66%), Gaps = 15/344 (4%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G++ I +S KA++ VC PT +++ C   L   A N++D  ELV+ AFN TMK+I++V KK
Sbjct  46    GDEEITTSVKAIKDVCAPTDYKKTCEDTLRKDAQNTSDPLELVKTAFNATMKQITEVAKK  105

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRA---LDRMVDHAGAGANLDLYMNDIKV  593
             S+T+    KDPRT  A   C+EL+  +I ++ ++   L R   H      +D  +  ++V
Sbjct  106   SQTMIELQKDPRTKMALDQCKELMDYAIGELSKSFEELGRFEFH-----KVDEALVKLRV  160

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WLS  ++ E TCL+GF GT+GD+ + +KK L TA QLT N L MV E+ + L  + I  +
Sbjct  161   WLSATISHEQTCLDGFQGTQGDAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEM  220

Query  774   N-RKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
             N R+LL  S+  P W     RRLL AP   V  D+VVA+DGSG+YKTINEA+  +P K N
Sbjct  221   NSRRLL--SQEFPSWMDGRTRRLLNAPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKN  278

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGS  1121
              +FV+HIK G+YKE V + + M ++VF+GDGP KT+ISG ++Y  G  T +T TV + G 
Sbjct  279   TTFVVHIKGGIYKEYVQVNRSMTHLVFIGDGPDKTVISGDKNYKDGITTYKTATVAIVGD  338

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              F+ KN+G ENTAG   HQAVA+RV SD++IF+NC+ D YQDTL
Sbjct  339   HFIAKNMGFENTAGAIKHQAVAIRVLSDESIFYNCRFDGYQDTL  382



>gb|KHN16095.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=566

 Score =   297 bits (761),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 155/355 (44%), Positives = 230/355 (65%), Gaps = 25/355 (7%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I SS KAV+ +CKPT +++ C K L A A N+TD +EL+++AF +T+K++   +KK+  +
Sbjct  29    IASSVKAVKTLCKPTDYQKECEKSLRAEAGNTTDPRELIKIAFKITIKKMGNGLKKTDFM  88

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
                  DPR+  A + C++L+  SID+ KR+L+RM        NLD  +N ++VWLSGA+T
Sbjct  89    HEVENDPRSKMALETCKQLMNLSIDEFKRSLERMGKFDLN--NLDNILNSLRVWLSGAIT  146

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN---RKL  785
             ++ TCL+GF  T   + +KMK LL +   ++ N L ++ E+ D +V +++   +   R+L
Sbjct  147   YQETCLDGFKNTTNKAGNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQL  206

Query  786   LADS---------RSLPVWATAAQ-------RRLLEAP---VTPDVVVAKDGSGKYKTIN  908
             + DS         + +P W    +       RRLL      + P+VVVAKDGSGKYK+IN
Sbjct  207   VEDSGDEHVFGQHKVIPSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSIN  266

Query  909   EAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQT  1088
             +A+  +P K+ K FVI+IK GVY E V + KKM +VVFVGDG  KT I+G++++V G  T
Sbjct  267   QALKKVPEKNQKPFVIYIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGLNT  326

Query  1089  SETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               T +V V+G  F+  NIG EN+AGPE HQAVA+RVQ+D++IF+ C +D YQDTL
Sbjct  327   YRTASVAVEGDYFVAVNIGFENSAGPEKHQAVAIRVQADKSIFYKCSMDGYQDTL  381



>ref|XP_009385223.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   297 bits (760),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 153/336 (46%), Positives = 225/336 (67%), Gaps = 9/336 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S K ++  C+PT ++  C   LSA A N+TD KELV +AF VT+  + +    S  L
Sbjct  39    LSTSNKNIKDFCRPTDYQATCESSLSAVAGNTTDPKELVNLAFQVTIDHMKEAFNHSTVL  98

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
               AAKD RTS+A + C+ELL  +I D+K ++DR+     +   LD +++D+KVW+S ++T
Sbjct  99    SEAAKDSRTSDALENCRELLDYAIYDLKSSIDRL--DGFSLTKLDKFLDDLKVWISASIT  156

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+GF  T  D+A+ M+K L ++ +LT N L +V     AL SL++ G NRKLLA+
Sbjct  157   YQETCLDGFENTTTDAAESMRKALNSSAELTSNILAIVTNFDSALDSLNL-GFNRKLLAE  215

Query  795   SRSLPVWATAAQRRLLE---APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIK  965
                 P W +   RRLL+   A + P++ VAKDGSG  KTI EA+  +P KSN +FVI+IK
Sbjct  216   E--YPSWISPGNRRLLQQSPAELKPNITVAKDGSGDVKTIGEAVLRVPTKSNYTFVIYIK  273

Query  966   AGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIG  1145
              GVY+E V + + + NV+ +GDG +KT I+G  +Y+ G  T +T TV + G GF+GK++ 
Sbjct  274   EGVYEEQVQVNRSLTNVMMIGDGTSKTKITGKLNYIDGTATFKTATVAIVGDGFIGKDLW  333

Query  1146  IENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             IEN+AG   HQAVALRVQSD+++F+N ++D YQDTL
Sbjct  334   IENSAGAAKHQAVALRVQSDKSVFYNVRMDGYQDTL  369



>ref|XP_010922274.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=574

 Score =   297 bits (760),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 150/341 (44%), Positives = 235/341 (69%), Gaps = 16/341 (5%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             +S KA++ VC+PT +++ C K LS+ + N+TD  ELV VAF+ +MK ++ V  +S+ L+ 
Sbjct  49    TSIKAIQTVCQPTDYKDACEKTLSSFSHNTTDHMELVNVAFSASMKYVTDVFDRSELLKE  108

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLY---MNDIKVWLSGAL  611
              +KDP ++EA + C+ELL+ ++DD+K+++ ++        + +LY   + D+KVWLS A+
Sbjct  109   VSKDPASTEALQTCRELLEYAMDDLKKSIVQL-----GNVHKNLYEQAVEDLKVWLSAAI  163

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL-NRKLL  788
             T+++TC++GF G    +A+ M++ +  + Q+T N L MV+++   + SL+I+ L  RKLL
Sbjct  164   TYQDTCVDGFEGINTSAAETMRQAIENSTQITSNALAMVNQLDVLVRSLNISSLLRRKLL  223

Query  789   ADS--RSLPVWATAAQRRLLE---APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
             +D+     P W  AAQRRLL+   A + P+V VA+DG+G ++TI EA+  +P  +N +FV
Sbjct  224   SDAGANEFPSWMPAAQRRLLKVRPAKIMPNVTVAQDGTGDFETITEALAQVPKDNNATFV  283

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGG-YQTSETGTVIVKGSGFM  1130
             I++KAGVYKE  ++ K M  V  +GDGPTKT I+G+ S + G   T +T TV V G  F+
Sbjct  284   IYVKAGVYKERFLVDKHMTKVTMIGDGPTKTKITGNVSVIAGEISTFKTATVAVAGEWFV  343

Query  1131  GKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  +G ENTAGPE HQAVALRV +D+++F+NC++D YQDTL
Sbjct  344   GIGLGFENTAGPEKHQAVALRVNADRSVFYNCRMDGYQDTL  384



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/348 (44%), Positives = 223/348 (64%), Gaps = 18/348 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I +S KA++ +C+P  +++ C K L  +A N+TD KEL++ AF +  K+I +  KKS TL
Sbjct  53    ISASMKAIKSICQPADYKKTCEKSLEKSAGNTTDPKELIKAAFKIAQKKIREAAKKSATL  112

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +   KDPRT +A + C+EL+  SI +++ + D++ D       LD +M D++ WLS  +T
Sbjct  113   EELEKDPRTRDALQSCKELMDMSISELQNSFDKVADFDIT--MLDDFMADLRTWLSAVIT  170

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             +E TCL+GF  T  D+ +KMKK +  A +++ N L+++D +  AL  L I G+NR+LL +
Sbjct  171   YEGTCLDGFENTTSDAGEKMKKAMKAAIEMSTNGLDIIDGLSSALADLQITGVNRRLLQE  230

Query  795   SRSL---------PVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLK-  935
                L         P W  A  RRLL AP   + P++ VAKDGSG +KTI  A+  IP   
Sbjct  231   DEVLGHDDVPSKFPSWVDAGTRRLLAAPPSKIKPNLTVAKDGSGDFKTIRGALDSIPKPK  290

Query  936   --SNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVI  1109
               S ++FV++IKAGVY+E V  TK M  ++ +GDGP KT I+G++++V G  T  T TV+
Sbjct  291   KGSTQTFVLYIKAGVYQEYVEFTKSMDYLMVIGDGPEKTRITGNKNFVDGVNTYHTATVV  350

Query  1110  VKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             V G  F+ KNIG EN+AG   HQAVALRV +D A+F+NC +D YQDTL
Sbjct  351   VLGDNFIAKNIGFENSAGAIKHQAVALRVSADFAVFYNCAMDGYQDTL  398



>ref|XP_003535332.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=589

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/355 (44%), Positives = 230/355 (65%), Gaps = 25/355 (7%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I SS KAV+ +CKPT +++ C K L A A N+TD +EL+++AF +T+K++   +KK+  +
Sbjct  52    IASSVKAVKTLCKPTDYQKECEKSLRAEAGNTTDPRELIKIAFKITIKKMGNGLKKTDFM  111

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
                  DPR+  A + C++L+  SID+ KR+L+RM        NLD  +N ++VWLSGA+T
Sbjct  112   HEVENDPRSKMALETCKQLMNLSIDEFKRSLERMGKFDLN--NLDNILNSLRVWLSGAIT  169

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN---RKL  785
             ++ TCL+GF  T   + +KMK LL +   ++ N L ++ E+ D +V +++   +   R+L
Sbjct  170   YQETCLDGFKNTTNKAGNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQL  229

Query  786   LADS---------RSLPVWATAAQ-------RRLLEAP---VTPDVVVAKDGSGKYKTIN  908
             + DS         + +P W    +       RRLL      + P+VVVAKDGSGKYK+IN
Sbjct  230   VEDSGDEHVFGQHKVIPSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSIN  289

Query  909   EAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQT  1088
             +A+  +P K+ K FVI+IK GVY E V + KKM +VVFVGDG  KT I+G++++V G  T
Sbjct  290   QALKKVPEKNQKPFVIYIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGLNT  349

Query  1089  SETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               T +V V+G  F+  NIG EN+AGPE HQAVA+RVQ+D++IF+ C +D YQDTL
Sbjct  350   YRTASVAVEGDYFVAVNIGFENSAGPEKHQAVAIRVQADKSIFYKCSMDGYQDTL  404



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score =   296 bits (758),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 221/333 (66%), Gaps = 10/333 (3%)
 Frame = +3

Query  279   VEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAAKDP  455
             +E +C+PT ++E C   L   A ++TD KELV+  F V   ++++V++ S TL+  AKDP
Sbjct  51    IEAICQPTSYKETCQSSLEKVAGDTTDPKELVKAGFQVAADKVNEVIQNSDTLKDLAKDP  110

Query  456   RTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENTCLE  635
               S+A  +C+E+L  +++D+  A+D+M     +   +D Y+ D+KVWLS A+  + TC++
Sbjct  111   MASQALDVCKEMLNTAVEDLLGAVDKMGPFEIS--KVDDYLEDLKVWLSAAVNHQATCVD  168

Query  636   GFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLADSR----S  803
              F  T+G++ DKMK  L TAQ+LT N L MV +I   L SL++    R L A S+    +
Sbjct  169   AFKDTKGEAGDKMKGFLKTAQELTSNGLAMVTQISSLLGSLNLNSHRRLLSAHSKRNYQA  228

Query  804   LPVWATAAQRRLLEA---PVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGV  974
             +P W  A Q +LL A    + P+VVVA+DGSGKYKTI EA+ ++P KSN++FVI+IK GV
Sbjct  229   VPSWMGARQLQLLTATPQSLKPNVVVAQDGSGKYKTIKEALKEVPTKSNETFVIYIKEGV  288

Query  975   YKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIEN  1154
             YKE +++ ++M NV  +GDGPTKT ISGS++   G  T  T T    G  F+ K+I  EN
Sbjct  289   YKEEIIIDRQMTNVFMIGDGPTKTKISGSKNKADGTATMHTATFAAVGDYFVAKDIRFEN  348

Query  1155  TAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             TAG   HQAVALRVQSD +IF+NC +DAYQDTL
Sbjct  349   TAGHIKHQAVALRVQSDFSIFYNCHMDAYQDTL  381



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score =   296 bits (758),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/339 (46%), Positives = 225/339 (66%), Gaps = 13/339 (4%)
 Frame = +3

Query  267   STKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  443
             S KA+E +C+PT ++E C   L   A ++TD KELV+  F V   ++++V++ S TL+  
Sbjct  45    SKKAIEAICQPTSYKETCQSSLEKVAGDTTDPKELVKAGFQVAADKVNEVIQNSDTLKDL  104

Query  444   AKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFEN  623
             AKDP  S+A  IC+ELL  +++D+  A+D+M     +   +D Y+ D+KVWLS A+  + 
Sbjct  105   AKDPMASQALDICKELLNTAVEDLLGAVDKMGPFEIS--KVDDYLEDLKVWLSAAVNHQA  162

Query  624   TCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLADSRS  803
             TC++ F  T+G++ DKMK  L TAQ+LT N L M  +I   L SL++   +R+LL+  +S
Sbjct  163   TCVDAFKDTKGEAGDKMKGFLKTAQELTSNGLAMATQISSLLGSLNLNS-HRRLLSAEKS  221

Query  804   ------LPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
                   +P W  A Q +LL A    + P+VVVA+DG+GKYKTI EA+ ++P KSN++FVI
Sbjct  222   KRNYQAVPSWMGARQLQLLTATPQNLKPNVVVAQDGTGKYKTITEALKEVPKKSNETFVI  281

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGK  1136
             +IK GVYKE +++ ++M NV  +GDGPTKT ISG+++   G  T  T T    G  F+ K
Sbjct  282   YIKEGVYKEQIIIDRQMTNVFMIGDGPTKTKISGNKNKADGTATMHTATFAAVGDYFVAK  341

Query  1137  NIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +I  ENTAG   HQAVALRVQSD +IF+NC +DAYQDTL
Sbjct  342   DIRFENTAGHIKHQAVALRVQSDFSIFYNCHMDAYQDTL  380



>ref|XP_004296866.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=559

 Score =   296 bits (758),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/343 (46%), Positives = 227/343 (66%), Gaps = 21/343 (6%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             +S+KA+E VC+PT  ++ C   L+A A N TD KEL++VA  +   ++ +V+  S+T+  
Sbjct  48    TSSKAIEAVCQPTDFKDTCKTTLAANAGNVTDPKELIKVAMKIATDKLQEVVDNSQTMHE  107

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLSG  605
               KDP   +A + C+EL+Q SI+DIK+A   M          D+     Y+ +++ WLS 
Sbjct  108   VVKDPLGDQALQNCKELIQYSINDIKKAFGNM-------GPFDVSKVKNYVKELENWLSA  160

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALV-SLDIAGLNRK  782
             ++++E TCL+GF   +GD+ DKMK  L  +Q+LT N L M+ EI   +  ++DI    R+
Sbjct  161   SVSYEQTCLDGFNSVKGDAGDKMKNFLKQSQELTKNGLAMISEISKLMGGAIDIKP-QRR  219

Query  783   LLAD---SRSLPVWATAAQRRLLEAPVT---PDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
             LLAD   S++ P W    +  L  A  +   PDVVVA+DGSGKYKT+ EA+ DIP +S K
Sbjct  220   LLADGDSSKTSPSWIDGRKLDLATASASSLKPDVVVAQDGSGKYKTVGEALKDIPKESPK  279

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
             +FVI+IK G YKE+VVL K+M NV+F+GDGPTKT I+G +++  G     T TV+V G  
Sbjct  280   TFVIYIKEGEYKEHVVLEKEMKNVMFIGDGPTKTKITGDKNFADGTHPFRTATVVVIGDY  339

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F+ K++G EN+AG + HQA+ALRVQSDQ+IF+NCQ+D YQ+TL
Sbjct  340   FIAKDMGFENSAGAKGHQAMALRVQSDQSIFYNCQMDGYQNTL  382



>ref|XP_006649944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=565

 Score =   295 bits (755),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 149/343 (43%), Positives = 224/343 (65%), Gaps = 10/343 (3%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G+  + +S K+++  C+P  +RE C   L A A N+++  +L +  F  T ++I + +++
Sbjct  35    GDGELSTSVKSIKSFCQPVDYRETCESTLEASAGNASNPTDLAKAIFKATSEKIEQAVRE  94

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S  L     D RTS A K C+ELL  +IDD+K   D++       +N    ++D+K WLS
Sbjct  95    STVLNDLKNDQRTSGALKDCKELLDYAIDDLKTTFDKL--GGFEMSNFKHAVDDLKTWLS  152

Query  603   GALTFENTCLEGFL-GTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNR  779
              ALT++ TCL+GF   T  D+++KMK  L ++Q+LT N L +VD+  D L +LD+   +R
Sbjct  153   SALTYQETCLDGFENATSTDASEKMKNALKSSQELTENILALVDQFGDTLANLDLPSFSR  212

Query  780   KLLADSRSLPVWATAAQRRLLEAP-----VTPDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
             +LL D   LP W + A+RRLL+A        PDV VA DGSG +KTINEA+  +P+K+  
Sbjct  213   RLLGDD-GLPGWISDAKRRLLQASPGAPEFKPDVTVAADGSGDFKTINEALAKVPIKATA  271

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
             ++V+++KAG YKE V + + + N+V +GDG TKTII+G++S++    T +T T+   G+G
Sbjct  272   TYVMYVKAGTYKEYVSVARNVTNLVMIGDGATKTIITGNKSFMLNITTKDTATMEAIGNG  331

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F  + IG+ENTAG +NHQAVALRVQSDQ++F+ CQ D YQDTL
Sbjct  332   FFMRGIGVENTAGAKNHQAVALRVQSDQSVFYQCQFDGYQDTL  374



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score =   298 bits (763),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 151/346 (44%), Positives = 225/346 (65%), Gaps = 14/346 (4%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             +++ +S KA+E +C+ T ++  CV+ L S+A  S+D KEL++ +F VTM++I + ++ S 
Sbjct  41    QDVTTSQKAIESICQTTRYQHTCVESLESSAEGSSDPKELIQKSFQVTMEKIKEAIENST  100

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
              LQ   KDPR   A + CQ+L   +++D+ R   +    +    +L  ++ D+K+WLSGA
Sbjct  101   MLQKLEKDPRAKLALENCQKLAWQAVNDLNRTHIKF--ESFEFNDLSHWIADLKIWLSGA  158

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI--AGLNRK  782
             +T++ TCL+GF  T G++ +KMK+ L ++ +LT N L M+ EI     SL+   +   R+
Sbjct  159   ITYQETCLDGFEKTTGETEEKMKRALNSSMELTSNALYMITEISSVFTSLNAGSSSRRRR  218

Query  783   LLADSRS--------LPVWATAAQRRLLEA-PVTPDVVVAKDGSGKYKTINEAIPDIPLK  935
             LL D           LP W    +RRLL A  + PD+VVAKDGSGKYKTINEA+ +IP  
Sbjct  219   LLFDEAPVLGHGNELLPDWVDMRRRRLLAAKEIKPDIVVAKDGSGKYKTINEALKNIPNN  278

Query  936   SNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVK  1115
              N+++V++IK G+Y E V  T  M N++ +GDGPTKT I+G++++  G  T  T T  V 
Sbjct  279   RNQTYVLYIKQGIYNEKVEFTSSMTNLMVIGDGPTKTRITGNQNFKDGTPTYLTATAAVM  338

Query  1116  GSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  F+ K+IG EN+AGPE HQAVALRV +D++IF+NC ID YQDTL
Sbjct  339   GDYFIAKDIGFENSAGPEKHQAVALRVAADKSIFYNCHIDGYQDTL  384



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   295 bits (755),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 146/363 (40%), Positives = 227/363 (63%), Gaps = 31/363 (9%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G   I + TKA++ +C+PT +++ C   L+ +  N+ D KELV+ AF V  +E++K ++K
Sbjct  41    GENKIAAGTKAIQSICQPTRYKQACESTLTNSGGNTNDPKELVKTAFRVAKEEVAKALEK  100

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGA--NLDLYMNDIKVW  596
             SKT+QAA  DPR +E  +IC+E++  +I+D    L+R V+  GA +  N+D ++ D++VW
Sbjct  101   SKTIQAAKDDPRAAEGIEICREVVGYAIND----LERTVESVGAFSMDNIDDFLEDLRVW  156

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             + GA+T++  C EGF  +  D+  KM+     +++L+ N L ++ E    L  LDI GL+
Sbjct  157   IGGAITYQEVCFEGFENSTSDAGTKMRNFFNVSRELSSNALNIITEAKSMLQYLDIPGLD  216

Query  777   --------------RKLLADSR-------SLPVWATAAQRRLLEAPVT---PDVVVAKDG  884
                           R+LL  +         +P W T  +R+++  PV+   PD  V++ G
Sbjct  217   LSALNGGGDGGAAHRRLLGKAPKGVWLAGEMPPWVTDPKRKMMNVPVSQLKPDATVSQSG  276

Query  885   SGKYKTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSR  1064
              G+YKTI+EAI  +P+ +   F+I+IKAG YKE + + KK  NV+ VGDGPTKTII+GS+
Sbjct  277   GGQYKTISEAIAKVPMNNASPFIIYIKAGTYKEYINIEKKQTNVILVGDGPTKTIITGSK  336

Query  1065  SYVGGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQ  1244
             ++  G  T +T TV V G GFM +++ IEN++GPE HQAVAL+V SD A+ +NC+    Q
Sbjct  337   NFAAGINTFKTATVGVLGDGFMARDLTIENSSGPEGHQAVALKVVSDLAVLYNCRFTGNQ  396

Query  1245  DTL  1253
             DTL
Sbjct  397   DTL  399



>ref|XP_010315470.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=598

 Score =   295 bits (755),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 150/347 (43%), Positives = 222/347 (64%), Gaps = 15/347 (4%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             +++ S+ KA+E +C+ T ++  CV+ L S    S+D KEL++ +F VT+K+I + +  S 
Sbjct  41    QDVTSTKKAIESICQTTQYQTTCVESLESTGECSSDPKELIQKSFQVTIKKIKEAIDNST  100

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
              +Q   KDPR   A + C++L   +++D+ R    +   +    +L  ++ D+K+WLSGA
Sbjct  101   FMQKLEKDPRAKMALENCEKLALQAVNDLNRT--HLKFESFEFNDLSHWIADLKIWLSGA  158

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLL  788
             +T++ +CL+GF  T G++ +KMKK L  + QLT N L M+ EI D   SL+     R+LL
Sbjct  159   ITYQESCLDGFEDTTGEAGEKMKKALNVSMQLTSNALSMITEISDVFTSLNAGSNRRRLL  218

Query  789   ADSRS--------LPVWATAAQRRLLEAPVT----PDVVVAKDGSGKYKTINEAIPDIPL  932
              D           LP W    +RRLL   V+    PDVVVAKDGSGKYK IN+A+  IP 
Sbjct  219   FDDTPVLGHGIELLPDWIDVGRRRLLAVNVSNEIKPDVVVAKDGSGKYKFINDALKHIPE  278

Query  933   KSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIV  1112
               N+++V++IK GVY E V +   M N+V +GDGPTKT I+G++S+ GG  T +T TV +
Sbjct  279   HRNQTYVLYIKEGVYDEKVEILSTMSNLVIIGDGPTKTRITGNQSFKGGVPTYQTSTVAI  338

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              G  F+ K+IG ENTAGP+ HQA+ALRV +D++IF+NC +D YQDTL
Sbjct  339   MGDYFVAKDIGFENTAGPDKHQALALRVAADKSIFYNCHMDGYQDTL  385



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score =   297 bits (761),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/347 (45%), Positives = 220/347 (63%), Gaps = 18/347 (5%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  422
             GN+ I +S KA++ VC PT +++ C   L   A N +D  ELV+ AFN TMK+IS V KK
Sbjct  44    GNEEITTSVKAIKDVCAPTDYKKTCEDTLRKDAKNISDPLELVKTAFNATMKQISNVAKK  103

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMND-----I  587
             S+T+    KDPRT  A   C+EL+  +I ++ ++ D +        + +L+  D     +
Sbjct  104   SQTMIDLQKDPRTKMALDQCKELMDYAIVELTKSFDEI-------GSFELHKMDEALIKL  156

Query  588   KVWLSGALTFENTCLEGFLGTEGD--SADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLD  761
             K+WLS  ++ E TCL+GF GT+G+  + + MKK L TA QLT N L MV E+ ++L  + 
Sbjct  157   KIWLSATISHEQTCLDGFQGTQGNNNAGETMKKALKTAVQLTHNGLAMVSEMSNSLGQMQ  216

Query  762   IAGLNRKLLADSRSLPVWATAAQRRLLEAPVT---PDVVVAKDGSGKYKTINEAIPDIPL  932
                LN + L      P W     R LL  P +   PD+VVA+DGSG+YKTINEA+ ++P 
Sbjct  217   FPELNSRRLLSQDQFPSWLDVRARSLLNVPSSEAKPDMVVAQDGSGQYKTINEALQNVPK  276

Query  933   KSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIV  1112
             K N +FV+HIK G+YKE V + + M ++VF+GDGP KT++SG +S+  G  T  T TV +
Sbjct  277   KRNATFVVHIKEGIYKEYVQVNRSMPDLVFIGDGPDKTVLSGDKSFKDGITTYRTATVGI  336

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              G  F+ KN+G ENTAG   HQAVA+RV SD++IF+NC+ D YQDTL
Sbjct  337   IGDHFIAKNMGFENTAGAIKHQAVAIRVLSDESIFYNCRFDGYQDTL  383



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 157/345 (46%), Positives = 223/345 (65%), Gaps = 15/345 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKT  431
             I ++TKAV+ VC PT ++E CV  L  A+ +ST   EL+++ FN+T++ I   +KK S+ 
Sbjct  48    IKTTTKAVQEVCAPTDYKETCVNSLMKASPDSTQPLELIKLGFNITIQSIKDSIKKASEE  107

Query  432   LQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
             L+A AAKD  T +A ++C+ L+ D+ DD+K+ LD       +  +++  + D++VWLSG+
Sbjct  108   LKAKAAKDNETKDALELCESLMTDATDDLKKCLDNF--DGFSITHIEDLVEDLRVWLSGS  165

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN----  776
             + ++ TC++ F     + +  M K+  T+++LT N L M+  I   L   ++ GL     
Sbjct  166   IAYQQTCMDTFDEINSNLSQDMHKIFKTSKELTSNGLAMITSISSFLGGFNMTGLTGDLG  225

Query  777   ---RKLLADSRSLPVWATAAQRRLL--EAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
                RKLL+    +P W     RRL+  +  V P+VVVA+DGSG+YKTINEA+  +P  + 
Sbjct  226   HYARKLLSTKDGIPSWVGPNTRRLMATQGVVKPNVVVAQDGSGQYKTINEALNLVPKANQ  285

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGTVIVKG  1118
               FVI+IK GVY E V +TKKM +V F+GDGPTKT I+GS +Y +G  +T  T TV V G
Sbjct  286   NPFVIYIKQGVYNEKVNVTKKMTHVTFIGDGPTKTKITGSLNYHIGKVKTYHTATVAVNG  345

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               F  KNIG ENTAGPE HQAVALRV +D A+FHNCQID YQDTL
Sbjct  346   DNFTAKNIGFENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTL  390



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   296 bits (757),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/339 (46%), Positives = 223/339 (66%), Gaps = 11/339 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I  S KAV+ VC PT +++ C   L     N+TD  ELV+ AF +TM +I+   KKS+T+
Sbjct  52    ITPSVKAVKDVCAPTDYKKTCEDTLIKNGKNTTDPVELVKTAFRITMNQITDAAKKSQTM  111

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +   KDPRT  A   C+EL+  ++ ++  + + +         LD  + ++++WLS A++
Sbjct  112   RELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFH--LLDEALINLRIWLSAAIS  169

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RKLLA  791
              E TCLEGF GT+G++ + MKK L TA +LT N L ++ E+ + +  + + GLN R+LLA
Sbjct  170   HEETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNYVGQMQMPGLNSRRLLA  229

Query  792   DSRSLPVWATAAQRRLLEA--PVT---PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             D   +P W     RRLL+A  P +    D+VVA+DGSG+Y TIN+A+ ++P K N +FV+
Sbjct  230   DE--VPSWVDQRGRRLLQAAAPYSDAKADIVVAQDGSGQYTTINDAMKNVPKKKNTTFVV  287

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGK  1136
             HIKAG+YKE V + + M ++VF+GDGP KTIISG++++  G  T  T TV + G  F+ K
Sbjct  288   HIKAGIYKEYVQVNRSMTHLVFIGDGPDKTIISGNKNFKDGITTYRTATVAIVGDHFIAK  347

Query  1137  NIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             NIG ENTAG   HQAVA+RVQSD+AIF NC+ D YQDTL
Sbjct  348   NIGFENTAGAIKHQAVAVRVQSDEAIFFNCRFDGYQDTL  386



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   293 bits (751),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 227/343 (66%), Gaps = 14/343 (4%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             G+  + +S+K+VE VCK   +++ C + LS A N++D +EL+++AF   +  I+ V++ S
Sbjct  44    GSDQVSTSSKSVESVCKHVDYKQTCEQSLSGAKNTSDPRELIKLAFTAAVDNIASVIQNS  103

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGA----NLDLYMNDIKV  593
               LQ AAKDPRT +A + C+  L  SI+D++R+ + +      G      +D Y+ D+K 
Sbjct  104   TLLQNAAKDPRTHQALETCKYALNTSIEDLQRSFETV------GTFDINKIDDYVADLKT  157

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WLS A TF+ TCL+ F  T GD+ ++MKKLL TA +LT N L MV +I + L + +I G 
Sbjct  158   WLSAAGTFQETCLDAFENTTGDTGEQMKKLLKTAGELTSNGLAMVTDISEVLTNFNIQGF  217

Query  774   NRKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
              R+L++ S   P +  A  R+L+ A    + P+ VVA+DGSG++K+I  A+  +P K+N+
Sbjct  218   KRRLMSSSVE-PDFVDATARKLMAASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQ  276

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
             +FVI IKAG+YKE V L K +  +V VG+GPTKT I+G++++V G  T +T T+ V G  
Sbjct  277   TFVIFIKAGIYKEYVTLPKHVNGIVLVGEGPTKTKITGNKNFVDGVGTFQTPTLSVNGDA  336

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              + K++GIEN+AG   HQAVALRV  D+ I +NCQIDAYQDTL
Sbjct  337   TILKDLGIENSAGAVKHQAVALRVSGDRTIVYNCQIDAYQDTL  379



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   296 bits (759),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 158/343 (46%), Positives = 219/343 (64%), Gaps = 11/343 (3%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  422
             GN  I SS KAV+ VC PT +++ C   L     N++D  ELV+ AF  TMK+I+   KK
Sbjct  47    GNGEITSSVKAVKDVCAPTDYKKTCEDTLIKNGNNTSDPVELVKTAFRATMKQITDAAKK  106

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S+T+    KDPRT  A   C+EL+  ++ ++  + + +         LD  + ++++WLS
Sbjct  107   SQTMMELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFH--KLDEALINMRIWLS  164

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-R  779
              A++ E TCLEGF  T+G++ + MKK L TA +LT N L ++ E+ + +  + I  LN R
Sbjct  165   AAISHEETCLEGFQDTKGNAGETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLNSR  224

Query  780   KLLADSRSLPVWATAAQRRLLE-----APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
             +LL  S  +P W     R+LL+     +   PD+VVA+DGSG+Y TINEA+  +P K N 
Sbjct  225   RLL--SEGIPSWVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINEALKFVPKKKNT  282

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
             +FV+HIKAG+Y E V + K M ++VF+GDGP KTIISG++SY  G  T  T TV + G  
Sbjct  283   TFVVHIKAGIYNEYVQVNKSMTHLVFIGDGPDKTIISGNKSYKDGITTYRTCTVAIVGDY  342

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F+ KNIG ENTAG   HQAVALRVQSD+AIF NC+ D YQDTL
Sbjct  343   FIAKNIGFENTAGAIKHQAVALRVQSDEAIFFNCRFDGYQDTL  385



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   293 bits (750),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 158/353 (45%), Positives = 226/353 (64%), Gaps = 22/353 (6%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKK  422
             G+  I ++TKAV+ VC+PT ++E CV  L AA+ NST   +L+ + FN+T+  I + +KK
Sbjct  43    GDSQIKTTTKAVQAVCEPTDYKETCVHSLMAASPNSTQPLDLIRLGFNLTINSIHQGIKK  102

Query  423   S-KTLQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANL---DLYMNDI  587
             +   L+A A KDP T  A  +CQEL+ D+IDD+K+  D+       G NL   + ++ D+
Sbjct  103   AAHELKARAEKDPETKGALDLCQELMIDAIDDLKKCFDKF-----DGFNLNEAEEFVEDL  157

Query  588   KVWLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA  767
             +VWLSG++ F+ TC++ F   + D A +M K+  T+++LT N L MV  +   L   +I 
Sbjct  158   RVWLSGSIAFQQTCMDTFEEIKSDLAQEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNIT  217

Query  768   GLN-------RKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAI  917
             G+        RKLL+     P W     R+L+ A    V P+ VVA DGSG++K+IN A+
Sbjct  218   GVRGDLGSYARKLLSTEDGFPTWMRPEARKLMAAKGTKVKPNAVVALDGSGQFKSINAAL  277

Query  918   PDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSE  1094
               +P+K+   FVI+IK G+YKE V +TK M  V F+GDGPTKT I+G+ ++ +G  +T +
Sbjct  278   KTVPMKNKFPFVIYIKQGIYKEKVDVTKTMSYVTFIGDGPTKTRITGNLNFGMGKVKTYQ  337

Query  1095  TGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             T TV V G  F  K+IG ENTAGP+ HQAVALRV +D A+FHNCQID YQDTL
Sbjct  338   TATVAVNGEHFTAKDIGFENTAGPKGHQAVALRVSADYAVFHNCQIDGYQDTL  390



>ref|XP_003561714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brachypodium distachyon]
Length=561

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/341 (43%), Positives = 219/341 (64%), Gaps = 9/341 (3%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             ++ + +S K+++  C+P  ++E C   L   A N+T T EL +  F  T + I + +++S
Sbjct  36    DQELSTSVKSIKSFCEPVDYKEACESTLEKTAGNATSTTELAKAIFKATSERIEQAVRES  95

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
               L     D RT+ A   C+ELL  ++DD+K   +++        N    ++D+K WLS 
Sbjct  96    SVLNELKHDQRTAGALNNCKELLNYAMDDLKTTFEQL--GGFEMTNFKHALDDLKTWLSS  153

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKL  785
             ALT++ TC++GF  T  D+A KMKK L  +Q+LT N L +VDE  D L +L++  L+R+L
Sbjct  154   ALTYQETCVDGFENTTTDAAAKMKKALNASQELTENILSIVDEFGDTLANLELPNLSRRL  213

Query  786   LADSRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPLKSNKSF  950
             L D   +P W +  +RRLL+A  +     PD+ VA DGSG YKTINEA+  +PLKS  +F
Sbjct  214   LGDD-GVPGWMSDTKRRLLQAKPSEPEFKPDITVASDGSGDYKTINEALAKVPLKSADTF  272

Query  951   VIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFM  1130
             V++IKAG YKE V + + + N+V +GDG +KTII+G +S++    T +T T+   G+GF 
Sbjct  273   VMYIKAGTYKEYVSVARNVTNLVMIGDGASKTIITGDKSFMLNITTKDTSTMEAIGNGFF  332

Query  1131  GKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              + IG+ENTAG +NHQAVALRVQSDQ++F+ CQ D YQDTL
Sbjct  333   MRGIGVENTAGAKNHQAVALRVQSDQSVFYECQFDGYQDTL  373



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   295 bits (754),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 157/343 (46%), Positives = 220/343 (64%), Gaps = 11/343 (3%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  422
             GN  I SS KAV+ VC PT +++ C   L     N++D  ELV+ AF  TMK+I+   KK
Sbjct  47    GNGEITSSVKAVKDVCAPTDYKKTCEDTLIKNGNNTSDPIELVKTAFKATMKQITDAAKK  106

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S+T+    KDPRT  A   C+EL+  ++ ++  + + +         LD  + ++++WLS
Sbjct  107   SQTMMELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFH--KLDEALINMRIWLS  164

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-R  779
              A++ E TCLEGF  T+G++ + MKK L TA +LT N L ++ E+ + +  + I  LN R
Sbjct  165   AAISHEETCLEGFQDTKGNAGETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLNSR  224

Query  780   KLLADSRSLPVWATAAQRRLLE-----APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
             +LLA  + +P W     R+LL+     +   PD+VVA+DGSG+Y TIN+A+  +P K N 
Sbjct  225   RLLA--QGIPSWVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNT  282

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
             +FV+HIKAG+YKE V + K M ++VF+GDG  KTIISG++SY  G  T  T TV + G  
Sbjct  283   TFVVHIKAGIYKEYVQVNKSMTHLVFIGDGADKTIISGNKSYKDGITTYRTATVAIVGDY  342

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F+ KNIG ENTAG   HQAVALRVQSD+AIF NC+ D YQDTL
Sbjct  343   FIAKNIGFENTAGAIKHQAVALRVQSDEAIFFNCRFDGYQDTL  385



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   295 bits (754),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 157/343 (46%), Positives = 220/343 (64%), Gaps = 11/343 (3%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  422
             GN  I SS KAV+ VC PT +++ C   L     N++D  ELV+ AF  TMK+I+   KK
Sbjct  47    GNGEITSSVKAVKDVCAPTDYKKTCEDTLIKNGNNTSDPIELVKTAFKATMKQITDAAKK  106

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S+T+    KDPRT  A   C+EL+  ++ ++  + + +         LD  + ++++WLS
Sbjct  107   SQTMMELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFH--KLDEALINMRIWLS  164

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-R  779
              A++ E TCLEGF  T+G++ + MKK L TA +LT N L ++ E+ + +  + I  LN R
Sbjct  165   AAISHEETCLEGFQDTKGNAGETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLNSR  224

Query  780   KLLADSRSLPVWATAAQRRLLE-----APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
             +LLA  + +P W     R+LL+     +   PD+VVA+DGSG+Y TIN+A+  +P K N 
Sbjct  225   RLLA--QGIPSWVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKKKNT  282

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
             +FV+HIKAG+YKE V + K M ++VF+GDG  KTIISG++SY  G  T  T TV + G  
Sbjct  283   TFVVHIKAGIYKEYVQVNKSMTHLVFIGDGADKTIISGNKSYKDGITTYRTATVAIVGDY  342

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F+ KNIG ENTAG   HQAVALRVQSD+AIF NC+ D YQDTL
Sbjct  343   FIAKNIGFENTAGAIKHQAVALRVQSDEAIFFNCRFDGYQDTL  385



>ref|XP_004984909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=564

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/339 (44%), Positives = 215/339 (63%), Gaps = 9/339 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S K+++  C+P  ++E C + L A A N+T   +L +V F VT   I K  ++S  L
Sbjct  37    MSTSVKSIKSFCQPVDYKETCERALEATAGNATSPTDLAKVIFKVTSDRIEKAARESAVL  96

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
                  DPRTS A + C+ELL  +IDD+K   DR+        N    ++D+K WLS ALT
Sbjct  97    NDLKNDPRTSGALRNCKELLDYAIDDLKTTFDRLGGFEMT--NFKAAVDDLKTWLSSALT  154

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+GF  T  D+A KM++ L T+Q+LT N L +VDE  + L SL +   +R+LLA 
Sbjct  155   YQETCLDGFENTTTDAAAKMRRALNTSQELTENILALVDEFSETLASLGLPSFHRRLLAG  214

Query  795   SRSLPVWATA-AQRRLLEAP-----VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             +   P W T  A+RR+L+A        PDV VA DGSG +KTIN A+  +P KS  ++V+
Sbjct  215   NGGAPSWMTDDAKRRVLKATPGSPDFKPDVTVAADGSGDFKTINAALAKVPTKSATAYVM  274

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGK  1136
             ++KAG YKE V + + + N+V VGDG TKT+++GS+S+     T +T T+ V G+GF  +
Sbjct  275   YVKAGTYKEYVSVPRNVTNLVVVGDGATKTVVTGSKSFAMNITTKDTATMEVIGNGFQMR  334

Query  1137  NIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              +G+ENTAG  NHQAVALRVQSD + F+ C+ D YQDTL
Sbjct  335   GVGVENTAGARNHQAVALRVQSDMSAFYECRFDGYQDTL  373



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score =   291 bits (744),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/341 (43%), Positives = 230/341 (67%), Gaps = 16/341 (5%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             +S KA++ VC+PT +++ C K LS+ + N++D  ELV VAFN +MK ++    KS+ L+ 
Sbjct  47    TSIKAIKAVCEPTDYKDACEKTLSSMSHNTSDPMELVNVAFNASMKYVTDAFDKSELLKD  106

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLY---MNDIKVWLSGAL  611
              +KDP ++EA + C ELL+ + DD+K++++++          + Y   + D+KVWLS A+
Sbjct  107   VSKDPASAEALRTCSELLEYATDDLKKSIEQL-----GSVQTNRYEQAVEDLKVWLSAAI  161

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG-LNRKLL  788
             T+++TC++GF G    +A+ M + +  + Q+T N L M+++  + + S +I+    RKLL
Sbjct  162   TYQDTCVDGFEGINTSAAEAMHQAIKNSTQITSNALAMINQFDNLVGSFNISSHAGRKLL  221

Query  789   ADSRS--LPVWATAAQRRLLE---APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
             + +R+   P W +AAQ R L+   A + P+V VA+DG+G +KTI+EA+  +P ++N +FV
Sbjct  222   SGTRANEFPWWMSAAQERFLQPAPAQIKPNVTVAQDGTGDFKTISEALKHVPKQNNDTFV  281

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYV-GGYQTSETGTVIVKGSGFM  1130
             I++KAGVYKE V++ K M +V  +GDGPTKT I+G    + G   T +T TV V G  F 
Sbjct  282   IYVKAGVYKEGVLVDKHMTHVTMIGDGPTKTKITGDVHVIQGKISTFKTATVAVAGEWFT  341

Query  1131  GKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  +G ENTAGP+NHQAVALRV +D+++F+NC++D YQDTL
Sbjct  342   GMGLGFENTAGPQNHQAVALRVNADRSVFYNCRMDGYQDTL  382



>gb|KHG19164.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=545

 Score =   290 bits (742),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 155/352 (44%), Positives = 223/352 (63%), Gaps = 21/352 (6%)
 Frame = +3

Query  249   NKN----IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVM  416
             NKN    I SS KAV+ +C+PT ++E C K L A++NS+D KEL+   F   + EI  V+
Sbjct  14    NKNDGEEISSSNKAVQALCQPTNYKETCQKSL-ASSNSSDVKELIRTGFQAGLVEIKNVL  72

Query  417   KKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVW  596
               S T+Q   KD     A  +CQE+L  +IDD +++ D + ++  +   +  Y+ ++K W
Sbjct  73    AHSVTVQELIKDKNNKAALGVCQEVLDLAIDDFQKSFDMLGEYDMS--KIGKYLLELKTW  130

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI----  764
             LSGA T + TC++ F  +  +S+ KM+ +L T+ ++T N L M++ +   +  L+I    
Sbjct  131   LSGAFTSQQTCIDSFAQSSNESSQKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVG  190

Query  765   ----AGLNRKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPD  923
                  G+NRKLL+ +  +P W + A R+LL+A    + P+VVVAKDGSGKY TIN+A+ +
Sbjct  191   NIDTTGVNRKLLS-AEDMPEWISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAE  249

Query  924   IPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGG--YQTSET  1097
             +P+KS   FVIHIKAG YKE + +TK+M NVVF+GDGPTKTII+   S       +T  T
Sbjct  250   VPVKSPDRFVIHIKAGTYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRT  309

Query  1098  GTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              TV V G+GFM K+IG +N+AGPE HQAVA R  +D+ I  NC    YQDTL
Sbjct  310   ATVGVDGAGFMAKDIGFDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTL  361



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   293 bits (751),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/347 (43%), Positives = 220/347 (63%), Gaps = 15/347 (4%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKLSAATN-STDTKELVEVAFNVTMKEISKVMKKSK  428
             K++ S+ KA+E +C+ T ++  CV+ L A    S+D K+L++++F VT+K+I + +  S 
Sbjct  41    KDVTSTKKAIESICQTTQYQTTCVESLEATGECSSDPKDLIQMSFQVTIKKIKEAIDNST  100

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
              +Q   KDPR   A + C+ L   +++D+ R   +    +    +L  ++ D+K+WLSGA
Sbjct  101   FMQKLEKDPRAKMALENCEMLALQAVNDLNRTHIKF--ESFEFNDLSHWIADLKIWLSGA  158

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLL  788
             +T++ TCL+GF  T G++ +KMKK L  + QLT N L M+ EI D   SL+     R+LL
Sbjct  159   ITYQETCLDGFEDTTGEAGEKMKKALNVSMQLTSNALSMITEISDVFTSLNAGSNRRRLL  218

Query  789   ADSRS--------LPVWATAAQRRLLEA----PVTPDVVVAKDGSGKYKTINEAIPDIPL  932
              D           LP W    +RRLL       + PDVVVAKDGSGKYK IN+A+  IP 
Sbjct  219   FDDTPVLGHGIELLPDWIDVGRRRLLAVNMSNEIKPDVVVAKDGSGKYKFINDALKHIPE  278

Query  933   KSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIV  1112
               N+++V++IK GVY E V +   M N+V +GDGPTKT I+G++S+  G  T +T TV +
Sbjct  279   HRNQTYVLYIKEGVYNEKVEILSTMSNLVIIGDGPTKTRITGNQSFKDGIPTYQTSTVAI  338

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              G  F+ K+IG ENTAGP+ HQA+ALRV +D++IF+NC +D YQDTL
Sbjct  339   MGDYFVAKDIGFENTAGPDKHQALALRVAADKSIFYNCHVDGYQDTL  385



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 158/352 (45%), Positives = 227/352 (64%), Gaps = 19/352 (5%)
 Frame = +3

Query  246   GNKN---IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKV  413
             GNK    +G+  KA+E +C+ T ++E C   L   T ++TD K+L++  F V   ++++V
Sbjct  38    GNKKPAKVGAKKKAIETICQATTYKETCQSSLEKETGDTTDPKDLIKAEFQVAADKVNEV  97

Query  414   MKKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKV  593
             +K S TL+  AKDP  S+A  +C+ELL+ +++D+  A+D+M     +   +  Y+ D+KV
Sbjct  98    IKNSNTLKEYAKDPMASQALGVCKELLETAVEDLLGAVDKMGPFDVS--KISDYLADLKV  155

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WLS A+  + TCL+ F  T+G++ +KM+  L TAQ+LT N L MV EI   LV       
Sbjct  156   WLSAAVNHQATCLDAFEDTKGEAGEKMRGFLKTAQELTSNGLAMVSEI-SRLVDSPKLNS  214

Query  774   NRKLLADSRS---------LPVWATAAQRRLLEA---PVTPDVVVAKDGSGKYKTINEAI  917
             +R+L++ S+          +P W +     LL A    + P+VVVAKDG+GKYKTINEA+
Sbjct  215   HRRLMSSSKGGQTKRNYKPVPGWMSDRHLDLLTATPESLKPNVVVAKDGTGKYKTINEAL  274

Query  918   PDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSET  1097
              ++P KSN++FVI+IK G+Y+E V++ K+M NVV +GDGPT T ISGS+S+  G  T  T
Sbjct  275   KEVPQKSNEAFVIYIKKGMYEETVIVDKEMTNVVMIGDGPTMTRISGSKSHADGITTMNT  334

Query  1098  GTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              T    G+ F+ K IG ENTAG   HQAVALRVQSD +IF NC +DAYQDTL
Sbjct  335   ATFAAVGNYFVAKGIGFENTAGHVKHQAVALRVQSDFSIFFNCHMDAYQDTL  386



>gb|EMT00224.1| Putative pectinesterase/pectinesterase inhibitor 21 [Aegilops 
tauschii]
Length=543

 Score =   289 bits (740),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/338 (43%), Positives = 215/338 (64%), Gaps = 9/338 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S K+++  C+P  ++  C K L   A N+T T EL +  F  T + I K +++S  L
Sbjct  38    LTTSMKSIKSFCQPVDYKAACEKTLGETAGNATTTTELAKAIFKATSERIEKAVQESSLL  97

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
                  DPRTS A K C+E+L  +IDD+K   D++        N    M+D+K WL+ ALT
Sbjct  98    NELKHDPRTSGALKNCKEMLHYAIDDLKTTFDQL--GGFEMTNFKHAMDDLKTWLTSALT  155

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TC++GF  T  D++ KM+K L  +Q+LT N L +VDE  D + +LD++  +R+LL  
Sbjct  156   YQETCIDGFANTTTDASAKMRKALNVSQELTENILSIVDEFGDTIANLDLSIFSRRLLGH  215

Query  795   SRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIH  959
               + P W + A+RRLLE   +     PD+ VA DGSG YKTINEA+  +PLKS  +FV+H
Sbjct  216   DGA-PRWMSDAKRRLLEVSPSEPDFKPDMTVAADGSGDYKTINEALAKVPLKSEDTFVMH  274

Query  960   IKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKN  1139
             +K G YKE V + + + N+V +GDG  KT+I+G ++++    T +T T+   G+GF  + 
Sbjct  275   VKEGTYKEYVSVARNVTNLVMIGDGAGKTVITGDKNFMMNITTKDTATMEAIGNGFFMRG  334

Query  1140  IGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             I +ENTAG +NHQAVALRVQSDQ++F+ CQ D YQDTL
Sbjct  335   ITVENTAGAKNHQAVALRVQSDQSVFYECQFDGYQDTL  372



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   294 bits (752),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 222/345 (64%), Gaps = 17/345 (5%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             +  I SS KAV+ VC PT  ++ C   L+    N+TD  ELV+ AF+ TMK+I+   KKS
Sbjct  48    DAQITSSVKAVKDVCAPTDFKKTCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKS  107

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVD---HAGAGANLDLYMNDIKVW  596
             +T+    KDPRT  A   C+EL+  ++ ++  + + +     H      LD  + ++++W
Sbjct  108   QTMMELQKDPRTKMALDQCKELMDYALGELSNSFEELGKFEFHL-----LDEALINLRIW  162

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LS A++ E TCLEGF GT+G++ + MKK L TA +LT N L ++ E+ + +  + I   +
Sbjct  163   LSAAISHEETCLEGFEGTQGNAGETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFS  222

Query  777   -RKLLADSRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPLKS  938
              R+LL  S+ +P W     RRLL+A        PD+VVA+DGSG+YKTINEA+  +P K 
Sbjct  223   SRRLL--SQEIPSWVDQRGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKKK  280

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKG  1118
             N +FV++IKAG+Y+E V + K M ++VF+GDGP KTIISGS++Y  G  T  T TV + G
Sbjct  281   NTTFVVYIKAGIYQEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAIIG  340

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               F+ KNIG  NTAGP   QAVA+RVQSD++IF NC+ D YQDTL
Sbjct  341   DSFIAKNIGFVNTAGPAKFQAVAVRVQSDESIFFNCRFDGYQDTL  385



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   293 bits (751),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 222/345 (64%), Gaps = 17/345 (5%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             +  I SS KAV+ VC PT  ++ C   L+    N+TD  ELV+ AF+ TMK+I+   KKS
Sbjct  48    DAQITSSVKAVKDVCAPTDFKKTCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKS  107

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVD---HAGAGANLDLYMNDIKVW  596
             +T+    KDPRT  A   C+EL+  ++ ++  + + +     H      LD  + ++++W
Sbjct  108   QTMMELQKDPRTKMALDQCKELMDYALGELSNSFEELGKFEFHL-----LDEALINLRIW  162

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LS A++ E TCLEGF GT+G++ + MKK L TA +LT N L ++ E+ + +  + I   +
Sbjct  163   LSAAISHEETCLEGFEGTQGNAGETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFS  222

Query  777   -RKLLADSRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPLKS  938
              R+LL  S+ +P W     RRLL+A        PD+VVA+DGSG+YKTINEA+  +P K 
Sbjct  223   SRRLL--SQEIPSWVDQRGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKKK  280

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKG  1118
             N +FV++IKAG+Y+E V + K M ++VF+GDGP KTIISGS++Y  G  T  T TV + G
Sbjct  281   NTTFVVYIKAGIYQEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAIIG  340

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               F+ KNIG  NTAGP   QAVA+RVQSD++IF NC+ D YQDTL
Sbjct  341   DSFIAKNIGFVNTAGPAKFQAVAVRVQSDESIFFNCRFDGYQDTL  385



>ref|XP_004252915.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=559

 Score =   288 bits (737),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/334 (43%), Positives = 216/334 (65%), Gaps = 11/334 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             I SSTK+V+ +C+PT ++E C K L +A N+T+ KEL++ AF+ T+ EI+  +K S   +
Sbjct  44    ISSSTKSVQAMCQPTQYKETCAKSLGSAKNTTNPKELIKAAFDNTLTEITNSIKNSAPFK  103

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTF  617
              AA DPRT  A K+C E+L  SI++IKR+  + +D       +  Y+ D++ WLS A+T 
Sbjct  104   EAANDPRTKNALKVCDEVLDRSIEEIKRSFSK-IDSNDLDKLIKEYIYDVRSWLSSAVTL  162

Query  618   ENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL-NRKLLAD  794
             E TC++ F  T GD+ +KMK +L TA +L+   L++V    + +V L   G+ NR+LL  
Sbjct  163   EETCIDAFANTTGDTGEKMKNILKTASELSSVALDIVSSFEEQMVGLQGLGITNRRLLV-  221

Query  795   SRSLPVWATAAQRRLLE-APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAG  971
                    A A  RRLL+ A + P+VVVA+DGSG++K+INEA+  +P  + + +VI IKAG
Sbjct  222   -------AEAGNRRLLQIATLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAG  274

Query  972   VYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIE  1151
             +Y EN+ +   M NVVF+G+G  KT I+ +++Y+ G    +T TV + G GF+ K+I  E
Sbjct  275   IYNENIEVANTMTNVVFIGEGSNKTKITSNKNYLDGLPIFQTATVSISGQGFVAKDIAFE  334

Query  1152  NTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             N+AGP   +AVALRV ++   F NCQID YQ TL
Sbjct  335   NSAGPLKKEAVALRVSAEMTAFQNCQIDGYQSTL  368



>gb|KHN26239.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=576

 Score =   288 bits (738),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/342 (43%), Positives = 221/342 (65%), Gaps = 18/342 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I SS KAV+ +C PT +++ C + L A A N+TD KEL+++ FN+T+ +I   +KK+  L
Sbjct  47    IASSVKAVQTLCHPTNYKKECEESLIARAGNTTDPKELIKIVFNITITKIGDKLKKTNLL  106

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGA----NLDLYMNDIKVWLS  602
                 +DPR   A   C++L+  SI+++ R+LD      G G     N+D  + ++KVWLS
Sbjct  107   HEVEEDPRAKMALDTCKQLMDLSIEELTRSLD------GIGEFDLKNIDKILMNLKVWLS  160

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRK  782
             GA+T+++TCL+GF  T  D+  KMK LL     ++ N L +V  + D +   ++  L+R+
Sbjct  161   GAVTYQDTCLDGFENTTSDAGKKMKDLLTAGMHMSSNALAIVTNLADTVDDWNVTELSRR  220

Query  783   LLADSRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPLKSNKS  947
              L     LPVW    Q RLL    +     P+V VA DGSG +K+INEA+  +P ++ K 
Sbjct  221   RLLQDSKLPVWVD--QHRLLNENESLLRHKPNVTVAIDGSGDFKSINEALKQVPKENRKP  278

Query  948   FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGF  1127
             FVI+IK GVY+E V +TKKM +VVF+G+G  KT I+G+++++ G  T  T TV ++G  F
Sbjct  279   FVIYIKEGVYQEYVEVTKKMTHVVFIGEGGKKTRITGNKNFIDGTNTYRTATVAIQGDYF  338

Query  1128  MGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +  N+G EN+AGP+ HQAVALRVQ+D++IF+NC +D YQDTL
Sbjct  339   VAINMGFENSAGPQKHQAVALRVQADKSIFYNCSMDGYQDTL  380



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   288 bits (738),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 158/362 (44%), Positives = 227/362 (63%), Gaps = 31/362 (9%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             G   + ++TKAV+ +C PT +++ C + LS A NSTD KEL++VAF  T+K I + +K S
Sbjct  46    GGGGVSATTKAVQAICSPTDYKQTCTESLSGA-NSTDPKELIKVAFEYTVKNIKESIKNS  104

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
                + AA D RT  A  +C E+L  SI+D++R+ +++ +   +   +D  ++D+K WLSG
Sbjct  105   TLYKDAAADERTKGALDVCSEVLNTSIEDLERSFEKIGEFDMS--KVDDLVDDVKTWLSG  162

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RK  782
             A+T++ TCL+ F  T GD+ +KMK LL T+ +L  N L MV +    L SL   G + R+
Sbjct  163   AITYQETCLDAFENTTGDTGEKMKNLLQTSGELLSNGLAMVTDFSSILSSL--GGFSSRR  220

Query  783   LLAD-SRSL---------------------PVWATAAQRRLLEA-PVT--PDVVVAKDGS  887
             LL+D  RSL                     P +  +  R+LL A P T  P+ VVAKDGS
Sbjct  221   LLSDEGRSLYHLDPTDYAPGEDPKMGFEGTPSFVDSKARKLLAATPATLKPNAVVAKDGS  280

Query  888   GKYKTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRS  1067
             G+Y TI  A+  +P K+N++FVI++KAGVYKE V++ + + N+V +GDGP KT I G+++
Sbjct  281   GQYGTIAAALKTLPKKTNQTFVIYVKAGVYKETVIIPRHVNNIVLIGDGPEKTRIIGNKN  340

Query  1068  YVGGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQD  1247
             Y  G QT  T  + V G GF+ K+IGIENTAG   HQAVA+RV  D AIF+N  +D YQD
Sbjct  341   YADGVQTFHTAVLAVNGDGFLAKDIGIENTAGAAKHQAVAVRVSGDNAIFYNVHMDGYQD  400

Query  1248  TL  1253
             TL
Sbjct  401   TL  402



>gb|EYU43978.1| hypothetical protein MIMGU_mgv1a003697mg [Erythranthe guttata]
Length=569

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 229/343 (67%), Gaps = 12/343 (3%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             NI +S KA++ +C+ T++++ C + LS ATNS+D + L++  F + +  ++  +++S  L
Sbjct  42    NISTSQKAIQDLCQSTYYQQTCTETLSNATNSSDPQTLIQTIFEIAISHLNNTIQQSGPL  101

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             Q  + DP+TS+A+K C ++L DSI D+++ + R         +  ++++DIK WL+GALT
Sbjct  102   QQISNDPKTSQAYKTCTKVLDDSIQDLRKTIHRT--ETFDFFDFSIFIDDIKTWLTGALT  159

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA---GLNRKL  785
             ++ TCL+ F  T+GD A+ M++LL  +++LT N L + ++IH   +   +A      +  
Sbjct  160   YQETCLDSFEDTKGDHAETMRQLLKLSRELTTNGLAIANQIHRLFLPNLLAPPVAPTKHQ  219

Query  786   LADSRSL-PVWATAAQRRLLEAPV-----TPDVVVAKDGSGKYKTINEAIPDIPLKSNKS  947
             LAD + L P   +   R+LL+        TP+VVVAKDGSGKYKT+ EA+ ++P +SN++
Sbjct  220   LADRKPLSPRGDSNYYRKLLQMASDRRYDTPNVVVAKDGSGKYKTVTEALKEVPERSNET  279

Query  948   FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVG-GYQTSETGTVIVKGSG  1124
             FVIH+K GVY+E V +T  M +VV VGDGPTKT I+G +SY G G  T  T TV + G  
Sbjct  280   FVIHVKEGVYEEYVEITSGMWSVVLVGDGPTKTRITGKKSYGGDGLGTYFTATVGIDGDN  339

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F+GK+IG ENTAG   +QAVALRV +D+AIF+NC ID YQDTL
Sbjct  340   FIGKDIGFENTAGAIGYQAVALRVSADKAIFYNCHIDGYQDTL  382



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   287 bits (735),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 154/346 (45%), Positives = 220/346 (64%), Gaps = 16/346 (5%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SK  428
             +I ++TKA+  VC PT ++E CV  L  A+ +ST   EL+++ FN+T++ I   +KK S 
Sbjct  47    HIQATTKAIRAVCAPTDYKETCVDSLMHASPDSTQPLELIKLGFNITIQSIKDSVKKASG  106

Query  429   TLQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
              L+A AA D  T  A  +C++L+ D+ DD+++ L     H  +  +++ ++ D++VWLSG
Sbjct  107   ELKAKAANDNETKGALDLCEKLMTDATDDLEKCLHNF--HGFSITHIEDFVEDLRVWLSG  164

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL----  773
             ++ ++ TC++ F     + +  M K+  T+++LT N L M+  I  + +   I GL    
Sbjct  165   SIAYQQTCMDTFEEINSNLSQDMHKIFETSKELTSNALAMITSI-SSFLGEHITGLIGDH  223

Query  774   ---NRKLLADSRSLPVWATAAQRRLL--EAPVTPDVVVAKDGSGKYKTINEAIPDIPLKS  938
                 RKLL+    +P W     RRL+  +  V PDVVVA+DGSG+YKTINEA+  +P  +
Sbjct  224   GNHARKLLSTEDGIPSWVGPNTRRLMAEQGVVKPDVVVAQDGSGQYKTINEALSVVPKAN  283

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGS-RSYVGGYQTSETGTVIVK  1115
              K FVI+IK GVY E V + KKM +V F+GDGPTKT I+GS   Y+G  +T  T TV + 
Sbjct  284   QKPFVIYIKQGVYNEKVDVPKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHTATVAIN  343

Query  1116  GSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  F  KNIG ENTAGPE HQAVALRV +D A+FHNCQID YQDTL
Sbjct  344   GDNFTAKNIGFENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTL  389



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   287 bits (735),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/346 (43%), Positives = 227/346 (66%), Gaps = 16/346 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT-  431
             I ++TKAV+ VC PT  ++ CV  L  A+ NST+  +L++++F+VT++ I   +K+S T 
Sbjct  43    IKTTTKAVQAVCSPTDFKDTCVNSLMEASPNSTEPLDLIKLSFDVTIRSIKDGIKRSSTE  102

Query  432   LQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
             L+A AAKD  T  A ++C+ L+ D+ DD+K+  D       +   ++ ++ D++VWLSG+
Sbjct  103   LKAKAAKDEETKGALELCENLMNDATDDLKKCFDNF--DGFSITQIEDFVEDLRVWLSGS  160

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDAL-------VSLDIA  767
             + ++ TC++ F   + + A  MK +  T+++LT N+L M+ ++   L       V+ D+ 
Sbjct  161   IAYQQTCMDTFEEVKSNLAQDMKNIFKTSKELTSNSLAMITDLSILLGKVNITEVTGDLG  220

Query  768   GLNRKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKS  938
                RKLL+    +P W     RRL+ A    V  +VVVA+DGSG+YK+I+EA+  +P  +
Sbjct  221   NYARKLLSTEEGIPSWVGTNTRRLMAATQGGVKANVVVAQDGSGQYKSIDEALKAVPQNN  280

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGTVIVK  1115
                FVI+IK G+YKENV +TKKM +V F+GDGPT+T I+G+ ++ +G  +T +T TV + 
Sbjct  281   RWPFVIYIKQGIYKENVDVTKKMTHVTFIGDGPTRTKITGNLNFRIGKVKTYQTATVAIN  340

Query  1116  GSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  F  KNIG ENTAGPE HQAVALRV +D A+FHNCQ+D YQDTL
Sbjct  341   GDNFTAKNIGFENTAGPEGHQAVALRVSADYAVFHNCQMDGYQDTL  386



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   287 bits (735),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 155/353 (44%), Positives = 224/353 (63%), Gaps = 22/353 (6%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKK  422
             G+  I ++TKAV+ VC+PT ++E CV  L AA+ NST   +L+ + FN+T+  I + +KK
Sbjct  43    GDSQIKTTTKAVQAVCEPTDYKETCVHSLMAASPNSTQPLDLIRLGFNLTINSIHQGIKK  102

Query  423   S-KTLQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANL---DLYMNDI  587
             +   L+A A KDP T  A  +CQEL+ D+IDD+K+  D+       G NL   + ++ D+
Sbjct  103   AAHELKARAEKDPETKGALDLCQELMIDAIDDLKKCFDKF-----DGFNLNEAEEFVEDL  157

Query  588   KVWLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA  767
             +VWLSG++ F+ TC++ F   + D A +M K+  T+++LT N L MV  +   L   +I 
Sbjct  158   RVWLSGSIAFQQTCMDTFEEIKSDLAQEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNIT  217

Query  768   GLN-------RKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAI  917
             G+        RKLL+     P W     R+L+ A    V P+ VVA DGSG++K+IN A+
Sbjct  218   GVRGDLGSYARKLLSTEDGFPTWMRPEARKLMAAKGTKVKPNAVVALDGSGQFKSINAAL  277

Query  918   PDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSE  1094
               +P+K+   FVI+IK G+YKE V +TK M  V F+GDGPTKT I+G+ ++ +G  +T +
Sbjct  278   KTVPMKNKFPFVIYIKQGIYKEKVDVTKTMSYVTFIGDGPTKTRITGNLNFGMGKVKTYQ  337

Query  1095  TGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             T TV V G  F  K+IG ENTAGP+ HQAVALRV +D A+FHNCQID Y D+ 
Sbjct  338   TATVAVNGEHFTAKDIGFENTAGPKGHQAVALRVSADYAVFHNCQIDGYVDSF  390



>ref|XP_009151177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=693

 Score =   290 bits (742),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 155/342 (45%), Positives = 219/342 (64%), Gaps = 16/342 (5%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             + I +S KA++ VC PT +++ C   L   A +++D  ELV  AFNVTMK+I+ V +KS+
Sbjct  48    EEITASVKAIKEVCAPTDYKKTCEDTLRKDAKDTSDPLELVRAAFNVTMKQITNVARKSQ  107

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRA---LDRMVDHAGAGANLDLYMNDIKVWL  599
             T+    KDPRT  A   C+EL+  +I ++  +   L +   H      +D  +  +KVWL
Sbjct  108   TMIELQKDPRTKMALDQCKELMDYAIGELSNSFVELGKFEFH-----KVDEVLIKVKVWL  162

Query  600   SGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-  776
             S  +T E TC++GF GT+GD+ + +KK L TA QLT N L MV E+ + L  +    L+ 
Sbjct  163   SATITHEQTCIDGFKGTKGDAGETIKKALKTAVQLTHNALAMVTEMSNYLGQMQFTELSS  222

Query  777   RKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKS  947
             R+LLA     P W     RRLL AP   V PD+VVA+DGSG+YKTI+EA+ ++P   N +
Sbjct  223   RRLLAQE---PSWVDGRVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVT  279

Query  948   FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGF  1127
             FV++IK GVYKE V + + M ++VF+GDGP KT+I+G +S+  G  T  T TV + G  F
Sbjct  280   FVVYIKTGVYKEFVQVDRTMSDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGDRF  339

Query  1128  MGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             + KN+G +NTAG   HQAV +RV SDQ+IF+NC+ D YQDTL
Sbjct  340   IAKNMGFQNTAGAAKHQAVGIRVLSDQSIFYNCRFDGYQDTL  381



>ref|XP_003516937.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=576

 Score =   287 bits (734),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 147/342 (43%), Positives = 221/342 (65%), Gaps = 18/342 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I SS KAV+ +C PT +++ C + L A A N+TD KEL+++ FN+T+ +I   +KK+  L
Sbjct  47    IASSVKAVQTLCHPTNYKKECEESLIARAGNTTDPKELIKIVFNITITKIGDKLKKTNLL  106

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGA----NLDLYMNDIKVWLS  602
                 +DPR   A   C++L+  SI+++ R+LD      G G     N+D  + ++KVWLS
Sbjct  107   HEVEEDPRAKMALDTCKQLMDLSIEELTRSLD------GIGEFDLKNIDKILMNLKVWLS  160

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRK  782
             GA+T+++TCL+GF  T  D+  KMK LL     ++ N L +V  + D +   ++  L+R+
Sbjct  161   GAVTYQDTCLDGFENTTSDAGKKMKDLLTAGMHMSSNALAIVTNLADTVDDWNVTELSRR  220

Query  783   LLADSRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPLKSNKS  947
              L     LPVW    Q RLL    +     P+V VA DGSG +++INEA+  +P ++ K 
Sbjct  221   RLLQDSKLPVWVD--QHRLLNENESLLRHKPNVTVAIDGSGDFESINEALKQVPKENRKP  278

Query  948   FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGF  1127
             FVI+IK GVY+E V +TKKM +VVF+G+G  KT I+G+++++ G  T  T TV ++G  F
Sbjct  279   FVIYIKEGVYQEYVEVTKKMTHVVFIGEGGKKTRITGNKNFIDGTNTYRTATVAIQGDYF  338

Query  1128  MGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +  N+G EN+AGP+ HQAVALRVQ+D++IF+NC +D YQDTL
Sbjct  339   VAINMGFENSAGPQKHQAVALRVQADKSIFYNCSMDGYQDTL  380



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score =   288 bits (736),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 156/342 (46%), Positives = 218/342 (64%), Gaps = 11/342 (3%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             N  + +S KAV+ VC PT +++ C   L     N+TD  ELV+ AF+VTMK+I+   KKS
Sbjct  48    NGELAASVKAVKDVCAPTDYKKTCEDTLLKNGHNTTDPMELVKTAFSVTMKQITDAAKKS  107

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
             +T+    KDPRT  A   C+EL+  ++ ++  + + +         LD  + ++++WLS 
Sbjct  108   QTMMDLQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFH--LLDEALINLRIWLSA  165

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RK  782
             A++ E TCLEGF GT+G + + MKK L TA +LT N L ++ E+   +  + I  LN R+
Sbjct  166   AISHEETCLEGFQGTQGKAGETMKKALKTAIELTHNGLAIISEMSSFVGQMGIPELNSRR  225

Query  783   LLADSRSLPVWATAAQRRLLEAP-----VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKS  947
             LL  S+ +P W     R LL+A         D+VVA+DGSG+Y TIN+A+  +P K N +
Sbjct  226   LL--SQDIPSWVDQRGRSLLQAAEGYSDAKADIVVAQDGSGQYTTINDAMKFVPKKKNTT  283

Query  948   FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGF  1127
             FV+HIKAGVYKE V + K M ++VF+GDGP KTIISGS++Y  G  T  T TV + G  F
Sbjct  284   FVVHIKAGVYKEYVQVNKSMTHLVFIGDGPDKTIISGSKNYKDGITTYRTATVAIIGDYF  343

Query  1128  MGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             + KNIG  NTAG   HQAVA+RVQSD++IF NC+ D YQDTL
Sbjct  344   IAKNIGFVNTAGAIKHQAVAVRVQSDESIFFNCRFDGYQDTL  385



>gb|KHG22352.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   286 bits (731),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/352 (44%), Positives = 220/352 (63%), Gaps = 21/352 (6%)
 Frame = +3

Query  249   NKN----IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVM  416
             NKN    I SS KAV+ +C+PT ++E C K L A++NS+D KEL+   F   + EI  V+
Sbjct  30    NKNDGEEISSSNKAVQALCQPTNYKETCQKSL-ASSNSSDVKELIRTGFQAGLVEIKNVL  88

Query  417   KKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVW  596
               S T+Q   KD     A  +CQE+L  +IDD +++ D + ++  +   +  Y+ ++K W
Sbjct  89    GHSVTVQELTKDENNKAALGVCQEVLDLAIDDFQKSFDMLGEYDMS--KIGKYLLELKTW  146

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI----  764
             LSGA T + TC++ F  +  +S+ KM+ +L T+ ++T N L M++ +   +  L+I    
Sbjct  147   LSGAFTSQQTCIDSFAQSSNESSQKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVG  206

Query  765   ----AGLNRKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPD  923
                  G NRKLL+    L  W + A R+LL+A    + P+VVVAKDGSGKY TIN+A+ +
Sbjct  207   NIDSTGFNRKLLSTEDMLE-WISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAE  265

Query  924   IPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGG--YQTSET  1097
             +P+KS   FVIHIKAG YKE + +TK+M NVVF+GDGPTKTII+   S       +T  T
Sbjct  266   VPVKSPDRFVIHIKAGTYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRT  325

Query  1098  GTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              TV V G+GFM K+IG +N+AGPE HQAVA R  +D+ I  NC    YQDTL
Sbjct  326   ATVGVDGAGFMAKDIGFDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTL  377



>emb|CDY68790.1| BnaAnng28400D [Brassica napus]
Length=704

 Score =   290 bits (741),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/342 (45%), Positives = 219/342 (64%), Gaps = 16/342 (5%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             + I +S KA++ VC PT +++ C   L   A +++D  ELV  AFNVTMK+I+ V +KS+
Sbjct  48    EEITASVKAIKEVCAPTDYKKTCEDTLRKDAKDTSDPLELVRAAFNVTMKQITNVARKSQ  107

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRA---LDRMVDHAGAGANLDLYMNDIKVWL  599
             T+    KDPRT  A   C+EL+  +I ++  +   L +   H      +D  +  +KVWL
Sbjct  108   TMIELQKDPRTKMALDQCKELMDYAIGELSNSFVELGKFEFH-----KVDEVLIKVKVWL  162

Query  600   SGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-  776
             S  +T E TC++GF GT+GD+ + +KK L TA QLT N L MV E+ + L  +    L+ 
Sbjct  163   SATITHEQTCIDGFKGTKGDAGETIKKALKTAVQLTHNALAMVTEMSNYLGQMQFTELSS  222

Query  777   RKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKS  947
             R+LLA     P W     RRLL AP   V PD+VVA+DGSG+YKTI+EA+ ++P   N +
Sbjct  223   RRLLAQE---PSWVDGRVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVT  279

Query  948   FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGF  1127
             FV++IK GVYKE V + + M ++VF+GDGP KT+I+G +S+  G  T  T TV + G  F
Sbjct  280   FVVYIKTGVYKEFVQVDRTMSDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGDRF  339

Query  1128  MGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             + KN+G +NTAG   HQAV +RV SDQ+IF+NC+ D YQDTL
Sbjct  340   IAKNMGFQNTAGAAKHQAVGIRVLSDQSIFYNCRFDGYQDTL  381



>emb|CDX80613.1| BnaC07g28310D [Brassica napus]
Length=678

 Score =   289 bits (739),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 154/342 (45%), Positives = 218/342 (64%), Gaps = 16/342 (5%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             + I +S KA++ VC PT +++ C   L   A +++D  ELV   FNVTMK+I+ V +KS+
Sbjct  34    EEITASVKAIKEVCAPTDYKKTCEDTLRKDAKDTSDPLELVRAGFNVTMKQITNVARKSQ  93

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRA---LDRMVDHAGAGANLDLYMNDIKVWL  599
             T+    KDPRT  A   C+EL+  +I ++  +   L +   H      +D  +  +KVWL
Sbjct  94    TMIELQKDPRTKMALDQCKELMDYAIGELSNSFVELGKFEFH-----KVDEVLIKVKVWL  148

Query  600   SGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-  776
             S  ++ + TC++GF GT+GD+ + +KK L TA QLT N L MV E+ + L  +    LN 
Sbjct  149   SATISHQQTCIDGFKGTKGDAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQFTELNS  208

Query  777   RKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKS  947
             R+LLA     P W     RRLL AP   V PD+VVA+DGSG+YKTI+EA+ ++P   N +
Sbjct  209   RRLLAQE---PSWVDGRVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKNVT  265

Query  948   FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGF  1127
             FV++IK GVYKE V + + M ++VF+GDGP KT+I+G +S+  G  T  T TV + G  F
Sbjct  266   FVVYIKTGVYKEFVQVDRTMSDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGDRF  325

Query  1128  MGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             + KN+G ENTAG   HQAV +RV SDQ+IF+NC+ D YQDTL
Sbjct  326   IAKNMGFENTAGAAKHQAVGIRVLSDQSIFYNCRFDGYQDTL  367



>gb|KHG02742.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   286 bits (731),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/352 (44%), Positives = 220/352 (63%), Gaps = 21/352 (6%)
 Frame = +3

Query  249   NKN----IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVM  416
             NKN    I SS KAV+ +C+PT ++E C K L A++NS+D KEL+   F   + EI  V+
Sbjct  30    NKNDGEEISSSNKAVQALCQPTNYKETCQKSL-ASSNSSDVKELIRTGFQAGLVEIKNVL  88

Query  417   KKSKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVW  596
               S T+Q   KD     A  +CQE+L  +IDD +++ D + ++  +   +  Y+ ++K W
Sbjct  89    AHSVTVQELIKDENNKAALGVCQEVLDLAIDDFQKSFDMLGEYDMS--KIGKYLLELKTW  146

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI----  764
             LSGA T + TC++ F  +  +S+ KM+ +L T+ ++T N L M++ +   +  L+I    
Sbjct  147   LSGAFTSQQTCIDSFAQSSNESSQKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVG  206

Query  765   ----AGLNRKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPD  923
                  G NRKLL+    L  W + A R+LL+A    + P+VVVAKDGSGKY TIN+A+ +
Sbjct  207   NIDSTGFNRKLLSTEDMLE-WISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAE  265

Query  924   IPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGG--YQTSET  1097
             +P+KS   FVIHIKAG YKE + +TK+M NVVF+GDGPTKTII+   S       +T  T
Sbjct  266   VPVKSPDRFVIHIKAGTYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRT  325

Query  1098  GTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              TV V G+GFM K+IG +N+AGPE HQAVA R  +D+ I  NC    YQDTL
Sbjct  326   ATVGVDGAGFMAKDIGFDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTL  377



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/340 (45%), Positives = 216/340 (64%), Gaps = 16/340 (5%)
 Frame = +3

Query  273   KAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKTLQA-A  443
             KA+  VC PT ++E CV  L  A+ +ST   EL+++ FN+T++ I   +KK S  L+A A
Sbjct  53    KAIRAVCAPTDYKETCVNSLMKASPDSTQPLELIKLGFNITIQSIKDSVKKASGELKAKA  112

Query  444   AKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFEN  623
             A D  T  A  +C++L+ D+ DD+++ L     H  +  +++ ++ D++VWLSG++ ++ 
Sbjct  113   ANDNETKGALDLCEKLMTDATDDLEKCLHNF--HGFSITHIEDFVEDLRVWLSGSIAYQQ  170

Query  624   TCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL-------NRK  782
             TC++ F     + +  M K+  T+++LT N L M+  I    +   I GL        RK
Sbjct  171   TCMDTFEEINSNLSQDMHKIFETSKELTSNALAMITSI-STFLGEHITGLIGDHGNHGRK  229

Query  783   LLADSRSLPVWATAAQRRLL--EAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             LL+    +P W     RRL+  +  V PDVVVA+DGSG+YKTINEA+  +P  + K FVI
Sbjct  230   LLSTEDGIPSWVGPNTRRLMAEQGVVKPDVVVAQDGSGQYKTINEALSIVPKANQKPFVI  289

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRS-YVGGYQTSETGTVIVKGSGFMG  1133
             +IK GVY E V +TKKM +V F+GDGPTKT I+GS + Y+G  +T  T TV + G  F  
Sbjct  290   YIKQGVYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHTATVAINGDNFTA  349

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             KNIG ENTAGPE HQAVALRV +D A+FHNCQID YQDTL
Sbjct  350   KNIGFENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTL  389



>tpg|DAA44942.1| TPA: hypothetical protein ZEAMMB73_754551 [Zea mays]
Length=566

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/339 (43%), Positives = 215/339 (63%), Gaps = 9/339 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S K+++  C+P  +RE C K L AA  N+T   EL +  F VT   I+K +++S  L
Sbjct  39    MSTSVKSIKSFCQPVDYRETCEKALEAAAGNATSPTELAKAIFKVTSDRIAKAVRESALL  98

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
                  D RTS A   C ELL  +IDD++   DR+        N    ++D++ WLS ALT
Sbjct  99    NELKHDRRTSGALHNCGELLDYAIDDLRTTFDRLGGFEMT--NFKSAVDDLRTWLSSALT  156

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+GF  T   +A KM+K L ++Q+LT N L +VDE  + L +L +   +R+LLA+
Sbjct  157   YQETCLDGFENTTTPAAGKMRKALNSSQELTENILALVDEFSETLANLGLPSFHRRLLAE  216

Query  795   -SRSLPVWATAAQRRLL-----EAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
              +R  P W   A+RRLL     E    PDV VAKDGSG ++TIN A+  +PLKS  ++V+
Sbjct  217   HARGAPSWMPDAKRRLLLVSPGEKGFRPDVTVAKDGSGDFRTINAALAKVPLKSATTYVM  276

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGK  1136
             ++KAG Y+E V + + + N+V VGDG TKT+I+G +S++    T +T T+   G+GF+ +
Sbjct  277   YVKAGKYREYVSVARNVTNLVMVGDGATKTVITGHKSFMMNITTKDTATMEAIGNGFLMR  336

Query  1137  NIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              IG++NTAG +NHQAVALRVQSD + F+ C+ D YQDTL
Sbjct  337   GIGVKNTAGAKNHQAVALRVQSDMSAFYECRFDGYQDTL  375



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 154/345 (45%), Positives = 221/345 (64%), Gaps = 15/345 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKT  431
             I ++T AVE VC PT ++E CV  L  A+ +ST   +L+++ FNVT++ I   +KK S  
Sbjct  49    IKTTTNAVEAVCAPTDYKETCVNSLMKASPDSTQPLDLIKLGFNVTIRSIKDGIKKASAE  108

Query  432   LQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
             L+A AA D  T  A ++C++L+ D+ DD+K+ LD       +   ++ ++ D++VWLSG+
Sbjct  109   LKAKAANDNETKGALELCEKLMNDATDDLKKCLDNF--DGFSITQIEDFVEDLRVWLSGS  166

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN----  776
             + ++ TC++ F   + + +  M K+  T+++LT N L M+  I + L   +I GL     
Sbjct  167   IAYQQTCMDTFEEIKSNLSQDMHKIFKTSRELTSNGLAMITNISNLLGEFNITGLTGDLG  226

Query  777   ---RKLLADSRSLPVWATAAQRRLL--EAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
                RKLL+    +P W     R+L+  +  V  +VVVA+DGSG+YKTINEA+  +P  + 
Sbjct  227   NYARKLLSTEDGIPSWVGPNTRQLMATKGGVKANVVVAQDGSGQYKTINEALNIVPKANQ  286

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRS-YVGGYQTSETGTVIVKG  1118
             K FVI+IK GVY E V +TKKM +V F+GDGPTKT I+GS + Y+G  +T  T TV + G
Sbjct  287   KPFVIYIKQGVYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNFYIGKVKTYHTATVAING  346

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               F  KNIG ENTAGPE HQAVALRV  D A+F+NCQID YQDTL
Sbjct  347   DHFTAKNIGFENTAGPEGHQAVALRVSGDYAVFYNCQIDGYQDTL  391



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   285 bits (728),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 219/345 (63%), Gaps = 16/345 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKT  431
             I ++TKA+  VC PT ++E CV  L  A+ +ST   EL+++ FN+T++ I   +KK S  
Sbjct  48    IKATTKAIRAVCAPTDYKETCVNSLMKASPDSTQPLELIKLGFNITIQSIKDSVKKASGE  107

Query  432   LQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
             L+A AA D  T  A  +C++L+ D+ DD+++ L     H  +  +++ ++ D++VWLSG+
Sbjct  108   LKAKAANDNETKGALDLCEKLMTDATDDLEKCLHNF--HGFSITHIEDFVEDLRVWLSGS  165

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL-----  773
             + ++ TC++ F     + +  M K+  T+++LT N L M+  I  + +   I GL     
Sbjct  166   IAYQQTCMDTFEEINSNLSQDMHKIFETSKELTSNALAMITSI-SSFLGEHITGLIGDHG  224

Query  774   --NRKLLADSRSLPVWATAAQRRLL--EAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
                RKLL+    +P W     RRL+  +  V P+VVVA+DGSG+YKTINEA+  +P  + 
Sbjct  225   NHARKLLSTEDGIPSWVGPNTRRLMAEQGVVKPNVVVAQDGSGEYKTINEALSVVPKANQ  284

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGS-RSYVGGYQTSETGTVIVKG  1118
             K FVI+IK GVY E V +TKKM +V F+GDGPTKT I+GS   Y+G  +T  T TV + G
Sbjct  285   KPFVIYIKQGVYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHTATVAING  344

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
                  KNIG ENTAGPE HQAVALRV +D A+FHNCQID YQDTL
Sbjct  345   DNLTAKNIGFENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTL  389



>ref|XP_002465396.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
 gb|EER92394.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
Length=568

 Score =   284 bits (727),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/339 (43%), Positives = 217/339 (64%), Gaps = 9/339 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S K+++  C+P  +RE C K L +AA N+T   +L +  F VT   I K +++S  L
Sbjct  39    MSTSVKSIKSFCQPVDYRETCEKALRAAAGNATSPTDLAKAIFKVTSDRIEKAVRESAVL  98

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
                  DPRT  A   C+ELL  +IDD+K   DR+        N    ++D++ WLS ALT
Sbjct  99    NELKNDPRTKGALDNCRELLDYAIDDLKTTFDRL--GGFEMTNFKSAVDDLRTWLSSALT  156

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+GF  T   +A KM++ L ++Q+LT N L +VDE  + L +L I   +R+LLAD
Sbjct  157   YQETCLDGFENTTTAAAGKMRRALNSSQELTENILALVDEFSETLANLGIPSFHRRLLAD  216

Query  795   -SRSLPVWATAAQRRLLE-AP----VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
              +  +P W   A+RRL + +P      PDV VAKDGSG ++TIN A+  +P+KS  ++V+
Sbjct  217   HAGGVPSWMPDAKRRLRKVSPGDKGFKPDVTVAKDGSGDFRTINAALAKVPVKSAATYVM  276

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGK  1136
             ++KAG Y+E V + + + N+V VGDG TKT+I+G +S++    T +T T+   G+GF+ +
Sbjct  277   YVKAGTYREYVSVPRNVTNLVMVGDGATKTVITGDKSFMMNITTKDTATMEALGNGFLMR  336

Query  1137  NIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              IG+ENTAG +NHQAVALRVQSD + F+ C+ D YQDTL
Sbjct  337   GIGVENTAGAKNHQAVALRVQSDMSAFYECRFDGYQDTL  375



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   285 bits (729),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 153/343 (45%), Positives = 225/343 (66%), Gaps = 14/343 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S KAV+ +C+PT +R+ C + L  AA N+TD KEL+++AF +  K+I++  +KSK L
Sbjct  55    VSASVKAVKAICQPTDYRKTCEESLQKAAGNTTDPKELIKIAFKIAEKQINEASEKSKLL  114

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +  +KDPRT  A + C+EL+  S+ ++K++LD++ D   +   L+  M D+K WLS ++T
Sbjct  115   EELSKDPRTRGALQSCKELMNMSVGELKQSLDKVTDFDLS--ELEKMMADVKTWLSASIT  172

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+GF  T  D+  KMKK +    +L+ N L++V  I  A+ SL+ +  +R+LL D
Sbjct  173   YQETCLDGFENTTTDAGKKMKKGMKLGMELSANLLDIVSGISSAIPSLE-SFTHRRLLQD  231

Query  795   -------SRSLPVWATAAQRRLLEAPVT---PDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
                        P W     RRLL APV+    D+VVAKDGSG + TI EA+  +P+KS K
Sbjct  232   DLPVLGHGDQFPTWTDFGTRRLLAAPVSKIKADIVVAKDGSGDFSTIREALKHVPIKSKK  291

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
             +FV+HIKAGVY+E + ++K M+N+V +GDG   T I G++++V G  T  T TV V G  
Sbjct  292   AFVLHIKAGVYQEYLEISKGMINLVVIGDGKENTRIIGNKNFVDGINTFHTATVAVLGDN  351

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F+ KNIG EN AG   HQAVALRV +D AIF+NC +D +QDTL
Sbjct  352   FVAKNIGFENNAGAIKHQAVALRVSADYAIFYNCSMDGHQDTL  394



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score =   284 bits (727),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 220/345 (64%), Gaps = 15/345 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT-  431
             I ++T AVE VC PT ++E CV  L  A+ +ST   +L+++ FNVT++ I   +KK+   
Sbjct  48    IKTATTAVEAVCAPTDYKETCVNSLMKASPDSTQPLDLIKLGFNVTIRSIEDSIKKASVE  107

Query  432   LQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
             L A AA D  T  A ++C++L+ D+ DD+K+ LD       +   ++ ++ D++VWLSG+
Sbjct  108   LTAKAANDKDTKGALELCEKLMNDATDDLKKCLDNF--DGFSIPQIEDFVEDLRVWLSGS  165

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN----  776
             + ++ TC++ F  T    +  M+K+  T+++LT N L M+  I + L   ++ G+     
Sbjct  166   IAYQQTCMDTFEETNSKLSQDMQKIFKTSRELTSNGLAMITNISNLLGEFNVTGVTGDLG  225

Query  777   ---RKLLADSRSLPVWATAAQRRLL--EAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
                RKLL+    +P W     RRL+  +  V  +VVVA DGSG+YKTINEA+  +P  + 
Sbjct  226   KYARKLLSAEDGIPSWVGPNTRRLMATKGGVKANVVVAHDGSGQYKTINEALNAVPKANQ  285

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRS-YVGGYQTSETGTVIVKG  1118
             K FVI+IK GVY E V +TKKM +V F+GDGPTKT I+GS + Y+G  +T  T TV + G
Sbjct  286   KPFVIYIKQGVYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYLTATVAING  345

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               F  KNIG ENTAGPE HQAVALRV +D A+F+NCQID YQDTL
Sbjct  346   DNFTAKNIGFENTAGPEGHQAVALRVSADLAVFYNCQIDGYQDTL  390



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   285 bits (730),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 155/354 (44%), Positives = 222/354 (63%), Gaps = 23/354 (6%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             +I SS KA++ +C+PT ++E CV+ LS AA N+TD KELV V F V MK I + + +S+T
Sbjct  58    DIQSSMKAIKAICQPTDYKETCVQSLSSAAGNTTDPKELVRVGFQVAMKHIREALSQSET  117

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L+   KDPR  +A   CQEL+  +IDD+K + D++   A   + +D  + D+KVWL+   
Sbjct  118   LKEVEKDPRAKQALLSCQELMDYAIDDLKNSFDKL--GAFDISKVDNILADLKVWLTSVN  175

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA  791
             T++ TC +GF  T GD+ ++MKK L T+ +LT N L MVDEI   L  L I  LNR+ L 
Sbjct  176   TYQVTCTDGFENTTGDAGERMKKALKTSGELTENALAMVDEISSILNQLQIPALNRRRLF  235

Query  792   DSRS--------------LPVWATAAQRRLL-EAPV---TPDVVVAKDGSGKYKTINEAI  917
              ++               +P W     R+LL   P+    PD+VVAKDG+G + TI EA+
Sbjct  236   STKESAESSETPTTAEDDIPAWIPNEHRKLLFTGPLDALKPDLVVAKDGTGNFATILEAL  295

Query  918   PDIP-LKSNKSFVIHIKAGVYKENVVLTKKMM-NVVFVGDGPTKTIISGSRSYVGGYQTS  1091
               +P  K NK+ +++IK GVY E V +++ +  + +  GDGPT+T I+GS +++ G  T 
Sbjct  296   ESLPKTKENKTIIMYIKEGVYSEIVEISRNLTGSFIMYGDGPTRTKITGSLNFIDGTPTF  355

Query  1092  ETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +T TV V   GF+ K+IGIEN AG E HQAVAL+V +D  +F NCQ+D YQDTL
Sbjct  356   KTATVSVNAHGFICKDIGIENAAGAEKHQAVALKVVADMVVFFNCQMDGYQDTL  409



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score =   287 bits (734),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 155/345 (45%), Positives = 220/345 (64%), Gaps = 17/345 (5%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             +  I SS KAV+ VC PT  ++ C   L+    N+TD  ELV+ AF+ TMK+I+   KKS
Sbjct  48    DAQITSSVKAVKDVCAPTDFKKTCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKS  107

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVD---HAGAGANLDLYMNDIKVW  596
             +T+    KDPRT  A   C+EL+  ++ ++  + + +     H      LD  + ++++W
Sbjct  108   QTMMELQKDPRTKMALDQCKELMDYALGELSNSFEELGKFEFHL-----LDEALINLRIW  162

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LS A++ E TCLEGF GT+G++ + MKK L TA +LT N L ++ E+ + +  + I   +
Sbjct  163   LSAAISHEETCLEGFEGTQGNAGETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFS  222

Query  777   -RKLLADSRSLPVWATAAQRRLLEAPVTP-----DVVVAKDGSGKYKTINEAIPDIPLKS  938
              R+LL  S+  P W     RRLL+A         D+VVA+DGSG+YKTINEA+  +P K 
Sbjct  223   SRRLL--SQEFPSWVDQRGRRLLQAAAAYSDAKADIVVAQDGSGQYKTINEALKFVPKKK  280

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKG  1118
             N +FV++IKAG+Y+E V + K M ++VF+GDGP KTIISGS++Y  G  T  T TV + G
Sbjct  281   NTTFVVYIKAGIYQEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAIIG  340

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               F+ KNIG  NTAGP   QAVA+RVQSD++IF NC+ D YQDTL
Sbjct  341   DSFIAKNIGFVNTAGPAKFQAVAVRVQSDESIFFNCRFDGYQDTL  385



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   283 bits (724),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/344 (42%), Positives = 223/344 (65%), Gaps = 15/344 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S KAV+ +C+PT +R+ C + L  AA N+TD +EL+++AF +  K +++  KKSK L
Sbjct  55    VSASMKAVKAICQPTDYRKTCEENLQKAAGNTTDPRELIKMAFKIAEKHVNEASKKSKVL  114

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +  +KDPRT  A + C+EL+  S+D++K++L+++ D       ++  M D+K WLS ++T
Sbjct  115   EELSKDPRTRGALQSCRELMTMSVDELKQSLNKVTDFDIT--EIEKLMADVKTWLSASIT  172

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+GF  T  ++  +MKK L  + +L+ N L +V  I  A+ SL+  G  R+LL D
Sbjct  173   YQETCLDGFQNTTTNAGKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLG-QRRLLQD  231

Query  795   S--------RSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
                      +  P W    +RRLL AP   +  D+VVAKDGSG + TI +A+  +P+KS+
Sbjct  232   DLPVLGHGDQIFPTWTDFGKRRLLAAPASKIKADIVVAKDGSGDFSTIRDALHHVPIKSS  291

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGS  1121
             K+FV++IKAG+Y+E +   K M N++ +GDG   T I G++++V G  T  T TV+V G 
Sbjct  292   KTFVLYIKAGIYQEYIDFNKSMTNLMVIGDGRETTRIVGNKNFVDGINTYHTATVVVLGD  351

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              F+ KNIG EN AG   HQAVALRV +D A+F+NC +D +QDT+
Sbjct  352   NFVAKNIGFENNAGAIKHQAVALRVSADYALFYNCSMDGHQDTM  395



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   283 bits (723),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/344 (42%), Positives = 222/344 (65%), Gaps = 15/344 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S KAV+ +C+PT +R+ C + L  AA N+TD +EL+++AF +  K +++  KKSK L
Sbjct  55    VSASMKAVKAICQPTDYRKTCEENLQKAAGNTTDPRELIKMAFKIAEKHLNEASKKSKVL  114

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +  +KDPRT  A + C+EL+  S+D++K++L+++ D       ++  M D+K WLS ++T
Sbjct  115   EELSKDPRTRGALQSCKELMTMSVDELKQSLNKVTDFDIT--EIEKLMADVKTWLSASIT  172

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+GF  T  ++  +MKK L  + +L+ N L +V  I  A+ SL+  G  R+LL D
Sbjct  173   YQETCLDGFQNTTTNAGKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLG-QRRLLQD  231

Query  795   S--------RSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
                      +  P W    +RRLL AP   +  D+VVAKDGSG + TI EA+  +P+KS+
Sbjct  232   DLPVLGHGDQIFPTWTDFGKRRLLAAPASKIKADIVVAKDGSGDFSTIREALHHVPIKSS  291

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGS  1121
             K+FV++IKAG+Y+E +   K M N++ +GDG   T I G++++V G  T  T TV+V G 
Sbjct  292   KTFVLYIKAGIYQEYIDFNKSMTNLMVIGDGRETTRIVGNKNFVDGINTYHTATVVVLGD  351

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              F+ KNIG E  AG   HQAVALRV +D A+F+NC +D +QDTL
Sbjct  352   NFVAKNIGFEKNAGAIKHQAVALRVSADYALFYNCSMDGHQDTL  395



>ref|XP_006407898.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
 gb|ESQ49351.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
Length=566

 Score =   282 bits (722),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 155/353 (44%), Positives = 229/353 (65%), Gaps = 22/353 (6%)
 Frame = +3

Query  249   NKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  422
             N+N I  +TKAV+ VC PT  +E CV  L +A+  ST+  +L+++ FNVT+K I++ ++K
Sbjct  38    NENEIRKNTKAVKAVCAPTDFKETCVNSLMNASPKSTEPLDLIKLGFNVTIKSINEALQK  97

Query  423   -SKTLQAAA-KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVW  596
              S+ ++A A K P    AF++C++L+ D+IDD    L + VDH  + A +D ++ D++VW
Sbjct  98    ASRDVKAKADKAPEAKGAFELCEKLMTDAIDD----LQKCVDHGFSVAKIDGFVEDLRVW  153

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LSG++ F+ TC++ F   + +    M K+  T+++L+ N+L MV ++   L + +I GL 
Sbjct  154   LSGSIAFQETCMDSFEEIKSNLLQDMLKIFKTSRELSSNSLAMVTDLSTILPNSNITGLT  213

Query  777   -------RKLLADSRSLPVWATAAQRRLLEAP------VTPDVVVAKDGSGKYKTINEAI  917
                    RKLL+    +P W     RRL+ AP      V  + VVA+DGSG++KTI +A+
Sbjct  214   GTLANYARKLLSTKDGIPTWVGPEARRLMAAPQGGGPPVKANAVVAQDGSGQFKTIADAL  273

Query  918   PDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSE  1094
               +P  +   FVIHIK G+YKE V++TKKM  V F+GDGPTKT I+GS ++ +G  +T  
Sbjct  274   NAVPKDNRLPFVIHIKQGIYKEKVIVTKKMPYVTFIGDGPTKTKITGSLNFGLGKVKTFL  333

Query  1095  TGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             T TV + G  F  KNI IENTAGPE  QAVALRV +D A+F++CQID YQDTL
Sbjct  334   TATVTIDGEHFTAKNIWIENTAGPEGGQAVALRVSADYAVFYSCQIDGYQDTL  386



>ref|XP_003557034.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=402

 Score =   277 bits (708),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 146/340 (43%), Positives = 218/340 (64%), Gaps = 12/340 (4%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++ SS KAV+ +C PT + + C + L A A N+TD KEL+++ FN+T+ +I   +K++  
Sbjct  51    HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNI  110

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L    ++PR   A   C++L+  SI ++ R+LD + +      N+D  + ++KVWLSGA+
Sbjct  111   LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGINEFNLI--NVDKILMNLKVWLSGAV  168

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA-GLNRKLL  788
             T+++TCL+GF  T  D+  KMK LL     ++ N L +V  + D +   +I     R+LL
Sbjct  169   TYQDTCLDGFENTTSDAGKKMKDLLTIGMHMSSNALAIVTGLADTVNDWNITKSFGRRLL  228

Query  789   ADSRSLPVWATAAQRRLLEAPVTP-----DVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
              DS  LP W    Q RLL    +P     +V VA D SG +K+INEA+  +P K+ K FV
Sbjct  229   QDSE-LPSWVD--QHRLLNENASPFKRKPNVTVAIDDSGDFKSINEALKQVPEKNRKPFV  285

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             I+IK GVY+E V +TKKM +VVF+G+G  KT ISG+++++ G  T  T TV ++G  F+ 
Sbjct  286   IYIKEGVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVA  345

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              N+G EN+AGP  HQAVALRVQ+D++IF+NC +D YQDTL
Sbjct  346   INMGFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTL  385



>ref|XP_003591168.1| Pectinesterase [Medicago truncatula]
 gb|AES61419.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   282 bits (722),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 147/359 (41%), Positives = 230/359 (64%), Gaps = 25/359 (7%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKK  422
             GN ++ S+ KAV+  C PT +++ C + + A A N+TD++EL+++AFNVT+ +IS  +KK
Sbjct  45    GNTHMASTVKAVKSFCHPTDYKKECEENVIANAGNTTDSRELIKIAFNVTVTKISDGIKK  104

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             +  L    K+PR   A   C++L+  SI +  R+++ + +      NL+  + ++KVWLS
Sbjct  105   TNLLHEVEKEPRAKMALDTCKQLMDLSIGEFDRSIEGIKNFDLN--NLENILVNLKVWLS  162

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRK  782
             GA+T++ TCL+GF  T  D++ KMK +L T+  ++ N L ++ ++ D ++ L+     R+
Sbjct  163   GAITYQETCLDGFENTTSDASKKMKNILTTSMHMSSNALAVISDLADNVLDLNATTDGRR  222

Query  783   LLADSRS---------------LPVWA----TAAQRRLL---EAPVTPDVVVAKDGSGKY  896
             L+ D +                +P W     +   RRLL   +  +  +VVVAKDGSGK+
Sbjct  223   LIDDYKGEYVGEQVVAKDDVNDVPSWVGDGLSVGVRRLLHVNQHKLKANVVVAKDGSGKF  282

Query  897   KTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVG  1076
             K IN+A+  +P K+ K FVIHIK GVY E V +TKKM +VVF+GDG  KT I+G+++++ 
Sbjct  283   KKINDALKQVPKKNQKPFVIHIKEGVYHEYVEVTKKMTHVVFLGDGGNKTRITGNKNFID  342

Query  1077  GYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  T +T TV ++G  F+  NIG EN+AGP+ HQAVA+RVQ+D+AIF+ C +D YQDTL
Sbjct  343   GINTYQTPTVAIEGDNFVAINIGFENSAGPQKHQAVAIRVQADKAIFYKCSMDGYQDTL  401



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   281 bits (719),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 146/328 (45%), Positives = 216/328 (66%), Gaps = 14/328 (4%)
 Frame = +3

Query  291   CKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAAKDPRTSEA  470
             CK   +++ C + LS A N++D +EL+++AF   +  I+ V++ S  LQ AAKDPRT +A
Sbjct  43    CKHVDYKQTCEQSLSGAKNTSDPRELIKLAFTAAVDNIASVIQNSTLLQNAAKDPRTHQA  102

Query  471   FKICQELLQDSIDDIKRALDRMVDHAGAGA----NLDLYMNDIKVWLSGALTFENTCLEG  638
              + C+  L  SI+D++R+ + +      G      +D Y+ D+K WLS A TF+ TCL+ 
Sbjct  103   LETCKYALNTSIEDLQRSFETV------GTFDINKIDDYVADLKTWLSAAGTFQETCLDA  156

Query  639   FLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLADSRSLPVWA  818
             F  T GD+ ++MKKLL TA +LT N L MV +I + L + +I G  R+L++ S   P + 
Sbjct  157   FENTTGDTGEQMKKLLKTAGELTSNGLAMVTDISEVLTNFNIQGFKRRLMSSSVE-PDFV  215

Query  819   TAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGVYKENV  989
              A  R+L+ A    + P+ VVA+DGSG++K+I  A+  +P K+N++FVI IKAG+YKE V
Sbjct  216   DATARKLMAASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKEYV  275

Query  990   VLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIENTAGPE  1169
              L K +  +V VG+GPTKT I+G++++V G  T +T T+ V G   + K++GIEN+AG  
Sbjct  276   TLPKHVNGIVLVGEGPTKTKITGNKNFVDGVGTFQTPTLSVNGDATILKDLGIENSAGAV  335

Query  1170  NHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              HQAVALRV  D+ I +NCQIDAYQDTL
Sbjct  336   KHQAVALRVSGDRTIVYNCQIDAYQDTL  363



>gb|KHN02946.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=555

 Score =   281 bits (720),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 147/350 (42%), Positives = 216/350 (62%), Gaps = 21/350 (6%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             G   I  S +  + +C+   ++E C K L+ A+ ++D KEL+  AFN T +EI+  +K S
Sbjct  19    GGDTIAKSQRNQQVICESAEYKETCHKSLAKASGTSDLKELIITAFNATAEEIANQIKNS  78

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIK  590
                   A D  T +A  IC+E+L  ++DDI+R++  +          DL     Y  D+K
Sbjct  79    TLYHELATDHMTKQATDICKEVLGYAVDDIRRSVHTL-------EKFDLNKLNDYAYDLK  131

Query  591   VWLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG  770
             VW++G L  + TCL+GF  T  ++   M K+L  + +L+ N L++V+ +      L+++ 
Sbjct  132   VWIAGTLAHQQTCLDGFENTSSEAGKTMAKVLNASLELSNNALDIVNGVSSLFKGLNLSS  191

Query  771   L----NRKLLADSRSL----PVWATAAQRRLLEA-PVTPDVVVAKDGSGKYKTINEAIPD  923
                  NRKLL++  +L    P W +  QRRLL+A    PDVVVA+DGSG+ KTI+EA+  
Sbjct  192   FSVNSNRKLLSEETALVDGFPTWVSEGQRRLLQAVDPKPDVVVAQDGSGQVKTIHEALKL  251

Query  924   IPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGT  1103
             +P K+ K FVI+IKAG+Y E +++ K +  V  +GDGPTKT I+GS++YV G QT  T T
Sbjct  252   VPKKNKKPFVIYIKAGIYNEYIIMNKHLTYVTMIGDGPTKTRITGSKNYVDGVQTYNTAT  311

Query  1104  VIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               V  + FM KNIG ENTAG E HQAVALRV +D+A+F+NC +D +QDTL
Sbjct  312   FGVNAANFMAKNIGFENTAGAEKHQAVALRVTADKAVFYNCNMDGFQDTL  361



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   281 bits (720),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 150/350 (43%), Positives = 218/350 (62%), Gaps = 23/350 (7%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKK-LSAATNSTDTKELVEVAFNVTMKEISKVMKKS--K  428
             I ++TKAV+ VC  T ++E C+   +SA+ NST   +L+ + F++T+K I + +KK+  +
Sbjct  47    IKTTTKAVKAVCAITDYKETCINSFMSASPNSTQPLDLIRLGFDLTIKSIHEGIKKAADE  106

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANL---DLYMNDIKVWL  599
               + AAKDP    A  +C EL+ DS DD+ +  D+       G NL   + ++ D++VWL
Sbjct  107   LKEKAAKDPEAKRALDLCHELMIDSTDDLSKCFDKF-----DGFNLSEIEEFVEDLRVWL  161

Query  600   SGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-  776
             SG++ F+ TC++ F   + D A  M K+  T+++LT N L MV  I   L   +I  +N 
Sbjct  162   SGSMAFQQTCIDTFDEVKSDLAQDMAKIFKTSKELTSNGLAMVSGISTFLPQFNITEIND  221

Query  777   ------RKLLADSRSLPVWATAAQRRLLEA----PVTPDVVVAKDGSGKYKTINEAIPDI  926
                   RKLL+     P W     R+L+ A     V P+ VVA DGSG++K+IN+A+  +
Sbjct  222   DLGSYARKLLSTEDGFPTWMRPETRKLMAAVTGPKVKPNAVVALDGSGQFKSINDALKTV  281

Query  927   PLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGT  1103
             P  +   FVI+IK G+YKE V +TK M  V F+GDGPTKTI++G+ ++ +G  +T +T T
Sbjct  282   PKNNKFPFVIYIKQGIYKEKVDVTKTMTYVTFIGDGPTKTIVTGNLNFGIGNVKTYQTAT  341

Query  1104  VIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             V V G  F  K+IG ENTAGPE HQAVALRV +D A+F+NCQID YQDTL
Sbjct  342   VAVNGENFTAKDIGFENTAGPEGHQAVALRVSADYAVFYNCQIDGYQDTL  391



>ref|XP_003530310.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 150/341 (44%), Positives = 222/341 (65%), Gaps = 20/341 (6%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             SS KAV+ +C PT +++ C + L A A N+TD KEL+++ FN+T+ +I   +K++  L  
Sbjct  54    SSIKAVQTLCHPTNYKKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHE  113

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGA----NLDLYMNDIKVWLSGA  608
               ++PR   A + C++L+  SI ++ R+LD      G G     N+D  + ++KVWLSGA
Sbjct  114   VEEEPRAKMALETCKQLMDLSIGELTRSLD------GIGEFNLINVDKILMNLKVWLSGA  167

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA-GLNRKL  785
             +T+++TCL+GF  T  D+  KMK LL     ++ N L +V ++ D +   +I     R+L
Sbjct  168   VTYQDTCLDGFENTTSDAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRL  227

Query  786   LADSRSLPVWATAAQRRLLE---APVT--PDVVVAKDGSGKYKTINEAIPDIPLKSNKSF  950
             L DS  LP W    Q RLL    +P+   P+V VA DGSG +K+INEA+  +P K+ K F
Sbjct  228   LQDSE-LPSWVD--QHRLLNENASPLKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPF  284

Query  951   VIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFM  1130
             VI+IK GVY+E V +TKKM +VVF+G+G  KT ISG+++++ G  T  T TV ++G  F+
Sbjct  285   VIYIKEGVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFV  344

Query  1131  GKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               N+G EN+AGP  HQAVALRVQ+D++IF+NC +D YQDTL
Sbjct  345   AINMGFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTL  385



>ref|XP_003529556.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=582

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/350 (42%), Positives = 216/350 (62%), Gaps = 21/350 (6%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             G   I  S +  + +C+   ++E C K L+ A+ ++D KEL+  AFN T +EI+  +K S
Sbjct  46    GGDTIAKSQRNQQVICESAEYKETCHKSLAKASGTSDLKELIITAFNATAEEIANQIKNS  105

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIK  590
                   A D  T +A  IC+E+L  ++DDI+R++  +          DL     Y  D+K
Sbjct  106   TLYHELATDHMTKQATDICKEVLGYAVDDIRRSVHTL-------EKFDLNKLNDYAYDLK  158

Query  591   VWLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG  770
             VW++G L  + TCL+GF  T  ++   M K+L  + +L+ N L++V+ +      L+++ 
Sbjct  159   VWIAGTLAHQQTCLDGFENTSSEAGKTMAKVLNASLELSNNALDIVNGVSSLFKGLNLSS  218

Query  771   L----NRKLLADSRSL----PVWATAAQRRLLEA-PVTPDVVVAKDGSGKYKTINEAIPD  923
                  NRKLL++  +L    P W +  QRRLL+A    PDVVVA+DGSG+ KTI+EA+  
Sbjct  219   FSVNSNRKLLSEETALVDGFPTWVSEGQRRLLQAVDPKPDVVVAQDGSGQVKTIHEALKL  278

Query  924   IPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGT  1103
             +P K+ K FVI+IKAG+Y E +++ K +  V  +GDGPTKT I+GS++YV G QT  T T
Sbjct  279   VPKKNKKPFVIYIKAGIYNEYIIMNKHLTYVTMIGDGPTKTRITGSKNYVDGVQTYNTAT  338

Query  1104  VIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               V  + FM KNIG ENTAG E HQAVALRV +D+A+F+NC +D +QDTL
Sbjct  339   FGVNAANFMAKNIGFENTAGAEKHQAVALRVTADKAVFYNCNMDGFQDTL  388



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/346 (42%), Positives = 228/346 (66%), Gaps = 18/346 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKT  431
             I  +TKAV+ VC PT  +E CV  L +A+  ST+  +L++++F+VT+K I++ +KK S  
Sbjct  44    IKKTTKAVQAVCAPTDFKETCVNSLMNASPKSTEPMDLIKLSFDVTIKSINEGLKKASGD  103

Query  432   LQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
             ++A A+KDP    AF++C++++ D+I+D+K+ +D    H  +   +D ++ D++VWLSG+
Sbjct  104   VKAKASKDPEAKGAFELCEKVMVDAIEDLKKCMD----HGFSVDKIDAFVEDLRVWLSGS  159

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG------  770
             + F+ TC++ F   + +   +M+ +  T ++L+ N+L MV  +   L + +  G      
Sbjct  160   IAFQQTCMDSFEEIKSNLMQEMQHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFA  219

Query  771   -LNRKLLADSRSLPVWATAAQRRLLEA---PVTPDVVVAKDGSGKYKTINEAIPDIPLKS  938
                RKLL     +P W     RRL+ A   PV  + VVA+DGSG++KTIN+A+  IP  +
Sbjct  220   NYARKLLTTEDGIPTWVGPEARRLMAAGPGPVKANAVVAQDGSGQFKTINDALNAIPKGN  279

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGTVIVK  1115
                FVIHIK G+YKE V++T+KM  V F+GDG TKT+I+G+++Y +G  +T +T  +IV+
Sbjct  280   TVPFVIHIKQGIYKEKVMVTRKMPYVTFIGDGQTKTVITGNQNYGIGKVKTFQTAPLIVE  339

Query  1116  GSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  F  KNIG+ENTAGPE  QAVALRV +D A+FH+CQ D YQDTL
Sbjct  340   GDHFTMKNIGVENTAGPEGGQAVALRVSADYAVFHSCQFDGYQDTL  385



>gb|KHN04170.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=558

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/340 (44%), Positives = 220/340 (65%), Gaps = 12/340 (4%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++ SS KAV+ +C PT + + C + L A A N+TD KELV++ FN+T+ +I   +K++  
Sbjct  27    HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELVKIFFNITITKIGDKLKETNI  86

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L    ++PR   A   C++L+  SI ++ R+LD + +      N+D  + ++KVWLSGA+
Sbjct  87    LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGINEFNLI--NVDKILMNLKVWLSGAV  144

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA-GLNRKLL  788
             T+++TCL+GF  T  D+  KMK LL     ++ N L +V ++ D +   +I     R+LL
Sbjct  145   TYQDTCLDGFENTTSDAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLL  204

Query  789   ADSRSLPVWATAAQRRLLEAPVTP-----DVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
              DS  LP W    Q RLL    +P     +V VA DGSG +K+INEA+  +P K+ K FV
Sbjct  205   QDSE-LPSWVD--QHRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFV  261

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             I+IK GVY+E V +TKKM +VVF+G+G  KT ISG+++++ G  T  T TV ++G  F+ 
Sbjct  262   IYIKEGVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVA  321

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              N+G EN+AGP  HQAVALRVQ+D++IF+NC +D YQDTL
Sbjct  322   INMGFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTL  361



>ref|XP_003529778.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/340 (44%), Positives = 222/340 (65%), Gaps = 12/340 (4%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++ SS KAV+ +C PT + + C + L A A N+TD KEL+++ FN+T+ +I   +K++  
Sbjct  51    HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNI  110

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L    ++PR   A   C++L+  SI ++ R+LD + +      N+D  + ++KVWLSGA+
Sbjct  111   LHEVEEEPRAKMALDTCKQLMDLSIGELTRSLDGINEFNLI--NVDKILMNLKVWLSGAV  168

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA-GLNRKLL  788
             T+++TCL+GF  T  D+  KMK LL     ++ N L +V ++ D +   +I     R+LL
Sbjct  169   TYQDTCLDGFENTTSDAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLL  228

Query  789   ADSRSLPVWATAAQRRLLE---APVT--PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
              DS  LP W    Q RLL    +P+   P+V VA DGSG +K+INEA+  +P K+ K FV
Sbjct  229   QDSE-LPSWVD--QHRLLNENASPLKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFV  285

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             I+IK GVY+E V +TKKM +VVF+G+G  KT ISG+++++ G  T  T TV ++G  F+ 
Sbjct  286   IYIKEGVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVA  345

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              N+G EN+AGP  HQAVALRVQ+D++IF+NC +D YQDTL
Sbjct  346   INMGFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTL  385



>ref|XP_011071430.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=573

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/345 (45%), Positives = 214/345 (62%), Gaps = 19/345 (6%)
 Frame = +3

Query  267   STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  446
             STKAV+ +C PT ++E C   LS A NST+  EL++ AF+ T+K I  ++  S   + AA
Sbjct  49    STKAVQSICAPTDYKETCESSLSHA-NSTNPNELIKAAFDFTVKNIGDIITNSPLFKEAA  107

Query  447   KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENT  626
              D  T +A +ICQE+L  +IDD+KR+ D  VD      N   Y+ ++K WLS  +T + T
Sbjct  108   NDDGTKQALEICQEVLDTAIDDLKRSFDS-VDEFDI-TNASEYVENLKTWLSAVITNQET  165

Query  627   CLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA-GLNRKLL-----  788
             C++ F  T GD+ +KMK LL TA++++ N L MV+E+   L SL +    +RKLL     
Sbjct  166   CIDAFENTTGDTGEKMKNLLKTAREMSSNGLAMVNEMSSFLSSLQLGNAASRKLLLSGKI  225

Query  789   ---------ADSRSLPVWATAAQRRLLEA-PVTPDVVVAKDGSGKYKTINEAIPDIPLKS  938
                      A          + +RRLL A  + P+ VVA+DGSG++ TI+ AI  +P K+
Sbjct  226   GYGGDPTDYAPGEEPHFNLDSNRRRLLSATSLKPNAVVAQDGSGQFNTISAAIASVPPKN  285

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKG  1118
             N++FVIH+KAGVYKE V + KK+  +V +GDGP KT ISG ++Y  G +T  T TV V  
Sbjct  286   NQTFVIHVKAGVYKEYVQIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTYHTATVAVNA  345

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               F+ K+IG ENTAG   HQAVALRV  D+A+F+N  ID YQDTL
Sbjct  346   DDFLAKDIGFENTAGAAGHQAVALRVSGDRAVFYNVHIDGYQDTL  390



>ref|XP_003557035.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=587

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/340 (44%), Positives = 220/340 (65%), Gaps = 12/340 (4%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++ SS KAV+ +C PT + + C + L A A N+TD KELV++ FN+T+ +I   +K++  
Sbjct  56    HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELVKIFFNITITKIGDKLKETNI  115

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L    ++PR   A   C++L+  SI ++ R+LD + +      N+D  + ++KVWLSGA+
Sbjct  116   LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGINEFNLI--NVDKILMNLKVWLSGAI  173

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA-GLNRKLL  788
             T+++TCL+GF  T  D+  KMK LL     ++ N L +V ++ D +   +I     R+LL
Sbjct  174   TYQDTCLDGFENTTSDAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLL  233

Query  789   ADSRSLPVWATAAQRRLLEAPVTP-----DVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
              DS  LP W    Q RLL    +P     +V VA DGSG +K+INEA+  +P K+ K FV
Sbjct  234   QDSE-LPSWVD--QHRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFV  290

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             I+IK GVY+E V +TKKM +VVF+G+G  KT ISG+++++ G  T  T TV ++G  F+ 
Sbjct  291   IYIKEGVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVA  350

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              N+G EN+AGP  HQAVALRVQ+D++IF+NC +D YQDTL
Sbjct  351   INMGFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTL  390



>ref|XP_009594458.1| PREDICTED: pectinesterase [Nicotiana tomentosiformis]
Length=684

 Score =   283 bits (724),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 147/348 (42%), Positives = 217/348 (62%), Gaps = 26/348 (7%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             +S K +E +C+ T ++  CV+ L S+A  S+D K+L++ +F V +K+I + ++ S  LQ 
Sbjct  45    TSQKTIESICQTTRYQHTCVESLESSAEGSSDPKDLIQKSFQVAIKKIKEAIENSTMLQK  104

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFE  620
               KDPR   A + CQ+L   +++D+ R   +    +    +L  ++ D+K+WLSGA+T++
Sbjct  105   LEKDPRAKLALENCQKLAWQAVNDLNRTHTKF--ESFEFNDLSHWIADLKIWLSGAITYQ  162

Query  621   NTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLD-------------  761
              TCL+GF  T G++ +KMK+ L ++ +LT N L M+ EI     SL+             
Sbjct  163   ETCLDGFEKTTGETEEKMKRALNSSMELTSNALYMITEISSVFTSLNAGSSSRRRLLLLD  222

Query  762   ---IAGLNRKLLADSRSLPVWATAAQRRLLEA-PVTPDVVVAKDGSGKYKTINEAIPDIP  929
                I G   +LL D      W    +RRLL A  + PD+VVAKDGS KYKTINEA+ +IP
Sbjct  223   EAPILGHGNELLPD------WVDMRRRRLLAAKEIKPDIVVAKDGSSKYKTINEALKNIP  276

Query  930   LKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVI  1109
                N+++V++IK GVY E V  T  M N++ +GDGPTKT I+G++++  G  T  T T  
Sbjct  277   NNRNQTYVLYIKQGVYNEKVEFTSSMTNLMVIGDGPTKTRITGNQNFKDGTPTYLTATAA  336

Query  1110  VKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             V G  F+ K+IG EN+AGPE HQAVALRV +D++IF+NC ID YQDTL
Sbjct  337   VMGDYFVAKDIGFENSAGPEKHQAVALRVAADKSIFYNCHIDGYQDTL  384



>ref|XP_003591164.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591167.1| Pectinesterase [Medicago truncatula]
 gb|AES61415.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES61418.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=583

 Score =   280 bits (716),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 145/347 (42%), Positives = 229/347 (66%), Gaps = 23/347 (7%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA---ATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             ++ S+ KA+  +C+PT +++ C + L A   A N TD KEL+++AFNVT+K+I + +K++
Sbjct  50    HVASTMKAIRTICQPTDYKKECEESLRAEAEADNVTDPKELIKIAFNVTIKKIGEKLKET  109

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAG----ANLDLYMNDIKV  593
               L    KDPR+ +A   C++L+  SID+  R+LD      G G     N++  + ++KV
Sbjct  110   DMLCELEKDPRSKDALDTCKQLMDLSIDEFTRSLD------GIGKLNIQNIENILMNLKV  163

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WL+GA+T+ +TCL+GF  T  ++  KMK+LL ++  ++ N L ++ +  D +  +++  +
Sbjct  164   WLNGAVTYMDTCLDGFENTTSEAGKKMKELLTSSMHMSSNALAIITDFADTISDMNVTKI  223

Query  774   -NRKLLADSRSLPVWATAAQRRLLEAPV-----TPDVVVAKDGSGKYKTINEAIPDIPLK  935
               R+LL D ++ P W     R+LL+A       TP+V VA DGSG +K+INEA+  +P +
Sbjct  224   VGRRLLQDYKT-PSWV--EHRKLLDAKTNAFKHTPNVTVALDGSGDFKSINEALKKVPHE  280

Query  936   SNKS-FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIV  1112
              +K+ FVI+IKAGVY+E V +   M ++VFVGDG  K+II+G+++++ G  T  T TV +
Sbjct  281   ESKTPFVIYIKAGVYREYVEVLTNMTHIVFVGDGGKKSIITGNKNFMDGVTTYHTATVAI  340

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +G  F   N+G EN+AGP+ HQAVALRVQ D+AIF+NC +D YQDTL
Sbjct  341   QGDHFTAINMGFENSAGPQKHQAVALRVQGDKAIFYNCSMDGYQDTL  387



>gb|KHN01292.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=582

 Score =   280 bits (716),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 147/340 (43%), Positives = 220/340 (65%), Gaps = 12/340 (4%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++ SS KAV+ +C PT + + C + L A A N+TD KEL+++ FN+T+ +I   +K++  
Sbjct  51    HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNI  110

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L    ++PR   A   C++L+  SI ++ R+LD + +      N+D  + ++KVWLSGA+
Sbjct  111   LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGINEFNLI--NVDKILMNLKVWLSGAV  168

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA-GLNRKLL  788
             T+++TCL+GF  T  D+  KMK LL     ++ N L +V ++ D +   +I     R+LL
Sbjct  169   TYQDTCLDGFENTTSDAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLL  228

Query  789   ADSRSLPVWATAAQRRLLEAPVTP-----DVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
              DS  LP W    Q RLL    +P     +V VA DGSG +K+INEA+  +P K+ K FV
Sbjct  229   QDSE-LPSWVD--QHRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFV  285

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             I+IK GVY+E V +TKKM +VVF+G+G  KT ISG+++++ G  T  T TV ++G  F+ 
Sbjct  286   IYIKEGVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVA  345

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              N+G EN+AGP  HQAVALRVQ+D++IF+NC +D YQDTL
Sbjct  346   INMGFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTL  385



>dbj|BAK06954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score =   279 bits (714),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 144/338 (43%), Positives = 212/338 (63%), Gaps = 9/338 (3%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S K+++  C+P  ++  C K L   A N+T T EL +  F  T + I K +++S  L
Sbjct  38    LTTSLKSIKSFCQPVDYKVACEKTLEETAGNATTTTELAKAIFKATSERIEKAVRESSLL  97

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
                  DPRTS A K C+ELL  +IDD+K   D++        N    M+D+K WLS ALT
Sbjct  98    NDLKHDPRTSGALKNCKELLHYAIDDLKTTFDQL--GGFEMTNFKHAMDDLKTWLSSALT  155

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ +CL+GF  T  ++A KM+K L  +Q+LT N L +VDE  D + +LD++  +R+LL  
Sbjct  156   YQESCLDGFDNTTTNAAAKMRKALNVSQELTENILSIVDEFGDTIANLDLSIFSRRLLGH  215

Query  795   SRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIH  959
               + P W + A+RRLLE   +     PDV VA DGSG + TINEA+  +PLK   ++V++
Sbjct  216   DGA-PRWMSDAKRRLLEVSPSEPDFKPDVTVAADGSGDFTTINEALAKVPLKREDTYVMY  274

Query  960   IKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKN  1139
             +K G YKE V + + + N+V +GDG  KT+I+G +S++    T +T T+   G+GF  + 
Sbjct  275   VKEGTYKEYVSVPRNVSNLVMIGDGADKTVITGEKSFMMNITTKDTATMEAIGNGFFMRG  334

Query  1140  IGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             I +ENTAG +NHQAVALRVQSDQ++F+ CQ   YQDTL
Sbjct  335   ITVENTAGAKNHQAVALRVQSDQSVFYECQFHGYQDTL  372



>gb|KFK38146.1| hypothetical protein AALP_AA3G075300 [Arabis alpina]
Length=565

 Score =   279 bits (714),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 235/351 (67%), Gaps = 19/351 (5%)
 Frame = +3

Query  246   GNKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMK  419
             G++N I  +TKAV+ VC PT ++E C  ++ +A   ST+  +L++++FNVT++ I + ++
Sbjct  39    GDENEIRKTTKAVQAVCAPTDYKETCFDRMMNAEPESTEPLDLIKLSFNVTIQSIHESLQ  98

Query  420   K-SKTLQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKV  593
             K S+ ++A A+K+P    AF++C+ ++ D+IDD++++ DR      + A ++ Y+ D++V
Sbjct  99    KASEDVKARASKNPAAKGAFQLCEHVMLDAIDDLRKSFDR----GFSLARIEGYVEDLRV  154

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WLSG++ F+ TC++ F   + +   +M  +  T+++LT N+L MV  +   L + +I GL
Sbjct  155   WLSGSIAFQQTCIDSFEEIKSNLLQEMINIFKTSRELTSNSLAMVTGMSTLLPNSNITGL  214

Query  774   N-------RKLLADSRSLPVWATAAQRRLLEA---PVTPDVVVAKDGSGKYKTINEAIPD  923
                     RKLL+    +P W     RRL+ A   PV  + VVA+DGSG++KTI +A+  
Sbjct  215   TGVLASYARKLLSTEDGIPTWVGPEARRLMVAQIGPVKANAVVAQDGSGQFKTITDALNA  274

Query  924   IPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETG  1100
             +P      F+IHIK G+YKE V++TKKM +V F+GDGPTKT+I+GS ++ +G  +T  T 
Sbjct  275   VPKGDTLPFIIHIKEGIYKEKVIVTKKMPHVTFIGDGPTKTVITGSLNFRIGKVKTFLTA  334

Query  1101  TVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             T+ ++G+ F  K+IGIENT+GP+  QAVALRV +D A+F+NCQID YQ+TL
Sbjct  335   TITIQGNHFTAKSIGIENTSGPKGGQAVALRVSADYAVFYNCQIDGYQNTL  385



>gb|EPS72184.1| pectinesterase family protein, partial [Genlisea aurea]
Length=560

 Score =   278 bits (712),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 144/336 (43%), Positives = 214/336 (64%), Gaps = 10/336 (3%)
 Frame = +3

Query  267   STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  446
             +TK+V+ +C PT +++ C + L+ A NSTD K L+++AF  T+K I   +  S   + AA
Sbjct  48    TTKSVQAICSPTDYKQTCEESLAGA-NSTDPKYLIKLAFQNTVKGIRSAILNSTLYREAA  106

Query  447   KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENT  626
              DP T  A ++C+E+L +S+DD++R+ D++   A     +D Y++DIK WLSGA+  +  
Sbjct  107   ADPNTKGALQVCEEVLDNSVDDLQRSFDQV--EAFDVNRMDEYIDDIKTWLSGAIANKEA  164

Query  627   CLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN--RKLLADSR  800
             C++   GT GD+A+KMKKLL T  ++  N L +V +      SL +      R+L+ +  
Sbjct  165   CIDAVNGTSGDTAEKMKKLLNTTSEMLSNGLAIVTDFSTIFSSLQLGSFTSRRRLMGEGE  224

Query  801   SLP--VWATAAQRRLLEAPVT---PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIK  965
               P   +  +A+RRLL   +     +V VA+DGSG++KTI  A+  +P KSN +FVIH+K
Sbjct  225   ENPDDGFVQSARRRLLAVNINTIKANVTVAQDGSGQFKTIGAALATLPKKSNDTFVIHVK  284

Query  966   AGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIG  1145
             AGVYKE V++ KK+ NVV  GDGP KT +  +++Y  G QT  T T+ V   GFM K+I 
Sbjct  285   AGVYKETVIVPKKVNNVVIYGDGPEKTRVVNNKNYADGVQTFHTATLAVNSDGFMAKDIA  344

Query  1146  IENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              EN+AGP  HQAVA+RV  D+A+F+N  +D YQDTL
Sbjct  345   FENSAGPTKHQAVAVRVSGDKAVFYNVVMDGYQDTL  380



>ref|XP_004494574.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=586

 Score =   279 bits (714),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 147/351 (42%), Positives = 224/351 (64%), Gaps = 20/351 (6%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             + +I SS KAV+ +C+PT +R+ C + L+A A N TD +ELV++AFN+T+ +IS  + K+
Sbjct  48    DSHISSSVKAVQTICEPTDYRKECEESLTAQAGNITDPRELVKIAFNITITKISDGLSKT  107

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
             + L     D RT EA   C++L+  SID+ KR+L++  +      NLD  +  +KVWLSG
Sbjct  108   QLLHEVESDERTKEALDTCKQLMNLSIDEFKRSLEKFSNFDLN--NLDRVLTSLKVWLSG  165

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKL  785
             A+T++ TCL+ F  T  ++ +KMK++L TA  ++ N L +++E+      +  AG  R+L
Sbjct  166   AITYQETCLDAFENTTTNAGEKMKEILQTAMHMSSNGLSIINELSKTFTEMKPAG--RRL  223

Query  786   LADSRSL----------PVWA--TAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIP  920
             L D   L          P W       R+LL+     +   VVVAKDG+G + TINEA+ 
Sbjct  224   LKDDGELHVVGRGDFEFPEWVDDRVGVRKLLKMTGRKLQAHVVVAKDGTGNFTTINEALK  283

Query  921   DIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETG  1100
              +P K+ + FVI+IK G+Y E V +++ M +VVF+GDG  K+ I+G+++++ G  T  T 
Sbjct  284   HVPKKNLRPFVIYIKEGIYNEYVEVSRNMTHVVFIGDGGRKSRITGNKNFIDGVGTYRTA  343

Query  1101  TVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             TV + G  F+G  IG EN+AGPE HQAVALRVQ+D++IF+ C++D YQDTL
Sbjct  344   TVAILGDFFVGIGIGFENSAGPEKHQAVALRVQADRSIFYKCRMDGYQDTL  394



>dbj|BAC42959.2| putative pectin methylesterase [Arabidopsis thaliana]
Length=568

 Score =   278 bits (711),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/350 (41%), Positives = 228/350 (65%), Gaps = 21/350 (6%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SK  428
             +I  +TKAV+ VC PT  ++ CV  L  A+ +S D  +L+++ F VT+K I++ ++K S 
Sbjct  43    HIRKTTKAVQAVCAPTDFKDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASG  102

Query  429   TLQAAA-KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
              ++A A K+P    AF++C++L+ D+IDD+K+ +D    H  +   +++++ D++VWLSG
Sbjct  103   DIKAEADKNPEAKGAFELCEKLMIDAIDDLKKCMD----HGFSVDQIEVFVEDLRVWLSG  158

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN---  776
             ++ F+ TC++ F   + +    M K+  T+++L+ N+L MV  I   + + ++ GL    
Sbjct  159   SIAFQQTCMDSFGEIKSNLMQDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTGLTGAL  218

Query  777   ----RKLLADSRSLPVWATAAQRRLLEA------PVTPDVVVAKDGSGKYKTINEAIPDI  926
                 RKLL+   S+P W     RRL+ A      PV  + VVA+DG+G++KTI +A+  +
Sbjct  219   AKYARKLLSTEDSIPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAV  278

Query  927   PLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGT  1103
             P  +   F+IHIK G+YKE V +TKKM +V F+GDGP KT+I+GS ++ +G  +T  T T
Sbjct  279   PKGNKVPFIIHIKEGIYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNFGIGKVKTFLTAT  338

Query  1104  VIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             + ++G  F  KNIGIENTAGPE  QAVALRV +D A+FH+CQID +QDTL
Sbjct  339   ITIEGDHFTAKNIGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTL  388



>ref|XP_003604119.1| Pectinesterase [Medicago truncatula]
 gb|AES86316.1| pectinesterase/pectinesterase inhibitor, putative [Medicago truncatula]
Length=636

 Score =   280 bits (715),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/347 (43%), Positives = 227/347 (65%), Gaps = 25/347 (7%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL---SAATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             + S+ KAV+ +C PT +++ CV+ L   + A N TD KEL+++AFNVT+ +I + +K+++
Sbjct  56    VASTLKAVQTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETE  115

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-YMNDI----KV  593
               +   KDPR+ +A   C++L+  SI +  R+LD +       +  DL +MN I    KV
Sbjct  116   MFREIEKDPRSKDALDTCKQLMHLSIGEFTRSLDGI-------SEFDLKHMNQILMNLKV  168

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WL+GA+T+ +TCL+GF  T GD++ KMK LL ++  ++ N L +V    D +  ++++ L
Sbjct  169   WLNGAVTYMDTCLDGFENTTGDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKL  228

Query  774   -NRKLLADSRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPLK  935
               R+LL DS  +P W     R LL+A        P+V VA DGSG +K+INEA+  +P +
Sbjct  229   FGRRLLQDSE-IPSWV--EHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGE  285

Query  936   SNKS-FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIV  1112
              +++ FVI+IKAGVY+E V + K M ++VFVGDG  K+II+G+++Y+ G  T  T TV +
Sbjct  286   EDETPFVIYIKAGVYREYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAI  345

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +G  F   N+G EN+AGP+ HQAVALRVQ D+AIF NC +D YQDTL
Sbjct  346   QGDHFTAINMGFENSAGPQKHQAVALRVQGDKAIFFNCSMDGYQDTL  392



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   286 bits (732),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/337 (44%), Positives = 215/337 (64%), Gaps = 14/337 (4%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
              ++ SS KA+  +C+ T +++ C+  L A  NST+ K+L+EVAF   +  I++  + S T
Sbjct  40    PDVSSSQKAISSICETTDYQQTCMNSL-AGHNSTNPKDLIEVAFQAAVNYINQAAENSST  98

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             LQ    DP    A ++CQ+L   +I+D++R+  +  +      N+D  + D+K+WLSGA+
Sbjct  99    LQHLETDPMAKSALQVCQDLANRAINDLQRSFAKFSNFDII--NVDDILLDLKIWLSGAI  156

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA  791
             T + TCL+GF    G+S  KMK  L  + +LT N L MV EI   L ++ +   +     
Sbjct  157   THQETCLDGFEDVPGESGQKMKDALKISMELTSNALAMVAEISTFLEAMGMQSFSE----  212

Query  792   DSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHI  962
                 LP WA   +R+LL A    + PD+VVAKDGSGKY+TINEA+ DIP KSNK+FV++I
Sbjct  213   ----LPDWADFNKRKLLTASPKELKPDLVVAKDGSGKYRTINEALKDIPKKSNKTFVLYI  268

Query  963   KAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNI  1142
             K GVY+E V +   + +++ VGDGPTKT I+G  +++ G  T +T TV V+G  F+ K I
Sbjct  269   KEGVYEEKVQINSSLTHLMMVGDGPTKTRITGHLNFIDGTGTYQTATVAVQGDDFIAKEI  328

Query  1143  GIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G EN+AG   HQAVALRV +D++IF+NC +D YQDTL
Sbjct  329   GFENSAGAAKHQAVALRVSADKSIFYNCHMDGYQDTL  365



>ref|NP_187339.2| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
 sp|Q8GXA1.3|PME23_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
23; Includes: RecName: Full=Pectinesterase inhibitor 23; AltName: 
Full=Pectin methylesterase inhibitor 23; Includes: RecName: 
Full=Pectinesterase 23; Short=PE 23; AltName: Full=Pectin 
methylesterase 23; Short=AtPME23; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABO38766.1| At3g06830 [Arabidopsis thaliana]
 gb|AEE74464.1| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
Length=568

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/350 (41%), Positives = 228/350 (65%), Gaps = 21/350 (6%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SK  428
             +I  +TKAV+ VC PT  ++ CV  L  A+ +S D  +L+++ F VT+K I++ ++K S 
Sbjct  43    HIRKTTKAVQAVCAPTDFKDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASG  102

Query  429   TLQAAA-KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
              ++A A K+P    AF++C++L+ D+IDD+K+ +D    H  +   +++++ D++VWLSG
Sbjct  103   DIKAKADKNPEAKGAFELCEKLMIDAIDDLKKCMD----HGFSVDQIEVFVEDLRVWLSG  158

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN---  776
             ++ F+ TC++ F   + +    M K+  T+++L+ N+L MV  I   + + ++ GL    
Sbjct  159   SIAFQQTCMDSFGEIKSNLMQDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTGLTGAL  218

Query  777   ----RKLLADSRSLPVWATAAQRRLLEA------PVTPDVVVAKDGSGKYKTINEAIPDI  926
                 RKLL+   S+P W     RRL+ A      PV  + VVA+DG+G++KTI +A+  +
Sbjct  219   AKYARKLLSTEDSIPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAV  278

Query  927   PLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGT  1103
             P  +   F+IHIK G+YKE V +TKKM +V F+GDGP KT+I+GS ++ +G  +T  T T
Sbjct  279   PKGNKVPFIIHIKEGIYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNFGIGKVKTFLTAT  338

Query  1104  VIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             + ++G  F  KNIGIENTAGPE  QAVALRV +D A+FH+CQID +QDTL
Sbjct  339   ITIEGDHFTAKNIGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTL  388



>ref|XP_011092100.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Sesamum indicum]
Length=793

 Score =   283 bits (724),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/346 (42%), Positives = 221/346 (64%), Gaps = 14/346 (4%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKLSAA-TNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             +++ SS KA+  +C+ T ++E CV+ L+A+ TNST+ K+L++  F   +  I +  K S 
Sbjct  38    QDVSSSKKAITSLCETTDYQEACVESLNASGTNSTNPKDLIDAIFQSAIDYIKEASKNST  97

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
              L     DPR   A + CQEL   ++ D++R+     +      N+D  + ++K+WLSGA
Sbjct  98    VLLELQTDPRAKAALENCQELADRAVHDLERSFQSFNNFDIT--NMDDLLLELKIWLSGA  155

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-AGLNRKL  785
             +T + TCL+GF G  G++ +KM+  L  A Q+T N L M+ E+   + SL I +  +R+L
Sbjct  156   ITHQETCLDGFEGVPGEAGEKMRVSLTKAMQMTSNALAMMAELSTYIKSLGIESSTSRRL  215

Query  786   LADSRS-------LPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLK  935
             L+++ +       LP W    +RRLL A    + P +VVAKDGSGK++TINEA+  IP K
Sbjct  216   LSENEAVVGHDDELPNWMDLNKRRLLSASPQQIRPHLVVAKDGSGKFRTINEALKHIPKK  275

Query  936   SNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVK  1115
              ++ FV++IK GVY+E V +   + +++F+GDGPTKT I+G  +++ G  T  T TV V+
Sbjct  276   RDEIFVLYIKEGVYEERVQVNSSLTHLLFIGDGPTKTRITGKLNFIDGTNTYRTATVAVQ  335

Query  1116  GSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  FM  NIG EN+AGP+ HQAVALRV +D+AIF+NC +D YQDTL
Sbjct  336   GDNFMAVNIGFENSAGPQKHQAVALRVSADKAIFYNCHMDGYQDTL  381



>ref|XP_003529788.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 146/340 (43%), Positives = 219/340 (64%), Gaps = 12/340 (4%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++ SS KAV+ +C PT + + C + L A A N+TD KEL+++ FN+T+ +I   +K++  
Sbjct  51    HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNI  110

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L    ++PR   A   C++L+  SI ++ R+LD + +      N+D  + ++KVWLSGA+
Sbjct  111   LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGINEFNLI--NVDKILMNLKVWLSGAV  168

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA-GLNRKLL  788
             T+++TCL+GF  T  D+  KMK LL     ++ N L +V ++ D +   +I     R+LL
Sbjct  169   TYQDTCLDGFENTTSDAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITKSFGRRLL  228

Query  789   ADSRSLPVWATAAQRRLLEAPVTP-----DVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
              D   LP W    Q RLL    +P     +V VA DGSG +K+INEA+  +P K+ K FV
Sbjct  229   QDYE-LPSWVD--QHRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFV  285

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             I+IK GVY+E V +TKKM +VVF+G+G  KT ISG+++++ G  T  T TV ++G  F+ 
Sbjct  286   IYIKEGVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVA  345

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              N+G EN+AGP  HQAVALRVQ+D++IF+NC +D YQDTL
Sbjct  346   INMGFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTL  385



>ref|XP_003591166.1| Pectinesterase [Medicago truncatula]
 gb|AES61417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 149/348 (43%), Positives = 226/348 (65%), Gaps = 25/348 (7%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKL---SAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             ++ S+ KAV+ +C PT +++ CV+ L   + A N TD KEL+++AFNVT+ +I + +K++
Sbjct  55    HVASTLKAVQTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKET  114

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-YMNDI----K  590
             +      KDPR+ +A   C++L+  SI +  R+LD +       +  DL +MN I    K
Sbjct  115   EMFSEIEKDPRSKDALDTCKQLMHLSIGEFTRSLDGI-------SEFDLKHMNQILMNLK  167

Query  591   VWLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG  770
             VWL+GA+T+ +TCL+GF  T GD++ KMK LL ++  ++ N L +V    D +  ++++ 
Sbjct  168   VWLNGAVTYMDTCLDGFENTTGDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSK  227

Query  771   L-NRKLLADSRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPL  932
             L  R+LL DS  +P W     R LL+A        P+V VA DGSG +K+INEA+  +P 
Sbjct  228   LFGRRLLQDSE-IPSWV--EHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPG  284

Query  933   KSNKS-FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVI  1109
             + +++ FVI+IKAGVY+E V + K M ++VFVGDG  K+II+G+++Y+ G  T  T TV 
Sbjct  285   EEDETPFVIYIKAGVYREYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVA  344

Query  1110  VKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             ++G  F   N+G EN+AGP+ HQAVALRVQ D+ IF NC +D YQDTL
Sbjct  345   IQGDHFTAINMGFENSAGPQKHQAVALRVQGDKTIFFNCSMDGYQDTL  392



>gb|AAF63815.1| pectin methylesterase, putative [Arabidopsis thaliana]
Length=562

 Score =   276 bits (707),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 144/344 (42%), Positives = 227/344 (66%), Gaps = 15/344 (4%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SK  428
             +I  +TKAV+ VC PT  ++ CV  L  A+ +S D  +L+++ F VT+K I++ ++K S 
Sbjct  43    HIRKTTKAVQAVCAPTDFKDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASG  102

Query  429   TLQAAA-KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
              ++A A K+P    AF++C++L+ D+IDD+K+ +D    H  +   +++++ D++VWLSG
Sbjct  103   DIKAKADKNPEAKGAFELCEKLMIDAIDDLKKCMD----HGFSVDQIEVFVEDLRVWLSG  158

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-AGLNRK  782
             ++ F+ TC++ F   + +    M K+  T+++L+ N+L MV  I   + + ++ A   RK
Sbjct  159   SIAFQQTCMDSFGEIKSNLMQDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTAKYARK  218

Query  783   LLADSRSLPVWATAAQRRLLEA------PVTPDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
             LL+   S+P W     RRL+ A      PV  + VVA+DG+G++KTI +A+  +P  +  
Sbjct  219   LLSTEDSIPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKV  278

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGTVIVKGS  1121
              F+IHIK G+YKE V +TKKM +V F+GDGP KT+I+GS ++ +G  +T  T T+ ++G 
Sbjct  279   PFIIHIKEGIYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNFGIGKVKTFLTATITIEGD  338

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              F  KNIGIENTAGPE  QAVALRV +D A+FH+CQID +QDTL
Sbjct  339   HFTAKNIGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTL  382



>ref|XP_002882495.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58754.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/352 (42%), Positives = 227/352 (64%), Gaps = 23/352 (7%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SK  428
             +I  +TKAV+ VC PT  ++ CV  L  A+ +S +  +L+++ FN+T+K I++ +KK S 
Sbjct  43    HIKKTTKAVQAVCAPTDFKDTCVNSLMGASPSSAEPLDLIKLGFNITIKSINESLKKASG  102

Query  429   TLQAAA-KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
              ++A A K+P    AF++C++L+ D+IDD+K+ +D    H  +   +++++ D++VWLSG
Sbjct  103   DVKAKADKNPEAKGAFELCEKLMIDAIDDLKKCMD----HGFSVDRIEVFVEDLRVWLSG  158

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN---  776
             ++ F+ TC++ F   + +    M K+  T+++L+ N+L MV  I   L + +I GL    
Sbjct  159   SIAFQQTCMDSFGEIKSNLMQDMLKIFQTSRELSSNSLAMVTSISTLLPNSNITGLTGAL  218

Query  777   ----RKLLADSRSLPVWATAAQRRLLEAP--------VTPDVVVAKDGSGKYKTINEAIP  920
                 RKLL+    +P W     RRL+ A         V  + VVA+DGSG++KTI +A+ 
Sbjct  219   ANYARKLLSTEDGIPNWVGPEARRLMAAQGGGPGPGPVKANAVVAQDGSGQFKTITDALN  278

Query  921   DIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSET  1097
              +P  +   FVIHIK G+YKE V++T+KM  V F+GDGP KT+I+GS ++ +G  +T  T
Sbjct  279   GVPKGNTVPFVIHIKQGIYKEKVMVTRKMPYVTFIGDGPNKTVITGSLNFGIGKVKTFLT  338

Query  1098  GTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              T+ V+G  F  KNIGIENTAGPE  QAVALRV +D A+FH+CQID +QDTL
Sbjct  339   ATITVEGDHFTAKNIGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTL  390



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/343 (43%), Positives = 223/343 (65%), Gaps = 14/343 (4%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S KAV+ +C+PT +R+ C + L  AA N+T+ KEL+++AF +  K+I++  +KSK L
Sbjct  55    VSASVKAVKAICQPTDYRKTCEESLQKAAGNTTNPKELIKIAFKIAEKQINEASEKSKLL  114

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
             +  +KD RT  A + C+EL+  S  ++K++L+++ D   +   L+  M D+K WLS ++T
Sbjct  115   EELSKDARTRGALQSCKELMNMSAGELKQSLNKVTDFDLS--ELETLMADVKTWLSASIT  172

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+GF  T  D+  KMKK +    +L+ N L++V  I  A+ SL+ +  +R+LL D
Sbjct  173   YQETCLDGFENTTTDAGKKMKKGMKLGMELSANLLDIVSGISSAIPSLE-SFTHRRLLQD  231

Query  795   -------SRSLPVWATAAQRRLLEAPVT---PDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
                        P W     RRLL APV+    D+VVAKDGSG + TI EA+  +P+KS K
Sbjct  232   DLPVLGHGDQFPTWTDFGTRRLLAAPVSKIKADIVVAKDGSGDFSTIREALKHVPIKSKK  291

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
             +FV+HIKAGVY+E + ++K M+N+V +GDG   T I G++++V G  T  T TV V G  
Sbjct  292   AFVLHIKAGVYQEYLEISKGMINLVVIGDGRENTRIIGNKNFVDGINTFHTATVAVLGDN  351

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F+ KNIG EN AG   HQAVALRV +D A+F+NC +D +QDTL
Sbjct  352   FVAKNIGFENNAGAIKHQAVALRVSADYAVFYNCSMDGHQDTL  394



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   276 bits (707),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 150/353 (42%), Positives = 222/353 (63%), Gaps = 24/353 (7%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             +STKA++ +C+PT +++ C+  L SAA N+TD  +L+++ F  TMK+I +  KKS  LQ 
Sbjct  59    ASTKAIKAICQPTDYKQECLSSLTSAAGNTTDPIQLIKIGFQATMKQIYEATKKSNLLQK  118

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFE  620
               KDPRTS A   C+EL++ ++D+++++ +R+ D     +    ++ D+KVWLS ++T++
Sbjct  119   LEKDPRTSMALDTCKELMELAVDELRQSFNRVGDIENF-SKYKTFIMDLKVWLSASITYQ  177

Query  621   NTCLEGFLGTEG--DSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSL---DIAGLNRKL  785
              +CL+ F  T    D+  +MK LL T+ +L+ N L MV +I  AL  L   D +   R+ 
Sbjct  178   ESCLDAFENTTSSTDAGQEMKTLLKTSMRLSSNGLAMVSQIFSALTDLNNPDPSRHRRRR  237

Query  786   LADSRSLPV----------WATAAQRRLLE---APVT----PDVVVAKDGSGKYKTINEA  914
             L     LP+          W  A  R+LL    AP      PD VVAKDGSG YKTI+EA
Sbjct  238   LLSLDGLPILGHGDLEFPEWYEAGVRKLLTISTAPSPKANKPDAVVAKDGSGSYKTISEA  297

Query  915   IPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSE  1094
             +  +P   N++FVI+IK GVY E+V + + M NV+ +GDG  KT I+G++++V G  T  
Sbjct  298   LEHVPKYGNETFVIYIKEGVYNESVRVNRSMTNVMMIGDGTNKTRITGNQNFVDGTPTYR  357

Query  1095  TGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             T TV + G  FM  +IG +N+AGPE HQAVALRV +D+AIF+ C +D YQDTL
Sbjct  358   TATVAIHGDHFMAMDIGFDNSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTL  410



>ref|XP_003529774.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   276 bits (705),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/340 (43%), Positives = 218/340 (64%), Gaps = 12/340 (4%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++ SS KAV+ +C PT + + C + L A A N+TD KELV++ FN+T+ +I   +K++  
Sbjct  51    HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELVKIFFNITITKIGDKLKETNI  110

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L    ++PR   A   C++L+  SI ++ R+LD + +      N+D  + ++KVWLSGA+
Sbjct  111   LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGINEFNLI--NVDKILMNLKVWLSGAV  168

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA-GLNRKLL  788
             T+++TCL+GF  T  D+  KMK LL     ++ N L +V  + D +   +I     R+LL
Sbjct  169   TYQDTCLDGFENTTSDAGKKMKDLLTIGMHMSSNALAIVTGLADTVNDWNITKSFGRRLL  228

Query  789   ADSRSLPVWATAAQRRLLEAPVTP-----DVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
              DS  LP W    Q RLL    +P     +V VA D SG +K+INEA+  +P K+ K FV
Sbjct  229   QDSE-LPSWVD--QHRLLNENASPFKRKPNVTVAIDDSGDFKSINEALKQVPEKNRKPFV  285

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             I+IK GVY+E V +TKKM +VVF+G+G  KT ISG+++++ G  T  T TV ++G  F+ 
Sbjct  286   IYIKEGVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVA  345

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              N+G EN+AGP  HQAVALRVQ+D++IF+NC +D YQDTL
Sbjct  346   INMGFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTL  385



>ref|XP_004487827.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=624

 Score =   276 bits (707),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/341 (43%), Positives = 215/341 (63%), Gaps = 9/341 (3%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNST-DTKELVEVAFNVTMKEISKVMKKS  425
             N  I S+ + VE +C+ T ++E C K L  A+N T D KEL++ AFN T +E+ K +  +
Sbjct  53    NGQISSTQRNVEIICESTQYQETCHKSLDKASNETSDMKELIKAAFNATAEELIKQIHNT  112

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
                   AKD  T +A  IC E+L  ++D I R++D M  +      L  Y  D+KVWL+G
Sbjct  113   TLYDELAKDNMTKQAMNICNEVLDYAVDGIHRSIDTMDKYDFN--KLSEYAYDLKVWLTG  170

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIH----DALVSLDIAGL  773
              L+ + TCL+GF  T   + + M K L T+ +L+ N+L++++ +     DA  +     L
Sbjct  171   TLSHQQTCLDGFENTTTKAGEIMAKALNTSLELSSNSLDIINAVSSLLKDAGENNVNVNL  230

Query  774   NRKLLADSRSLPVWATAAQRR-LLEAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSF  950
             NRKLL++    P W +  QR  L+E    P+ VVA+DGSG++KT++EA+  +P  + + F
Sbjct  231   NRKLLSND-GFPSWVSEGQRHILMEGNFKPNAVVAQDGSGQFKTLSEALLTVPSYNAEPF  289

Query  951   VIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFM  1130
             VI++KAG+Y ENV + K+M +V  +GDGPTKT  + S +YV G QT  T T  V G+ FM
Sbjct  290   VIYVKAGIYNENVNVLKEMTHVTIIGDGPTKTRFTASLNYVDGVQTYNTATFGVNGANFM  349

Query  1131  GKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              K++G ENTAG E HQAVALRV +DQA+F+NCQ+D +QDTL
Sbjct  350   AKDVGFENTAGAEKHQAVALRVTADQAVFYNCQMDGFQDTL  390



>ref|XP_006299740.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
 gb|EOA32638.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
Length=568

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/349 (42%), Positives = 224/349 (64%), Gaps = 21/349 (6%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKT  431
             I  +TKAV+ VC PT  +E CV  L SA+  S +  +L+++ F+VT+K I++ +KK S  
Sbjct  44    IKKTTKAVQAVCAPTDFKETCVNSLMSASPKSAEPLDLIKLGFDVTIKSINEGLKKASGD  103

Query  432   LQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
             ++A A KDP    AF++C++L+ D+I+D+K+ +D    H  +   +++++ D++VWLSG+
Sbjct  104   IKAKAGKDPDAKGAFELCEKLMVDAIEDLKKCMD----HGFSVDRVEVFVEDLRVWLSGS  159

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN----  776
             + F+ TC++ F   + +    M+ +  T+++L+ N+L MV  +     S +  GL     
Sbjct  160   IAFQQTCMDSFEEIKSNLMQDMQNIFQTSKELSSNSLAMVSSMSTLFPSSNDTGLTGTLT  219

Query  777   ---RKLLADSRSLPVWATAAQRRLLEA------PVTPDVVVAKDGSGKYKTINEAIPDIP  929
                RKLL+    +P W     RRLL A      PV  + VVA+DGSG++KTI +A+  +P
Sbjct  220   NYARKLLSAEDGIPTWVRPEARRLLAAQGGGPGPVKANAVVAQDGSGQFKTIADALNAVP  279

Query  930   LKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGTV  1106
               +   FVIHIK G+YKE V++T+KM  V F+GDGP KT+I+GS ++ +G  +T  TG++
Sbjct  280   KGNTVPFVIHIKQGIYKEKVIVTRKMPYVTFIGDGPNKTVITGSLNFGIGKVKTFLTGSI  339

Query  1107  IVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              ++G  F  KNIGIENTAGPE  QAVALRV +D A F +CQID +QDTL
Sbjct  340   TIEGDHFTAKNIGIENTAGPEGGQAVALRVSADYAAFQSCQIDGHQDTL  388



>ref|XP_004515520.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
 ref|XP_004515521.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/339 (43%), Positives = 215/339 (63%), Gaps = 8/339 (2%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA---ATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             ++ S+ KAV+ +C PT +++ C + L A   A N TD KEL+++AFNVTMK I   +K++
Sbjct  51    HVASTMKAVQTICHPTDYKKECEETLIAEAEADNVTDPKELIKIAFNVTMKRIGDKIKET  110

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
               L    KDPR+ +A   C++L+  SID+  R+LD + +      N+D  + ++KVWL+G
Sbjct  111   DLLHEVEKDPRSKDALDTCKQLMDLSIDEFTRSLDGINEFDLQ--NIDKILMNLKVWLNG  168

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG-LNRK  782
             A+T+ +TCL+GF  T  ++  KMK+LL ++  ++ N L ++ +  D +   +    L R 
Sbjct  169   AVTYMDTCLDGFENTTSEAGTKMKELLTSSIHMSSNALAIISDFADTVSDWNATNILRRH  228

Query  783   LLADSRSLPVWATAAQRRLLEAPVT--PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             LL DS +        Q   ++      P+V VA DGSG +K+INEA+  +P KS K FVI
Sbjct  229   LLHDSETPSSVDHHKQHNAMKNVFKHKPNVTVALDGSGDFKSINEALTRVPEKSKKPFVI  288

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGK  1136
             +IK GVY E V +TK M +VVFVGDG  KTII+G+++++ G  T  T +V ++G  F+  
Sbjct  289   YIKEGVYPEYVEVTKHMTHVVFVGDGGKKTIITGNKNFIDGVNTYRTASVAIQGDHFVAI  348

Query  1137  NIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             N+G EN+AGP  HQAVALRVQ D+ IF NC +D YQDTL
Sbjct  349   NMGFENSAGPHKHQAVALRVQGDKTIFFNCSMDGYQDTL  387



>ref|XP_004495691.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/342 (41%), Positives = 218/342 (64%), Gaps = 14/342 (4%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA---ATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             +I S+ KAV+ +C PT +++ C + L A   A N TD KEL+++AFNVTM+ IS+ +K++
Sbjct  51    HIASTMKAVQTICHPTEYKKECEETLVAEAQADNVTDPKELIKIAFNVTMRRISEKIKET  110

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
               +    KDPR+ +A   C++L+  SI +  R+LD          ++D  + ++KVWL+G
Sbjct  111   DLMHEVEKDPRSKDALDTCKQLMDLSIGEFTRSLDGFSQFDLQ--DMDKILMNLKVWLNG  168

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG-LNRK  782
             A+T+ +TC++GF  T  ++  KMK+LL ++  +  N L ++ +  D L   +      R+
Sbjct  169   AVTYMDTCVDGFDNTTTEAGAKMKELLTSSMHMGSNALAIISDFADTLADWNATKVFGRR  228

Query  783   LLADSRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPLKSNKS  947
             LL DS + P W     R+L++         P+V VA DG+G +KTINEA+  +P K+ K 
Sbjct  229   LLHDSET-PSWVD--HRQLIDTKTNTFRHKPNVTVALDGTGDFKTINEALAKVPEKTKKP  285

Query  948   FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGF  1127
             F+I+IK GVY E V +TK+M +VVFVGDG  K++I+G+++++ G  T  T +V ++G  F
Sbjct  286   FIIYIKEGVYSEYVEVTKRMTHVVFVGDGGKKSVITGNKNFIDGVNTYRTASVAIQGDHF  345

Query  1128  MGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
                N+G EN+AGP  HQAVALRVQ D++IF NC +D YQDTL
Sbjct  346   TAINMGFENSAGPHKHQAVALRVQGDKSIFFNCSMDGYQDTL  387



>gb|AEL79481.1| pectin methylesterase-like protein [Capsicum annuum]
Length=553

 Score =   274 bits (701),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/344 (43%), Positives = 221/344 (64%), Gaps = 21/344 (6%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             +K + +STK+V+ +C+PT +++ C K LS A N +D K+ ++VAF  T+ E+  ++K  +
Sbjct  35    SKGLATSTKSVQSMCQPTPYKQTCEKTLSIAKNVSDPKDYIKVAFEATVTELKNIIKSIE  94

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYM-----NDIKV  593
              ++ AA DP T +A   C++L   + +D++ ++ ++        N D+ M     +D+K 
Sbjct  95    PIKKAASDPYTKDALLACEQLFDLAAEDLRTSITKI-------QNFDISMIKDVVDDLKT  147

Query  594   WLSGALTFENTCLEGFLGTE-GDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG  770
             WLS  L +E+TCL+GF   E  ++ +KM KL+ T Q+LT N L MVD     +      G
Sbjct  148   WLSAVLAYEDTCLDGFTKKEYSETREKMAKLMNTTQELTLNVLYMVDSFGQMITQ--TTG  205

Query  771   LNRKLLADSRSLPVWATAAQRRLLE-APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKS  947
             L RKLL++S S+     A+ R+LL+ +   P+ VV+ DGSG+YKTI +AI  +P K+ K 
Sbjct  206   LTRKLLSNSDSI---IEASNRKLLQISSAQPNAVVSADGSGQYKTIKDAINAVPKKNTKP  262

Query  948   FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYV--GGYQTSETGTVIVKGS  1121
             FVI IK G+YKEN+ + K  +NVV +G+GPTKTII+G  +    GG  T  T T+ V G 
Sbjct  263   FVILIKEGIYKENIEIEKDKLNVVLIGEGPTKTIITGDNAVKNGGGMTTWHTSTLGVSGF  322

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             GF+ K+IGI+NTAGPE  QAVALRV +D+A  +NC+ID YQDTL
Sbjct  323   GFVMKDIGIQNTAGPEKEQAVALRVNADKAAVYNCKIDGYQDTL  366



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 157/365 (43%), Positives = 220/365 (60%), Gaps = 43/365 (12%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  443
             +S KA   +C    ++  C K LS A NS+D +EL++VAFN  + +I + +K S   + A
Sbjct  33    NSNKAAHALCTSVDYKITCEKSLSGA-NSSDPQELIKVAFNHAITDIQEAIKNSTLYKQA  91

Query  444   AKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLSGA  608
             A D RT  A ++C+E+L  SIDD++R+ DR+        NLD+     Y+ D+KVWLSGA
Sbjct  92    ALDHRTKGALEVCEEVLDTSIDDLRRSFDRV-------GNLDITKLKQYIEDVKVWLSGA  144

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL-NRKL  785
             +T   TCL+ F  T GD+ +KMK LL ++  +  N L MV +I     SL + G  +R+L
Sbjct  145   ITNHETCLDAFQNTTGDTGEKMKNLLHSSGMMLSNGLAMVGDISSIFSSLSLGGFTSRRL  204

Query  786   LADSRSL--------------------------PVWATAAQRRLLEAPVT---PDVVVAK  878
             L +  SL                          P +  A  RR++ A V     ++VVA+
Sbjct  205   LEEEGSLAYGVDQTDGEDPKTAFDGKVTDAAGPPSFVDAEARRIMTANVNTLKANIVVAQ  264

Query  879   DGSGKYKTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISG  1058
             DGSG++KTI  AI  +P K +  FVIH+KAG YKENV+  KK+ NVV +GDGP KT ISG
Sbjct  265   DGSGQFKTITGAINSLPKKGDGPFVIHVKAGFYKENVIFPKKVNNVVLIGDGPLKTRISG  324

Query  1059  SRSYVGGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDA  1238
             S++YV G QT  T  + V G GF+ K+IGIENTAGP  HQAVA+RV  D++IF+N  +++
Sbjct  325   SKNYVDGVQTFHTAVLGVNGDGFIAKDIGIENTAGPIKHQAVAVRVSGDKSIFYNVHMNS  384

Query  1239  YQDTL  1253
             +QDTL
Sbjct  385   FQDTL  389



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/346 (42%), Positives = 218/346 (63%), Gaps = 16/346 (5%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKK-LSAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             NI  ++KAVE VC PT  +E CV   + A+ NST+  +L++++FN+T++ I   +KKS  
Sbjct  47    NIKMTSKAVEAVCAPTDFKETCVNSFMKASPNSTEPLDLIKLSFNITIQAIKDGVKKSSV  106

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGAN-LDLYMNDIKVWLSGA  608
                A  D  T  + ++C+ L+ D+IDD+ +  D   + AG   + ++ ++ D++VWLSG+
Sbjct  107   ELKAKADHETKGSLELCETLMNDAIDDLTKCFD---NFAGFSVDQIEKFVYDLRVWLSGS  163

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDAL-------VSLDIA  767
             ++++ TC++ F   +   A  MK +   +++LT N+L M+  +            + D+ 
Sbjct  164   ISYQQTCMDAFEEVKSILAQDMKDIFKPSKELTSNSLAMITSMSSMFGKSNITEATGDLG  223

Query  768   GLNRKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKS  938
                RKLL      P W     RRL+ AP   V P+VVVAKDGSG+YK+INEA+  +P+ +
Sbjct  224   NNARKLLNAEDGFPSWVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAVPINN  283

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGTVIVK  1115
                FVI+IK GVYKE VV+TK+M +V F+GDGPTKT I+GS ++ +G  +T  T ++ V+
Sbjct  284   KVPFVIYIKQGVYKEKVVVTKQMYHVTFIGDGPTKTKITGSVNFAIGKVRTYLTSSLTVE  343

Query  1116  GSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  F+ KN+GIENTAGP   QAVALRV +D  +  NCQID YQDTL
Sbjct  344   GDNFVAKNMGIENTAGPPGGQAVALRVSADCVVIFNCQIDGYQDTL  389



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score =   274 bits (700),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 145/346 (42%), Positives = 217/346 (63%), Gaps = 16/346 (5%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKK-LSAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             NI  + KAVE VC PT  +E CV   + A+ NST+  +L++++FN+T++ I   +KKS  
Sbjct  47    NIKMTNKAVEAVCAPTDFKETCVNSFMKASPNSTEPLDLIKLSFNITIQAIKDGVKKSSV  106

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGAN-LDLYMNDIKVWLSGA  608
                A  D  T  + ++C+ L+ D+IDD+ +  D   + AG   + ++ ++ D++VWLSG+
Sbjct  107   ELKAKADHETKGSLELCETLMNDAIDDLTKCFD---NFAGFSVDQIEKFVYDLRVWLSGS  163

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDAL-------VSLDIA  767
             ++++ TC++ F   +   A  MK +   +++LT N+L M+  +            + D+ 
Sbjct  164   ISYQQTCMDAFEEVKSILAQDMKDIFKPSKELTSNSLAMITSMSSMFGKSNITEATGDLG  223

Query  768   GLNRKLLADSRSLPVWATAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKS  938
                RKLL      P W     RRL+ AP   V P+VVVAKDGSG+YK+INEA+  +P+ +
Sbjct  224   NNARKLLNAEDGFPSWVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAVPINN  283

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGTVIVK  1115
                FVI+IK GVYKE VV+TK+M +V F+GDGPTKT I+GS ++ +G  +T  T ++ V+
Sbjct  284   KVPFVIYIKQGVYKEKVVVTKQMYHVTFIGDGPTKTKITGSVNFAIGKVRTYLTSSLTVE  343

Query  1116  GSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  F+ KN+GIENTAGP   QAVALRV +D  +  NCQID YQDTL
Sbjct  344   GDNFVAKNMGIENTAGPPGGQAVALRVSADCVVIFNCQIDGYQDTL  389



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score =   273 bits (698),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 149/346 (43%), Positives = 221/346 (64%), Gaps = 15/346 (4%)
 Frame = +3

Query  249   NKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  422
             N+N I  +TKAV+ VC PT ++E C+K L  A+  ST+   L++++FNVT+K I + +KK
Sbjct  38    NENEIRQNTKAVKTVCAPTDYKETCLKSLMDASPKSTEPLALIKLSFNVTIKSIQEGLKK  97

Query  423   SK--TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVW  596
             +       A K P   +AF++C++++ D+I D+K+     VDH  +   ++ ++ D++VW
Sbjct  98    ASEDVKHKADKHPEAKDAFELCEKVMNDAIADLKKC----VDHKVSVDEIERFIKDLRVW  153

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             +SG++ F+ TC++ F   +      M  +   ++QL+ N+L MV +++     L  A  N
Sbjct  154   ISGSIAFQQTCIDTFEEIKSTLKHDMINIFKRSRQLSSNSLAMVTDLNSNATELTGAFEN  213

Query  777   --RKLLADSRSLPVWATAAQRRLLEAPVTPDV----VVAKDGSGKYKTINEAIPDIPLKS  938
               RKLL+    +P W     RRL+ AP  P V    VVA+DGSG++KTIN+A+  +P ++
Sbjct  214   NARKLLSTEDGVPTWVGPEARRLMGAPGGPPVKANAVVAQDGSGQFKTINDALNAVPKEN  273

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGTVIVK  1115
                FVIHIK GVYKE VV+T+KM  V F+GDGPTKT+ISGS ++ +G  +T  T  + V+
Sbjct  274   KVPFVIHIKEGVYKEKVVVTRKMPYVTFIGDGPTKTVISGSLNFGIGKVKTYLTAPLTVE  333

Query  1116  GSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  F  K IG+ENTAGPE  QAVALRV  D A+F +CQID YQDTL
Sbjct  334   GEHFTAKGIGMENTAGPEGGQAVALRVSGDYAVFFDCQIDGYQDTL  379



>ref|XP_010495536.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=627

 Score =   275 bits (703),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 149/325 (46%), Positives = 204/325 (63%), Gaps = 29/325 (9%)
 Frame = +3

Query  345   NSTDTKELVEVAFNVTMKEISKVMKKS---------------KTLQAAAKDPRTSEAFKI  479
             N++D  ELV+ AFN TMK+I+ V KKS               K L+   KDPRT  A   
Sbjct  4     NTSDPLELVKTAFNATMKQITGVAKKSQXSPPNLIKQKLTLLKRLRKXQKDPRTKMALDQ  63

Query  480   CQELLQDSIDDIKRA---LDRMVDHAGAGANLDLYMNDIKVWLSGALTFENTCLEGFLGT  650
             C+EL+  +I ++ ++   L R   H      +D  +  ++VWLS  ++ E TCL+GF GT
Sbjct  64    CKELMDYAIGELSKSFEELGRFEFH-----KVDEALVKLRVWLSATISHEETCLDGFQGT  118

Query  651   EGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-RKLLADSRSLPVWATAA  827
             +GD+ + +KK L TA QLT N L MV E+ + L  + I  +N R+LL  S+  P W    
Sbjct  119   QGDAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMNSRRLL--SQEFPSWMDGR  176

Query  828   QRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLT  998
              RRLL +P   V  D+VVA+DGSG+YKTINEA+  +P K N +FV+HIK G+YKE V + 
Sbjct  177   TRRLLNSPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIKGGIYKEYVQVN  236

Query  999   KKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQ  1178
             + M ++VF+GDGP KT+ISG ++Y  G  T  T TV + G  F+ KN+G ENTAG   HQ
Sbjct  237   RSMTHLVFIGDGPDKTVISGDKNYKDGITTYRTATVAIVGDHFIAKNMGFENTAGAIKHQ  296

Query  1179  AVALRVQSDQAIFHNCQIDAYQDTL  1253
             AVA+RV SD++IF+NC+ D YQDTL
Sbjct  297   AVAIRVLSDESIFYNCRFDGYQDTL  321



>ref|XP_004508195.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=576

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/346 (41%), Positives = 220/346 (64%), Gaps = 16/346 (5%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G+  + +S K V+ +C    +++ C K L+  ++ +TD K LV  AFN T +E+   +  
Sbjct  48    GDNQLATSQKNVKVICDSAEYKQTCEKSLANVSSETTDMKTLVIAAFNATAEELLSKIHN  107

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRA---LDRMVDHAGAGANLDLYMNDIKV  593
             S      A D  T +A  IC+E+L  ++DDI ++   LDR        + +D Y  DIK+
Sbjct  108   STLYNELATDNMTKQAMDICKEVLGYAVDDIHQSIHTLDRF-----ELSKIDEYAYDIKI  162

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             W++G L+ + TCL+GF  T  ++   M K+L  + +L+ N +++V+ +   +  L+++ L
Sbjct  163   WIAGTLSHQRTCLDGFENTTTEAGQTMAKVLNASLELSNNAMDIVNGVAGFVKGLNLSSL  222

Query  774   ----NRKLLADSRSLPVWATAAQRRLLEAP--VTPDVVVAKDGSGKYKTINEAIPDIPLK  935
                 +RKLL++   +P W   +QRRLLEAP  VTP+V+VA+DGSG++KT+NEA+  +P K
Sbjct  223   TSAMSRKLLSED-GIPSWVGQSQRRLLEAPHDVTPNVIVAQDGSGQFKTLNEALELVPKK  281

Query  936   SNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVK  1115
             +   FVI++KAGVY E V L K   +V  +GDGPTKTI +G+++YV G QT  T T  + 
Sbjct  282   NKIPFVIYVKAGVYNEYVALDKHKSHVHIIGDGPTKTIFTGNKNYVDGVQTYNTATFSIN  341

Query  1116  GSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              + FM  N+G EN+AG E HQAVALRV +D+A+F+NCQ+D +QDTL
Sbjct  342   AADFMAINVGFENSAGAEKHQAVALRVTADKAVFYNCQMDGFQDTL  387



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/335 (43%), Positives = 211/335 (63%), Gaps = 15/335 (4%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  443
             +S KAV+ VC PT +RE C + L+ A N++D KEL+   F V +  I + +KKS  L+ A
Sbjct  32    TSNKAVQAVCSPTSYRETCEQTLAKA-NTSDPKELIRYGFGVAVDGIGEALKKSALLKQA  90

Query  444   AKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFEN  623
             A D  T +AF +C+++L  ++ D+++++DR+ +       L+ Y+ D++ WLSG +T + 
Sbjct  91    AADQSTKDAFYVCEDVLDLAVYDLQKSIDRIGEFNPQ--KLNDYVEDLRTWLSGVVTTQT  148

Query  624   TCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN-----RKLL  788
             TC++ F  T GD+ +KMKKLL T  +LT N L+MV ++   L  L I   N     R+LL
Sbjct  149   TCIDAFENTTGDTGEKMKKLLKTVGELTSNGLDMVTDLTSILSQLQIGIGNVSAGRRRLL  208

Query  789   ADSRSLPVWATAAQRRLLEAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKA  968
             +D      WA   + R+L   +  + VVA DGSG+YK+IN AI   P K+ + FVIH+KA
Sbjct  209   SD------WAEP-KMRMLAGGIRANAVVALDGSGQYKSINAAINAAPSKNARPFVIHVKA  261

Query  969   GVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGI  1148
             G+Y+E V + K   N+V +GDG T+T I+G ++  GG +T  T T  V    F  K+IGI
Sbjct  262   GLYREYVEVPKHKTNIVILGDGATRTRITGRKNLAGGVKTFATATFAVNADDFTAKDIGI  321

Query  1149  ENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             ENTAGPE HQAVALRV  D+A+ +N  ID +QDTL
Sbjct  322   ENTAGPEGHQAVALRVTGDRAVLYNLNIDGFQDTL  356



>ref|XP_010486213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=564

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/345 (41%), Positives = 225/345 (65%), Gaps = 17/345 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKT  431
             I  +TKAV+ VC+PT  +E CV  L SA+  ST+  +L+++ F+VT+K I++ +KK S+ 
Sbjct  44    IKKTTKAVQAVCEPTDFKETCVNSLMSASPKSTEPIDLIKLGFDVTIKSINEGLKKASED  103

Query  432   LQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
             ++A A+KDP    AF++C++++ D+I+D+K+ +D    H  +   +D ++ D++VWLSG+
Sbjct  104   VKAKASKDPEAKGAFELCEKVMVDAIEDLKKCMD----HGFSVDKIDAFVEDLRVWLSGS  159

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG------  770
             + F+ TC++ F   + D   +M+ +  T ++L+ N+L MV  +   L + +  G      
Sbjct  160   IAFQQTCMDSFEEIKSDLMQEMRHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFA  219

Query  771   -LNRKLLADSRSLPVWATAAQRRLLEAP--VTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
                RKLL     +P W     RRL+ AP  V  + VVA+DGSG++KTI +A+  +P  + 
Sbjct  220   NYARKLLTTEDGIPTWVGREARRLMAAPGPVKANAVVAQDGSGQFKTIADALNAVPKGNT  279

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGTVIVKG  1118
               FVIHIK G+YKE +++T+KM  V F+GDG TKT+I+G+ +Y +G  +T  T  + ++G
Sbjct  280   VPFVIHIKQGIYKEKIMVTRKMPYVTFIGDGQTKTVITGNLNYGIGKVKTFLTAPLTIEG  339

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               F  KNIG+ENTAGPE  QAVALRV +D A+FH+CQ D +QDTL
Sbjct  340   DHFTMKNIGVENTAGPEGGQAVALRVSADYAVFHSCQFDGHQDTL  384



>ref|XP_002461260.1| hypothetical protein SORBIDRAFT_02g043780 [Sorghum bicolor]
 gb|EER97781.1| hypothetical protein SORBIDRAFT_02g043780 [Sorghum bicolor]
Length=571

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 151/349 (43%), Positives = 221/349 (63%), Gaps = 18/349 (5%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G++N+  S K+V+  C+PT +++ C  +LS AA N++   +L +V F VT  +I K + +
Sbjct  36    GDENMSMSVKSVKAFCQPTDYKQTCEAELSKAAGNASTPSDLAKVIFGVTSDKIHKAISE  95

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S+TL+    D RTS A K C ELL+ +IDD+K + D++        N    ++D+K WLS
Sbjct  96    SETLKELKNDQRTSGALKDCNELLEYAIDDLKSSFDKL--GGFEMTNFKKAVDDLKTWLS  153

Query  603   GALTFENTCLEGFL-GTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNR  779
              ALT+++TCL+GF+  T  +++ KMKK L  +Q+LT + L +VD+  D L  L +    R
Sbjct  154   AALTYQDTCLDGFMNATSTEASGKMKKALNASQELTEDILAVVDQFSDTLGGLSVG---R  210

Query  780   KLLADSRS-LPVW---ATAAQRRLLE------AP-VTPDVVVAKDGSGKYKTINEAIPDI  926
             +LL D+ +  P W   A A ++RLL       +P   P+V VA DGSG  KTI EA+  +
Sbjct  211   RLLDDAATPTPSWVSEADAGRQRLLADSAGAGSPDFKPNVTVAADGSGDVKTIKEALAKV  270

Query  927   PLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTV  1106
             P K+   +V+H+KAG YKE V + +   NV F+GDG  KTII+GS+++     T +T T+
Sbjct  271   PPKNKDLYVVHVKAGTYKEYVSVARPQTNVAFIGDGAEKTIITGSKNFKMNLTTKDTATM  330

Query  1107  IVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
                G+GF  ++I +ENTAG ENHQAVALRVQSDQA+F+ C  D YQDTL
Sbjct  331   EAIGNGFFMRDIRVENTAGAENHQAVALRVQSDQAVFYQCTFDGYQDTL  379



>ref|XP_003626199.1| Pectinesterase [Medicago truncatula]
 gb|AES82417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=593

 Score =   273 bits (698),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 223/353 (63%), Gaps = 23/353 (7%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++  S KAV+ +C PT +++ C   L A A N T+ KEL+++AFN+T+ +IS+ +KK+  
Sbjct  51    HVSQSVKAVKTLCAPTDYKKECEDSLIAHAGNITEPKELIKIAFNITIAKISEGLKKTHL  110

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             LQ A KD RT +A   C++++Q SID+ +R+L+R  +      +LD  +  +KVWLSGA+
Sbjct  111   LQEAEKDERTKQALDTCKQVMQLSIDEFQRSLERFSNFDLN--SLDRVLTSLKVWLSGAI  168

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA  791
             T++ TCL+ F  T  D+  KMK++L T+  ++ N L +++++      +      R+LL 
Sbjct  169   TYQETCLDAFENTTTDAGKKMKEVLQTSMHMSSNGLSIINQLSKTFEEMKQPA-GRRLLK  227

Query  792   DS-------------RSLPVWA--TAAQRRLLEA----PVTPDVVVAKDGSGKYKTINEA  914
             +S               LP W    A  R+LL       +   VVVAKDGSG + TI EA
Sbjct  228   ESVDGEEDVLGHGGDFELPEWVDDRAGVRKLLNKMTGRKLQAHVVVAKDGSGNFTTITEA  287

Query  915   IPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSE  1094
             +  +P K+ K FVI+IK GVYKE V +TK M +VVF+GDG  KT I+G+++++ G  T +
Sbjct  288   LKHVPKKNLKPFVIYIKEGVYKEYVEVTKTMTHVVFIGDGGRKTRITGNKNFIDGVGTFK  347

Query  1095  TGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             T +V + G  F+G  IG EN+AGPE HQAVALRVQSD++IF+ C++D YQDTL
Sbjct  348   TASVAITGDFFVGIGIGFENSAGPEKHQAVALRVQSDRSIFYKCRMDGYQDTL  400



>gb|EPS70728.1| pectinesterase, partial [Genlisea aurea]
Length=560

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/336 (42%), Positives = 213/336 (63%), Gaps = 11/336 (3%)
 Frame = +3

Query  270   TKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAAK  449
             TKAV+ +C PT +++ C + L+ A N+TD KEL+++AF+ T+K++   +  S   + AA 
Sbjct  48    TKAVQAICSPTDYKQTCEESLAGA-NTTDPKELIKLAFDNTVKKVRAAILNSTLYKDAAA  106

Query  450   DPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENTC  629
             DPRT  A K+C+E+L + IDD++R+ D++ D       +D Y++DIK WLSGA+  +  C
Sbjct  107   DPRTKGALKVCEEVLDNCIDDLQRSFDQVNDFNVN--QMDEYIDDIKTWLSGAIANKEAC  164

Query  630   LEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL-NRKLLA-DSRS  803
             ++    T GD+A+KMKK+L    ++  N L +V +      SL +    +R+L+  D + 
Sbjct  165   IDAVQNTTGDTAEKMKKVLNATSEMLSNGLAIVTDFSTIFSSLQLGSFTSRRLMGEDEQQ  224

Query  804   LP---VWATAAQRRLLEAPVT---PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIK  965
              P    +   A+R+LL   +    P+  VA+DGSG +KTI  A+  +P KSN +FVIH+K
Sbjct  225   QPGIDSFVEFARRKLLAVNINSMKPNATVAQDGSGDFKTIGAALSTLPKKSNATFVIHVK  284

Query  966   AGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIG  1145
             AGVYKE V++ KK+ NVV  GDGP KT +  +++Y  G +T  T T+ V   GFM K+I 
Sbjct  285   AGVYKETVIIPKKVNNVVIYGDGPNKTRVVNNKNYADGVETFHTATLAVNSDGFMAKDIA  344

Query  1146  IENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              EN+AG   HQAVA+RV  D+AIF+N  +D YQDTL
Sbjct  345   FENSAGASKHQAVAVRVSGDKAIFYNVVMDGYQDTL  380



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   273 bits (698),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/351 (42%), Positives = 216/351 (62%), Gaps = 22/351 (6%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             +STKA++ +C+PT +++ C+  L SAA N+TD  +L+++ F   MK+I +  KKS  LQ 
Sbjct  59    ASTKAIKAICQPTDYKQECLSSLTSAAGNTTDPIQLIKIGFQAAMKQIYEATKKSNLLQK  118

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFE  620
               KD RTS A   C+EL++ ++D++ ++ +R+ D          ++ D+KVWLS ++T++
Sbjct  119   LEKDHRTSMALDTCKELMELAVDELNQSFNRLGDTENF-YKYKTFIMDLKVWLSASITYQ  177

Query  621   NTCLEGFLGT--EGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLD--IAGLNRKLL  788
              +CL+ F  T    D+ ++MK LL T+ +L+ N L MV +I  AL  L+       R+LL
Sbjct  178   ESCLDAFENTTSSNDAGEEMKTLLKTSMRLSSNGLAMVAQIFSALTDLNNPDPSHRRRLL  237

Query  789   A---------DSRSLPVWATAAQRRLLE---APVT----PDVVVAKDGSGKYKTINEAIP  920
             +             LP W  A  R+LL    AP      PD VV+KDGSG YKTI EA+ 
Sbjct  238   SFDGLPILGHGDLELPEWYEAGVRKLLTISTAPAPKAHKPDAVVSKDGSGSYKTICEALE  297

Query  921   DIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETG  1100
              +P   N++FVI+IK GVY E+V + + M NV+ +GDG  KT I+G+ ++V G  T  T 
Sbjct  298   HVPKYGNETFVIYIKEGVYNESVRVNRSMTNVMMIGDGANKTRITGNHNFVDGTPTYRTA  357

Query  1101  TVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              V + G  FM  +IG EN+AGPE HQAVALRV +D+AIF+ C +D YQDTL
Sbjct  358   AVAIHGDHFMAMDIGFENSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTL  408



>ref|XP_007148795.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
 gb|ESW20789.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
Length=582

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 142/340 (42%), Positives = 220/340 (65%), Gaps = 12/340 (4%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++ S+ KAV+ +C PT + + C + L A A N+TD +ELV++AFN+T+ +I   +K++  
Sbjct  52    HVASTVKAVQSLCHPTNYEKECEESLIAGAGNTTDPRELVKIAFNITITKIGDKLKETNL  111

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L    K+PR   A   C++L+  SI ++ R++D + +      N++  + +IKVWLSGA+
Sbjct  112   LHDVEKEPRAKMALDTCKQLMDLSIGELSRSIDGISEFELI--NIEKILMNIKVWLSGAI  169

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL-NRKLL  788
             T+++TCL+GF  T  ++  KMK  L+T+  ++ N L +V E+ D + +L++  L  R+LL
Sbjct  170   TYQDTCLDGFDNTTSEAGQKMKDSLMTSMHMSSNALALVTELGDTITNLNVTQLLGRRLL  229

Query  789   ADSRSLPVWA-----TAAQRRLLEAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
              DS S P W        A   L    +  +V VA+DG+G +K+INEA+  +P K+ K FV
Sbjct  230   QDSES-PSWVDHQGLPNANTSLFNHKL--NVTVAQDGNGDFKSINEALKQVPEKNKKPFV  286

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             I+IK G Y+E V +TK M +VVF+GDG  KT I G+++++ G  T  T TV ++G  F+ 
Sbjct  287   IYIKEGTYQEYVEVTKDMTHVVFIGDGGKKTRIIGNKNFIDGINTYRTATVAIQGDYFVA  346

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              N+G EN AGP  HQAVALRVQ+D++IF+NC +D YQDTL
Sbjct  347   INMGFENFAGPHKHQAVALRVQADKSIFYNCSMDGYQDTL  386



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   273 bits (697),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/346 (40%), Positives = 214/346 (62%), Gaps = 17/346 (5%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLSAAT--NSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             +S KA++ +C+PT +++ C+  LS A+   +TD  EL+E  F V MK ++   KKS  L+
Sbjct  59    ASMKAIKTICQPTDYKQECLDSLSYASGNTTTDPIELIEYGFKVAMKYVTDAAKKSDFLR  118

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTF  617
                KDPRTS A   C+EL+  ++ +++++L R+  +       +  + D+KVWLS  +T+
Sbjct  119   KLEKDPRTSNALDACEELMDLALSELRQSLVRL-GYIDDFTKFNEMLVDLKVWLSATITY  177

Query  618   ENTCLEGFLGTEG--DSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA  791
             + +CL+ F  T    D+A++MK +L T+  L+ N L MV ++  A   L+    + + L 
Sbjct  178   QESCLDAFENTTSSTDAAEEMKSVLNTSMHLSSNALAMVSQVFSAFTDLNNPDSSHRRLL  237

Query  792   DSRSLPV----------WATAAQRRLLEAPVT--PDVVVAKDGSGKYKTINEAIPDIPLK  935
                + PV          W     R+L  AP    PD++VAKDGSG YKTI EA+  +P  
Sbjct  238   QFDAFPVIGHSEFEDPKWYEGGVRKLSSAPKINKPDIIVAKDGSGSYKTITEALDHVPKY  297

Query  936   SNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVK  1115
              N++F+I+IK GVY E++++T+ M +V+ +GDG  KT I+G++++  G  T  T TV ++
Sbjct  298   GNETFIIYIKEGVYNEHILVTRSMTSVMMIGDGANKTRITGNKNFADGTPTYHTATVAIQ  357

Query  1116  GSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  FM ++IG EN+AGPE HQAVALRV +D+AIF+ C +D YQDTL
Sbjct  358   GDHFMARDIGFENSAGPEKHQAVALRVSADEAIFYRCSMDGYQDTL  403



>gb|EAZ05229.1| hypothetical protein OsI_27427 [Oryza sativa Indica Group]
Length=570

 Score =   271 bits (694),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 147/343 (43%), Positives = 218/343 (64%), Gaps = 16/343 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL--SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             + +S K+V+  C+PT +++ C ++L  +A   ++   +L +  F VT ++ISK + +S T
Sbjct  38    LSTSVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVTSEKISKAISESST  97

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L+    D RTS A + C+ELL+ ++DD+K + +++        N    ++D++ WLS AL
Sbjct  98    LEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFEMT--NFHKAVDDLRTWLSAAL  155

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA  791
             T++ TCL+GFL T  D+ADKMK  L ++Q+LT + L +VD+    L SL+I    R+LLA
Sbjct  156   TYQGTCLDGFLNTTTDAADKMKSALNSSQELTEDILAVVDQFSATLGSLNIG--RRRLLA  213

Query  792   DSRSLPVWATAAQRR-LLEA------PVT--PDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
             D   +PVW +   RR LLEA      PV   PDV VA DGSG  KTI EA+  +P K+ +
Sbjct  214   DD-GMPVWMSEGGRRQLLEAAGPEAGPVEFKPDVTVAADGSGDVKTIGEAVAKVPPKNKE  272

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
              + I++KAG YKE V + +   NV  +GDG  KTII+G++++     T +T T+   G+G
Sbjct  273   RYTIYVKAGTYKEYVSVGRPATNVNMIGDGIGKTIITGNKNFKMNLTTKDTATMEAIGNG  332

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F  + I +ENTAGPENHQAVALR QSD A+F+ C+ D YQDTL
Sbjct  333   FFMRGITVENTAGPENHQAVALRAQSDMAVFYQCEFDGYQDTL  375



>ref|XP_004495690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=595

 Score =   272 bits (695),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 144/360 (40%), Positives = 225/360 (63%), Gaps = 30/360 (8%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             I S+ K+V+  C+PT +++ C + L   A N+T+ +EL+++AFNVT+K+I   +KK+  L
Sbjct  51    IASTIKSVKSFCQPTDYKKECEENLIEIAGNTTEPRELIKLAFNVTIKKIGDGIKKTNLL  110

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
                 K+PR   A   C++L+  SI + +R+L+ +        NL+  +  +KVWLSGA+T
Sbjct  111   HEVEKEPRAKLALDTCKQLMDLSIGEFERSLEGI--KTFDLNNLENILVSLKVWLSGAIT  168

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLL--  788
             ++ TCL+GF  T  D++ KM+ +L T+  ++ N L ++ ++  +++ L++    R+L+  
Sbjct  169   YQETCLDGFQNTTSDASKKMQNILTTSMHMSSNALAIISDLAKSVLDLNLTNNERRLIDN  228

Query  789   ------------------ADSRSLPVWA----TAAQRRLLEA---PVTPDVVVAKDGSGK  893
                                D   +P WA    +   RRLL A    +  +V+VAKDGSGK
Sbjct  229   NNNNNNNNNNDVGEQVFGHDDVEVPSWAGDGSSVGVRRLLHANHYKLKANVIVAKDGSGK  288

Query  894   YKTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYV  1073
             +K IN+A+  +P K+ K FVI+IK GVY E V +TKKM +VVFVGDG  KT I+G+++++
Sbjct  289   FKKINDALKHVPKKNKKIFVIYIKEGVYHEYVEVTKKMTHVVFVGDGGNKTRITGNKNFI  348

Query  1074  GGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              G  T +T TV + G  F+  NIG EN+AGP+ HQAVA+RVQ+D++IF+ C ID YQDTL
Sbjct  349   DGVNTYKTPTVAIAGDYFVAINIGFENSAGPQKHQAVAIRVQADKSIFYKCSIDGYQDTL  408



>ref|XP_003550542.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=579

 Score =   271 bits (694),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 141/341 (41%), Positives = 217/341 (64%), Gaps = 7/341 (2%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             G  +I  S + V+ +C+   ++E C K L+ A+ ++D KEL+  AFN T +EI+K +K S
Sbjct  47    GGDSIVKSQRNVQVICESAEYKETCHKSLAKASETSDLKELIITAFNATAEEIAKQIKNS  106

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
                   A D    +A  IC+E+L  ++DD+ +++ ++ +       L+ Y  D+KVW++G
Sbjct  107   TLYHELATDDMNKQAMDICKEVLGYAVDDMHQSVRKLEEFELN--KLNDYAYDLKVWIAG  164

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDAL----VSLDIAGL  773
              L  + TCL+GF  T  ++   M ++L T+ +L+ N L++V+ + +      +S      
Sbjct  165   TLAHQQTCLDGFENTTNEAGKTMARVLNTSLELSNNALDIVNGVSNLFKGLNLSSFSNNN  224

Query  774   NRKLLADSRSLPVWATAAQRRLLEAP-VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSF  950
             NRKLL++    P W +  QRRLL+A     DVVVA+DGSG+ KTI+EA+  +P K+ K F
Sbjct  225   NRKLLSEVDGFPTWVSEGQRRLLQAADAKADVVVAQDGSGQVKTIHEALKLVPKKNKKPF  284

Query  951   VIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFM  1130
             VI++KAGVY+E +++ K + +V  +GDGPTKT I+GS++YV G +T  T T  V  + FM
Sbjct  285   VIYVKAGVYQEYIMINKHLTHVTMIGDGPTKTRITGSKNYVDGIKTYNTATFGVNAANFM  344

Query  1131  GKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               NIG ENTAG E HQAVALRV +D+A+F+NC +D +QDTL
Sbjct  345   AMNIGFENTAGAEKHQAVALRVTADKAVFYNCNMDGFQDTL  385



>ref|XP_006472135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Citrus sinensis]
Length=599

 Score =   271 bits (694),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 152/361 (42%), Positives = 221/361 (61%), Gaps = 30/361 (8%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S KA++ VC+PT +++ CV+ L   + N+TD KEL+  AF V  K ++   K+S+TL
Sbjct  56    VSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTL  115

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM--VDHAGAGANLDLYMNDIKVWLSGA  608
             +   KDPR S A + C EL+ ++I+D++R+ + +   DH  A   +   +N++K WLS  
Sbjct  116   KQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQ-ARYKMGPMINNLKTWLSST  174

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-------A  767
             +T++ TCL+GF  T G++  KM+++L T+ +LT N + MV +I   L +LDI       +
Sbjct  175   ITYQETCLDGFANTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGS  234

Query  768   GLNRKLLADSRSL---------------PVWATAAQRRLL----EAPVTPDVVVAKDGSG  890
               +R L+ ++  +               P W     R+LL    +A   PDVVVAKDGSG
Sbjct  235   SHHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSG  294

Query  891   KYKTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY  1070
                TINEA+  IP KSNK+  I+IK G+Y+E V L + M  V  +GDG  KT I+G+ +Y
Sbjct  295   NCTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNY  354

Query  1071  VGGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDT  1250
             V G  T  T TV + G  FM KNIG EN+AGPE HQAVALRV +D +IF+NC +D YQDT
Sbjct  355   VDGTPTMHTATVSILGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDT  414

Query  1251  L  1253
             L
Sbjct  415   L  415



>ref|XP_004515516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=584

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/340 (42%), Positives = 217/340 (64%), Gaps = 9/340 (3%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA---ATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             +I S+ KAV+ +C PT +++ C + L A   A N TD KEL+++AFNVTMK I   +K++
Sbjct  51    HIASTMKAVQTICHPTDYKKECEETLIAEAEADNVTDPKELIKIAFNVTMKRIGDKIKET  110

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
               L    KDPR+ +A   C++L+  SI++  R+LD + +      ++D  + ++KVWL+G
Sbjct  111   DLLHEVEKDPRSKDALDTCKQLMDLSIEEFTRSLDGINEFDLK--DIDKILMNLKVWLNG  168

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG-LNRK  782
             A+T+ +TCL+GF  T  ++  KMK+LL ++  ++ N L ++ +  D +   +    L R+
Sbjct  169   AVTYIDTCLDGFENTTSEAGTKMKELLTSSIHMSSNALAIISDFADTVSDWNATQILRRR  228

Query  783   LLADSRSLPVWATAAQRRLLEAPV---TPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
             LL DS +        ++   +  V    P+V VA DGSG +K+INEA+  +P KS K FV
Sbjct  229   LLHDSETPSSVDHHHKQHNAKKNVFKHKPNVTVALDGSGDFKSINEALTQVPKKSKKPFV  288

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             I+IK GVY E V +TK M +VVFVGDG  KTII+G+++++ G  T  T +V ++G  F+ 
Sbjct  289   IYIKEGVYPEYVEVTKHMTHVVFVGDGGKKTIITGNKNFIDGVNTYRTASVAIQGDHFVA  348

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              N+G EN+AGP  HQAVALRVQ D+ IF NC +D YQDTL
Sbjct  349   INMGFENSAGPHKHQAVALRVQGDKTIFFNCSMDGYQDTL  388



>gb|EYU37278.1| hypothetical protein MIMGU_mgv1a002232mg [Erythranthe guttata]
Length=698

 Score =   273 bits (699),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 228/365 (62%), Gaps = 38/365 (10%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNST-DTKELVEVAFNVTMKEISKVMKK  422
             G +++ +S K+++ +C+ T ++E CV  L+++ +++ D KEL+E+AF   +K+I      
Sbjct  38    GEQDVSASQKSIQTLCQNTDYQETCVNSLTSSGSNSSDPKELIEIAFQAAIKQIRDAANN  97

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDI  587
             S       KDPR  EA + C+EL   +I+D++R+ D+         N D+      + D+
Sbjct  98    STVFHEVEKDPRGKEALESCRELADRAINDLQRSFDKF-------NNFDITDVENILADL  150

Query  588   KVWLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIA  767
             K+WLSGA+T++ TC++GF    GD+ +KMK+LL T  ++T N L MV  I   L S  I 
Sbjct  151   KIWLSGAITYQETCIDGFEEVPGDATEKMKELLKTGMEMTSNGLAMVTGISSVLQS--IG  208

Query  768   GL------NRKLLADSR----------SLPVWATAAQRRLLEAP---VTPDVVVAKDGSG  890
             GL      +R+LL+++            +P W  + +R LL +    + P++VVAKDGSG
Sbjct  209   GLGSYTTTSRRLLSNNDIIQIIGNSDDEMPGWIDSNRRNLLRSSKKKIKPNLVVAKDGSG  268

Query  891   KYKTINEAIPDI----PLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISG  1058
              Y T+NEA+ +I      K+NK+FV++IK GVY+E VV+   + N++F+GDGPTKT I+G
Sbjct  269   NYTTVNEALRNIVNIIDKKNNKTFVLYIKEGVYEEKVVVNSSLTNLMFLGDGPTKTKITG  328

Query  1059  SRSYVGGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDA  1238
               +++ G  T +T TV ++G  F+ ++IG EN+AG E HQAVALRV +D  IF+NCQ+D 
Sbjct  329   RLNFIDGTNTYQTATVAIQGDHFIARDIGFENSAGAEKHQAVALRVSADMVIFYNCQMDG  388

Query  1239  YQDTL  1253
             YQDTL
Sbjct  389   YQDTL  393



>ref|XP_010445248.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=568

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/349 (41%), Positives = 224/349 (64%), Gaps = 21/349 (6%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK-SKT  431
             I  +TKAV+ VC PT  +E CV  L SA+  ST+  +L+++ F+VT+K I++ +KK S+ 
Sbjct  44    IKKTTKAVQAVCAPTDFKETCVNSLMSASPKSTEPIDLIKLGFDVTIKSINEGLKKASED  103

Query  432   LQA-AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
             ++A A+KDP    AF++C++++ D+I+D+K+ +D    H  +   +D ++ D+ VWLSG+
Sbjct  104   VKAKASKDPEAKGAFELCEKVMVDAIEDLKKCMD----HGFSVDKIDSFVEDLLVWLSGS  159

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG------  770
             + F+ TC++ F   + D   +M+ +  T ++L+ N+L MV  +   L + +  G      
Sbjct  160   IAFQQTCMDSFEEIKSDLMQEMRHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFA  219

Query  771   -LNRKLLADSRSLPVWATAAQRRLLEA------PVTPDVVVAKDGSGKYKTINEAIPDIP  929
                RKLL+    +P W     RRL+ A      PV  + VVA+DGSG++KTI EA+  +P
Sbjct  220   NYARKLLSAEDGIPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGSGQFKTIAEALNAVP  279

Query  930   LKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGTV  1106
               +   +VIHIK G+YKE V++T+KM  V F+GDG TKT+I+G+ +Y +G  +T  T  +
Sbjct  280   KGNTVPYVIHIKQGIYKEKVMVTRKMPYVTFIGDGQTKTVITGNLNYGIGKVKTFLTAPL  339

Query  1107  IVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              ++G  F  KNIG+ENTAGPE  QAVALRV +D A+FH+CQ D +QDTL
Sbjct  340   TIEGDHFTMKNIGVENTAGPEGGQAVALRVSADYAVFHSCQFDGHQDTL  388



>gb|EAZ41174.1| hypothetical protein OsJ_25671 [Oryza sativa Japonica Group]
Length=570

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/343 (43%), Positives = 217/343 (63%), Gaps = 16/343 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL--SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             + +S K+V+  C+PT +++ C ++L  +A   ++   +L +  F VT ++ISK + +S T
Sbjct  38    LSTSVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVTSEKISKAISESST  97

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L+    D RTS A + C+ELL+ ++DD+K + +++        N    ++D++ WLS AL
Sbjct  98    LEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFEMT--NFHKAVDDLRTWLSAAL  155

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA  791
             T++ TCL+GFL T  D+ADKMK  L ++Q+LT + L +VD+    L SL+I    R+LLA
Sbjct  156   TYQGTCLDGFLNTTTDAADKMKSALNSSQELTEDILAVVDQFSATLGSLNIG--RRRLLA  213

Query  792   DSRSLPVWATAAQRR-LLEA------PVT--PDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
             D   +PVW +   RR LLEA      PV   PDV VA DGSG  KTI EA+  +P K+ +
Sbjct  214   DD-GMPVWMSEGGRRQLLEAAGPEAGPVEFKPDVTVAADGSGDVKTIGEAVAKVPPKNKE  272

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
              + I++KAG Y E V + +   NV  +GDG  KTII+G++++     T +T T+   G+G
Sbjct  273   RYTIYVKAGTYNEYVSVGRPATNVNMIGDGIGKTIITGNKNFKMNLTTKDTATMEAIGNG  332

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F  + I +ENTAGPENHQAVALR QSD A+F+ C+ D YQDTL
Sbjct  333   FFMRGITVENTAGPENHQAVALRAQSDMAVFYQCEFDGYQDTL  375



>ref|NP_001060715.1| Os07g0691100 [Oryza sativa Japonica Group]
 dbj|BAC83510.1| putative pectin methylesterase [Oryza sativa Japonica Group]
 dbj|BAF22629.1| Os07g0691100 [Oryza sativa Japonica Group]
 dbj|BAG92656.1| unnamed protein product [Oryza sativa Japonica Group]
Length=566

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 146/343 (43%), Positives = 217/343 (63%), Gaps = 16/343 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKL--SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             + +S K+V+  C+PT +++ C ++L  +A   ++   +L +  F VT ++ISK + +S T
Sbjct  38    LSTSVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVTSEKISKAISESST  97

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L+    D RTS A + C+ELL+ ++DD+K + +++        N    ++D++ WLS AL
Sbjct  98    LEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFEMT--NFHKAVDDLRTWLSAAL  155

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA  791
             T++ TCL+GFL T  D+ADKMK  L ++Q+LT + L +VD+    L SL+I    R+LLA
Sbjct  156   TYQGTCLDGFLNTTTDAADKMKSALNSSQELTEDILAVVDQFSATLGSLNIG--RRRLLA  213

Query  792   DSRSLPVWATAAQRR-LLEA------PVT--PDVVVAKDGSGKYKTINEAIPDIPLKSNK  944
             D   +PVW +   RR LLEA      PV   PDV VA DGSG  KTI EA+  +P K+ +
Sbjct  214   DD-GMPVWMSEGGRRQLLEAAGPEAGPVEFKPDVTVAADGSGDVKTIGEAVAKVPPKNKE  272

Query  945   SFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSG  1124
              + I++KAG Y E V + +   NV  +GDG  KTII+G++++     T +T T+   G+G
Sbjct  273   RYTIYVKAGTYNEYVSVGRPATNVNMIGDGIGKTIITGNKNFKMNLTTKDTATMEAIGNG  332

Query  1125  FMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             F  + I +ENTAGPENHQAVALR QSD A+F+ C+ D YQDTL
Sbjct  333   FFMRGITVENTAGPENHQAVALRAQSDMAVFYQCEFDGYQDTL  375



>gb|EMS57827.1| putative pectinesterase/pectinesterase inhibitor 21 [Triticum 
urartu]
Length=481

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/337 (41%), Positives = 204/337 (61%), Gaps = 22/337 (7%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S K+++  C+P  ++  C K L   A N+T T EL +  F  T + I K +++S  L
Sbjct  38    LATSVKSIKSFCQPVDYKVACEKTLEETAGNATTTTELAKAIFKATSERIEKAVQESSLL  97

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALT  614
                  DPRTS A K C+E+L  +IDD+K   D++        N    M+D+K WL+ ALT
Sbjct  98    NELKHDPRTSGALKNCKEMLHYAIDDLKTTFDQL--GGFEMTNFKHAMDDLKTWLTSALT  155

Query  615   FENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLAD  794
             ++ TCL+GF  T  D++ KM+K L  +Q+LT N L +VDE  D + +LD++  +R+LL  
Sbjct  156   YQETCLDGFANTTTDASAKMRKALNVSQELTENILSIVDEFGDTIANLDLSIFSRRLLGH  215

Query  795   SRSLPVWATAAQRRLLEAPVTPD----VVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHI  962
                              AP  PD    +  A DGSG YKTINEA+  +PLKS  ++V+H+
Sbjct  216   DG---------------APSGPDYKPYMTGAADGSGDYKTINEALAKVPLKSEDTYVMHV  260

Query  963   KAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNI  1142
             K G YKE V + + + N+V +GDG  KT+I+G ++++    T +T T+   G+GF  + I
Sbjct  261   KEGTYKEYVSVARNVTNLVMIGDGVGKTVITGDKNFMMNITTKDTATMEAIGNGFFMRGI  320

Query  1143  GIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              +ENTAG +NHQAVALRVQSDQ++F+ CQ D YQDTL
Sbjct  321   TVENTAGAKNHQAVALRVQSDQSVFYECQFDGYQDTL  357



>ref|XP_009147125.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=569

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 222/356 (62%), Gaps = 25/356 (7%)
 Frame = +3

Query  249   NKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  422
             N+N I ++TKAV  VC PT  +E CVK L  A+ NST+  EL++++FN T+K I+  +KK
Sbjct  38    NENQIRTTTKAVRAVCAPTDFKEACVKSLMDASPNSTEPLELIKLSFNATIKSINDNLKK  97

Query  423   SK--TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVW  596
             +       A KDP    AF++C+ L+ D+IDD+K+ +DR      +   +++++ D++VW
Sbjct  98    ASEDVKPKADKDPGAKGAFQLCERLMIDAIDDLKKCVDREF----SVTQIEIFVEDLRVW  153

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LSG++ F+ TC++ F   + +    M  +  ++++L+ N+L M  ++   L + +I GL 
Sbjct  154   LSGSIAFQQTCIDTFEEIKSNLKRDMLNIFKSSRELSSNSLAMTTDLPTILPNSNITGLT  213

Query  777   -------RKLLADSRSLPVWATAAQRRLLEA---------PVTPDVVVAKDGSGKYKTIN  908
                    RKLL     +P W     RRL++A         PV  +V VA+DGSG +KTI 
Sbjct  214   GALAKYARKLLYTEDGIPTWVGPHARRLMQAEPKPKGGGPPVKANVAVAQDGSGHFKTIT  273

Query  909   EAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQ  1085
             +A+  +P  +   F+IHIK G+YKE V +TKKM  V F+GDGP KT I+G+ ++ +G  +
Sbjct  274   DALKVVPKNNRMPFIIHIKEGIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNFGIGKVK  333

Query  1086  TSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             T  T T+ ++G  F  KNIGIENTAG +  QAVALRV +D A+F++CQID YQDTL
Sbjct  334   TFLTSTLTIEGEHFTAKNIGIENTAGRKGGQAVALRVSADYAVFYSCQIDGYQDTL  389



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   268 bits (686),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 148/347 (43%), Positives = 222/347 (64%), Gaps = 16/347 (5%)
 Frame = +3

Query  249   NKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  422
             N+N I  +TKAV+ VC PT ++E C+K L  A+  ST+   L++++FNVT+K I + +KK
Sbjct  38    NENEIRQNTKAVKTVCAPTDYKETCLKSLMDASPKSTEPLALIKLSFNVTIKSIQEGLKK  97

Query  423   SK--TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVW  596
             +       A K P   +AF++C++++ D+I D+K+     VDH  +   ++ ++ D++VW
Sbjct  98    ASEDVKHKADKHPEAKDAFELCEKVMNDAIADLKKC----VDHKVSVDEIERFIKDLRVW  153

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             +SG++ F+ TC++ F   +      M  +   ++QL+ N+L MV +++     L  A  N
Sbjct  154   ISGSIAFQQTCIDTFEEIKSTLKHDMINIFKRSRQLSSNSLAMVTDLNSNATELTGAFEN  213

Query  777   --RKLLA-DSRSLPVWATAAQRRLLEAPVTPDV----VVAKDGSGKYKTINEAIPDIPLK  935
               RKLL+ +   +P W     RRL+ AP  P V    VVA+DGSG++KTIN+A+  +P +
Sbjct  214   NARKLLSTEEDGVPTWVGPEARRLMGAPGGPPVKANAVVAQDGSGQFKTINDALNAVPKE  273

Query  936   SNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQTSETGTVIV  1112
             +   FVIHIK GVYKE VV+T+KM  V F+GDGPTKT+I+GS ++ +G  +T  T  + V
Sbjct  274   NKVPFVIHIKEGVYKEKVVVTRKMPYVTFIGDGPTKTVITGSLNFGIGKVKTYLTAPLTV  333

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +G  F  K IG+ENTAGPE  QAVALRV  D A+F +CQID YQDTL
Sbjct  334   EGEHFTAKGIGMENTAGPEGGQAVALRVSGDYAVFFDCQIDGYQDTL  380



>gb|AES86317.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=570

 Score =   269 bits (687),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 220/347 (63%), Gaps = 23/347 (7%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKL---SAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             ++ S+ KAV+ +C PT +++ CV+ L   + A N TD KEL+++AFNVT+ +I + +K++
Sbjct  37    HVASTLKAVQTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKET  96

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-YMNDI----K  590
             +      KD R+ +A   C++L+  SI +  R+LD +       +  DL +MN I    K
Sbjct  97    EMFSEIEKDSRSKDALDTCKQLMHLSIGEFTRSLDGI-------SEFDLKHMNQILMNLK  149

Query  591   VWLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG  770
             VWL+GA+T+ +TCL+GF  T GD++ KMK LL ++  ++ N L +V    D +  ++++ 
Sbjct  150   VWLNGAVTYMDTCLDGFENTTGDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSK  209

Query  771   LNRKLLADSRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPLK  935
             L  + L     +P W     R LL+A        P+V VA DGSG +K+INEA+  +P +
Sbjct  210   LFGRCLLQDSEIPSWV--EHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGE  267

Query  936   SNKS-FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIV  1112
              +++ FVI+IK GVY+E V + K M ++VFVGDG  K+II+G+++Y+ G  T  T TV +
Sbjct  268   EDETPFVIYIKEGVYREYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAI  327

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +   F   N+G EN+AGP+ HQAVALRVQ D+AIF NC +D YQDTL
Sbjct  328   QEDHFTAINMGFENSAGPQKHQAVALRVQGDKAIFFNCSMDGYQDTL  374



>emb|CDY24663.1| BnaA05g30620D [Brassica napus]
Length=569

 Score =   269 bits (687),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 221/356 (62%), Gaps = 25/356 (7%)
 Frame = +3

Query  249   NKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  422
             N+N I ++TKAV  VC PT  +E CVK L  A+ NST+  EL++++FN T+K I+   KK
Sbjct  38    NENQIRTTTKAVRAVCAPTDFKEACVKSLMDASPNSTEPLELIKLSFNATIKSINDNFKK  97

Query  423   SK--TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVW  596
             +       A KDP    AF++C+ L+ D+IDD+K+ +DR      +   +++++ D++VW
Sbjct  98    ASEDVKPKADKDPGAKGAFQLCERLMIDAIDDLKKCVDREF----SVTQIEIFVEDLRVW  153

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LSG++ F+ TC++ F   + +    M  +  ++++L+ N+L M  ++   L + +I GL 
Sbjct  154   LSGSIAFQQTCIDTFEEIKSNLKRDMLNIFKSSRELSSNSLAMTTDLPTILPNSNITGLT  213

Query  777   -------RKLLADSRSLPVWATAAQRRLLEA---------PVTPDVVVAKDGSGKYKTIN  908
                    RKLL     +P W     RRL++A         PV  +V VA+DGSG +KTI 
Sbjct  214   GALAKYARKLLYTEDGIPTWVGPHARRLMQAEPKPKEGGPPVKANVAVAQDGSGHFKTIT  273

Query  909   EAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQ  1085
             +A+  +P  +   F+IHIK G+YKE V +TKKM  V F+GDGP KT I+G+ ++ +G  +
Sbjct  274   DALKVVPKNNRMPFIIHIKEGIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNFGIGKVK  333

Query  1086  TSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             T  T T+ ++G  F  KNIGIENTAG +  QAVALRV +D A+F++CQID YQDTL
Sbjct  334   TFLTSTLTIEGEHFTAKNIGIENTAGRKGGQAVALRVSADYAVFYSCQIDGYQDTL  389



>ref|XP_004958780.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=565

 Score =   268 bits (685),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 148/344 (43%), Positives = 214/344 (62%), Gaps = 14/344 (4%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G+ N+  S K+V+  C+PT +++ C  +LS AA N++   EL +V F VT  +I K + +
Sbjct  36    GDDNLSMSVKSVKAFCQPTDYQQTCEAELSKAAGNASSPTELAKVIFGVTSDKIHKAISE  95

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S TL     D RTS A + C+E+L+ +IDD+K + D++        N    ++D+K WLS
Sbjct  96    SATLTELKNDKRTSGALQNCKEMLEYAIDDLKSSFDKL--GGFEMTNFKKAVDDLKTWLS  153

Query  603   GALTFENTCLEGFL-GTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNR  779
              ALT+++TCL+GF+  T  +++ KM+  L  +Q+LT + L +VD+  D L  L I    R
Sbjct  154   AALTYQDTCLDGFMNATTTEASAKMQNALNASQELTEDILAVVDQFSDTLGGLSIG---R  210

Query  780   KLLADSRSLPVW-ATAAQRRLLEAP-----VTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
             +LL D  + P W   AA R LLEA        P+V VA DGSG  KTI EA+  +P K+ 
Sbjct  211   RLLGDDGA-PAWMPDAASRHLLEASPESPEFKPNVTVAADGSGDVKTIKEALDKVPPKNA  269

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGS  1121
               +V+++KAG YKE V + +   NV F+GDG  KTII+G++++     T +T T+   G+
Sbjct  270   AMYVVYVKAGTYKEYVSVARPQTNVAFIGDGADKTIITGNKNFKMNLTTKDTATMEAIGN  329

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             GF  K + +ENTAG ENHQAVALRVQSDQA+F+ C  D YQDTL
Sbjct  330   GFFMKGVRVENTAGAENHQAVALRVQSDQAVFYQCTFDGYQDTL  373



>ref|XP_006433462.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46702.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=706

 Score =   271 bits (694),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/361 (42%), Positives = 221/361 (61%), Gaps = 30/361 (8%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S KA++ VC+PT +++ CV+ L   + N+TD KEL+  AF V  K ++   K+S+TL
Sbjct  56    VSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTL  115

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM--VDHAGAGANLDLYMNDIKVWLSGA  608
             +   KDPR S A + C EL+ ++I+D++R+ + +   DH  A   +   +N++K WLS  
Sbjct  116   KQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQ-ARYKMGPMINNLKTWLSST  174

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-------A  767
             +T++ TCL+GF  T G++  KM+++L T+ +LT N + MV +I   L +LDI       +
Sbjct  175   ITYQETCLDGFANTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGS  234

Query  768   GLNRKLLADSRSL---------------PVWATAAQRRLL----EAPVTPDVVVAKDGSG  890
               +R L+ ++  +               P W     R+LL    +A   PDVVVAKDGSG
Sbjct  235   SHHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSG  294

Query  891   KYKTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY  1070
                TINEA+  IP KSNK+  I+IK G+Y+E V L + M  V  +GDG  KT I+G+ +Y
Sbjct  295   NCTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNY  354

Query  1071  VGGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDT  1250
             V G  T  T TV + G  FM KNIG EN+AGPE HQAVALRV +D +IF+NC +D YQDT
Sbjct  355   VDGTPTMHTATVSILGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDT  414

Query  1251  L  1253
             L
Sbjct  415   L  415



>gb|KDO39972.1| hypothetical protein CISIN_1g039111mg [Citrus sinensis]
Length=595

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/360 (42%), Positives = 219/360 (61%), Gaps = 28/360 (8%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S KA++ VC+PT +++ CV+ L   + N+TD KEL+  AF V  K ++   K+S+TL
Sbjct  52    VSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTL  111

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM-VDHAGAGANLDLYMNDIKVWLSGAL  611
             +   KDPR S A + C EL+ ++I+D++R+ + +      A   +   +N++K WLS  +
Sbjct  112   KQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDRQARYKMGPMINNLKTWLSSTI  171

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-------AG  770
             T++ TCL+GF  T G++  KM+++L T+ +LT N + MV +I   L +LDI       + 
Sbjct  172   TYQETCLDGFENTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGSS  231

Query  771   LNRKLLADSRSL---------------PVWATAAQRRLL----EAPVTPDVVVAKDGSGK  893
              +R L+ ++  +               P W     R+LL    +A   PDVVVAKDGSG 
Sbjct  232   HHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSGN  291

Query  894   YKTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYV  1073
               TINEA+  IP KSNK+  I+IK G+Y+E V L + M  V  +GDG  KT I+G+ +YV
Sbjct  292   CTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNYV  351

Query  1074  GGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              G  T  T TV V G  FM KNIG EN+AGPE HQAVALRV +D +IF+NC +D YQDTL
Sbjct  352   DGTPTMHTATVSVLGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDTL  411



>ref|XP_006433460.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46700.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=714

 Score =   271 bits (693),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/361 (42%), Positives = 221/361 (61%), Gaps = 30/361 (8%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S KA++ VC+PT +++ CV+ L   + N+TD KEL+  AF V  K ++   K+S+TL
Sbjct  56    VSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTL  115

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM--VDHAGAGANLDLYMNDIKVWLSGA  608
             +   KDPR S A + C EL+ ++I+D++R+ + +   DH  A   +   +N++K WLS  
Sbjct  116   KQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQ-ARYKMGPMINNLKTWLSST  174

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-------A  767
             +T++ TCL+GF  T G++  KM+++L T+ +LT N + MV +I   L +LDI       +
Sbjct  175   ITYQETCLDGFANTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGS  234

Query  768   GLNRKLLADSRSL---------------PVWATAAQRRLL----EAPVTPDVVVAKDGSG  890
               +R L+ ++  +               P W     R+LL    +A   PDVVVAKDGSG
Sbjct  235   SHHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSG  294

Query  891   KYKTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY  1070
                TINEA+  IP KSNK+  I+IK G+Y+E V L + M  V  +GDG  KT I+G+ +Y
Sbjct  295   NCTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNY  354

Query  1071  VGGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDT  1250
             V G  T  T TV + G  FM KNIG EN+AGPE HQAVALRV +D +IF+NC +D YQDT
Sbjct  355   VDGTPTMHTATVSILGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDT  414

Query  1251  L  1253
             L
Sbjct  415   L  415



>ref|XP_006433461.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46701.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=727

 Score =   271 bits (694),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/361 (42%), Positives = 221/361 (61%), Gaps = 30/361 (8%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S KA++ VC+PT +++ CV+ L   + N+TD KEL+  AF V  K ++   K+S+TL
Sbjct  56    VSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTL  115

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM--VDHAGAGANLDLYMNDIKVWLSGA  608
             +   KDPR S A + C EL+ ++I+D++R+ + +   DH  A   +   +N++K WLS  
Sbjct  116   KQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQ-ARYKMGPMINNLKTWLSST  174

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-------A  767
             +T++ TCL+GF  T G++  KM+++L T+ +LT N + MV +I   L +LDI       +
Sbjct  175   ITYQETCLDGFANTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGS  234

Query  768   GLNRKLLADSRSL---------------PVWATAAQRRLL----EAPVTPDVVVAKDGSG  890
               +R L+ ++  +               P W     R+LL    +A   PDVVVAKDGSG
Sbjct  235   SHHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSG  294

Query  891   KYKTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY  1070
                TINEA+  IP KSNK+  I+IK G+Y+E V L + M  V  +GDG  KT I+G+ +Y
Sbjct  295   NCTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNY  354

Query  1071  VGGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDT  1250
             V G  T  T TV + G  FM KNIG EN+AGPE HQAVALRV +D +IF+NC +D YQDT
Sbjct  355   VDGTPTMHTATVSILGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDT  414

Query  1251  L  1253
             L
Sbjct  415   L  415



>ref|XP_006433459.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46699.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=711

 Score =   271 bits (693),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/361 (42%), Positives = 221/361 (61%), Gaps = 30/361 (8%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAAT-NSTDTKELVEVAFNVTMKEISKVMKKSKTL  434
             + +S KA++ VC+PT +++ CV+ L   + N+TD KEL+  AF V  K ++   K+S+TL
Sbjct  56    VSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRTL  115

Query  435   QAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM--VDHAGAGANLDLYMNDIKVWLSGA  608
             +   KDPR S A + C EL+ ++I+D++R+ + +   DH  A   +   +N++K WLS  
Sbjct  116   KQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQ-ARYKMGPMINNLKTWLSST  174

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-------A  767
             +T++ TCL+GF  T G++  KM+++L T+ +LT N + MV +I   L +LDI       +
Sbjct  175   ITYQETCLDGFANTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGS  234

Query  768   GLNRKLLADSRSL---------------PVWATAAQRRLL----EAPVTPDVVVAKDGSG  890
               +R L+ ++  +               P W     R+LL    +A   PDVVVAKDGSG
Sbjct  235   SHHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSG  294

Query  891   KYKTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY  1070
                TINEA+  IP KSNK+  I+IK G+Y+E V L + M  V  +GDG  KT I+G+ +Y
Sbjct  295   NCTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNY  354

Query  1071  VGGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDT  1250
             V G  T  T TV + G  FM KNIG EN+AGPE HQAVALRV +D +IF+NC +D YQDT
Sbjct  355   VDGTPTMHTATVSILGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDT  414

Query  1251  L  1253
             L
Sbjct  415   L  415



>gb|AGT17860.1| pollen-specific pectin methylesterase [Pisum sativum]
Length=584

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/341 (41%), Positives = 218/341 (64%), Gaps = 12/341 (4%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA---ATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             ++ S+ +AV+ +C+PT +++ CV  L+A   A N TD KEL+++AFNVTMK+I + +K +
Sbjct  52    HVSSTMRAVQTICQPTDYKKECVDTLTAEAEAGNVTDPKELIKIAFNVTMKKIGEQIKAT  111

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
               +    KDPR+ +A   C++L+  SI +  RA+D  +D      ++D  + ++KVWL+G
Sbjct  112   DLMHEVEKDPRSKDAIDTCKQLMDLSIGEFARAMDG-IDQFDL-KDIDRILMNLKVWLNG  169

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKL  785
             A+T+ +TC++GF  T  D+  KMK +L ++  ++ N L ++ +  D + S ++  +  + 
Sbjct  170   AVTYMDTCVDGFQNTTTDAGKKMKDILTSSMHMSSNALAIISDFADTVTSWNVTKIFGRR  229

Query  786   LADSRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPLKSNKSF  950
             L D+ + P W +   R LL+A  +     P+V VA DG+G  KTINEA+  +P KS K F
Sbjct  230   LLDTDT-PSWVSE-HRMLLDAKTSSFKLKPNVTVALDGTGDVKTINEALLKVPEKSEKPF  287

Query  951   VIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFM  1130
              I+IK GVY E V + K M  VVF+GDG  K+ I+GS++++ G  T +T +V ++G  F 
Sbjct  288   FIYIKEGVYNEYVEVGKHMTYVVFLGDGGQKSRITGSKNFIDGVNTYKTASVAIQGDHFT  347

Query  1131  GKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               N+G EN+AG   HQAVALRVQ D++IF NC +D YQDTL
Sbjct  348   AINMGFENSAGAHKHQAVALRVQGDKSIFFNCSMDGYQDTL  388



>ref|XP_003604120.1| Pectinesterase [Medicago truncatula]
Length=614

 Score =   268 bits (686),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 220/347 (63%), Gaps = 23/347 (7%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKL---SAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             ++ S+ KAV+ +C PT +++ CV+ L   + A N TD KEL+++AFNVT+ +I + +K++
Sbjct  37    HVASTLKAVQTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKET  96

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-YMNDI----K  590
             +      KD R+ +A   C++L+  SI +  R+LD +       +  DL +MN I    K
Sbjct  97    EMFSEIEKDSRSKDALDTCKQLMHLSIGEFTRSLDGI-------SEFDLKHMNQILMNLK  149

Query  591   VWLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG  770
             VWL+GA+T+ +TCL+GF  T GD++ KMK LL ++  ++ N L +V    D +  ++++ 
Sbjct  150   VWLNGAVTYMDTCLDGFENTTGDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSK  209

Query  771   LNRKLLADSRSLPVWATAAQRRLLEAPVT-----PDVVVAKDGSGKYKTINEAIPDIPLK  935
             L  + L     +P W     R LL+A        P+V VA DGSG +K+INEA+  +P +
Sbjct  210   LFGRCLLQDSEIPSWV--EHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGE  267

Query  936   SNKS-FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIV  1112
              +++ FVI+IK GVY+E V + K M ++VFVGDG  K+II+G+++Y+ G  T  T TV +
Sbjct  268   EDETPFVIYIKEGVYREYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAI  327

Query  1113  KGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +   F   N+G EN+AGP+ HQAVALRVQ D+AIF NC +D YQDTL
Sbjct  328   QEDHFTAINMGFENSAGPQKHQAVALRVQGDKAIFFNCSMDGYQDTL  374



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 154/364 (42%), Positives = 217/364 (60%), Gaps = 43/364 (12%)
 Frame = +3

Query  267   STKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAA  446
             S KA + +C    ++  C K LS A +S++ +EL++VAFN  + +I + +K S   + AA
Sbjct  34    SNKAAQALCTSVDYKITCEKSLSDA-HSSNPQELIKVAFNHAITDIQEAIKNSTLYKQAA  92

Query  447   KDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLSGAL  611
              D RT  A ++C+E+L  SIDD++R+ DR+        NLD+     Y+ D+KVWLSGA+
Sbjct  93    TDHRTKGALEVCEEVLDTSIDDLRRSFDRV-------GNLDITKLKQYIEDVKVWLSGAI  145

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNR-KLL  788
             T   TCL+ F  T GD+ +KMK LL ++  +  N L MV +I     SL + G    +LL
Sbjct  146   TNHETCLDAFQNTTGDTGEKMKNLLHSSGMILSNGLAMVGDISSIFSSLSLGGFTSGRLL  205

Query  789   ADSRSL--------------------------PVWATAAQRRLLEAPVT---PDVVVAKD  881
              +  SL                          P +  A  RR++ A V     ++VVA+D
Sbjct  206   EEEGSLAYGVDQTDGEDLKTAFDGKVTDAAGPPPFVDAEARRIMTANVNTLKANIVVAQD  265

Query  882   GSGKYKTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGS  1061
             GSG++KTI  AI  +P K +  FVIH+KAG YKENV+  KK+ NVV +GDGP KT ISGS
Sbjct  266   GSGQFKTITGAINSLPKKGDGPFVIHVKAGFYKENVIFPKKVNNVVLIGDGPLKTRISGS  325

Query  1062  RSYVGGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAY  1241
             ++YV G QT  T  + V G GF+ K+IGIENTAGP  HQAVA+RV  D++IF+N  ++ +
Sbjct  326   KNYVDGVQTFHTAVLGVNGDGFIAKDIGIENTAGPIKHQAVAVRVSGDKSIFYNVHMNGF  385

Query  1242  QDTL  1253
             QDTL
Sbjct  386   QDTL  389



>ref|XP_009419138.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=557

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/345 (41%), Positives = 211/345 (61%), Gaps = 15/345 (4%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATN-STDTKELVEVAFNVTMKEISKVMKK  422
             G+ ++ +++K+V   C  T ++  C + + +A N S+  KE+++ +F   + EI      
Sbjct  37    GDGSLTTTSKSVSAFCAKTDYQADCERTIGSAINGSSSPKEVIQASFQAAIDEIQAAFHL  96

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S  +   A DP    AF IC++LL+D+ +++  A     D  G     D    DIK WLS
Sbjct  97    SNNVSLKANDPMNKAAFNICRQLLEDADEELNAAFSETHDLQGLARRTD----DIKTWLS  152

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDAL----VSLDIAG  770
               ++++ TCL+G   TE +    MK  L TA ++T N + +VDE+   L    + ++I  
Sbjct  153   AVISYQQTCLDGI--TEPELQSTMKDGLSTATKVTSNAIAIVDELSSLLKSFKIPINITM  210

Query  771   LNRKLLADSRSLPVWATAAQRRLLEAP----VTPDVVVAKDGSGKYKTINEAIPDIPLKS  938
              +R+LL D +  P W +   R+LL A     +TP+VVVAKDGSGK+KTIN+A+  +P   
Sbjct  211   GSRRLLVDEQGYPSWFSGHDRKLLAAQARGQLTPNVVVAKDGSGKFKTINDAVNAMPKDY  270

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKG  1118
             +  +VI++KAGVYKENV++ K  +NV+  GDG  KT+++GS++YV G QT +T T    G
Sbjct  271   SGRYVIYVKAGVYKENVIVGKDKVNVLMYGDGSRKTVVTGSKNYVDGVQTVDTATFAALG  330

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              GF+ K++G  NTAG E HQAVALRVQSD + F NC++DAYQDTL
Sbjct  331   QGFIAKSMGFSNTAGAEKHQAVALRVQSDMSAFFNCRMDAYQDTL  375



>ref|XP_003534836.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
 gb|KHN26531.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=579

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/336 (41%), Positives = 211/336 (63%), Gaps = 13/336 (4%)
 Frame = +3

Query  279   VEHVCKPTFHREMCVKKLSAATN--STDTKELVEVAFNVTMKEISKVMKKSKTLQAAAKD  452
             VE +C  T ++E C K L  A++  + DTKEL++ AFN +  E+   +K S   +  AKD
Sbjct  58    VEMICNSTEYKETCKKSLEKASSDENADTKELIKAAFNASAVELLNHIKNSTLYKELAKD  117

Query  453   PRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENTCL  632
               T +A  IC+E+   +ID ++++++ +         L  Y+ D+KVWL+G+L+ + TCL
Sbjct  118   NMTRQAMDICKEVFDYAIDGVQKSIETLDKFEFI--KLSEYVYDLKVWLTGSLSHQQTCL  175

Query  633   EGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL---NRKLLADSRS  803
             +GF  T   + +KM K +  + +L+ N L+M++ I   +  L+I+ L   NR+LL+    
Sbjct  176   DGFENTNTKAGEKMAKAMNASLELSSNALDMINFISGLIKDLNISSLVGNNRRLLSSKEE  235

Query  804   -----LPVWATAAQRRLLE-APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIK  965
                   P W +  QRRLL  + + P+  VAKDGSG++ T+ +A+  +P K+ ++FVI++K
Sbjct  236   ALVDGYPSWVSEGQRRLLGLSSIKPNATVAKDGSGQFATLTDALKTVPPKNAQAFVIYVK  295

Query  966   AGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIG  1145
             AGVYKENV +   M +V  +GDGP KT  SGS +Y  G QT  + T  V  + FM K++G
Sbjct  296   AGVYKENVNVGMDMTHVTVIGDGPKKTRFSGSLNYKDGVQTFNSATFAVNAANFMAKDVG  355

Query  1146  IENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              ENTAG E HQAVALRV +DQA+F+NCQ+DA+QDTL
Sbjct  356   FENTAGAEKHQAVALRVTADQAVFYNCQMDAFQDTL  391



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score =   265 bits (678),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 142/340 (42%), Positives = 219/340 (64%), Gaps = 19/340 (6%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             + +STK+V+ +C+PT +++ C K LS+A N+++ K+ ++VAF  T+ +I   +  +  + 
Sbjct  39    VTTSTKSVKAMCQPTPYKQTCEKTLSSAKNASEPKDFIKVAFEATVTDIRNAIMNTDLIM  98

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLS  602
              AA DP+T +A   C+EL   +I+D++ ++ ++        + DL      ++D+K WLS
Sbjct  99    QAASDPKTKDALHACEELFDLAIEDLRTSVSKL-------ESFDLTKIKDIVDDLKTWLS  151

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRK  782
               + +E TCL+ F  T+GD+ +KM KLL T ++L+ N L MV+   + +      GL+RK
Sbjct  152   AVVAYEETCLDAFEKTDGDTGEKMVKLLNTTRELSINGLAMVNSFGEMITQ--TTGLSRK  209

Query  783   LLADSRSLPVWATAAQRRLLE-APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIH  959
             LL    S   +  A+ R+LL+ +   P+ VVA+DGSG+YKTI +A+  +P K+ + FVI 
Sbjct  210   LLTTDES--SFVEASNRKLLQISNAKPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVIL  267

Query  960   IKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGG--YQTSETGTVIVKGSGFMG  1133
             IKAG+YKE V + K M NVVF+G+G TKT I+G++S  G     T  T TV V G GF+ 
Sbjct  268   IKAGIYKEYVEVEKGMTNVVFIGEGSTKTKITGNKSVKGPGIGSTWHTCTVGVSGEGFVA  327

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             ++IG ENTAGP   QAVALRV +D+A+ +NC+ID YQDTL
Sbjct  328   RDIGFENTAGPAQEQAVALRVNADKAVIYNCKIDGYQDTL  367



>emb|CDY05295.1| BnaC05g45080D [Brassica napus]
Length=569

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 220/356 (62%), Gaps = 25/356 (7%)
 Frame = +3

Query  249   NKN-IGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKK  422
             N+N I ++TKAV  VC PT  +E CVK L  A+ NST+  EL++++FN T+K I+  +KK
Sbjct  38    NENQIRTTTKAVRAVCAPTDFKEACVKSLMDASPNSTEPLELIKLSFNATIKSINDNLKK  97

Query  423   SK--TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVW  596
             +       A KDP    AF++C+ L+ D+IDD+K+ +DR      +   +++++ D++VW
Sbjct  98    ASEDVKPKADKDPGAKGAFQLCERLMIDAIDDLKKCVDREF----SVTQIEIFVEDLRVW  153

Query  597   LSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLN  776
             LSG++ F+ TC++ F   + +    M  +  T+++L+ N+L M  ++   L + +  GL 
Sbjct  154   LSGSIAFQQTCIDTFEEIKSNLMRDMLNIFKTSRELSSNSLAMTTDLPTILPNSNTTGLT  213

Query  777   -------RKLLADSRSLPVWATAAQRRLL-EAP--------VTPDVVVAKDGSGKYKTIN  908
                    RKLL     +P W     RRL+ E P        V  + VV +DGSG +KTI 
Sbjct  214   GALAKYARKLLYTEDGIPTWVGPHARRLMAEEPKPKGGGPLVKANAVVDQDGSGHFKTIT  273

Query  909   EAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY-VGGYQ  1085
             +A+  +P  +   F+IHIK G+YKE V +TKKM  V F+GDGP KT I+G+ ++ +G  +
Sbjct  274   DALKVVPKNNRMPFIIHIKEGIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNFGIGKVK  333

Query  1086  TSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             T  T T+ ++G  F  KNIGIENTAGP+  QAVALRV +D A+F++CQID YQDTL
Sbjct  334   TFLTSTLTIEGEHFTAKNIGIENTAGPKGGQAVALRVSADYAVFYSCQIDGYQDTL  389



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/351 (39%), Positives = 213/351 (61%), Gaps = 22/351 (6%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLSAAT--NSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             +S KA++ +C+PT +++ C+  LS A+   +TD  +L+   F V MK +    KKS  L+
Sbjct  59    ASMKAIKAICQPTDYKQECLDSLSYASGNTTTDPVQLIGYGFKVAMKYVYDAAKKSDFLR  118

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTF  617
                KDPRTS A   C+EL++ ++ +++++L R+          D+ M D+KVWLS  +T+
Sbjct  119   KLEKDPRTSNALDTCEELMELALGELRQSLVRLGFIDDLTKFNDMLM-DLKVWLSATITY  177

Query  618   ENTCLEGFLGTEG--DSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA  791
             + +CL+ F  T    D+A++MK +L T+  L+ N L MV ++  A   L+    + + L 
Sbjct  178   QESCLDAFENTTSSTDAAEEMKNVLKTSMHLSSNALAMVSQVFSAFTDLNNPDPSHRRLL  237

Query  792   DSRSLPV----------WATAAQRRLLEAPVT-------PDVVVAKDGSGKYKTINEAIP  920
                + PV          W     R+LL    T       PD++VAKDGSG YKTI EA+ 
Sbjct  238   QFDAFPVIGHSEFEDPKWYGGEGRKLLTTSTTSAPKINKPDIIVAKDGSGSYKTITEALK  297

Query  921   DIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETG  1100
              +P   N++F+I+IK G+Y E++++T+ M NV+ +GDG  KT I+G++++V G  T  T 
Sbjct  298   HVPKYGNETFIIYIKEGIYNEHILVTRSMTNVMMIGDGANKTRITGNKNFVDGTTTYHTA  357

Query  1101  TVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             TV ++G  FM  +IG EN+AGPE HQAVALRV +D+AIF+ C +D YQDTL
Sbjct  358   TVAIQGDHFMVMDIGFENSAGPEKHQAVALRVSADKAIFYRCSMDGYQDTL  408



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/335 (42%), Positives = 218/335 (65%), Gaps = 8/335 (2%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             + +STK+VE +C+PT +++ C K LS+A N++D K+ ++VAF  T+ +I   +  +  + 
Sbjct  39    VTTSTKSVESMCQPTPYKQTCEKTLSSAKNASDPKDFIKVAFEATVTDIKNAIMNTDLIM  98

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTF  617
              AA DP+T +A   C+EL   +I+D++ ++ ++ D        D+ ++D+K WLS  + +
Sbjct  99    QAASDPKTKDALHACEELFDLAIEDLRTSVSKL-DSFDLSKIKDI-VDDLKTWLSAVVAY  156

Query  618   ENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLADS  797
             E TCL+ F  T+GD+ +KM KLL T ++L+ N L MV+   + +      GL+RKLL  +
Sbjct  157   EETCLDAFEKTDGDTGEKMVKLLNTTRELSINGLAMVNSFGEMITQ--TTGLSRKLLTTT  214

Query  798   RSLPVWATAAQRRLLE-APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGV  974
                  +  A+ R+LL+ +   P+ VVA+DGSG+YKTI +A+  +P K+ + FVI IKAG+
Sbjct  215   EE-SSFIEASNRKLLQISSAKPNAVVAQDGSGQYKTIKDALKAVPKKNAEPFVILIKAGI  273

Query  975   YKENVVLTKKMMNVVFVGDGPTKTIISGSRS--YVGGYQTSETGTVIVKGSGFMGKNIGI  1148
             YKE V + K M NVVF+G+G TKT I+G++     G   T  T TV V G GF+ ++IG 
Sbjct  274   YKEYVEVEKGMTNVVFIGEGSTKTKITGNKGAKTPGIGSTWHTCTVGVSGEGFVARDIGF  333

Query  1149  ENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             ENTAGP   QAVALRV +D+A+ +NC+ID YQDTL
Sbjct  334   ENTAGPTLEQAVALRVNADKAVIYNCKIDGYQDTL  368



>ref|XP_003559753.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=575

 Score =   264 bits (674),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 143/348 (41%), Positives = 212/348 (61%), Gaps = 21/348 (6%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLS--AATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             + +S K+V+  C+P  ++E C  +LS  +    T   EL +  F  T  +I+K + +S T
Sbjct  42    LSTSVKSVKAFCQPMDYKETCEAELSKMSGDKPTSPTELAKAIFEATSAKINKAVAESAT  101

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L+    D RTS A + C+ELL+ +++D+K + D++        + +  ++D+K WLS AL
Sbjct  102   LEELKNDKRTSGALQNCKELLEYAVEDLKTSFDKL--GGFEMTDFNKAVDDLKTWLSAAL  159

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA  791
             T++ TCL+GFL T GD++ KMK  L  +Q+LT + L +VD+    L SL      R+LLA
Sbjct  160   TYQETCLDGFLNTTGDASAKMKGALNASQELTEDILAVVDQFSATLGSLSFG--KRRLLA  217

Query  792   DSRSLPVWATAAQRRLLEAP--------------VTPDVVVAKDGSGKYKTINEAIPDIP  929
             D  + P W T  +RRL+EA                 P+V VA DGSG +KTINEA+  +P
Sbjct  218   DDGA-PTWMTDGKRRLMEASAGAPSSSSSSSPMDFEPNVTVAADGSGDFKTINEALAKVP  276

Query  930   LKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVI  1109
              KS   +V+++KAG YKE V + + + N+V +GDG  KTII+G++++     T +T T+ 
Sbjct  277   PKSTAMYVMYVKAGTYKEYVSVGRPITNLVMIGDGAEKTIITGNKNFKMNLTTKDTATME  336

Query  1110  VKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               G+GF  ++I +ENTAG  NHQAVALRVQSDQA+F  C  D YQDTL
Sbjct  337   AIGNGFFMRDIRVENTAGAANHQAVALRVQSDQAVFFQCTFDGYQDTL  384



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   263 bits (673),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 143/340 (42%), Positives = 217/340 (64%), Gaps = 19/340 (6%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             + +STK+VE +C+PT +++ C K LS+A N TD K+ ++VAF  T+ +I   +  +  + 
Sbjct  39    VTTSTKSVEAMCQPTPYKQTCEKTLSSAKNVTDPKDFIKVAFEATVTDIKNAIMNTDLIM  98

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLS  602
              AA DP+T +A   C+EL   +I+D++ ++ ++        + DL      ++D+K WLS
Sbjct  99    KAASDPKTKDALHACEELFDLAIEDLRTSVSKL-------ESFDLTKIKDIVDDLKTWLS  151

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRK  782
               + +E TCL+ F  T+GD+ +KM KLL T ++L+ N L MV+   + +      GL+RK
Sbjct  152   AVVAYEETCLDAFEKTDGDTGEKMAKLLNTTRELSINGLAMVNSFGEMITQ--TTGLSRK  209

Query  783   LLADSRSLPVWATAAQRRLLE-APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIH  959
             LL    S   +  A+ R+LL+ +   P+ VVA+DGSG+YKTI +A+  +P K+ + FVI 
Sbjct  210   LLTTDES--SFVEASNRKLLQISNAKPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVIL  267

Query  960   IKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY--VGGYQTSETGTVIVKGSGFMG  1133
             IKAG+YKE V + K M NVVF+G+G TKT I+G+++    G   T  T TV V G GF+ 
Sbjct  268   IKAGIYKEYVDVEKGMTNVVFIGEGSTKTKITGNKAVKEPGIGSTWHTCTVGVSGEGFVA  327

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             ++IG ENTAG    QAVALRV +D+A+ +NC+ID YQDTL
Sbjct  328   RDIGFENTAGAVKEQAVALRVNADKAVIYNCKIDGYQDTL  367



>gb|EPS69059.1| hypothetical protein M569_05708 [Genlisea aurea]
Length=1231

 Score =   272 bits (696),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 144/345 (42%), Positives = 216/345 (63%), Gaps = 15/345 (4%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
              ++ +S +A+  +C  T +++ C+  L A  NS+D K L+EVA   ++  I + +K S  
Sbjct  38    PDVSASQRAIMSICDTTDYQQTCLDSL-AGHNSSDPKALIEVAIQSSINHIEEAVKNSTA  96

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDH-AGAGANLDLYMNDIKVWLSGA  608
             +  A K PR   A + C+EL   ++DD+ R+     D    + A++ L   ++K+WLSGA
Sbjct  97    IHDAEKTPRGRLALETCRELANRAVDDLDRSFGTFDDFDITSVADVPL---ELKIWLSGA  153

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAG------  770
             +T   TCL+ F    GD+ ++M+++L  + ++T N L MV EI   L S+   G      
Sbjct  154   ITQLETCLDSFEDVPGDAGNRMRQVLRESMEMTSNVLTMVAEISTFLDSMGGGGGAQTAV  213

Query  771   LNRKLLADSRSLPVWATAAQRRLLEA-P--VTPDVVVAKDGSGKYKTINEAIPDIPLKS-  938
              +R+LL+    LP W  A +R+LL A P  VTPD++VAKDG+G Y TINEA+ +IP    
Sbjct  214   TSRRLLSTDEFLPEWVDAGKRKLLAATPQVVTPDLIVAKDGTGNYPTINEALKNIPKSGK  273

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKG  1118
             NK+ V++I+ GVY+E +     M N+  +GDGPTKT I+G  +++ G  T +T TV V+G
Sbjct  274   NKTIVLYIREGVYEEKLQFNSSMKNLFVIGDGPTKTRITGKSNFIDGTNTYQTATVAVQG  333

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               F+ ++IG ENTAGPE HQAVALRV +D+AIF+NC +DAYQDTL
Sbjct  334   DDFIARDIGFENTAGPEKHQAVALRVSADKAIFYNCHMDAYQDTL  378



>ref|XP_006342829.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=552

 Score =   263 bits (671),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 141/340 (41%), Positives = 214/340 (63%), Gaps = 20/340 (6%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             + +STK+VE +C+PT +++ C K LSAA N +D K+ ++VAF  T+ +I   +K ++ ++
Sbjct  38    VATSTKSVESMCQPTPYKQTCEKTLSAAKNVSDPKDYIKVAFEATVADIKNALKNTEPIK  97

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLS  602
              AA DP T +A   C+EL   +++D++ ++ ++        N D       ++D+K WLS
Sbjct  98    KAASDPYTKDALLACEELFDLAVEDLRGSVAKI-------ENFDFSKIKDIVDDLKSWLS  150

Query  603   GALTFENTCLEGFLGTEGDSA-DKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNR  779
               + +E TCL+GF  +E  +  ++M KL+ T ++L+ N L MV+   + +      GL R
Sbjct  151   AVVAYEETCLDGFTKSEYSATRNQMVKLMNTTRELSINALSMVNSFGEMITQ--TTGLTR  208

Query  780   KLLADSRSLPVWATAAQRRLLEAPVT-PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             KLL+DS S      A+ R+L++   + P+ VV+  G G+YKTI EA+  +P  +   FVI
Sbjct  209   KLLSDSDSF---VEASNRKLVQISASKPNAVVSASGGGQYKTIQEAVNAVPKNNPTPFVI  265

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYV-GGYQTSETGTVIVKGSGFMG  1133
              IKAG YKE++ + K   NVVF+G+GPTKTII+G R     GY T  T  + V G GF+ 
Sbjct  266   LIKAGTYKEHIEIDKNKPNVVFIGEGPTKTIITGDRGVKHDGYATWHTCALGVAGEGFVI  325

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             K+IGIENTAGP   QAVALR+ +D+A+ HNC+ID YQDTL
Sbjct  326   KDIGIENTAGPAKEQAVALRINADKAVVHNCKIDGYQDTL  365



>gb|KHN03341.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=554

 Score =   263 bits (671),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 138/341 (40%), Positives = 214/341 (63%), Gaps = 13/341 (4%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             G  +I  S + V+ +C+   ++E C K L+ A+ ++D KEL+  AFN T +EI+K +K S
Sbjct  28    GGDSIVKSQRNVQVICESAEYKETCHKSLAKASETSDLKELIITAFNATAEEIAKQIKNS  87

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
                   A D    +A  IC+E+L  ++DD+ +++ ++ +       L+ Y  D+KVW++G
Sbjct  88    TLYHELATDDMNKQAMDICKEVLGYAVDDMHQSVRKLEEFELN--KLNDYAYDLKVWIAG  145

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDAL----VSLDIAGL  773
              L  + TCL+GF  T  ++   M ++L T+ +L+ N L++V+ + +      +S      
Sbjct  146   TLAHQQTCLDGFENTTNEAGKTMARVLNTSLELSNNALDIVNGVSNLFKGLNLSSFSNNN  205

Query  774   NRKLLADSRSLPVWATAAQRRLLEAP-VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSF  950
             NRKLL++    P W +  QRRLL+A     DVVVA+DGSG+ KTI+EA+  +P K+ K F
Sbjct  206   NRKLLSEVDGFPTWVSEGQRRLLQAADAKADVVVAQDGSGQVKTIHEALKLVPKKNKKPF  265

Query  951   VIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFM  1130
             VI++KAGVY+E +++ K + +V  +GDGPTKT I+GS++Y+ G      G   V  + FM
Sbjct  266   VIYVKAGVYQEYIMINKHLTHVTMIGDGPTKTRITGSKNYING------GLAGVNAANFM  319

Query  1131  GKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               NIG ENTAG E HQAVALRV +D+A+F+NC +D +QDTL
Sbjct  320   AMNIGFENTAGAEKHQAVALRVTADKAVFYNCNMDGFQDTL  360



>tpg|DAA64233.1| TPA: pectinesterase [Zea mays]
Length=566

 Score =   263 bits (671),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 144/345 (42%), Positives = 215/345 (62%), Gaps = 14/345 (4%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKK  422
             G++N+  S K+V+  C+P  ++E C  +LS AA N++   +L +V F VT  +I K + +
Sbjct  35    GDENLSMSVKSVKAFCQPADYKETCEAELSKAAGNASSPSDLAKVIFKVTSDKIHKAISE  94

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S TL+    DPRTS A   C+E+L  +ID++K + D++        N +  ++D+K WLS
Sbjct  95    SATLEELKNDPRTSGALHDCKEMLGYAIDELKSSFDKL--GGFEMTNFNKAVDDLKTWLS  152

Query  603   GALTFENTCLEGFL-GTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNR  779
              ALT+++TCL+GF   T  +++ KM+K L  +Q+LT + L +VD+  D L  L I    R
Sbjct  153   AALTYQDTCLDGFANATTTEASAKMQKALNASQELTEDILAVVDQFSDTLGGLSIG---R  209

Query  780   KLLADSRSLPVWATAAQRRLLEAP-------VTPDVVVAKDGSGKYKTINEAIPDIPLKS  938
             +LL     +   A  A++RLL A          P+V VA DGSG  KTI EA+  +P+K+
Sbjct  210   RLLLTPSWVSEPADPARQRLLAADSPAGSPDFKPNVTVAADGSGDVKTIMEALEKVPVKN  269

Query  939   NKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKG  1118
                +V+++KAG YKE V + +   NV F+GDG  KTII+G++++     T +T T+   G
Sbjct  270   ADLYVVYVKAGTYKEYVTVGRPQTNVAFIGDGAEKTIITGNKNFKMNLTTKDTATMQAIG  329

Query  1119  SGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +GF  ++I +ENTAGPENHQAVALRVQSD A+F+ C  D YQDTL
Sbjct  330   NGFFMRDIRVENTAGPENHQAVALRVQSDLAVFYQCTFDGYQDTL  374



>ref|XP_004229262.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/340 (41%), Positives = 215/340 (63%), Gaps = 20/340 (6%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             + +STK+VE +C+PT +++ C K LSAA N +D K+ ++VAF  T+ +I   +K ++ ++
Sbjct  38    VATSTKSVESMCQPTPYKQTCEKTLSAAKNVSDPKDYIKVAFEATVADIKNAIKNTEPVK  97

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLS  602
              AA DP T +A   C+E+   ++++++ ++ R+        N D       ++D+K WLS
Sbjct  98    KAASDPYTKDALLACEEVFDLAVEELRGSIARI-------ENFDFSKMKDIVDDLKSWLS  150

Query  603   GALTFENTCLEGFLGTEGDSA-DKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNR  779
               + +E TCL+GF  +E  +  D+M KL+ T ++L+ N L MV+   + +      GL R
Sbjct  151   AVVAYEETCLDGFTKSEYSATRDEMMKLMSTTRELSSNALSMVNNFGEMITQN--TGLTR  208

Query  780   KLLADSRSLPVWATAAQRRLLEAPVT-PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             KLL++S S      A+ R+LL+   + P+ VV+  G G+YKTI EA+  +P  S   FVI
Sbjct  209   KLLSNSDSF---VEASNRKLLQISASKPNAVVSTSGGGQYKTIQEALQAVPRSSPTPFVI  265

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGG-YQTSETGTVIVKGSGFMG  1133
              IKAG YKE++ + K M+NVV +G+GPTKTII+G ++ V     T  T T+ V G GF+ 
Sbjct  266   LIKAGTYKEHIEIEKNMLNVVLIGEGPTKTIITGDQAVVPNRISTWHTATLGVCGDGFVM  325

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             K++GIENTAGP   QAVALR+ +D+A+ +NC ID YQDTL
Sbjct  326   KDMGIENTAGPTKEQAVALRINADKAVLYNCNIDGYQDTL  365



>ref|XP_004229264.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/340 (41%), Positives = 215/340 (63%), Gaps = 20/340 (6%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             + +STK+VE +C+PT +++ C K LSAA N +D K+ ++VAF  T+ +I   +K ++ ++
Sbjct  38    VATSTKSVESMCQPTPYKQTCEKTLSAAKNVSDPKDYIKVAFEATVADIKNAIKNTEPVK  97

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLS  602
              AA DP T +A   C+E+   ++++++ ++ R+        N D       ++D+K WLS
Sbjct  98    KAASDPYTKDALLACEEVFDLAVEELRGSIARI-------ENFDFSKMKDIVDDLKSWLS  150

Query  603   GALTFENTCLEGFLGTEGDSA-DKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNR  779
               + +E TCL+GF  +E  +  D+M KL+ T ++L+ N L MV+   + +      GL R
Sbjct  151   AVVAYEETCLDGFTKSEYSATRDEMMKLMSTTRELSSNALSMVNSFGEMITQN--TGLTR  208

Query  780   KLLADSRSLPVWATAAQRRLLEAPVT-PDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             KLL++S S      A+ R+LL+   + P+ VV+  G G+YKTI EA+  +P  S   FVI
Sbjct  209   KLLSNSDSF---VEASNRKLLQISASKPNAVVSASGGGQYKTIQEALQAVPKSSPTPFVI  265

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGG-YQTSETGTVIVKGSGFMG  1133
              IKAG YKE++ + K M+NVV +G+GPTKTII+G ++ V     T  T T+ V G GF+ 
Sbjct  266   LIKAGTYKEHIQIEKNMLNVVLIGEGPTKTIITGDQAVVPNRISTWHTATLGVCGDGFVM  325

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             K++GIENTAGP   QAVALR+ +D+A+ +NC ID YQDTL
Sbjct  326   KDMGIENTAGPTKEQAVALRINADKAVLYNCNIDGYQDTL  365



>ref|XP_002528621.1| Pectinesterase-4 precursor, putative [Ricinus communis]
 gb|EEF33779.1| Pectinesterase-4 precursor, putative [Ricinus communis]
Length=568

 Score =   261 bits (667),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 139/348 (40%), Positives = 213/348 (61%), Gaps = 16/348 (5%)
 Frame = +3

Query  252   KNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             + + +STK+V  +C+PT ++E C K L++  ++ D KE V+ A   T++  +K    S  
Sbjct  40    QQVSTSTKSVAQICQPTDYKEACEKSLNSVKDTKDPKEYVKAAILATVEAATKSFNLSSN  99

Query  432   LQAAAK--DPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
             L   AK  D  T  + + C++LLQD++ +++ +   + +       +D  + +++ WLS 
Sbjct  100   LIVDAKNADNDTRMSLEDCKDLLQDAVQELQASFSTVGE--STVNTMDQRIAELQNWLSA  157

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-------  764
              +++++TCLE F     +   +M+  +V A QLT N L +++ +   L + D+       
Sbjct  158   VVSYQDTCLEQFGDPNSNYKSQMQDGMVDATQLTSNALAIINALSQMLSTFDLKFDLTSE  217

Query  765   AGLN-RKLLA-DSRSLPVWATAAQRRLLEA---PVTPDVVVAKDGSGKYKTINEAIPDIP  929
             +G N RKLL+ D   +P+W   A+RRL+ A    + P++ VA+DGSG  KT+ EAI  IP
Sbjct  218   SGDNSRKLLSVDETGVPIWFDGAKRRLMAADTSAIKPNITVAQDGSGDVKTVTEAIAKIP  277

Query  930   LKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVI  1109
             LKS   F+I++KAG YKE  ++ KKM+NV   GDGP KTII+GS S   G++T  + T  
Sbjct  278   LKSENPFIIYVKAGTYKEYPIVEKKMLNVFMYGDGPKKTIITGSHSNHTGWKTMRSATFA  337

Query  1110  VKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
               G GFM K++G ENTAGPE HQAVALRVQ+D+A F +C ID YQDTL
Sbjct  338   ALGPGFMAKSMGFENTAGPEGHQAVALRVQADRAAFFDCNIDGYQDTL  385



>ref|XP_006658993.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=567

 Score =   261 bits (666),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 141/340 (41%), Positives = 213/340 (63%), Gaps = 18/340 (5%)
 Frame = +3

Query  267   STKAVEHVCKPTFHREMCVKKLS-AATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAA  443
             S K+V+  C+PT +++ C  +L+ AA N +   +L +  F VT ++ISK + +S TL+  
Sbjct  44    SVKSVKAFCQPTDYQQTCEAELTQAAANGSSPTDLAKAIFAVTSEKISKAISESATLEEL  103

Query  444   AKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAG-ANLDLYMNDIKVWLSGALTFE  620
               D RTS A + C+ELL+ +++D+K + D++    G G  + +  ++D++ WLS ALT++
Sbjct  104   RNDQRTSGALQNCKELLEYAVEDLKTSFDKL---GGFGMTDFNKAVDDLRTWLSAALTYQ  160

Query  621   NTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLADSR  800
             +TCL+GFL T  D+A KM+  L ++Q+LT + L +VD+    L SL      R+LL +  
Sbjct  161   DTCLDGFLNTTTDAAAKMRTALNSSQELTEDILAVVDQFSATLGSLSFG---RRLLGED-  216

Query  801   SLPVWAT-AAQRRLLEAP--------VTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFV  953
              +P W +   +R LL A          TP+V VA DGSG +KTI EA    P K+ + + 
Sbjct  217   GMPTWMSEGGKRELLAAAGPEAGPEAFTPNVTVAADGSGDFKTIGEAGAKGPPKNAQRYT  276

Query  954   IHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMG  1133
             I++KAG+YKE V + +   NV  +GDG  KTII+G++++     T +T T+   G+GF  
Sbjct  277   IYVKAGMYKEYVSVGRPATNVAMIGDGADKTIITGNKNFKMNLTTKDTATMEAIGNGFFM  336

Query  1134  KNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             + I +ENTAGPENHQAVALR QSDQA+F+ C  D YQDTL
Sbjct  337   RGIRVENTAGPENHQAVALRAQSDQAVFYQCTFDGYQDTL  376



>ref|XP_007144961.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16955.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=578

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/356 (38%), Positives = 216/356 (61%), Gaps = 28/356 (8%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             N ++ SS KAV  +CKPT++++ C K L   A N+TD++EL+++ FN+TMK+I K   K 
Sbjct  46    NNHVVSSVKAVRTLCKPTYYQKECEKSLREEAGNTTDSRELIKIVFNITMKKIGKGQHKI  105

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRM----VDHAGAGANLDLYMNDIKV  593
               +  A ++PR   A   C++L+  S+ + KRAL++M    +D      NL+  +  +KV
Sbjct  106   DHMLGAERNPRARMALATCKQLMNLSVGEFKRALEKMGKFDLD------NLNNILTSLKV  159

Query  594   WLSGALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL  773
             WLSGA+T++ TCL+GF  T   + ++M+ LL T   ++ N L ++  + + +  L     
Sbjct  160   WLSGAITYQETCLDGFHNTTVQAGNRMRNLLTTTMHMSSNALAIITALANTVSELSDVN-  218

Query  774   NRKLLADSRSL--------------PVWATAAQRRLLEAP--VTPDVVVAKDGSGKYKTI  905
              R+L+ D   +                     +R L + P  +  + +VAKDGS K+K+I
Sbjct  219   KRQLVEDDEHVFGQDEVISSLIFDDDDDGGGVRRLLYQNPYKLKANAIVAKDGSEKFKSI  278

Query  906   NEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQ  1085
             ++A+  +P K+ K FVI+I+ GVY E + +TK M  VVFVGDG  KT I+G+R+++ G  
Sbjct  279   DQALQKVPKKNKKPFVIYIREGVYNEYIEVTKTMTRVVFVGDGANKTRITGNRNFLDGLN  338

Query  1086  TSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             T +T +V + G  F+  NIG EN+AGP  HQAVA+RVQ+D++IF+ C +D Y+DTL
Sbjct  339   TYKTASVAIHGDYFVAINIGFENSAGPHKHQAVAIRVQADRSIFYRCSMDGYEDTL  394



>gb|KEH32300.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=585

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/344 (42%), Positives = 210/344 (61%), Gaps = 12/344 (3%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             G   I  S K V+ +C  T +++ C K L A T  TD KEL++  F  T +E+SK +  S
Sbjct  48    GGNQIVKSQKIVQVLCGTTGYKQTCEKSL-AKTGKTDMKELIKAVFKATAEELSKQIHNS  106

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
             K  +  A +  T +A  IC+E+L  ++DD+ +++  + D       +D    D+KVWLSG
Sbjct  107   KLYKELATNDMTKQAMDICKEVLGYAVDDVHQSIHSL-DKFDI-RKIDEIAYDLKVWLSG  164

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL----  773
              L  + TCL GF  T   +   M K+L  + +LT N L++++ +   +  L+++ L    
Sbjct  165   TLANQQTCLYGFENTTTHAEQTMAKVLKASLELTNNALDIINGLSGFVKDLNLSSLTSVL  224

Query  774   --NRKLLADSRSLPVWATAAQRRLLEAP--VTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
               NRK L++   LP W + +QR+LL AP  V P+ VVA+DGSG++KT+ EA+  +P K+ 
Sbjct  225   NNNRKHLSED-GLPSWVSQSQRKLLAAPENVKPNAVVAQDGSGQFKTLTEALALVPKKNQ  283

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGS  1121
               FVIH+KAG+YKE V + K   +V  +GDGPTKTI +GS+SY  G QT  T T  V  +
Sbjct  284   VPFVIHVKAGIYKEYVSVDKDRDHVTIIGDGPTKTIFTGSKSYADGVQTYNTATFGVNSA  343

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              F   N+G EN+AG   HQAVALRV +D+A+F+NCQ+D YQDTL
Sbjct  344   HFTALNVGFENSAGAAKHQAVALRVTADKALFYNCQMDGYQDTL  387



>ref|XP_007138937.1| hypothetical protein PHAVU_009G250600g [Phaseolus vulgaris]
 gb|ESW10931.1| hypothetical protein PHAVU_009G250600g [Phaseolus vulgaris]
Length=573

 Score =   259 bits (661),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 143/337 (42%), Positives = 210/337 (62%), Gaps = 9/337 (3%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLSAATN-STDTKELVEVAFNVTMKEISKVMKKSKTLQA  440
             S   +VE +C  T + + C K L+   + + DT+ LV+ A N T  E+   +K S   + 
Sbjct  51    SQRTSVEILCHSTEYAKTCKKSLAKVPDRNADTRALVKAAINATAVELLSHIKNSTLYRD  110

Query  441   AAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFE  620
               KD  T +A +IC+E+ + +I  I++++D  +D    G  L  Y+ D+KVW+SG+LT +
Sbjct  111   LGKDNMTRQAVEICKEVFEYAIHGIQKSVD-TIDKFEYG-KLSEYIYDLKVWISGSLTHQ  168

Query  621   NTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL-NRKLLADS  797
              TCL GF  T+  +  KM K+L T+ +LT N L+M+D I   L  L++    NR+LL+  
Sbjct  169   YTCLYGFEHTDTKAGAKMNKVLNTSLELTSNALDMIDVISGILKDLNMTSFGNRRLLSQD  228

Query  798   R----SLPVWATAAQRRLL-EAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHI  962
             +      P W +  +RRLL +   +  VVVA+DGSG++KTI EA+  +P  + + +VI++
Sbjct  229   KVPLDDYPSWVSEGKRRLLSQGTESAKVVVAQDGSGQFKTIKEALKTVPPNNAEPYVIYV  288

Query  963   KAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNI  1142
             KAGVYKENV ++  M +V  +GDGPTKT  SGS +Y  G QT +T T  V  + FM KN+
Sbjct  289   KAGVYKENVDMSMLMTHVTIIGDGPTKTRFSGSLNYDDGVQTYKTATFAVNAANFMAKNV  348

Query  1143  GIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G ENTAG + HQAVALRV +DQA+F NC +D +QDTL
Sbjct  349   GFENTAGSKKHQAVALRVTADQAVFVNCHMDGFQDTL  385



>ref|XP_007146999.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
 gb|ESW18993.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
Length=585

 Score =   259 bits (661),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/351 (40%), Positives = 213/351 (61%), Gaps = 20/351 (6%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++ SS KAV+ +C PT +++ C   L+  A N TD +EL+++AFN+T+  IS  + K++ 
Sbjct  49    HVASSMKAVKTLCAPTDYQKECEDSLNENAGNITDPRELIKLAFNITITRISDGLGKTQL  108

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             L     DPRT EA   C++L+  SI++  R+L R   +     +LD  +  +KVWLSGA+
Sbjct  109   LHDVESDPRTKEALDTCKQLMHLSIEEFNRSLQRF--NKFELNSLDRILTSLKVWLSGAV  166

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA  791
             T++ TCL+ F  T  D+  KM+  L TA  +T N L ++ E+   L  + ++   R+LL 
Sbjct  167   TYQETCLDAFDNTTTDAGKKMQGHLQTAMHMTSNGLAIISELSKTLSDMHVSKSGRRLLT  226

Query  792   DSRSLPV------------WATA--AQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIP  920
              +  LPV            W  +    RRLL          VVVAKDGSG + TIN+A+ 
Sbjct  227   AADDLPVLGHETDDFDLPDWVESRFGVRRLLHMTGRKRMAHVVVAKDGSGNFTTINDALK  286

Query  921   DIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETG  1100
              +P+K+ + F+I+IK GVY E V +++ M +VV +GDG  K+ I+GS++++ G  T +T 
Sbjct  287   HVPMKNLRPFIIYIKEGVYDEYVEVSRNMTHVVMIGDGGRKSRITGSKNFIDGVGTYKTA  346

Query  1101  TVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +  + G  F+   +G ENTAG E HQAVALRVQSD++IF+ C++D YQDTL
Sbjct  347   SAAIIGDFFVAIGMGFENTAGAEKHQAVALRVQSDRSIFYKCRMDGYQDTL  397



>emb|CAB65290.2| pectin methyl-esterase PER [Medicago truncatula]
Length=602

 Score =   259 bits (662),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 137/332 (41%), Positives = 203/332 (61%), Gaps = 20/332 (6%)
 Frame = +3

Query  279   VEHVCKPTFHREMCVKKLSAATNST-DTKELVEVAFNVTMKEISKVMKKSKTLQAAAKDP  455
             V+ +C+ T +++ C + L+ A   T   K+L++ AF+ T +E+ K +  S  +Q   +D 
Sbjct  43    VQILCESTQYQQTCHQSLAKAPAETAGVKDLIKAAFSATSEELLKHINSSSLIQELGQDK  102

Query  456   RTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLSGALTFE  620
              T +A ++C E+L  ++D I +++       GA    D+     Y  D+KVWL+G L+ +
Sbjct  103   MTKQAMEVCNEVLDYAVDGIHKSV-------GAVDKFDINKIHEYSYDLKVWLTGTLSHQ  155

Query  621   NTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLADSR  800
              TCL+GF  T   + + M + L T+ QL+ N ++MVD ++D      +    R+LL+   
Sbjct  156   QTCLDGFANTTTKAGETMARALNTSIQLSSNAIDMVDAVYD------LTNAKRRLLSLDN  209

Query  801   SLPVWATAAQRRLL-EAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGVY  977
               P+W +  QRRLL EA V P+VVVA+DGSG++KT+ +AI  +P  + ++FVI++K GVY
Sbjct  210   GYPLWVSEGQRRLLAEATVKPNVVVAQDGSGQFKTLTDAIKTVPANNAQNFVIYVKEGVY  269

Query  978   KENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIENT  1157
              E V + K M  V  +GDGP KT  +GS +Y  G     T T  V G  FM K+I IENT
Sbjct  270   NETVNVPKDMAFVTIIGDGPAKTKFTGSLNYADGLLPYNTATFGVNGENFMAKDISIENT  329

Query  1158  AGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             AGPE HQAVALRV +D+AIF+NCQID YQ TL
Sbjct  330   AGPEKHQAVALRVTADKAIFYNCQIDGYQATL  361



>ref|XP_010932334.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=602

 Score =   259 bits (661),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 138/357 (39%), Positives = 217/357 (61%), Gaps = 28/357 (8%)
 Frame = +3

Query  249   NKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSK  428
             NK++ S+T+A++ VC    ++E C  +++ A N+T  K L+  + ++ + E++K   KS 
Sbjct  66    NKDLQSTTRAIKLVCGAVDYKEACESRMAKAVNTTSPKALIRASISIVVDEVAKAFNKSD  125

Query  429   TLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGA  608
              +++   DP    A + C+EL +DS D++  AL  +  H      +    ++++ WLS  
Sbjct  126   LIKS--DDPMVQGAIEDCKELFRDSADELATALGNIDAHTLE--QVPKQSSELRNWLSAV  181

Query  609   LTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDI-AGLNRKL  785
             ++++ TC++GF    G+  DKMK+ + +A++LT N L +++E    L S+ I AG  R+L
Sbjct  182   MSYQQTCIDGF--PNGEWKDKMKEAMKSAKELTSNALAIIEEASHFLSSVKIPAGNGRRL  239

Query  786   LADSRS--------LPVWATAAQRRLLE--------AP-----VTPDVVVAKDGSGKYKT  902
             LA+ +          P W +  +RR LE         P     + P+V VAKDGSG +KT
Sbjct  240   LAEGQEAAPHKDAGFPSWLSKEERRHLEEEGQDGQDGPRATKNLKPNVTVAKDGSGDFKT  299

Query  903   INEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGY  1082
             I+EA+  +P K    + I++K GVY+E VV+ KKM+NV   GDG  KTI++GS++YV G 
Sbjct  300   ISEALARMPKKYEGRYFIYVKEGVYEETVVVDKKMVNVTMFGDGSRKTIVTGSKNYVDGT  359

Query  1083  QTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             +T +T T    G GFMG  +G  NTAGPE HQAVALRVQ+D+A+F NC+++ YQDTL
Sbjct  360   RTYQTATFAALGDGFMGIAMGFRNTAGPEKHQAVALRVQADRAVFLNCRMEGYQDTL  416



>gb|EPS58111.1| pectinesterase [Genlisea aurea]
Length=374

 Score =   252 bits (644),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/325 (40%), Positives = 198/325 (61%), Gaps = 18/325 (6%)
 Frame = +3

Query  276   AVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAAKDP  455
             AV  VC  T +RE C   LS   N+TD KEL++ A  V ++ +  ++  S  L+ AA+D 
Sbjct  62    AVRAVCSSTSYRETCETSLSQ-VNTTDPKELLKYAMEVALRGVGDLLANSTLLRRAAEDA  120

Query  456   RTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLSGALTFE  620
              T +A  +C+++   ++D+++R+L+++         L+L     Y  D++ WLS  +T +
Sbjct  121   ATRDALYVCEDVFDLAVDEMRRSLEKV-------GELELSKMSEYAGDVRTWLSAVVTNQ  173

Query  621   NTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLADSR  800
              TC++ F  T GD   KM+ L+ T ++++ N L +V ++ D    L+I G+ RK+++D  
Sbjct  174   ETCIDAFQNTTGDVGKKMENLMKTVREMSSNCLAIVTQMSDLASQLEIGGVRRKMMSDEP  233

Query  801   SLPVWATAAQRRLLEAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGVYK  980
                 W    +RRLLEA  TPD VVA DGS ++ +IN+AI   P  + + FVIH+K G+Y 
Sbjct  234   PRG-W----RRRLLEADRTPDAVVALDGSARFSSINDAISAAPEMNARPFVIHVKEGLYA  288

Query  981   ENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIENTA  1160
             E VV+ KK  N+V +GDGP KT I+G+ ++  G +T  T TV V    F  ++I +ENTA
Sbjct  289   ETVVVPKKKDNIVLIGDGPEKTRITGNLNFAAGVKTFVTATVAVNARDFFARDIAVENTA  348

Query  1161  GPENHQAVALRVQSDQAIFHNCQID  1235
             GPE HQAVALRV  D+A+F+N  ID
Sbjct  349   GPEGHQAVALRVSGDRAVFYNVHID  373



>ref|XP_008800480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Phoenix dactylifera]
Length=570

 Score =   258 bits (658),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 133/344 (39%), Positives = 211/344 (61%), Gaps = 18/344 (5%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATN--STDTKELVEVAFNVTMKEISKVMKKSKT  431
             I S+TK+V+ +C  T ++E C   L+   N  +++ K++++ +    + EISK   +S+ 
Sbjct  50    IRSTTKSVKMLCATTDYKETCETSLTKIVNGSTSNPKDVLKASVVAVIDEISKSFSQSRV  109

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
              +    + R  +A   C E+ QDS +D+K+ L +++D      +L      +K WLS   
Sbjct  110   FKT--NNSRVQDAIDDCWEMYQDSKEDLKKTLSKIID--TGLEDLPEQALSLKNWLSAVF  165

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA  791
              ++ TC++GF   EG+  +KM+  + T+++LT N L M+ ++ D L  L+I G +R+LL+
Sbjct  166   FYQETCVDGF--PEGELKNKMRSAMKTSKELTSNALAMIGQVSDFLTMLNIPGSSRRLLS  223

Query  792   ------DSRSLPVWATAAQRRLLE----APVTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
                     R  P W +   RRLL       + P+V VA+DGSG ++TINEAI  +PLK +
Sbjct  224   VDEKPVMKRGYPSWVSEGDRRLLREYLNVKLRPNVTVAQDGSGDFRTINEAIDKVPLKYD  283

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGS  1121
               +VI++K G+Y E V LT + + +   GDGP KTI++G++++V G +TS T T +  G 
Sbjct  284   GRYVIYVKEGIYNEAVNLTSRYVGITMYGDGPKKTIVTGNKNFVDGTKTSHTATFVASGE  343

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             GFM  ++G  NTAGPE HQAVALRVQSD++IF NC+++ YQDTL
Sbjct  344   GFMAVDMGFRNTAGPEKHQAVALRVQSDRSIFINCRMEGYQDTL  387



>gb|KEH37212.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=614

 Score =   259 bits (661),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 137/332 (41%), Positives = 203/332 (61%), Gaps = 20/332 (6%)
 Frame = +3

Query  279   VEHVCKPTFHREMCVKKLSAATNST-DTKELVEVAFNVTMKEISKVMKKSKTLQAAAKDP  455
             V+ +C+ T +++ C + L+ A   T   K+L++ AF+ T +E+ K +  S  +Q   +D 
Sbjct  43    VQILCESTQYQQTCHQSLAKAPAETAGVKDLIKAAFSATSEELLKHINSSSLIQELGQDK  102

Query  456   RTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLSGALTFE  620
              T +A ++C E+L  ++D I +++       GA    D+     Y  D+KVWL+G L+ +
Sbjct  103   MTKQAMEVCNEVLDYAVDGIHKSV-------GAVDKFDINKIHEYSYDLKVWLTGTLSHQ  155

Query  621   NTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLADSR  800
              TCL+GF  T   + + M + L T+ QL+ N ++MVD ++D      +    R+LL+   
Sbjct  156   QTCLDGFANTTTKAGETMARALNTSIQLSSNAIDMVDAVYD------LTNAKRRLLSLDN  209

Query  801   SLPVWATAAQRRLL-EAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIKAGVY  977
               P+W +  QRRLL EA V P+VVVA+DGSG++KT+ +AI  +P  + ++FVI++K GVY
Sbjct  210   GYPLWVSEGQRRLLAEATVKPNVVVAQDGSGQFKTLTDAIKTVPANNAQNFVIYVKEGVY  269

Query  978   KENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIGIENT  1157
              E V + K M  V  +GDGP KT  +GS +Y  G     T T  V G  FM K+I IENT
Sbjct  270   NETVNVPKDMAFVTIIGDGPAKTKFTGSLNYADGLLPYNTATFGVNGENFMAKDISIENT  329

Query  1158  AGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             AGPE HQAVALRV +D+AIF+NCQID YQ TL
Sbjct  330   AGPEKHQAVALRVTADKAIFYNCQIDGYQATL  361



>ref|XP_006342828.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=550

 Score =   257 bits (656),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 138/341 (40%), Positives = 213/341 (62%), Gaps = 21/341 (6%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             + +STK+VE +C+PT +++ C K LSAA N +D K+ ++VAF  T+ +I   +   + ++
Sbjct  38    VATSTKSVESMCQPTPYKQTCEKTLSAAKNVSDPKDYIKVAFEATVTDIKNAIMNIEPIK  97

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDL-----YMNDIKVWLS  602
              AA DP T +A   C+EL   +++D++ ++ ++        N D       ++D+K WLS
Sbjct  98    KAASDPYTKDALHACEELFDLAVEDLRGSVAKI-------ENFDFSKIKDVVDDLKTWLS  150

Query  603   GALTFENTCLEGFLGTEGDSA-DKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNR  779
               + +E TCL+GF  +E  +  D+M KL+ T ++L+ N L MV+   + +      GL R
Sbjct  151   AVVAYEETCLDGFTKSEYSATRDEMVKLMNTTRELSINALSMVNSFGEMITQ--TTGLTR  208

Query  780   KLLADSRSLPVWATAAQRRLLE-APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVI  956
             KLL++S S      A+ R+LL+ +   P+ VV+  G G+YKTI EA+  +P  +   F+I
Sbjct  209   KLLSNSDSF---VEASNRKLLQISAAKPNAVVSASGGGQYKTIQEAVNAVPKNNPTPFII  265

Query  957   HIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYV--GGYQTSETGTVIVKGSGFM  1130
              IKAG YKE++ + K   NVVF+G+G TKTII+G R     GGY T  T  + V G GF+
Sbjct  266   LIKAGTYKEHIEIEKSKPNVVFIGEGATKTIITGDRGVKNGGGYATWHTCALGVAGEGFV  325

Query  1131  GKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              ++IG+ENTAGPE  QAVALR+ +D+AI +NC+ID +QDTL
Sbjct  326   IRDIGLENTAGPEKEQAVALRINADKAIVYNCKIDGFQDTL  366



>gb|KHN03958.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=580

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/346 (40%), Positives = 212/346 (61%), Gaps = 15/346 (4%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKLSAATNS-TDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++ SS KAV+ +C PT +++ C   L   +N+ TD +EL+++AF+VT+ +I + ++K++ 
Sbjct  49    SVASSIKAVKTLCAPTDYKKECEDSLIEHSNNITDPRELIKIAFHVTISKIGEGLEKTEL  108

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             +     DPRT EA   C++L+  SI +  R+LDR         NLD  +  +KVWLSGA+
Sbjct  109   MHQVENDPRTKEALDTCKQLMNLSIGEFTRSLDRFTKFDLN--NLDNILTSLKVWLSGAI  166

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLA  791
             T++ TCL+ F  T  D++ KM++LL +A  ++ N L ++ E+   L  + I    R+ L 
Sbjct  167   TYQETCLDAFENTTTDASLKMQRLLQSAMHMSSNGLSIITELSKTLSEMHIGKPGRRRLL  226

Query  792   -------DSRSLPVWA--TAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDIPLK  935
                    D   LP W       R+LL          VVVAKDGSG + TINEA+  +P K
Sbjct  227   NNNVLGHDYFDLPEWVDDQVGVRKLLHMTGRKRMAHVVVAKDGSGNFTTINEALKHVPKK  286

Query  936   SNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVK  1115
             + + FVI++K GVY E V ++K M +VV +GDG  K+ I+G++++V G  T  T +  + 
Sbjct  287   NLRPFVIYVKEGVYNEYVEVSKNMTHVVMIGDGGKKSRITGNKNFVDGVGTFRTASAAIL  346

Query  1116  GSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             G  F+G  +G EN+AG E HQAVALRVQ+D++IF+ C++D YQDTL
Sbjct  347   GDFFVGIGMGFENSAGAEKHQAVALRVQADRSIFYKCRMDGYQDTL  392



>ref|XP_007031044.1| Pectinesterase, putative [Theobroma cacao]
 gb|EOY11546.1| Pectinesterase, putative [Theobroma cacao]
Length=623

 Score =   258 bits (659),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 149/365 (41%), Positives = 210/365 (58%), Gaps = 42/365 (12%)
 Frame = +3

Query  273   KAVEHVCKPTFHREMCVKKLSA-ATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQAAAK  449
             KA++ VC+PT  R+ C ++L A A ++TD KELV+ AF   MK  S+ ++ S TL+   K
Sbjct  59    KAIKSVCQPTDFRKTCEEQLRAEAGDTTDIKELVQAAFKAAMKSASQAVQNSTTLRDLEK  118

Query  450   DPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENTC  629
             DPRT +A  +C++L+  SI ++K++LD+ +D        D  + D+K+WLS  +T + TC
Sbjct  119   DPRTKKALDVCKQLMTYSIKELKKSLDQ-IDKLDIN-KFDRMLADLKIWLSATITNQQTC  176

Query  630   LEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLADSRSLP  809
             L+GF  T   + +KMKK L  + +L+ N L +  E+   L  L+I G++R+LL ++  LP
Sbjct  177   LDGFKNTTSKAGEKMKKALNVSMELSRNGLAIATEMSAVLKQLEIQGVSRRLLQEN--LP  234

Query  810   V-----WAT-----------------------------AAQRRLLEAP---VTPDVVVAK  878
             V     W+T                                RRL+ AP   +  D+VVAK
Sbjct  235   VLGHGDWSTYLDIPMTRRRRLLQDNEPPVLGHGQFEIQPGVRRLMAAPPSRIKADIVVAK  294

Query  879   DGSGKYKTINEAIPDIPLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISG  1058
             DGSG + TIN A+  IPL + K FVI+IK GVY+EN+    KM NV  +GDG  KT I+G
Sbjct  295   DGSGNFTTINAAMSSIPLNATKPFVIYIKEGVYEENLEFGYKMTNVALIGDGKEKTRITG  354

Query  1059  SRSYVGGYQTSETGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDA  1238
               +   G  T  T TV V G  F  KNIG EN+AG    QAVAL V SD ++F+NC +D 
Sbjct  355   HLNNADGVPTFRTATVAVNGDYFFAKNIGFENSAGAAKFQAVALLVISDFSVFYNCSMDG  414

Query  1239  YQDTL  1253
             YQDTL
Sbjct  415   YQDTL  419



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 209/351 (60%), Gaps = 34/351 (10%)
 Frame = +3

Query  276   AVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKT-LQAAAK-  449
             AV  +C  T ++E CV  L     S D + L++ AF   +K I K + ++   L+  AK 
Sbjct  65    AVNVICSSTDYKETCVASLETV-RSPDPRNLIKSAFEFAIKSIQKGINQAAIDLRMRAKS  123

Query  450   DPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTFENTC  629
             D RT EA + C EL+++S++D++++ ++    A     L     D+ VWLSGA+T++ TC
Sbjct  124   DRRTREALENCVELMENSVEDLRKSNEKFAGFAFT--RLRDIAEDLGVWLSGAITYQQTC  181

Query  630   LEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLADSR---  800
             ++GF G + D+A+ M+++  TAQQLT N L +   + + L    I       L  SR   
Sbjct  182   IDGFEGIDSDAAEIMERIFKTAQQLTSNGLAIATNLDNLLKFFHIP---IPFLTTSRDST  238

Query  801   -------------SLPVWATAAQRRLLE---APVTPDVVVAKDGSGKYKTINEAIPDIPL  932
                            P W T   RRLL      +  + VVAKDGSG+Y+TI EA+  +P 
Sbjct  239   DEDSIEPVGRQLTEFPDWVTGHSRRLLAEKGGRIRANAVVAKDGSGQYRTITEALAAVPK  298

Query  933   KSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSY----VGGYQTSETG  1100
              + + FVI+IK+GVY ENV LTKKM +V+F+GDGPTKTI++G+ S+    +  Y+TS   
Sbjct  299   NNERRFVIYIKSGVYAENVELTKKMTHVMFIGDGPTKTIVTGNLSFHPNRISTYRTS---  355

Query  1101  TVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             TV V G  FM K++  ENTAGPE HQAVALRV +D A+F+NC++D YQDTL
Sbjct  356   TVAVNGDWFMAKDMAFENTAGPEGHQAVALRVSADYAVFYNCRMDGYQDTL  406



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/353 (39%), Positives = 220/353 (62%), Gaps = 24/353 (7%)
 Frame = +3

Query  258   IGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             + +S+KAV  +C+   ++  C + L+ A ++T+ K+LV+  FN  M+++   +  S T++
Sbjct  57    LATSSKAVRSICQMVEYQRACERTLAHA-HTTNPKKLVQTTFNAAMEKLEGALTNSSTIK  115

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTF  617
             AA  D R + A + C+++++ +I D+KR++D+M DH       + ++ ++++WLSGA+T 
Sbjct  116   AAKDDRRNAGALETCKQVVEYAITDLKRSIDQM-DHFDMHKKEE-HVENMRIWLSGAMTS  173

Query  618   ENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRK----L  785
             + TC+E F  T GD+ +KMK  L  +++LT N L++  E+     SL+I+  N K    L
Sbjct  174   QETCIEAFQNTTGDAGEKMKLFLNASRELTSNGLDVATELSTGFKSLNISHQNHKHKRML  233

Query  786   LADS------RSLPVWATAAQRRLLE--AP-VTPDVVVAKDGSGKYKTINEAIPDIPL--  932
             L +         +P W    Q++LL    P V  DVVVAKDGSG +KTI EA+   P+  
Sbjct  234   LEEQGEAKNKEEIPHWVDTKQQKLLHVRGPNVKADVVVAKDGSGNFKTITEALKQAPIID  293

Query  933   ------KSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSE  1094
                    +NK+FVI+IK GVY+E V +   M  V+ +GDGPTKT I+G +++  G+   +
Sbjct  294   ATKVEKGTNKTFVIYIKEGVYEEEVQVEANMWFVMLIGDGPTKTKITGKKNFADGFVLFK  353

Query  1095  TGTVIVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             T TV + G  F+ K+IG EN+AG E HQA+AL VQSD+++F+NC I+ YQDTL
Sbjct  354   TATVSIFGHNFIAKDIGFENSAGAEKHQAIALLVQSDKSVFYNCHINGYQDTL  406



>gb|KEH32301.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=582

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/344 (41%), Positives = 211/344 (61%), Gaps = 12/344 (3%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATNSTDTKELVEVAFNVTMKEISKVMKKS  425
             G+  I  S K V+ +C  T +++ C K L A T + D KEL++ AFN T +E+ K +  S
Sbjct  48    GDNQITKSQKNVKVLCGTTEYKQTCEKSL-AKTGNKDMKELIKQAFNATAEELVKQIHNS  106

Query  426   KTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSG  605
                +  A +  T +A  IC+E+L  ++DD+ +++  + D       +D    D+KVWLSG
Sbjct  107   TLYKELATNDMTKQAMDICKEVLGYAVDDVHQSIHSL-DKFDLN-KIDEIAYDLKVWLSG  164

Query  606   ALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL----  773
              L  + TCL+GF  T   +   M K+L  + +L+ N L++++ +   +  L+++      
Sbjct  165   TLANQQTCLDGFENTTTHAGQTMAKVLNASLELSNNALDIINGLSGFVKDLNLSSFASAL  224

Query  774   --NRKLLADSRSLPVWATAAQRRLLEAP--VTPDVVVAKDGSGKYKTINEAIPDIPLKSN  941
               NRKLL++   LP W + +QR+LL AP  V P+VVVA+DGSG++KT+ EA+  +P K+ 
Sbjct  225   NNNRKLLSED-GLPSWVSQSQRKLLAAPQNVKPNVVVAQDGSGQFKTLTEALATVPKKNK  283

Query  942   KSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGS  1121
               FVIH+KAG+YKE V L     +V  +GDGP KTI +GS+SY  G QT  T T  V  +
Sbjct  284   VPFVIHVKAGIYKEYVALDNHRDHVTIIGDGPKKTIFTGSKSYGDGVQTYNTATFSVNSA  343

Query  1122  GFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              F   N+G EN+AG   HQAVALRV +D+A+F+NC+++ YQDTL
Sbjct  344   HFTAFNVGFENSAGAAKHQAVALRVTADKALFYNCEMNGYQDTL  387



>gb|KHN43318.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=561

 Score =   255 bits (652),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 137/349 (39%), Positives = 211/349 (60%), Gaps = 18/349 (5%)
 Frame = +3

Query  255   NIGSSTKAVEHVCKPTFHREMCVKKL-SAATNSTDTKELVEVAFNVTMKEISKVMKKSKT  431
             ++ SS KAV+ +C PT +++ C   L   A+N TD +EL+++AF+VT+ +I + ++K++ 
Sbjct  27    HVASSMKAVKTLCAPTDYKKECEDNLIEHASNITDPRELIKIAFHVTISKIGEGLEKTQL  86

Query  432   LQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGAL  611
             +     DP T EA   C++L+  SI +  R+LD+         NLD  +  +KVWLSGA+
Sbjct  87    MHEVENDPITKEALDTCKQLMNLSIGEFTRSLDKFAKFDLN--NLDNILTSLKVWLSGAI  144

Query  612   TFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRK---  782
             T++ TCL+ F  T  D+  KM+KLL TA  ++ N L +++E+   L  + +    R+   
Sbjct  145   TYQETCLDAFENTTTDAGQKMQKLLQTAMHMSSNGLSIINELSKTLSEMHVNRPGRRRLL  204

Query  783   -------LLADSRSLPVWA--TAAQRRLLEAP---VTPDVVVAKDGSGKYKTINEAIPDI  926
                    +L     LP W       R+LL          VVVAKDGSG + TINEA+  +
Sbjct  205   NNVDDLPVLGHDFDLPEWVDDRVGVRKLLRMTGRKRMAHVVVAKDGSGNFSTINEALKYV  264

Query  927   PLKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTV  1106
             P K+ + FVI++K GVY E V ++K M +VV +GDG  K+ I+GS++++ G  T  T + 
Sbjct  265   PKKNLRPFVIYVKEGVYNEYVEVSKNMTHVVMIGDGGKKSRITGSKNFIDGVGTYRTASA  324

Query  1107  IVKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              + G  F+G  +G EN+AG E HQAVALRVQ+D++IF+ C++D YQDTL
Sbjct  325   AILGDFFVGIGMGFENSAGAEKHQAVALRVQADRSIFYKCRMDGYQDTL  373



>gb|EPS65387.1| pectinesterase, partial [Genlisea aurea]
Length=553

 Score =   255 bits (651),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 133/336 (40%), Positives = 196/336 (58%), Gaps = 21/336 (6%)
 Frame = +3

Query  279   VEHVCKPTFHREMCVKKLSAATNST-DTKELVEVAFNVTMKEISKVMKKSKTLQAAAKDP  455
             ++ +C  T +++ CV  L  + NST D KEL+E+AF  TM  I+   + S  L+   +DP
Sbjct  45    IDTLCSSTDYKKACVDTLRDSGNSTSDPKELMEIAFRATMDRIAAAGRNSSVLREVQRDP  104

Query  456   RTSEAFKICQELLQDSIDDIKRALDRMVDHAGAG--ANLDLYMNDIKVWLSGALTFENTC  629
             R  EA   C EL + ++ D+ R  ++           N D  + D+K+WLSGA+T++ TC
Sbjct  105   RGREAVDACAELAERAVADLNRTFEKFSKEFSEFDLTNADEVVGDLKIWLSGAVTYQETC  164

Query  630   LEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGL--------NRKL  785
             L+GF G  GD+ D+M+ LL  + Q++ N L M+  +   L S   +           R+L
Sbjct  165   LDGFEGVSGDAGDRMRDLLTLSMQMSSNALAMMTGMQSILSSFSSSSSSAAALGSRRRRL  224

Query  786   LADSRSLPVWATAAQRRLLEAPVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKSFVIHIK  965
             L++   LP              + PD++VAKDGSG +KTINEA+  +P  S K+FV++IK
Sbjct  225   LSEKDDLPKLNI----------MKPDLIVAKDGSGDFKTINEALFKVPENSEKTFVLYIK  274

Query  966   AGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGFMGKNIG  1145
              G+Y+E V +     N++ VGDGP KT I+G  ++V G  T ++ TV V G  F   ++G
Sbjct  275   EGIYEEQVKINSSFTNLLVVGDGPLKTRITGKLNFVNGTTTYQSATVAVHGDRFTAMDVG  334

Query  1146  IENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
              EN AGPE HQAVALRV +D A+F+NC +D YQDTL
Sbjct  335   FENAAGPEGHQAVALRVSADLAVFYNCHMDGYQDTL  370



>ref|XP_007154304.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
 gb|ESW26298.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
Length=588

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 140/348 (40%), Positives = 209/348 (60%), Gaps = 14/348 (4%)
 Frame = +3

Query  246   GNKNIGSSTKAVEHVCKPTFHREMCVKKLSAATN-STDTKELVEVAFNVTMKEISKVMKK  422
             G+  I  + + V+ +C+   ++E C K L  A++ ++D K+L+  AFN T +EI   +K 
Sbjct  48    GDSGIVKNQRNVKVICQSAEYKETCQKSLEKASDENSDLKQLIITAFNATAEEIHSKIKN  107

Query  423   SKTLQAAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLS  602
             S   Q  A D  T +A +ICQE+L  ++DDI ++   +       + L+ Y  D+KVW++
Sbjct  108   STLFQELATDNMTKQAMEICQEVLGYAVDDINKSSATL--EKFDLSMLNEYAYDLKVWIA  165

Query  603   GALTFENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVD---EIHDALVSLDIAGL  773
             G L  + TCL+GF  T  ++   M ++L  + +++ N L++V+    +   L     A  
Sbjct  166   GTLAHQQTCLDGFNHTTTEAGKTMTRVLNASLEMSHNALDIVNGASALFKGLNFTSFAAS  225

Query  774   NRKLLADSR-------SLPVWATAAQRRLLE-APVTPDVVVAKDGSGKYKTINEAIPDIP  929
             NRKLL++           P W T  QR++LE A   PDVVVA DGSG+   I+EA+  +P
Sbjct  226   NRKLLSEEPLVDGLVDGFPSWVTEGQRKILEDANPKPDVVVALDGSGQVTKIHEALKLVP  285

Query  930   LKSNKSFVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVI  1109
               + K FVI+IKAG+Y+E V + K M  V  +GDGPT+T I+G+++YV G QT  T T  
Sbjct  286   KNNKKPFVIYIKAGIYQEYVRMNKHMSFVTMIGDGPTRTRITGNKNYVDGEQTYNTATFG  345

Query  1110  VKGSGFMGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
                + FM KNIG EN+AG E HQAVALRV +D+A+F+NC +D YQDTL
Sbjct  346   ANAANFMAKNIGFENSAGAEKHQAVALRVTADKAVFYNCHMDGYQDTL  393



>ref|XP_008783344.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=570

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 137/342 (40%), Positives = 207/342 (61%), Gaps = 18/342 (5%)
 Frame = +3

Query  264   SSTKAVEHVCKPTFHREMCVKKLSAATNST--DTKELVEVAFNVTMKEISKVMKKSKTLQ  437
             S++KAV+ +C  T +++ C   L+   N++  D KEL++ +    + EIS+    S+ ++
Sbjct  51    STSKAVKMLCASTDYKQTCETSLTKLVNTSTPDPKELLKASVTAVINEISESFSHSRLIK  110

Query  438   AAAKDPRTSEAFKICQELLQDSIDDIKRALDRMVDHAGAGANLDLYMNDIKVWLSGALTF  617
             +   D R  +A   C E+ QDS +D+ + LD+++D  G     D  +N +K WLS    +
Sbjct  111   S--NDSRVQDAINDCWEMYQDSKEDLVKTLDKIID-TGLEHLPDQTLN-LKNWLSAVFFY  166

Query  618   ENTCLEGFLGTEGDSADKMKKLLVTAQQLTGNTLEMVDEIHDALVSLDIAGLNRKLLADS  797
             + TC++GF   EG+  +KM+  + T ++LT N L MV ++ D L  L I   +R+LL+  
Sbjct  167   QETCVDGF--PEGELKNKMRSAMKTTKELTSNALAMVGQVSDILTMLGIPSFSRRLLSVE  224

Query  798   ------RSLPVWATAAQRRLLE----APVTPDVVVAKDGSGKYKTINEAIPDIPLKSNKS  947
                   R  P W +   RRLL+      + P+V VAKDGSG + TIN+AI +IPLK +  
Sbjct  225   DRPVMKRGYPSWVSKRDRRLLKEYLKVKLNPNVTVAKDGSGNFSTINDAIRNIPLKHDGR  284

Query  948   FVIHIKAGVYKENVVLTKKMMNVVFVGDGPTKTIISGSRSYVGGYQTSETGTVIVKGSGF  1127
             +VI+IK G+Y E V LT    N+   GDGP KTI++G+++   G +TS T T +  G GF
Sbjct  285   YVIYIKEGIYNEAVNLTSAYANITVYGDGPKKTIVTGNKNVKDGTKTSHTATFVASGDGF  344

Query  1128  MGKNIGIENTAGPENHQAVALRVQSDQAIFHNCQIDAYQDTL  1253
             M  ++G  NTAGPE  QAVALRVQSD++IF NC+++ YQDTL
Sbjct  345   MAIDMGFHNTAGPEKEQAVALRVQSDRSIFLNCRMEGYQDTL  386



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3177808337144