BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21179_g3_i1 len=1553 path=[8875:0-1439 3294:1440-1466
3319:1467-1552]

Length=1553
                                                                      Score     E

emb|CAN61823.1|  hypothetical protein VITISV_008493                     281   3e-85   Vitis vinifera
emb|CAN61230.1|  hypothetical protein VITISV_010115                     277   5e-83   Vitis vinifera
emb|CAN66005.1|  hypothetical protein VITISV_027449                     278   2e-80   Vitis vinifera
emb|CAN69370.1|  hypothetical protein VITISV_010057                     270   6e-79   Vitis vinifera
gb|AAD22324.1|  putative retroelement pol polyprotein                   256   7e-76   Arabidopsis thaliana [mouse-ear cress]
emb|CAN71676.1|  hypothetical protein VITISV_015838                     270   2e-75   Vitis vinifera
emb|CAN76493.1|  hypothetical protein VITISV_007584                     263   1e-73   Vitis vinifera
gb|KFK45117.1|  hypothetical protein AALP_AA1G346500                    259   5e-72   
emb|CAN68364.1|  hypothetical protein VITISV_021899                     246   1e-71   Vitis vinifera
emb|CAN62863.1|  hypothetical protein VITISV_030334                     258   4e-71   Vitis vinifera
gb|KFK44388.1|  hypothetical protein AALP_AA1G251100                    259   4e-71   
gb|AAF99727.1|AC004557_6  F17L21.7                                      258   5e-71   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA78424.1|  polyprotein                                            257   7e-71   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM42650.1|  Polyprotein                                            257   1e-70   
gb|AAC79110.1|  putative polyprotein of LTR transposon                  257   1e-70   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM42646.1|  polyprotein                                            257   1e-70   
emb|CAN73909.1|  hypothetical protein VITISV_029162                     245   6e-70   Vitis vinifera
dbj|BAA78426.1|  polyprotein                                            254   7e-70   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM42649.1|  Polyprotein                                            254   7e-70   
emb|CAN70817.1|  hypothetical protein VITISV_029336                     252   8e-70   Vitis vinifera
gb|AAK43485.1|AC084807_10  polyprotein, putative                        254   1e-69   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM42647.1|  polyprotein                                            254   1e-69   
dbj|BAM44534.1|  polyprotein                                            253   2e-69   
dbj|BAB10876.1|  polyprotein                                            253   2e-69   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM44535.1|  polyprotein                                            253   2e-69   
dbj|BAA78423.1|  polyprotein                                            253   2e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AAK62793.1|AC027036_14  polyprotein, putative                        253   2e-69   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK41511.1|  polyprotein                                            253   2e-69   
gb|AAK62788.1|AC027036_9  polyprotein, putative                         253   3e-69   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA78425.1|  polyprotein                                            252   5e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CAN65555.1|  hypothetical protein VITISV_009833                     235   1e-68   Vitis vinifera
dbj|BAK41507.1|  polyprotein                                            250   2e-68   
ref|XP_009772944.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    247   3e-68   
gb|AAC02664.1|  polyprotein                                             249   5e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CAA16691.1|  retrotransposon - like protein                         245   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145096.1|  PREDICTED: uncharacterized protein LOC103868780    249   1e-67   
emb|CAN67588.1|  hypothetical protein VITISV_036280                     247   2e-67   Vitis vinifera
ref|XP_010686475.1|  PREDICTED: uncharacterized protein LOC104900682    249   3e-67   
gb|AAC02669.1|  polyprotein                                             246   4e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AAC02666.1|  polyprotein                                             246   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002444548.1|  hypothetical protein SORBIDRAFT_07g023610          241   5e-67   Sorghum bicolor [broomcorn]
emb|CAB46043.1|  retrotransposon like protein                           245   1e-66   Arabidopsis thaliana [mouse-ear cress]
emb|CAN66863.1|  hypothetical protein VITISV_013500                     243   2e-66   Vitis vinifera
gb|KFK33814.1|  hypothetical protein AALP_AA5G063400                    236   2e-66   
gb|KFK29449.1|  hypothetical protein AALP_AA7G135900                    235   6e-66   
emb|CAN73071.1|  hypothetical protein VITISV_032383                     242   7e-66   Vitis vinifera
gb|EEC76475.1|  hypothetical protein OsI_14210                          229   8e-66   Oryza sativa Indica Group [Indian rice]
gb|AAP20859.1|  retrotransposon protein, putative, Ty1-copia sub-...    228   2e-65   Oryza sativa Japonica Group [Japonica rice]
ref|YP_514636.1|  hypothetical protein OrsaiPp07                        229   1e-64   Oryza sativa Indica Group [Indian rice]
ref|YP_002000554.1|  orf490                                             229   1e-64   Oryza sativa Japonica Group [Japonica rice]
emb|CAN75351.1|  hypothetical protein VITISV_031045                     223   1e-64   Vitis vinifera
gb|KHN05629.1|  Retrovirus-related Pol polyprotein from transposo...    238   2e-64   
gb|ABA95366.1|  retrotransposon protein, putative, Ty1-copia subc...    229   4e-64   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83506.1|  hypothetical protein VITISV_027576                     236   7e-64   Vitis vinifera
gb|KHN17953.1|  Retrovirus-related Pol polyprotein from transposo...    236   1e-63   
ref|XP_002453623.1|  hypothetical protein SORBIDRAFT_04g009135          233   1e-63   Sorghum bicolor [broomcorn]
emb|CAN65591.1|  hypothetical protein VITISV_042091                     236   2e-63   Vitis vinifera
emb|CAE04646.2|  OSJNBa0061G20.2                                        226   3e-63   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001175678.1|  Os08g0544300                                       231   5e-63   
emb|CAN61640.1|  hypothetical protein VITISV_021909                     234   5e-63   Vitis vinifera
gb|AAK02020.2|AC074283_1  Putative gag-pol polyprotein                  231   1e-62   Oryza sativa [red rice]
ref|XP_002489074.1|  hypothetical protein SORBIDRAFT_0139s002040        234   1e-62   Sorghum bicolor [broomcorn]
gb|AEJ07956.1|  putative polyprotein                                    224   2e-62   
ref|XP_002460196.1|  hypothetical protein SORBIDRAFT_02g024427          233   3e-62   Sorghum bicolor [broomcorn]
ref|XP_002438095.1|  hypothetical protein SORBIDRAFT_10g007953          232   3e-62   Sorghum bicolor [broomcorn]
ref|XP_002456118.1|  hypothetical protein SORBIDRAFT_03g030787          232   4e-62   Sorghum bicolor [broomcorn]
emb|CAN61827.1|  hypothetical protein VITISV_027629                     225   6e-62   Vitis vinifera
ref|XP_008350549.1|  PREDICTED: uncharacterized protein LOC103413885    231   8e-62   
gb|ACY72569.1|  unknown                                                 230   1e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009604985.1|  PREDICTED: uncharacterized protein LOC104099639    227   2e-61   
emb|CAN64509.1|  hypothetical protein VITISV_041217                     229   2e-61   Vitis vinifera
emb|CAN79884.1|  hypothetical protein VITISV_002539                     229   2e-61   Vitis vinifera
ref|XP_007019438.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    222   4e-61   
emb|CAH67061.1|  H0112G12.6                                             225   4e-61   Oryza sativa [red rice]
gb|AAR88589.1|  putative copia-like retrotransposon protein             228   5e-61   Oryza sativa Japonica Group [Japonica rice]
gb|KHN21230.1|  Retrovirus-related Pol polyprotein from transposo...    228   6e-61   
gb|ACF87376.2|  unknown                                                 220   6e-61   Zea mays [maize]
ref|XP_002449547.1|  hypothetical protein SORBIDRAFT_05g018930          222   9e-61   Sorghum bicolor [broomcorn]
ref|XP_008356535.1|  PREDICTED: uncharacterized protein LOC103420252    228   1e-60   
gb|AAK55460.1|AC069300_15  putative gag-pol polyprotein                 226   1e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002489126.1|  hypothetical protein SORBIDRAFT_0019s003280        224   1e-60   Sorghum bicolor [broomcorn]
ref|XP_002455933.1|  hypothetical protein SORBIDRAFT_03g027495          222   2e-60   Sorghum bicolor [broomcorn]
emb|CCH50966.1|  T4.5                                                   228   2e-60   
emb|CAN60276.1|  hypothetical protein VITISV_028253                     220   2e-60   Vitis vinifera
emb|CAR66103.1|  RT-RNaseH                                              216   2e-60   Triticum turgidum subsp. durum
ref|NP_001174286.1|  Os05g0235100                                       224   2e-60   
ref|XP_004963727.1|  PREDICTED: uncharacterized protein LOC101777694    226   5e-60   
ref|XP_010541762.1|  PREDICTED: retrovirus-related Pol polyprotei...    222   7e-60   
ref|XP_004986808.1|  PREDICTED: uncharacterized protein LOC101773259    226   1e-59   
gb|AAT85031.1|  putative polyprotein                                    225   1e-59   Oryza sativa Japonica Group [Japonica rice]
gb|AAL66754.1|AF464738_5  putative copia-like retrotransposon Hop...    224   1e-59   Zea mays [maize]
gb|ACA61613.1|  hypothetical protein AP2_E11.1                          214   2e-59   Arabidopsis lyrata subsp. petraea
ref|XP_002444329.1|  hypothetical protein SORBIDRAFT_07g020255          221   2e-59   Sorghum bicolor [broomcorn]
ref|XP_010684978.1|  PREDICTED: uncharacterized protein LOC104899479    224   2e-59   
gb|AAT93988.1|  putative polyprotein                                    224   3e-59   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95721.1|  retrotransposon protein, putative, Ty1-copia subc...    221   3e-59   Oryza sativa Japonica Group [Japonica rice]
gb|AAU10819.1|  putative polyprotein                                    224   3e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008376990.1|  PREDICTED: uncharacterized protein LOC103440084    222   4e-59   
emb|CAN72527.1|  hypothetical protein VITISV_009255                     221   4e-59   Vitis vinifera
gb|AAD22155.1|AF061282_8  polyprotein                                   221   5e-59   Sorghum bicolor [broomcorn]
emb|CAN81099.1|  hypothetical protein VITISV_017741                     223   7e-59   Vitis vinifera
gb|AAT07563.1|  putative polyprotein                                    223   7e-59   Oryza sativa Japonica Group [Japonica rice]
gb|ACP30598.1|  disease resistance protein                              223   7e-59   Brassica rapa subsp. pekinensis [bai cai]
gb|AAP53968.1|  retrotransposon protein, putative, Ty1-copia subc...    219   8e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006595215.1|  PREDICTED: uncharacterized mitochondrial pro...    207   8e-59   
emb|CAN76473.1|  hypothetical protein VITISV_016007                     220   9e-59   Vitis vinifera
gb|AAL34933.1|AC079037_6  Putative gag-pol polyprotein                  218   1e-58   Oryza sativa [red rice]
ref|XP_008228040.1|  PREDICTED: uncharacterized protein LOC103327479    220   1e-58   
emb|CAN69344.1|  hypothetical protein VITISV_006017                     210   1e-58   Vitis vinifera
gb|AAN06870.1|  Putative gag-pol polyprotein                            221   2e-58   Oryza sativa Japonica Group [Japonica rice]
gb|AAK53860.1|AC016781_14  Putative retroelement                        220   2e-58   Oryza sativa Japonica Group [Japonica rice]
emb|CAN81355.1|  hypothetical protein VITISV_039158                     221   2e-58   Vitis vinifera
emb|CAA19715.1|  putative protein                                       221   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KHN41724.1|  Copia protein                                           206   2e-58   
gb|AAU43956.1|  unknown protein                                         221   2e-58   Oryza sativa Japonica Group [Japonica rice]
gb|AAT69582.1|  putative polyprotein                                    220   3e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004966848.1|  PREDICTED: uncharacterized protein LOC101777861    221   3e-58   
ref|XP_010555983.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    221   3e-58   
emb|CAN62447.1|  hypothetical protein VITISV_024007                     219   5e-58   Vitis vinifera
ref|XP_008349120.1|  PREDICTED: uncharacterized protein LOC103412315    219   5e-58   
gb|AAK51235.1|AF287471_1  polyprotein                                   219   6e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006605007.1|  PREDICTED: uncharacterized mitochondrial pro...    206   7e-58   
gb|AAL86510.1|AC099040_14  putative retrotransposon protein             218   7e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004292511.1|  PREDICTED: uncharacterized mitochondrial pro...    205   7e-58   
gb|ABA98049.1|  retrotransposon protein, putative, Ty1-copia subc...    219   8e-58   Oryza sativa Japonica Group [Japonica rice]
emb|CAN69851.1|  hypothetical protein VITISV_009554                     219   9e-58   Vitis vinifera
gb|AAB82754.1|  retrofit                                                219   9e-58   Oryza longistaminata [long-staminate rice]
gb|ABB47033.2|  retrotransposon protein, putative, Ty1-copia subc...    218   9e-58   Oryza sativa Japonica Group [Japonica rice]
gb|AAM18766.1|AC099325_22  putative copia-like retrotransposon Ho...    218   1e-57   Oryza sativa Japonica Group [Japonica rice]
emb|CAN80475.1|  hypothetical protein VITISV_027529                     207   1e-57   Vitis vinifera
pir||T02087  gag/pol polyprotein - maize retrotransposon Hopscotch      219   1e-57
emb|CAN81057.1|  hypothetical protein VITISV_033321                     206   1e-57   Vitis vinifera
ref|XP_004963982.1|  PREDICTED: uncharacterized protein LOC101777276    218   1e-57   
ref|XP_010669333.1|  PREDICTED: copia protein isoform X1                216   1e-57   
gb|ABF97142.1|  retrotransposon protein, putative, Ty1-copia subc...    213   1e-57   Oryza sativa Japonica Group [Japonica rice]
emb|CAN59952.1|  hypothetical protein VITISV_006720                     218   2e-57   Vitis vinifera
emb|CAA19714.1|  putative protein                                       215   2e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CAN67403.1|  hypothetical protein VITISV_025614                     217   3e-57   Vitis vinifera
emb|CAN83392.1|  hypothetical protein VITISV_041406                     217   3e-57   Vitis vinifera
gb|AAM08751.1|AC025098_18  Putative copia-type polyprotein              218   4e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006465491.1|  PREDICTED: uncharacterized protein LOC102624640    217   5e-57   
emb|CAN69838.1|  hypothetical protein VITISV_008389                     204   6e-57   Vitis vinifera
ref|XP_008389560.1|  PREDICTED: uncharacterized protein LOC103451895    216   6e-57   
emb|CAN71108.1|  hypothetical protein VITISV_001478                     216   7e-57   Vitis vinifera
gb|ABA93844.2|  retrotransposon protein, putative, unclassified         215   9e-57   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83285.1|  hypothetical protein VITISV_004139                     216   1e-56   Vitis vinifera
dbj|BAB90546.1|  putative rice retrotransposon retrofit gag/pol p...    216   1e-56   Oryza sativa Japonica Group [Japonica rice]
gb|AAO26690.1|AF478377_1  gag-pol polyprotein                           203   1e-56   Vitis vinifera
ref|XP_008387250.1|  PREDICTED: uncharacterized protein LOC103449699    216   1e-56   
emb|CAN73437.1|  hypothetical protein VITISV_031733                     216   1e-56   Vitis vinifera
ref|XP_008359393.1|  PREDICTED: uncharacterized protein LOC103423104    216   1e-56   
gb|KHN30958.1|  Retrovirus-related Pol polyprotein from transposo...    215   1e-56   
emb|CAB40035.1|  retrotransposon like protein                           216   2e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAC35532.1|  contains similarity to proteases                        215   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008386299.1|  PREDICTED: uncharacterized protein LOC103448812    215   2e-56   
gb|AAD21687.1|  Strong similarity to gi|3600044 T12H20.12 proteas...    215   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008358596.1|  PREDICTED: uncharacterized protein LOC103422324    214   2e-56   
ref|XP_004294137.1|  PREDICTED: uncharacterized mitochondrial pro...    202   2e-56   
gb|KHN45997.1|  Retrovirus-related Pol polyprotein from transposo...    214   2e-56   
dbj|BAK64102.1|  gag-pol polyprotein                                    215   2e-56   
ref|XP_010683797.1|  PREDICTED: uncharacterized protein LOC104898410    214   2e-56   
gb|ABF95666.1|  retrotransposon protein, putative, Ty1-copia subc...    213   2e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008341155.1|  PREDICTED: uncharacterized protein LOC103404078    213   3e-56   
ref|XP_010493723.1|  PREDICTED: uncharacterized protein LOC104770945    211   3e-56   
emb|CAN70361.1|  hypothetical protein VITISV_033646                     213   3e-56   Vitis vinifera
emb|CAN67546.1|  hypothetical protein VITISV_027734                     215   3e-56   Vitis vinifera
ref|XP_008356672.1|  PREDICTED: uncharacterized protein LOC103420386    214   4e-56   
gb|ACV42639.1|  gag/pol                                                 214   4e-56   
gb|EPS67678.1|  hypothetical protein M569_07096                         211   4e-56   
ref|XP_010665060.1|  PREDICTED: uncharacterized protein LOC104882664    211   4e-56   
emb|CAN81985.1|  hypothetical protein VITISV_001567                     202   5e-56   Vitis vinifera
emb|CAN65808.1|  hypothetical protein VITISV_033389                     212   2e-55   Vitis vinifera
gb|AID60162.1|  copia-like LTR-retrotransposon                          207   2e-55   
ref|XP_009359358.1|  PREDICTED: uncharacterized protein LOC103949948    212   2e-55   
gb|AAO26684.1|AF478370_1  gag-pol polyprotein                           200   2e-55   Vitis vinifera
emb|CAN60203.1|  hypothetical protein VITISV_036059                     212   2e-55   Vitis vinifera
ref|XP_002445301.1|  hypothetical protein SORBIDRAFT_07g008525          207   2e-55   Sorghum bicolor [broomcorn]
ref|XP_010534024.1|  PREDICTED: uncharacterized protein LOC104809678    213   3e-55   
ref|XP_010039234.1|  PREDICTED: uncharacterized protein LOC104427926    209   3e-55   
ref|XP_002457887.1|  hypothetical protein SORBIDRAFT_03g018791          207   4e-55   Sorghum bicolor [broomcorn]
emb|CAN83877.1|  hypothetical protein VITISV_014760                     207   4e-55   Vitis vinifera
emb|CAN64963.1|  hypothetical protein VITISV_002891                     211   5e-55   Vitis vinifera
emb|CAN70115.1|  hypothetical protein VITISV_020105                     206   6e-55   Vitis vinifera
gb|AID60119.1|  hypothetical protein                                    208   6e-55   
gb|AAO26683.1|AF478369_1  gag-pol polyprotein                           198   7e-55   Vitis vinifera
emb|CAE03643.1|  OSJNBa0060N03.8                                        199   8e-55   Oryza sativa Japonica Group [Japonica rice]
gb|KDP32454.1|  hypothetical protein JCGZ_13379                         195   1e-54   
ref|XP_010065142.1|  PREDICTED: uncharacterized protein LOC104452376    209   1e-54   
gb|ABA99152.1|  retrotransposon protein, putative, unclassified         207   2e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002446435.1|  hypothetical protein SORBIDRAFT_06g016046          207   2e-54   Sorghum bicolor [broomcorn]
emb|CAN62227.1|  hypothetical protein VITISV_008101                     202   2e-54   Vitis vinifera
gb|KHN22040.1|  Retrovirus-related Pol polyprotein from transposo...    209   2e-54   
gb|KHN36156.1|  Retrovirus-related Pol polyprotein from transposo...    209   2e-54   
ref|XP_006493639.1|  PREDICTED: LRR receptor-like serine/threonin...    209   2e-54   
emb|CAN75041.1|  hypothetical protein VITISV_027174                     209   2e-54   Vitis vinifera
emb|CAN59963.1|  hypothetical protein VITISV_022756                     202   2e-54   Vitis vinifera
emb|CAE05417.1|  OSJNBa0035I04.5                                        209   2e-54   Oryza sativa [red rice]
gb|ABA97658.1|  retrotransposon protein, putative, Ty1-copia subc...    209   2e-54   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83125.1|  hypothetical protein VITISV_015109                     209   2e-54   Vitis vinifera
emb|CAN80320.1|  hypothetical protein VITISV_034560                     209   2e-54   Vitis vinifera
gb|AAG09097.1|AC009323_8  Putative retroelement polyprotein             209   3e-54   Arabidopsis thaliana [mouse-ear cress]
gb|ABF94964.1|  retrotransposon protein, putative, Ty1-copia subc...    206   3e-54   Oryza sativa Japonica Group [Japonica rice]
emb|CAN78451.1|  hypothetical protein VITISV_005945                     206   3e-54   Vitis vinifera
gb|EMT21953.1|  ABC transporter C family member 10                      210   3e-54   
emb|CAH66488.1|  OSIGBa0076I14.9                                        209   3e-54   Oryza sativa [red rice]
ref|XP_008342226.1|  PREDICTED: uncharacterized protein LOC103405031    207   4e-54   
emb|CAN63683.1|  hypothetical protein VITISV_030301                     208   4e-54   Vitis vinifera
gb|ABA93730.1|  retrotransposon protein, putative, unclassified         204   5e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010527127.1|  PREDICTED: uncharacterized protein LOC104804512    207   6e-54   
gb|ABF96081.1|  retrotransposon protein, putative, Ty1-copia subc...    207   6e-54   Oryza sativa Japonica Group [Japonica rice]
emb|CAN69190.1|  hypothetical protein VITISV_001578                     207   7e-54   Vitis vinifera
emb|CAN65108.1|  hypothetical protein VITISV_036622                     202   7e-54   Vitis vinifera
ref|XP_002442174.1|  hypothetical protein SORBIDRAFT_08g015513          204   8e-54   Sorghum bicolor [broomcorn]
emb|CAN65233.1|  hypothetical protein VITISV_022975                     207   1e-53   Vitis vinifera
ref|XP_006577466.1|  PREDICTED: uncharacterized mitochondrial pro...    197   1e-53   
emb|CAN68148.1|  hypothetical protein VITISV_035665                     207   1e-53   Vitis vinifera
emb|CAN65942.1|  hypothetical protein VITISV_001716                     207   1e-53   Vitis vinifera
ref|XP_008365969.1|  PREDICTED: uncharacterized protein LOC103429605    206   2e-53   
gb|AAD43604.1|AC005698_3  T3P18.3                                       206   2e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CAN73924.1|  hypothetical protein VITISV_041509                     207   2e-53   Vitis vinifera
emb|CAC37623.1|  copia-like polyprotein                                 207   2e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CAN61322.1|  hypothetical protein VITISV_012106                     206   2e-53   Vitis vinifera
emb|CAN71427.1|  hypothetical protein VITISV_027864                     206   2e-53   Vitis vinifera
emb|CAN73624.1|  hypothetical protein VITISV_042460                     206   2e-53   Vitis vinifera
gb|ABA95797.1|  retrotransposon protein, putative, unclassified         206   2e-53   Oryza sativa Japonica Group [Japonica rice]
emb|CAN62906.1|  hypothetical protein VITISV_043610                     206   3e-53   Vitis vinifera
emb|CAN82483.1|  hypothetical protein VITISV_006799                     205   3e-53   Vitis vinifera
ref|XP_007044242.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    206   4e-53   
ref|XP_008360651.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    202   4e-53   
emb|CAN62394.1|  hypothetical protein VITISV_021305                     205   4e-53   Vitis vinifera
emb|CAN72277.1|  hypothetical protein VITISV_043408                     195   5e-53   Vitis vinifera
emb|CAN69367.1|  hypothetical protein VITISV_035520                     204   6e-53   Vitis vinifera
ref|XP_010666841.1|  PREDICTED: uncharacterized protein LOC104883959    202   6e-53   
emb|CAN69607.1|  hypothetical protein VITISV_009561                     204   6e-53   Vitis vinifera
ref|XP_008337174.1|  PREDICTED: ankyrin repeat-containing protein...    201   7e-53   
emb|CAN68711.1|  hypothetical protein VITISV_015847                     204   7e-53   Vitis vinifera
emb|CAN80558.1|  hypothetical protein VITISV_023041                     202   7e-53   Vitis vinifera
ref|XP_008358376.1|  PREDICTED: uncharacterized protein LOC103422119    204   7e-53   
ref|XP_006576040.1|  PREDICTED: uncharacterized mitochondrial pro...    192   9e-53   
ref|XP_008348842.1|  PREDICTED: uncharacterized protein LOC103412011    205   1e-52   
gb|AAP21414.1|  putative polyprotein                                    204   1e-52   Oryza sativa Japonica Group [Japonica rice]
emb|CAN75478.1|  hypothetical protein VITISV_020209                     203   1e-52   Vitis vinifera
emb|CAN74499.1|  hypothetical protein VITISV_013001                     202   1e-52   Vitis vinifera
ref|XP_002445564.1|  hypothetical protein SORBIDRAFT_07g021665          199   1e-52   Sorghum bicolor [broomcorn]
emb|CAN82526.1|  hypothetical protein VITISV_028058                     203   1e-52   Vitis vinifera
ref|XP_008345130.1|  PREDICTED: uncharacterized protein LOC103408038    204   2e-52   
emb|CAN72673.1|  hypothetical protein VITISV_024842                     195   2e-52   Vitis vinifera
ref|XP_004304542.1|  PREDICTED: uncharacterized mitochondrial pro...    192   2e-52   
ref|XP_006603195.1|  PREDICTED: uncharacterized mitochondrial pro...    191   2e-52   
emb|CAN61340.1|  hypothetical protein VITISV_007301                     201   2e-52   Vitis vinifera
emb|CAN69715.1|  hypothetical protein VITISV_011263                     202   2e-52   Vitis vinifera
emb|CAN60373.1|  hypothetical protein VITISV_034932                     203   2e-52   Vitis vinifera
emb|CAN73399.1|  hypothetical protein VITISV_006541                     200   2e-52   Vitis vinifera
gb|AAG12528.1|AC015446_9  Hypothetical Protein                          199   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007019411.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    202   2e-52   
gb|AAF02855.1|AC009324_4  Similar to retrotransposon proteins           203   3e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KHN23712.1|  Retrovirus-related Pol polyprotein from transposo...    189   3e-52   
emb|CAN61004.1|  hypothetical protein VITISV_015023                     201   3e-52   Vitis vinifera
emb|CAN83015.1|  hypothetical protein VITISV_041694                     202   4e-52   Vitis vinifera
emb|CAN83352.1|  hypothetical protein VITISV_022160                     202   4e-52   Vitis vinifera
ref|XP_008381548.1|  PREDICTED: uncharacterized protein LOC103444402    202   4e-52   
gb|AAD26943.1|  putative retroelement pol polyprotein                   202   4e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CAN62623.1|  hypothetical protein VITISV_001656                     202   4e-52   Vitis vinifera
ref|XP_006604978.1|  PREDICTED: uncharacterized mitochondrial pro...    191   5e-52   
ref|XP_008337255.1|  PREDICTED: retrovirus-related Pol polyprotei...    202   6e-52   
emb|CAN74430.1|  hypothetical protein VITISV_010987                     202   6e-52   Vitis vinifera
ref|XP_010655804.1|  PREDICTED: uncharacterized protein LOC104880556    200   8e-52   
ref|XP_006339297.1|  PREDICTED: uncharacterized protein LOC102605337    202   9e-52   
emb|CAN69647.1|  hypothetical protein VITISV_022133                     202   1e-51   Vitis vinifera
emb|CAN77113.1|  hypothetical protein VITISV_042189                     189   1e-51   Vitis vinifera
gb|AAT38786.2|  Gag-pol polyprotein, putative                           201   1e-51   Solanum demissum
gb|AAC02672.1|  polyprotein                                             201   1e-51   Arabidopsis arenosa
gb|ADB85329.1|  putative retrotransposon protein                        190   1e-51   Phyllostachys edulis [kikko-chiku]
ref|XP_008374297.1|  PREDICTED: uncharacterized protein LOC103437591    200   2e-51   
emb|CAN79872.1|  hypothetical protein VITISV_017186                     198   2e-51   Vitis vinifera
ref|XP_008366454.1|  PREDICTED: uncharacterized protein LOC103430102    195   2e-51   
emb|CAN73272.1|  hypothetical protein VITISV_013115                     199   2e-51   Vitis vinifera
gb|ABY49842.1|  hypothetical protein                                    200   2e-51   Vitis hybrid cultivar
ref|XP_004971463.1|  PREDICTED: uncharacterized mitochondrial pro...    190   3e-51   
gb|AAX96193.1|  retrotransposon protein, putative, Ty1-copia sub-...    200   3e-51   
emb|CAN75466.1|  hypothetical protein VITISV_025054                     200   3e-51   
ref|XP_002489309.1|  hypothetical protein SORBIDRAFT_0010s008890        198   3e-51   
emb|CAN77222.1|  hypothetical protein VITISV_010482                     189   3e-51   
emb|CAN68489.1|  hypothetical protein VITISV_037543                     200   3e-51   
emb|CAN74532.1|  hypothetical protein VITISV_019849                     193   3e-51   
gb|AAF97297.1|AC010164_19  Hypothetical protein                         188   3e-51   
emb|CAN67780.1|  hypothetical protein VITISV_006406                     189   4e-51   
emb|CAN73395.1|  hypothetical protein VITISV_003815                     198   4e-51   
ref|XP_008347300.1|  PREDICTED: uncharacterized protein LOC103410364    199   4e-51   
emb|CAN61858.1|  hypothetical protein VITISV_016691                     196   5e-51   
gb|AAD25646.1|  putative retroelement pol polyprotein                   199   6e-51   
ref|XP_006584292.1|  PREDICTED: uncharacterized protein LOC102668041    198   6e-51   
emb|CAB42059.1|  Tpv2-1c                                                189   7e-51   
emb|CAN83871.1|  hypothetical protein VITISV_044470                     184   7e-51   
gb|KHN01991.1|  Retrovirus-related Pol polyprotein from transposo...    199   7e-51   
emb|CAN60374.1|  hypothetical protein VITISV_001215                     199   9e-51   
gb|AAF79259.1|AC023279_8  F12K21.14                                     190   1e-50   
ref|XP_010662484.1|  PREDICTED: uncharacterized protein LOC104882143    198   1e-50   
emb|CAN65230.1|  hypothetical protein VITISV_034221                     191   1e-50   
emb|CAN72498.1|  hypothetical protein VITISV_010513                     198   1e-50   
ref|XP_007030765.1|  Uncharacterized protein TCM_026511                 198   1e-50   
emb|CAN79573.1|  hypothetical protein VITISV_017340                     186   1e-50   
gb|ABA98286.2|  retrotransposon protein, putative, Ty1-copia subc...    198   1e-50   
ref|XP_003597218.1|  Beta-galactosidase                                 198   2e-50   
gb|AAD41979.1|  putative retroelement pol polyprotein                   197   2e-50   
ref|XP_010647148.1|  PREDICTED: uncharacterized protein LOC104878438    195   2e-50   
emb|CAB10381.1|  retrotransposon like protein                           186   2e-50   
gb|ABR67407.1|  integrase                                               197   2e-50   
emb|CAN83455.1|  hypothetical protein VITISV_029958                     190   2e-50   
ref|XP_008342448.1|  PREDICTED: uncharacterized protein LOC103405249    196   2e-50   
ref|XP_007030531.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    186   2e-50   
ref|XP_009354183.1|  PREDICTED: uncharacterized protein LOC103945350    197   3e-50   
ref|XP_008228903.1|  PREDICTED: uncharacterized protein LOC103328294    196   4e-50   
ref|XP_006494841.1|  PREDICTED: uncharacterized protein LOC102608996    197   4e-50   
emb|CAN65603.1|  hypothetical protein VITISV_021511                     190   4e-50   
emb|CAN79061.1|  hypothetical protein VITISV_024577                     196   4e-50   
gb|AAG13591.2|AC051633_7  putative gag/pol polyprotein                  196   5e-50   
ref|XP_004172502.1|  PREDICTED: uncharacterized mitochondrial pro...    184   5e-50   
emb|CAN71189.1|  hypothetical protein VITISV_005044                     186   6e-50   
emb|CAN76196.1|  hypothetical protein VITISV_041073                     196   6e-50   
gb|ABG22578.1|  retrotransposon protein, putative, unclassified         193   6e-50   
emb|CAN76078.1|  hypothetical protein VITISV_008973                     195   6e-50   
emb|CAN66496.1|  hypothetical protein VITISV_036886                     195   6e-50   
gb|AAT38797.2|  Polyprotein, putative                                   196   7e-50   
gb|AAG52211.1|AC022288_10  hypothetical protein; 74056-75837            189   7e-50   
emb|CAN60617.1|  hypothetical protein VITISV_003256                     189   7e-50   
ref|XP_008389883.1|  PREDICTED: uncharacterized protein LOC103452157    195   8e-50   
emb|CAN61658.1|  hypothetical protein VITISV_040310                     196   8e-50   
emb|CAN76179.1|  hypothetical protein VITISV_022751                     192   8e-50   
emb|CAN61982.1|  hypothetical protein VITISV_021615                     183   9e-50   
gb|AFN88207.1|  integrase core domain containing protein                195   9e-50   
gb|AAD17409.1|  putative retroelement pol polyprotein                   195   1e-49   
gb|KHN31153.1|  Copia protein                                           184   1e-49   
ref|XP_002489193.1|  hypothetical protein SORBIDRAFT_0013s009070        195   1e-49   
dbj|BAB11200.1|  copia-type polyprotein                                 195   1e-49   
gb|AAG51247.1|AC055769_6  copia-type polyprotein, putative; 28768...    195   1e-49   
emb|CAN64418.1|  hypothetical protein VITISV_030041                     195   1e-49   
gb|AAG10812.1|AC018460_6  Putative retroelement polyprotein             195   1e-49   
emb|CAN72663.1|  hypothetical protein VITISV_031849                     193   1e-49   
emb|CAN75973.1|  hypothetical protein VITISV_019857                     191   1e-49   
ref|XP_007010924.1|  Copia-like retrotransposable element, putative     194   2e-49   
emb|CAN67362.1|  hypothetical protein VITISV_001157                     194   2e-49   
emb|CAN81715.1|  hypothetical protein VITISV_032902                     192   2e-49   
emb|CAN61207.1|  hypothetical protein VITISV_015446                     192   3e-49   
emb|CAN76326.1|  hypothetical protein VITISV_014220                     193   3e-49   
emb|CAN67338.1|  hypothetical protein VITISV_016115                     192   4e-49   
emb|CAN82928.1|  hypothetical protein VITISV_025045                     194   4e-49   
emb|CAN64816.1|  hypothetical protein VITISV_010668                     193   4e-49   
emb|CAN72886.1|  hypothetical protein VITISV_019713                     194   4e-49   
gb|ABA95230.1|  retrotransposon protein, putative, unclassified         191   4e-49   
gb|AAG46116.1|AC073166_14  putative copia-like retrotransposon po...    193   5e-49   
emb|CAB75932.1|  putative protein                                       193   5e-49   
emb|CAN72132.1|  hypothetical protein VITISV_040707                     190   5e-49   
emb|CAN62614.1|  hypothetical protein VITISV_028123                     192   5e-49   
emb|CAN68802.1|  hypothetical protein VITISV_008809                     193   5e-49   
ref|XP_010451381.1|  PREDICTED: uncharacterized protein LOC104733506    193   6e-49   
ref|XP_008650136.1|  PREDICTED: uncharacterized protein LOC103630871    192   6e-49   
gb|AFP55546.1|  gag-pol polyprotein                                     192   6e-49   
gb|KHN45218.1|  Putative mitochondrial protein                          181   7e-49   
ref|XP_010513561.1|  PREDICTED: copia protein                           186   7e-49   
emb|CAB40067.1|  putative retrotransposon polyprotein                   192   7e-49   
emb|CAN72018.1|  hypothetical protein VITISV_001841                     192   7e-49   
emb|CAN71595.1|  hypothetical protein VITISV_010143                     193   7e-49   
ref|XP_007021177.1|  Uncharacterized protein TCM_031224                 194   8e-49   
emb|CAN72054.1|  hypothetical protein VITISV_031315                     192   8e-49   
emb|CAN75312.1|  hypothetical protein VITISV_033326                     182   1e-48   
emb|CAN70689.1|  hypothetical protein VITISV_012155                     192   1e-48   
ref|XP_004246220.1|  PREDICTED: uncharacterized protein LOC101249672    188   1e-48   
ref|XP_010227141.1|  PREDICTED: uncharacterized protein LOC104581367    191   1e-48   
dbj|BAB01972.1|  copia-like retrotransposable element                   192   1e-48   
emb|CAN71246.1|  hypothetical protein VITISV_011986                     190   1e-48   
emb|CAN77643.1|  hypothetical protein VITISV_007625                     183   1e-48   
emb|CAN65356.1|  hypothetical protein VITISV_012647                     188   2e-48   
emb|CAD41085.2|  OSJNBb0011N17.2                                        191   2e-48   
dbj|BAD99221.1|  polypepetide with reverse transcriptase and RNas...    183   2e-48   
emb|CAN63730.1|  hypothetical protein VITISV_030286                     191   2e-48   
ref|XP_009338880.1|  PREDICTED: uncharacterized protein LOC103931184    191   2e-48   
emb|CAN83978.1|  hypothetical protein VITISV_007067                     186   2e-48   
emb|CAN63141.1|  hypothetical protein VITISV_034574                     181   2e-48   
emb|CAN81385.1|  hypothetical protein VITISV_012324                     191   2e-48   
emb|CAN61660.1|  hypothetical protein VITISV_000260                     191   2e-48   
emb|CAN73101.1|  hypothetical protein VITISV_042890                     188   2e-48   
emb|CAN69870.1|  hypothetical protein VITISV_032283                     190   2e-48   
emb|CAN75233.1|  hypothetical protein VITISV_018493                     181   3e-48   
gb|AGW47867.1|  polyprotein                                             191   3e-48   
emb|CAN62836.1|  hypothetical protein VITISV_020079                     187   3e-48   
gb|AIC77183.1|  polyprotein                                             191   3e-48   
ref|XP_006580800.1|  PREDICTED: uncharacterized mitochondrial pro...    179   3e-48   
emb|CAN78330.1|  hypothetical protein VITISV_034973                     190   4e-48   
emb|CAH66946.1|  B0809H07.1                                             190   4e-48   
emb|CAN64673.1|  hypothetical protein VITISV_007430                     189   5e-48   
gb|ABG00000.1|  retrotransposon protein, putative, Ty1-copia subc...    191   5e-48   
emb|CAN67993.1|  hypothetical protein VITISV_015687                     180   5e-48   
gb|KHN20350.1|  Putative mitochondrial protein                          177   5e-48   
gb|AAT47077.1|  putative polyprotein                                    189   6e-48   
emb|CAN78715.1|  hypothetical protein VITISV_030863                     190   6e-48   
ref|XP_008364001.1|  PREDICTED: uncharacterized protein LOC103427704    190   7e-48   
emb|CAN77225.1|  hypothetical protein VITISV_002211                     190   7e-48   
emb|CAN73405.1|  hypothetical protein VITISV_010053                     187   7e-48   
emb|CAN59787.1|  hypothetical protein VITISV_042166                     180   7e-48   
ref|XP_008366917.1|  PREDICTED: uncharacterized protein LOC103430548    187   7e-48   
emb|CAN70229.1|  hypothetical protein VITISV_024789                     190   8e-48   
emb|CAN66596.1|  hypothetical protein VITISV_019893                     190   8e-48   
gb|AAO20078.1|  putative polyprotein                                    189   8e-48   
ref|XP_009335215.1|  PREDICTED: uncharacterized protein LOC103927954    190   1e-47   
emb|CAN84135.1|  hypothetical protein VITISV_000113                     189   1e-47   
emb|CAN73765.1|  hypothetical protein VITISV_035279                     190   1e-47   
emb|CAN64934.1|  hypothetical protein VITISV_012214                     179   1e-47   
gb|AAM98191.1|  unknown protein                                         186   1e-47   
emb|CAN81026.1|  hypothetical protein VITISV_023317                     189   1e-47   
emb|CAN82770.1|  hypothetical protein VITISV_020468                     179   1e-47   
emb|CAC95126.1|  gag-pol polyprotein                                    189   1e-47   
gb|AAF79879.1|AC000348_32  T7N9.5                                       189   1e-47   
emb|CAN68477.1|  hypothetical protein VITISV_029627                     185   1e-47   
emb|CAN62074.1|  hypothetical protein VITISV_001619                     189   1e-47   
gb|AAW56918.1|  putative polyprotein                                    188   1e-47   
emb|CAN62328.1|  hypothetical protein VITISV_029806                     188   1e-47   
emb|CAN71553.1|  hypothetical protein VITISV_034738                     189   1e-47   
emb|CAN62538.1|  hypothetical protein VITISV_031159                     189   1e-47   
gb|AAD24600.1|  putative retroelement pol polyprotein                   189   1e-47   
emb|CAN64288.1|  hypothetical protein VITISV_022326                     189   1e-47   
ref|XP_004515892.1|  PREDICTED: uncharacterized mitochondrial pro...    179   1e-47   
emb|CAN74029.1|  hypothetical protein VITISV_013540                     187   1e-47   
emb|CAN82171.1|  hypothetical protein VITISV_040546                     188   1e-47   
gb|ABD32333.1|  polyprotein-like, putative                              185   2e-47   
gb|KHN23535.1|  Copia protein                                           175   2e-47   
gb|KFK25001.1|  hypothetical protein AALP_AA8G053500                    189   2e-47   
emb|CAN83575.1|  hypothetical protein VITISV_025852                     189   2e-47   
emb|CAN78751.1|  hypothetical protein VITISV_028425                     187   2e-47   
ref|XP_004292800.1|  PREDICTED: uncharacterized mitochondrial pro...    176   2e-47   
gb|AAG52949.1|  gag/pol polyprotein                                     189   2e-47   
emb|CAN72652.1|  hypothetical protein VITISV_027360                     178   3e-47   
ref|XP_006481389.1|  PREDICTED: probable LRR receptor-like serine...    187   3e-47   
gb|AAD19784.1|  putative retroelement pol polyprotein                   188   3e-47   
emb|CAN81940.1|  hypothetical protein VITISV_007358                     185   3e-47   
emb|CAN68742.1|  hypothetical protein VITISV_036839                     178   3e-47   
ref|XP_004514121.1|  PREDICTED: uncharacterized protein LOC101493292    188   3e-47   
ref|XP_002444394.1|  hypothetical protein SORBIDRAFT_07g021220          184   3e-47   
emb|CAN81712.1|  hypothetical protein VITISV_038973                     188   3e-47   
gb|AEJ72555.1|  putative retroelement polyprotein                       187   3e-47   
emb|CAN79805.1|  hypothetical protein VITISV_031503                     177   4e-47   
gb|AAL68641.1|AF458765_1  polyprotein                                   188   4e-47   
emb|CAN72168.1|  hypothetical protein VITISV_004170                     187   4e-47   
emb|CAN81839.1|  hypothetical protein VITISV_033739                     187   4e-47   
emb|CAN61009.1|  hypothetical protein VITISV_038443                     177   4e-47   
emb|CCI55376.1|  PH01B035L11.21                                         188   4e-47   
emb|CAN72141.1|  hypothetical protein VITISV_017108                     187   5e-47   
emb|CAN74283.1|  hypothetical protein VITISV_032452                     187   5e-47   
emb|CBL94154.1|  putative polyprotein (retrotrasposon protein)          187   5e-47   
gb|AAP54332.2|  retrotransposon protein, putative, unclassified         184   5e-47   
dbj|BAM44529.1|  polyprotein                                            187   5e-47   
dbj|BAM44532.1|  polyprotein                                            187   6e-47   
dbj|BAM44531.1|  polyprotein                                            187   6e-47   
dbj|BAM44530.1|  polyprotein                                            187   6e-47   
emb|CAN77046.1|  hypothetical protein VITISV_035257                     187   6e-47   
dbj|BAA78427.1|  polyprotein                                            187   6e-47   
emb|CAN80930.1|  hypothetical protein VITISV_005279                     187   7e-47   
gb|AAT58770.1|  putative polyprotein                                    187   7e-47   
emb|CAN71258.1|  hypothetical protein VITISV_043225                     185   8e-47   
emb|CAN71437.1|  hypothetical protein VITISV_039530                     177   8e-47   
emb|CAN67073.1|  hypothetical protein VITISV_011746                     184   8e-47   
gb|AAX94989.1|  retrotransposon protein, putative, unclassified         176   9e-47   
emb|CAN65588.1|  hypothetical protein VITISV_036516                     176   9e-47   
gb|AAM91874.1|  putative copia-like polyprotein                         184   9e-47   
emb|CAN69597.1|  hypothetical protein VITISV_038518                     187   9e-47   
ref|XP_007024187.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    186   1e-46   
emb|CAN79930.1|  hypothetical protein VITISV_007488                     186   1e-46   
gb|AAW57789.1|  putative polyprotein                                    187   1e-46   
emb|CAN74064.1|  hypothetical protein VITISV_028146                     186   1e-46   
gb|KFK30733.1|  hypothetical protein AALP_AA6G020200                    187   1e-46   
gb|AAO37957.1|  putative gag-pol polyprotein                            187   1e-46   
emb|CAN73851.1|  hypothetical protein VITISV_035861                     177   1e-46   
dbj|BAB11447.1|  polyprotein-like                                       181   1e-46   
gb|AAB87099.1|  putative retroelement pol polyprotein                   186   1e-46   
emb|CAN78382.1|  hypothetical protein VITISV_025352                     176   1e-46   
ref|XP_010513698.1|  PREDICTED: uncharacterized protein LOC104789749    186   1e-46   
ref|WP_025584723.1|  hypothetical protein                               176   1e-46   
ref|XP_010430873.1|  PREDICTED: uncharacterized protein LOC104715130    186   1e-46   
gb|AFP55537.1|  retrotransposon polyprotein                             186   1e-46   
ref|XP_010430787.1|  PREDICTED: uncharacterized protein LOC104715028    185   2e-46   
gb|KHN30919.1|  Copia protein                                           173   2e-46   
ref|XP_004306286.1|  PREDICTED: uncharacterized mitochondrial pro...    172   2e-46   
emb|CAN72398.1|  hypothetical protein VITISV_041202                     186   2e-46   
emb|CAN67925.1|  hypothetical protein VITISV_021168                     186   2e-46   
gb|AAC62795.1|  contains similarity to retroviral aspartyl protea...    185   2e-46   
ref|XP_007014182.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    180   2e-46   
gb|ABF94836.1|  retrotransposon protein, putative, unclassified         186   2e-46   
gb|ABF93543.1|  retrotransposon protein, putative, unclassified         186   2e-46   
gb|AAN60494.1|  Putative Zea mays retrotransposon Opie-2                186   2e-46   
gb|ABG22582.1|  retrotransposon protein, putative, unclassified         176   2e-46   
emb|CAE03600.2|  OSJNBb0004A17.2                                        186   2e-46   
ref|XP_009139303.1|  PREDICTED: uncharacterized protein LOC103863290    185   2e-46   
emb|CAN67009.1|  hypothetical protein VITISV_004754                     185   2e-46   
ref|NP_001062563.2|  Os09g0107600                                       176   3e-46   
gb|KHN17267.1|  Putative mitochondrial protein                          174   3e-46   
gb|KHN44882.1|  Putative mitochondrial protein                          174   4e-46   
emb|CAN73234.1|  hypothetical protein VITISV_033857                     185   4e-46   
gb|AAG60117.1|AC073555_1  copia-type polyprotein, putative              184   4e-46   
gb|AAG50698.1|AC079604_5  copia-type polyprotein, putative              184   4e-46   
emb|CAN62192.1|  hypothetical protein VITISV_023983                     180   4e-46   



>emb|CAN61823.1| hypothetical protein VITISV_008493 [Vitis vinifera]
Length=414

 Score =   281 bits (718),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/293 (49%), Positives = 200/293 (68%), Gaps = 2/293 (1%)
 Frame = +1

Query  589   ALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVA  768
             +LH+FLG+EVIPTP GLFLSQ QY  D+L +  M  AK   TP+ +   L    +   V 
Sbjct  111   SLHYFLGIEVIPTPQGLFLSQHQYIRDLLSRTSMENAKETLTPMSTTAKLTVQDNSECV-  169

Query  769   ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGL  948
              D+T Y+++IG LQYL +T PD+ +V+NRLSQFM  P   HW A KR+LRYLK T+FHG+
Sbjct  170   -DSTEYRKIIGALQYLGLTRPDIAFVVNRLSQFMQKPTTNHWAAAKRLLRYLKQTMFHGI  228

Query  949   LLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
             LL++  Q  L  +SD+DW    D   STT ++ F G N ISW + +Q+AV+  STEAE+R
Sbjct  229   LLQKHDQFQLKTYSDADWASDTDTRVSTTAFITFIGPNPISWSARKQRAVSRSSTEAEFR  288

Query  1129  alanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
             ALA A +E +W+H+L++++G+ L  +P + CDN+ A +   N V H+RMKH+ +D  FVR
Sbjct  289   ALATATSETVWLHSLIKELGLTLREAPQIFCDNIGANHFSLNPVQHTRMKHIDIDLLFVR  348

Query  1309  VHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
               +  GT+RVQH+    Q+A +LTK L R+ F+  RSK+GV+DG+SILRG I+
Sbjct  349   DLVKKGTIRVQHIHTIDQLADLLTKSLSRQRFQLLRSKIGVADGTSILRGHIR  401



>emb|CAN61230.1| hypothetical protein VITISV_010115 [Vitis vinifera]
Length=478

 Score =   277 bits (709),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 149/296 (50%), Positives = 200/296 (68%), Gaps = 4/296 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPI-VSPVDLFRPKDQS  759
             L  L +FLGVEV    +GLFLSQ +Y  D+L +  M EAK   TP+  SP+   +     
Sbjct  181   LGPLTYFLGVEVTSHTNGLFLSQRKYIADLLNRTHMTEAKPAPTPLATSPILTLQ---SG  237

Query  760   TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVF  939
             T  +D T Y+ V+G LQYLS+T PD+ Y +N+LSQFMH P   HW AVKR+LRYL GT+ 
Sbjct  238   TPLSDPTEYRTVVGSLQYLSLTRPDIAYTVNKLSQFMHQPTSDHWNAVKRLLRYLCGTLD  297

Query  940   HGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTea  1119
             H + LRR++ L L AFSDSDW G  D   ST+ Y+++ G N ISW S +Q+ VA  STEA
Sbjct  298   HDITLRRTSPLALHAFSDSDWAGNKDDFTSTSAYIIYLGHNPISWSSKKQRTVARSSTEA  357

Query  1120  eyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYF  1299
             EYR++A+ AAE+ W+ +LL ++GV LP  PV++CDN+ A  +C N V+HSRMKH+ALDY 
Sbjct  358   EYRSVASTAAEIRWICSLLTELGVTLPQQPVIYCDNVGATNLCSNPVFHSRMKHVALDYH  417

Query  1300  FVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
             F+R  + NG LRV H+ A+ Q+A  LTK L R  F+  ++K+G++   SILRG  K
Sbjct  418   FIREQVQNGLLRVSHISASDQLADALTKPLARPQFDSLKAKIGLAPRPSILRGHDK  473



>emb|CAN66005.1| hypothetical protein VITISV_027449 [Vitis vinifera]
Length=793

 Score =   278 bits (711),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/293 (48%), Positives = 199/293 (68%), Gaps = 2/293 (1%)
 Frame = +1

Query  589   ALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVA  768
             +LH+FLG+EVIPTP GLFLSQ QY  D+L +  M  A+   TP+ +   L    +   V 
Sbjct  3     SLHYFLGIEVIPTPQGLFLSQHQYIRDLLSRTSMENAEETLTPMSTTAKLTVQDNSECV-  61

Query  769   ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGL  948
              D+T Y+++IG LQYL +T PD+ + +NRLSQFM  P   HW A KR+LRYLK T+FHG+
Sbjct  62    -DSTEYRKIIGALQYLGLTRPDIAFAVNRLSQFMQKPTTNHWAAAKRLLRYLKQTMFHGI  120

Query  949   LLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
             LL++  Q  L  +SD+DW    D   STT ++ F G N ISW + +Q+AV+  STEAE+R
Sbjct  121   LLQKHDQFQLKTYSDADWASDTDTRVSTTAFITFIGPNPISWSARKQRAVSRSSTEAEFR  180

Query  1129  alanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
             ALA A +E +W+H+L++++G+ L  +P + CDN+ A +   N V H+RMKH+ +D  FVR
Sbjct  181   ALATATSETVWLHSLIKELGLTLREAPQMFCDNIGANHFSLNPVQHTRMKHIDIDLLFVR  240

Query  1309  VHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
               +  GT+RVQH+    Q+A +LTK L R+ F+  RSK+GV+DG+SIL+G I+
Sbjct  241   DLVKKGTIRVQHIHTIDQLADLLTKSLSRQRFQLLRSKIGVADGTSILKGHIR  293



>emb|CAN69370.1| hypothetical protein VITISV_010057 [Vitis vinifera]
Length=591

 Score =   270 bits (689),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 144/296 (49%), Positives = 200/296 (68%), Gaps = 4/296 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPI-VSPVDLFRPKDQS  759
             L  L +FLGVEV    +GLFL+Q +Y  D+L +  M EAK   TP+  SP+   +     
Sbjct  294   LGPLIYFLGVEVTSHTNGLFLNQRKYIADLLNRTHMTEAKSAPTPLATSPILTLQ---SG  350

Query  760   TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVF  939
             T  ++ T Y+ V+G LQYLS+T PD+ Y +N+LSQFMH P   HW AVKR+LRYL GT+ 
Sbjct  351   TPLSNPTEYRTVVGSLQYLSLTRPDIAYTVNKLSQFMHQPTSDHWNAVKRLLRYLCGTLD  410

Query  940   HGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTea  1119
             H + LRR++ L L AFSDSDW G  +   ST+ Y+++ G N ISW S +Q+ VA  STEA
Sbjct  411   HDITLRRTSPLALHAFSDSDWAGNKNDFTSTSAYIIYLGHNPISWSSKKQRTVARSSTEA  470

Query  1120  eyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYF  1299
             EYR +A+ AAE+ W+ +LL ++GV LP  PV++CDN+ A ++C N V+HSRMKH+ALDY 
Sbjct  471   EYRTVASTAAEIRWICSLLTELGVTLPQQPVIYCDNVGATHLCSNSVFHSRMKHVALDYH  530

Query  1300  FVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
             F++  + NG LRV H+ A++Q+   LTK L R  F+  ++K+G++   SILRG  K
Sbjct  531   FIQEQVQNGLLRVSHISASNQLVDALTKPLARPRFDSLKAKIGLAPRPSILRGHDK  586



>gb|AAD22324.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=387

 Score =   256 bits (653),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 193/304 (63%), Gaps = 4/304 (1%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             ++  F V L  R S  +  L AL +FLG+E   T  GL L Q +Y  D+L K  M +AK 
Sbjct  84    LVKNFNVSLADRFSLKD--LGALSYFLGIEATRTKKGLHLMQRKYITDLLAKTHMLDAKP  141

Query  706   VRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLL  885
             + TP+ +   L       T+  DA  Y+ +IG LQYLS T PD+ +V+NRLSQFMH P  
Sbjct  142   ISTPMATTPKL--SLHSGTILDDAKEYRMIIGSLQYLSFTRPDIAFVVNRLSQFMHKPTD  199

Query  886   IHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNV  1065
              HWQA KRVLRYL GT  HG+ LR    L + +FSD+DW G    G ST  Y+++FG + 
Sbjct  200   EHWQAAKRVLRYLAGTKSHGIFLRSDAPLTVHSFSDADWAGDLGDGLSTNAYIVYFGGSP  259

Query  1066  ISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYV  1245
             ISW S +Q+  +  STEAEYRA+AN A+E+ W+ +LL +MG+ LP +PV++CDN+ A Y+
Sbjct  260   ISWSSKKQRRFSRSSTEAEYRAVANTASELQWICSLLSEMGISLPVAPVVYCDNMGATYL  319

Query  1246  CQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
             C N V+HS+MKH+ALDY FVR +I  G LRV H+    Q+A  LTK L R  F+    K+
Sbjct  320   CANPVFHSKMKHVALDYHFVRGNIQTGALRVSHLSTKDQLADALTKPLHRPRFQELNYKI  379

Query  1426  GVSD  1437
             GV +
Sbjct  380   GVKE  383



>emb|CAN71676.1| hypothetical protein VITISV_015838 [Vitis vinifera]
Length=1352

 Score =   270 bits (690),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/293 (47%), Positives = 197/293 (67%), Gaps = 2/293 (1%)
 Frame = +1

Query  589   ALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVA  768
             +LH+FLG+EVIPTP GLFLSQ QY  D+L +  M  AK   TP+ +   L    +   V 
Sbjct  127   SLHYFLGIEVIPTPQGLFLSQHQYIRDLLSRTSMENAKETLTPMSTTAKLTVQDNSECV-  185

Query  769   ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGL  948
              D+T Y+++IG LQYL +T P++ + +NRLSQFM  P   HW A KR+LRYLK T+FHG+
Sbjct  186   -DSTEYRKIIGALQYLGLTRPNIAFAVNRLSQFMQKPTTNHWAAAKRLLRYLKQTMFHGI  244

Query  949   LLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
             LL++  Q  L  +SD++W    D   STT ++ F G N ISW + +Q+AV+  STEAE+R
Sbjct  245   LLQKHDQFQLKTYSDANWASDXDTRVSTTAFITFIGPNPISWSARKQRAVSRSSTEAEFR  304

Query  1129  alanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
             ALA A +E +W+H+L++++G+ L  +P +  DN+ A +   N V H+RMKH+ +D  FVR
Sbjct  305   ALATATSETVWLHSLIKELGLTLREAPQMFXDNIGANHFSLNPVQHTRMKHIDIDLLFVR  364

Query  1309  VHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
               +  GT+RVQH+    Q+A +LTK L R+ F+  RSK+GV DG+SILRG I+
Sbjct  365   DLVKKGTIRVQHIHTIDQLADLLTKSLSRQRFQLLRSKIGVXDGTSILRGHIR  417



>emb|CAN76493.1| hypothetical protein VITISV_007584 [Vitis vinifera]
Length=1120

 Score =   263 bits (673),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/293 (46%), Positives = 194/293 (66%), Gaps = 2/293 (1%)
 Frame = +1

Query  589   ALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVA  768
             +LH+FLG+EVIP P GLFLSQ QY  D+L +  M  AK   TP+ +   L    +   V 
Sbjct  817   SLHYFLGIEVIPIPQGLFLSQHQYIRDLLSRTSMENAKETLTPMSTTAKLTVQDNSECV-  875

Query  769   ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGL  948
              D+T Y+++IG LQYL +T PD+ + +NRLSQFM  P   HW A KR+L YLK T+FHG+
Sbjct  876   -DSTDYRKIIGALQYLGLTRPDIAFAVNRLSQFMQKPTTNHWAAAKRLLIYLKQTMFHGI  934

Query  949   LLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
             +L++  Q  L  +SD+DW    D   ST  ++ F G N ISW + +Q+AV+  S E E+R
Sbjct  935   ILQKHDQFQLKTYSDADWVSNTDTRVSTIAFITFIGPNPISWSARKQRAVSRSSIEVEFR  994

Query  1129  alanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
             ALA A +E +W+H+L++++G+ L  +P + CDN+ A +   N V ++RMKH+ +D  FVR
Sbjct  995   ALATATSETVWLHSLIKELGLTLREAPQMFCDNIGANHFSLNPVQNTRMKHIEIDLLFVR  1054

Query  1309  VHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
               +  GT+RVQH+    Q+A +LTK L R+ F+  RSK+GV+DG+SILRG I+
Sbjct  1055  DLVKKGTIRVQHIHTIDQLADLLTKSLSRQRFQLLRSKIGVADGTSILRGHIR  1107



>gb|KFK45117.1| hypothetical protein AALP_AA1G346500, partial [Arabis alpina]
Length=1203

 Score =   259 bits (661),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 139/283 (49%), Positives = 184/283 (65%), Gaps = 2/283 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E   T  GL LSQ +Y +D+L K  M  AK V TP+ +   L    +  T  +
Sbjct  920   LHYFLGIEAHRTATGLHLSQRKYILDLLHKYTMTNAKPVTTPMATSPKLTL--NAGTNLS  977

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D + Y++++G LQYL+ T  D+ Y +NRLSQFMH P   HWQA KR+LRYL GT  HGL 
Sbjct  978   DPSAYRKLVGSLQYLAFTRLDIAYAVNRLSQFMHKPTEDHWQAAKRILRYLAGTPTHGLF  1037

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                 + L+L AFSD+DW G  D   ST  Y+++ G   ISW + +QK VA  STEAEYRA
Sbjct  1038  YAAKSSLNLHAFSDADWAGDSDDYVSTNAYIIYLGKQPISWTAKKQKGVARSSTEAEYRA  1097

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN  +E+ W+ NLL ++G+ LP SP+++CDN+ A ++C N V+HSRMKH+ALDY FVR 
Sbjct  1098  VANTVSELCWICNLLTELGLSLPTSPLVYCDNVGATFLCANPVFHSRMKHIALDYHFVRG  1157

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDG  1440
             HI  G LRV HV    Q+A  LTK L R  F   R+K+GV+  
Sbjct  1158  HIQKGALRVAHVNTKDQLADALTKPLSRARFLDLRNKIGVTSA  1200



>emb|CAN68364.1| hypothetical protein VITISV_021899 [Vitis vinifera]
Length=431

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 135/297 (45%), Positives = 194/297 (65%), Gaps = 4/297 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVS-PVDLFRPKDQS  759
             L  L+ FLG+EV+ +   L LSQ++Y  D L++  + E+K + +P+ + PV         
Sbjct  37    LSPLNFFLGIEVLNSRSSLHLSQAKYICDFLQRAGLSESKSMASPMAAGPV---LSIADG  93

Query  760   TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVF  939
             T   D T+Y+ ++G LQY +IT PD+ Y +N+L QFMH P   H Q VKRVLRYLKG++F
Sbjct  94    TRLEDPTLYRSLVGALQYCTITRPDIAYTVNKLCQFMHAPTSTHLQVVKRVLRYLKGSLF  153

Query  940   HGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTea  1119
             +GL  + S+ L L A++D+DW    D  RST+GY +FFG N++SW + +QK V+  STE+
Sbjct  154   YGLSFQPSSSLDLIAYTDADWASCPDDRRSTSGYCIFFGGNLVSWSASKQKVVSRSSTES  213

Query  1120  eyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYF  1299
             EYR LANAAAE+ W+ +LL+++ + L   PVL+CDNLS  Y+  N + HSR KH+ +DY 
Sbjct  214   EYRGLANAAAELTWIQSLLKELFIPLFQPPVLYCDNLSTTYLAANPILHSRAKHVEIDYH  273

Query  1300  FVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIKK  1470
             FVR  ++  TL V+ +P+  Q+A ILTK L  + F H RSK+ V      LRG +KK
Sbjct  274   FVRERVLQKTLDVRFLPSEDQVADILTKSLSTQHFLHLRSKLTVLSRPVCLRGDVKK  330



>emb|CAN62863.1| hypothetical protein VITISV_030334 [Vitis vinifera]
Length=1442

 Score =   258 bits (659),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 148/288 (51%), Positives = 194/288 (67%), Gaps = 6/288 (2%)
 Frame = +1

Query  601   FLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPI--VSPVDLFRPKDQSTVAAD  774
             FLGVEVIPT  GLFLSQ QY  D+L   +M  AK V TP+   + + LF      T   D
Sbjct  1095  FLGVEVIPTRAGLFLSQHQYIRDLLSTTNMLGAKDVSTPLSTTASLKLF----DGTAPVD  1150

Query  775   ATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLL  954
             +T ++RVIG LQYLS+T PD+ + +N+LSQFMH P   HW A KR+LRYLK T+FHG+ L
Sbjct  1151  STDFRRVIGSLQYLSLTRPDISFAVNKLSQFMHKPTTAHWTATKRLLRYLKQTIFHGIQL  1210

Query  955   RRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyral  1134
              R+T   L  FSD+DW G  D   ST+ Y+ F G+N ISW S +Q+A+A  STEAEYRAL
Sbjct  1211  TRNTTSVLTTFSDADWVGNVDDRTSTSAYISFLGTNPISWSSKKQRAIARSSTEAEYRAL  1270

Query  1135  anaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVH  1314
             ANA +E +W+++L  ++G  L   P+L CDNL A ++  N V HSRMK++ +D  FVR  
Sbjct  1271  ANATSETVWLNSLHHELGFPLKVPPLLLCDNLGATHLSFNPVNHSRMKYIQIDLHFVREL  1330

Query  1315  IVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
             + NGTL V+HV    Q+A +LTK L R+  E   +K+G++DGSSILRG
Sbjct  1331  VQNGTLHVRHVHTQDQLADLLTKPLSRQRTELLCTKIGLADGSSILRG  1378



>gb|KFK44388.1| hypothetical protein AALP_AA1G251100, partial [Arabis alpina]
Length=2090

 Score =   259 bits (662),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 147/309 (48%), Positives = 204/309 (66%), Gaps = 16/309 (5%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPI-VSP-VDLFRPKDQSTV  765
             LH+FLG+E   +  GL LSQ +Y  D+L + +M  AK V TP+  SP + L+      T 
Sbjct  1215  LHYFLGIEARRSSQGLHLSQRKYINDLLARTNMLLAKPVLTPMATSPKLSLY----SGTH  1270

Query  766   AADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHG  945
              +D T Y+ ++G LQYLS T PD+ Y +N+LSQ+MH+P   HW A+KR+LRYL GT  HG
Sbjct  1271  LSDPTEYRAILGSLQYLSFTRPDLCYAVNKLSQYMHSPTSDHWSALKRLLRYLAGTTDHG  1330

Query  946   LLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaey  1125
             + L++ T L L A+SD+DW G  D   ST GY+++ GS+ +SW S +QK +A  STEAEY
Sbjct  1331  IFLQKGTTLTLHAYSDADWAGDKDDYVSTNGYIVYLGSHPLSWSSKKQKGIARSSTEAEY  1390

Query  1126  ralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFV  1305
             R++AN AAEV W+ +LL ++G+ L H PV++CDN+ A Y+C N V+HSRMKH+ALDY F+
Sbjct  1391  RSVANTAAEVKWLCSLLGELGITLTHPPVIYCDNVGATYLCANPVFHSRMKHIALDYHFI  1450

Query  1306  RVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS---------DGSSILRG  1458
             R  + +G LRV HV    Q+A +LTK L R  F  F SK+GV+          G+ +L+G
Sbjct  1451  RNQVQSGALRVVHVSTHDQLADVLTKPLSRMAFNKFSSKIGVTRVPPSCGGVTGTPLLQG  1510

Query  1459  R-IKK*YYW  1482
             R I + Y W
Sbjct  1511  RTINELYEW  1519



>gb|AAF99727.1|AC004557_6 F17L21.7 [Arabidopsis thaliana]
Length=1534

 Score =   258 bits (659),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 145/284 (51%), Positives = 188/284 (66%), Gaps = 8/284 (3%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQ--STV  765
             L +FLG+E   T  GL L Q +Y  D+L ++ M +AK V TP+ +      PK    S +
Sbjct  1251  LVYFLGIEATRTSQGLHLMQHKYVYDLLSRMKMLDAKPVSTPMAT-----HPKLSLYSGI  1305

Query  766   AADAT-VYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             A D    Y+ VIG LQYL+ T PD+ Y +NRLSQFMH P  IHWQA KRVLRYL GT  H
Sbjct  1306  ALDEPGEYRTVIGSLQYLAFTRPDIAYAVNRLSQFMHRPTDIHWQAAKRVLRYLAGTATH  1365

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             G+LLR ++ L L AFSD+DW G +D   ST  Y+++ GS  I+W S +QK VA  STEAE
Sbjct  1366  GILLRSNSPLSLHAFSDADWAGDNDDFVSTNAYIVYLGSTPIAWSSKKQKGVARSSTEAE  1425

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+AN  +E+ WV +LL ++G+ LP  PV++CDN+ A Y+  N V+HSRMKHLALDY F
Sbjct  1426  YRAVANTTSEIRWVCSLLTELGITLPKMPVIYCDNVGATYLSANPVFHSRMKHLALDYHF  1485

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
             +R ++  G LRV H+    Q+A  LTK L R+ F  F SK+GVS
Sbjct  1486  IRDNVSAGALRVSHISTHDQLADALTKPLPRQHFLQFSSKIGVS  1529



>dbj|BAA78424.1| polyprotein [Arabidopsis thaliana]
 dbj|BAM44533.1| polyprotein [Arabidopsis thaliana]
Length=1330

 Score =   257 bits (656),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 136/280 (49%), Positives = 186/280 (66%), Gaps = 2/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E    P GL LSQ +YT+D+L + +M  AK V TP+ +   L       T   
Sbjct  1040  LHYFLGIEAKRVPQGLHLSQRRYTLDLLARTNMLTAKPVATPMATSPKLTL--HSGTKLP  1097

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ ++G LQYL+ T PD+ Y +NRLSQ+MH P   HW A+KRVLRYL GT  HG+ 
Sbjct  1098  DPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPTDDHWNALKRVLRYLAGTPDHGIF  1157

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEYR+
Sbjct  1158  LKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEYRS  1217

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN ++E+ W+ +LL ++G+ L H PV++CDN+ A Y+C N V+HSRMKH+ALDY F+R 
Sbjct  1218  VANTSSELQWICSLLTELGIQLSHPPVIYCDNVGATYLCANPVFHSRMKHIALDYHFIRN  1277

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              + +G LRV HV    Q+A  LTK L R  F++F  K+GV
Sbjct  1278  QVQSGALRVVHVSTHDQLADTLTKPLSRVAFQNFSRKIGV  1317



>dbj|BAM42650.1| Polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   257 bits (656),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/280 (49%), Positives = 186/280 (66%), Gaps = 2/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E    P GL LSQ +YT+D+L + +M  AK V TP+ +   L       T   
Sbjct  1185  LHYFLGIEAKRVPQGLHLSQRRYTLDLLARTNMLTAKPVATPMATSPKLTL--HSGTKLP  1242

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ ++G LQYL+ T PD+ Y +NRLSQ+MH P   HW A+KRVLRYL GT  HG+ 
Sbjct  1243  DPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPTDDHWNALKRVLRYLAGTPDHGIF  1302

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEYR+
Sbjct  1303  LKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEYRS  1362

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN ++E+ W+ +LL ++G+ L H PV++CDN+ A Y+C N V+HSRMKH+ALDY F+R 
Sbjct  1363  VANTSSELQWICSLLTELGIQLSHPPVIYCDNVGATYLCANPVFHSRMKHIALDYHFIRN  1422

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              + +G LRV HV    Q+A  LTK L R  F++F  K+GV
Sbjct  1423  QVQSGALRVVHVSTHDQLADTLTKPLSRVAFQNFSRKIGV  1462



>gb|AAC79110.1| putative polyprotein of LTR transposon [Arabidopsis thaliana]
 emb|CAB77781.1| putative polyprotein of LTR transposon [Arabidopsis thaliana]
Length=1456

 Score =   257 bits (656),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/280 (49%), Positives = 186/280 (66%), Gaps = 2/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E    P GL LSQ +YT+D+L + +M  AK V TP+ +   L       T   
Sbjct  1166  LHYFLGIEAKRVPQGLHLSQRRYTLDLLARTNMLTAKPVATPMATSPKLTL--HSGTKLP  1223

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ ++G LQYL+ T PD+ Y +NRLSQ+MH P   HW A+KRVLRYL GT  HG+ 
Sbjct  1224  DPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPTDDHWNALKRVLRYLAGTPDHGIF  1283

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEYR+
Sbjct  1284  LKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEYRS  1343

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN ++E+ W+ +LL ++G+ L H PV++CDN+ A Y+C N V+HSRMKH+ALDY F+R 
Sbjct  1344  VANTSSELQWICSLLTELGIQLSHPPVIYCDNVGATYLCANPVFHSRMKHIALDYHFIRN  1403

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              + +G LRV HV    Q+A  LTK L R  F++F  K+GV
Sbjct  1404  QVQSGALRVVHVSTHDQLADTLTKPLSRVAFQNFSRKIGV  1443



>dbj|BAM42646.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   257 bits (656),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/280 (49%), Positives = 186/280 (66%), Gaps = 2/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E    P GL LSQ +YT+D+L + +M  AK V TP+ +   L       T   
Sbjct  1185  LHYFLGIEAKRVPQGLHLSQRRYTLDLLARTNMLTAKPVATPMATSPKLTL--HSGTKLP  1242

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ ++G LQYL+ T PD+ Y +NRLSQ+MH P   HW A+KRVLRYL GT  HG+ 
Sbjct  1243  DPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPTDDHWNALKRVLRYLAGTPDHGIF  1302

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEYR+
Sbjct  1303  LKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEYRS  1362

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN ++E+ W+ +LL ++G+ L H PV++CDN+ A Y+C N V+HSRMKH+ALDY F+R 
Sbjct  1363  VANTSSELQWICSLLTELGIQLSHPPVIYCDNVGATYLCANPVFHSRMKHIALDYHFIRN  1422

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              + +G LRV HV    Q+A  LTK L R  F++F  K+GV
Sbjct  1423  QVQSGALRVVHVSTHDQLADTLTKPLSRVAFQNFSRKIGV  1462



>emb|CAN73909.1| hypothetical protein VITISV_029162 [Vitis vinifera]
Length=569

 Score =   245 bits (626),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 135/297 (45%), Positives = 185/297 (62%), Gaps = 26/297 (9%)
 Frame = +1

Query  577   GILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQ  756
             G L+   H + VEV    +GLFLSQS+Y  D+L    M EAK   TP+            
Sbjct  294   GYLIVEPHII-VEVTSHTNGLFLSQSKYIADLLNITHMTEAKPAPTPL------------  340

Query  757   STVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTV  936
             +T +++             LS+T PD+ Y +N+L QFMH P   HW AVKR+LRYL GT+
Sbjct  341   ATTSSN-------------LSLTRPDIAYTVNKLCQFMHQPTSDHWNAVKRLLRYLCGTL  387

Query  937   FHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTe  1116
              H + LRR++ L   AFSDSDW G  D   ST+ Y+++ G N ISW S +Q+ VA  STE
Sbjct  388   DHSITLRRTSPLAFHAFSDSDWAGNKDDFTSTSAYIIYLGHNPISWSSKKQRTVARSSTE  447

Query  1117  aeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDY  1296
              EYR++A+ AAE+ W+ +LL ++GV LP  PV++CDN+ A ++C N V+HSRMKH+ALDY
Sbjct  448   VEYRSVASTAAEIRWICSLLTELGVTLPQQPVIYCDNVGATHLCSNPVFHSRMKHVALDY  507

Query  1297  FFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
              F+R  + NG LRV H+ A+ Q+A  LTK L R  F   ++K+G++   SILRG  K
Sbjct  508   HFIREQVQNGLLRVSHISASDQLADALTKPLARPQFNSLKAKIGLAPRPSILRGHDK  564



>dbj|BAA78426.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   254 bits (650),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 186/280 (66%), Gaps = 2/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E    P GL LSQ +YT+D+L + +M  AK V TP+ +   L       T   
Sbjct  1185  LHYFLGIEAKRVPQGLHLSQRRYTLDLLARTNMLTAKPVATPMATSPKLTL--HSGTKLP  1242

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ ++G LQYL+ T PD+ Y +NRLSQ+MH P   +W A+KRVLRYL GT  HG+ 
Sbjct  1243  DPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPTDDNWNALKRVLRYLAGTPDHGIF  1302

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEYR+
Sbjct  1303  LKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEYRS  1362

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN ++E+ W+ +LL ++G+ L H PV++CDN+ A Y+C N V+HSRMKH+ALDY F+R 
Sbjct  1363  VANTSSELQWICSLLTELGIQLSHPPVIYCDNVGATYLCANPVFHSRMKHIALDYHFIRN  1422

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              + +G LRV HV    Q+A  LTK L R  F++F  K+GV
Sbjct  1423  QVQSGALRVVHVSTHDQLADTLTKPLSRVAFQNFSRKIGV  1462



>dbj|BAM42649.1| Polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   254 bits (650),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 186/280 (66%), Gaps = 2/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E    P GL LSQ +YT+D+L + +M  AK V TP+ +   L       T   
Sbjct  1185  LHYFLGIEAKRVPQGLHLSQRRYTLDLLARTNMLTAKPVATPMATSPKLTL--HSGTKLP  1242

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ ++G LQYL+ T PD+ Y +NRLSQ+MH P   +W A+KRVLRYL GT  HG+ 
Sbjct  1243  DPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPTDDNWNALKRVLRYLAGTPDHGIF  1302

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEYR+
Sbjct  1303  LKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEYRS  1362

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN ++E+ W+ +LL ++G+ L H PV++CDN+ A Y+C N V+HSRMKH+ALDY F+R 
Sbjct  1363  VANTSSELQWICSLLTELGIQLSHPPVIYCDNVGATYLCANPVFHSRMKHIALDYHFIRN  1422

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              + +G LRV HV    Q+A  LTK L R  F++F  K+GV
Sbjct  1423  QVQSGALRVVHVSTHDQLADTLTKPLSRVAFQNFSRKIGV  1462



>emb|CAN70817.1| hypothetical protein VITISV_029336 [Vitis vinifera]
Length=1044

 Score =   252 bits (643),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 145/296 (49%), Positives = 197/296 (67%), Gaps = 6/296 (2%)
 Frame = +1

Query  589   ALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVA  768
             +LH+FLGVEVIPT   +FLSQ +Y  DIL+   M  AK V TP+ +   L      + + 
Sbjct  747   SLHYFLGVEVIPTTAVVFLSQHKYARDILENTHMAGAKDVSTPLSTTQSLHLVDGMNAI-  805

Query  769   ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGL  948
              + T Y+RVIG LQYLS+T PD+ + +N+LSQFMH P++ HW A KR+LRYLK T+FHGL
Sbjct  806   -NNTEYRRVIGNLQYLSLTRPDISFAVNKLSQFMHKPIVTHWTATKRLLRYLKKTIFHGL  864

Query  949   LLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
              L+ +    L  ++D+DW G  D   ST+ Y+ F G N ISW S +Q+AVA  +T+AEYR
Sbjct  865   HLKSAAAPCLTTYTDADWAGNIDDRTSTSAYITFLGYNPISWSSKKQRAVARSTTKAEYR  924

Query  1129  alanaaaeVIWVHNLLQDMG--VVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             ALAN A+E +W+  LLQ++G  + LPHS  L CDNL A ++  N + HSRMKH+ +D  F
Sbjct  925   ALANGASETMWLLALLQELGFSLKLPHS--LLCDNLGATHLSFNPIQHSRMKHIQIDLHF  982

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIKK  1470
             V   +  G L+V +V    Q+A +LTK L R   E  R+K+G++DGSSILRG IK+
Sbjct  983   VCDQVQKGALKVSYVHTQDQLADLLTKPLSREHTECLRAKIGLADGSSILRGHIKE  1038



>gb|AAK43485.1|AC084807_10 polyprotein, putative [Arabidopsis thaliana]
 dbj|BAH30336.1| hypothetical protein [Arabidopsis thaliana]
Length=1459

 Score =   254 bits (648),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 182/280 (65%), Gaps = 2/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E   T  GL L Q +Y  D+L K +M +AK V TP+ +   L       T   
Sbjct  1176  LHYFLGIEATRTNTGLHLMQRKYMTDLLAKHNMLDAKPVATPLPTSPKLTL--HGGTKLN  1233

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DA+ Y+ V+G LQYL+ T PD+ + +NRLSQFMH P   HWQA KRVLRYL GT  HG+ 
Sbjct  1234  DASEYRSVVGSLQYLAFTRPDIAFAVNRLSQFMHQPTSDHWQAAKRVLRYLAGTTTHGIF  1293

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L  S+ +HL AFSD+DW G      ST  YV++ G N ISW S +Q+ V+  STE+EYRA
Sbjct  1294  LNSSSPIHLHAFSDADWAGDSADYVSTNAYVIYLGRNPISWSSKKQRGVSRSSTESEYRA  1353

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +ANAA+E+ W+ +LL ++ + LPH P + CDN+ A Y+C N V+HSRMKH+ALDY FVR 
Sbjct  1354  VANAASEIRWLCSLLTELHIRLPHGPTIFCDNIGATYICANPVFHSRMKHIALDYHFVRG  1413

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              I +  LRV HV    Q+A  LTK L R  F   RSK+GV
Sbjct  1414  MIQSRALRVSHVSTNDQLADALTKSLSRPHFLSARSKIGV  1453



>dbj|BAM42647.1| polyprotein [Arabidopsis thaliana]
 dbj|BAM42648.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   254 bits (648),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 185/280 (66%), Gaps = 2/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E    P GL LSQ +YT+D+L + +M  AK V TP+ +   L       T   
Sbjct  1185  LHYFLGIEAKRVPQGLHLSQRRYTLDLLARTNMLTAKPVATPMATSPKLTL--HSGTKLP  1242

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ ++G LQYL+ T PD+ Y +NRLSQ+MH P   HW A+KRVLRYL GT  HG+ 
Sbjct  1243  DPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPTDDHWNALKRVLRYLAGTPDHGIF  1302

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEYR+
Sbjct  1303  LKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEYRS  1362

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN ++E+ W+ +LL ++G+ L H PV++CDN+ A Y+C N V+HSRMKH+ALDY F+R 
Sbjct  1363  VANTSSELQWICSLLTELGIQLSHPPVIYCDNVGATYLCANPVFHSRMKHIALDYHFIRN  1422

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              + +G LRV HV    Q+A  LTK L    F++F  K+GV
Sbjct  1423  QVQSGALRVVHVSTHDQLADTLTKPLSLVAFQNFSRKIGV  1462



>dbj|BAM44534.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   253 bits (646),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 185/280 (66%), Gaps = 2/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E    P GL LSQ +YT+D+L + +M  AK V TP+ +   L       T   
Sbjct  1185  LHYFLGIEAKRVPQGLHLSQRRYTLDLLARTNMLTAKPVATPMATSPKLTL--HSGTKLP  1242

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ ++G LQYL+ T PD+ Y +NRLSQ+MH P   HW A+KRVLRYL GT  HG+ 
Sbjct  1243  DPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPTDDHWNALKRVLRYLAGTPDHGIF  1302

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEYR+
Sbjct  1303  LKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEYRS  1362

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN ++E+ W+ +LL ++G+ L H  V++CDN+ A Y+C N V+HSRMKH+ALDY F+R 
Sbjct  1363  VANISSELQWICSLLTELGIQLSHPSVIYCDNVGATYLCANPVFHSRMKHIALDYHFIRN  1422

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              + +G LRV HV    Q+A  LTK L R  F++F  K+GV
Sbjct  1423  QVQSGALRVVHVSTHDQLADTLTKPLSRVAFQNFSRKIGV  1462



>dbj|BAB10876.1| polyprotein [Arabidopsis thaliana]
Length=1429

 Score =   253 bits (646),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 149/307 (49%), Positives = 195/307 (64%), Gaps = 10/307 (3%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             ++  F   L SR S  +  L  L +FLG+E   T  GL L Q +Y  D+LKK +M + K 
Sbjct  1126  LVQAFNASLASRFSLKD--LGPLSYFLGIEATRTSRGLHLMQRKYITDLLKKHNMLDTKP  1183

Query  706   VRTPIVSPVDLFRPKDQ---STVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHN  876
             V TP+ SP     PK      T   DAT Y+ V+G LQYL+ T PD+ + +NRLSQFMH 
Sbjct  1184  VSTPM-SPT----PKLSLLSGTALDDATEYRTVLGSLQYLAFTRPDIAFAVNRLSQFMHR  1238

Query  877   PLLIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFG  1056
             P   HWQA KR+LRYL GT  HG+ LR  T L + AFSD+DWG   D   ST  Y+++FG
Sbjct  1239  PTNEHWQAAKRILRYLAGTKSHGIFLRSDTPLTIHAFSDADWGCDLDAYLSTNAYIVYFG  1298

Query  1057  SNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSA  1236
              + +SW S +Q++VA  STEAEYRA+AN A+E+ W+ +LL +MG+     PV++CDN+ A
Sbjct  1299  GSPVSWSSKKQRSVARSSTEAEYRAVANTASELRWLCSLLLEMGISQTTVPVIYCDNIGA  1358

Query  1237  MYVCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFR  1416
              Y+C N V+HSRMKH+ALDY FVR +I +G LRV HV    Q+A  LTK L R  F    
Sbjct  1359  TYLCANPVFHSRMKHVALDYHFVRGYIQSGALRVSHVSTKDQLADALTKPLPRPRFTELN  1418

Query  1417  SKMGVSD  1437
             SK+GV +
Sbjct  1419  SKIGVQE  1425



>dbj|BAM44535.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   253 bits (646),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 185/280 (66%), Gaps = 2/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E    P GL LSQ +YT+D+L + +M  AK V TP+ +   L       T   
Sbjct  1185  LHYFLGIEAKRVPQGLHLSQRRYTLDLLARTNMLTAKPVATPMATSPKLTL--HSGTKLP  1242

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ ++G LQYL+ T PD+ Y +NRLSQ+MH P   HW A+KRVLRYL GT  HG+ 
Sbjct  1243  DPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPTDDHWNALKRVLRYLAGTPDHGIF  1302

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEYR+
Sbjct  1303  LKKGNTLSLHAYSDADWAGDTDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEYRS  1362

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN ++E+ W+ +LL ++G+ L H  V++CDN+ A Y+C N V+HSRMKH+ALDY F+R 
Sbjct  1363  VANISSELQWICSLLTELGIQLSHPSVIYCDNVGATYLCANPVFHSRMKHIALDYHFIRN  1422

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              + +G LRV HV    Q+A  LTK L R  F++F  K+GV
Sbjct  1423  QVQSGALRVVHVSTHDQLADTLTKPLSRVAFQNFSRKIGV  1462



>dbj|BAA78423.1| polyprotein [Arabidopsis thaliana]
Length=1431

 Score =   253 bits (646),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 136/283 (48%), Positives = 189/283 (67%), Gaps = 6/283 (2%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIV-SP-VDLFRPKDQSTV  765
             LH+FLG+E    P GL LSQ +Y +D+L + +M  AK V TP+  SP + L+      T 
Sbjct  1148  LHYFLGIEAKRVPTGLHLSQRRYILDLLARTNMITAKPVTTPMAPSPKLSLY----SGTK  1203

Query  766   AADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHG  945
               D T Y+ ++G LQYL+ T PD+ Y +NRLSQFMH P   H QA+KR+LRYL GT  HG
Sbjct  1204  LTDPTEYRGIVGSLQYLAFTRPDISYAVNRLSQFMHMPTEEHLQALKRILRYLAGTPNHG  1263

Query  946   LLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaey  1125
             + L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEY
Sbjct  1264  IFLKKGNTLSLHAYSDADWAGDKDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEY  1323

Query  1126  ralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFV  1305
             R++AN ++E+ W+ +LL ++G+ L   PV++CDN+ A Y+C N V+HSRMKH+A+DY F+
Sbjct  1324  RSVANTSSEMQWICSLLTELGIRLTRPPVIYCDNVGATYLCANPVFHSRMKHIAIDYHFI  1383

Query  1306  RVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
             R  + +G LRV HV    Q+A  LTK L R  F++F SK+GV+
Sbjct  1384  RNQVQSGALRVVHVSTHDQLADTLTKPLSRTAFQNFASKIGVT  1426



>gb|AAK62793.1|AC027036_14 polyprotein, putative [Arabidopsis thaliana]
 dbj|BAK41510.1| polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   253 bits (646),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 136/283 (48%), Positives = 189/283 (67%), Gaps = 6/283 (2%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIV-SP-VDLFRPKDQSTV  765
             LH+FLG+E    P GL LSQ +Y +D+L + +M  AK V TP+  SP + L+      T 
Sbjct  1183  LHYFLGIEAKRVPTGLHLSQRRYILDLLARTNMITAKPVTTPMAPSPKLSLY----SGTK  1238

Query  766   AADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHG  945
               D T Y+ ++G LQYL+ T PD+ Y +NRLSQFMH P   H QA+KR+LRYL GT  HG
Sbjct  1239  LTDPTEYRGIVGSLQYLAFTRPDISYAVNRLSQFMHMPTEEHLQALKRILRYLAGTPNHG  1298

Query  946   LLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaey  1125
             + L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEY
Sbjct  1299  IFLKKGNTLSLHAYSDADWAGDKDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEY  1358

Query  1126  ralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFV  1305
             R++AN ++E+ W+ +LL ++G+ L   PV++CDN+ A Y+C N V+HSRMKH+A+DY F+
Sbjct  1359  RSVANTSSEMQWICSLLTELGIRLTRPPVIYCDNVGATYLCANPVFHSRMKHIAIDYHFI  1418

Query  1306  RVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
             R  + +G LRV HV    Q+A  LTK L R  F++F SK+GV+
Sbjct  1419  RNQVQSGALRVVHVSTHDQLADTLTKPLSRTAFQNFASKIGVT  1461



>dbj|BAK41511.1| polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   253 bits (646),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 136/283 (48%), Positives = 189/283 (67%), Gaps = 6/283 (2%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIV-SP-VDLFRPKDQSTV  765
             LH+FLG+E    P GL LSQ +Y +D+L + +M  AK V TP+  SP + L+      T 
Sbjct  1183  LHYFLGIEAKRVPTGLHLSQRRYILDLLARTNMITAKPVTTPMAPSPKLSLY----SGTK  1238

Query  766   AADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHG  945
               D T Y+ ++G LQYL+ T PD+ Y +NRLSQFMH P   H QA+KR+LRYL GT  HG
Sbjct  1239  LTDPTEYRGIVGSLQYLAFTRPDISYAVNRLSQFMHMPTEEHLQALKRILRYLAGTPNHG  1298

Query  946   LLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaey  1125
             + L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEY
Sbjct  1299  IFLKKGNTLSLHAYSDADWAGDKDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEY  1358

Query  1126  ralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFV  1305
             R++AN ++E+ W+ +LL ++G+ L   PV++CDN+ A Y+C N V+HSRMKH+A+DY F+
Sbjct  1359  RSVANTSSEMQWICSLLTELGIRLTRPPVIYCDNVGATYLCANPVFHSRMKHIAIDYHFI  1418

Query  1306  RVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
             R  + +G LRV HV    Q+A  LTK L R  F++F SK+GV+
Sbjct  1419  RNQVQSGALRVVHVSTHDQLADTLTKPLSRTAFQNFASKIGVT  1461



>gb|AAK62788.1|AC027036_9 polyprotein, putative [Arabidopsis thaliana]
 dbj|BAB84015.1| polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   253 bits (645),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 136/283 (48%), Positives = 189/283 (67%), Gaps = 6/283 (2%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIV-SP-VDLFRPKDQSTV  765
             LH+FLG+E    P GL LSQ +Y +D+L + +M  AK V TP+  SP + L+      T 
Sbjct  1183  LHYFLGIEAKRVPTGLHLSQRRYILDLLARTNMITAKPVTTPMAPSPKLSLY----SGTK  1238

Query  766   AADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHG  945
               D T Y+ ++G LQYL+ T PD+ Y +NRLSQFMH P   H QA+KR+LRYL GT  HG
Sbjct  1239  LTDPTEYRGIVGSLQYLAFTRPDISYAVNRLSQFMHMPTEEHLQALKRILRYLAGTPNHG  1298

Query  946   LLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaey  1125
             + L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEY
Sbjct  1299  IFLKKGNTLSLHAYSDADWAGDKDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEY  1358

Query  1126  ralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFV  1305
             R++AN ++E+ W+ +LL ++G+ L   PV++CDN+ A Y+C N V+HSRMKH+A+DY F+
Sbjct  1359  RSVANTSSEMQWICSLLTELGIRLTRPPVIYCDNVGATYLCANPVFHSRMKHIAIDYHFI  1418

Query  1306  RVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
             R  + +G LRV HV    Q+A  LTK L R  F++F SK+GV+
Sbjct  1419  RNQVQSGALRVVHVSTHDQLADTLTKPLSRTAFQNFASKIGVT  1461



>dbj|BAA78425.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41505.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41506.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41508.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41509.1| polyprotein [Arabidopsis thaliana]
Length=1447

 Score =   252 bits (643),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 136/283 (48%), Positives = 189/283 (67%), Gaps = 6/283 (2%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIV-SP-VDLFRPKDQSTV  765
             LH+FLG+E    P GL LSQ +Y +D+L + +M  AK V TP+  SP + L+      T 
Sbjct  1164  LHYFLGIEAKRVPTGLHLSQRRYILDLLARTNMITAKPVTTPMAPSPKLSLY----SGTK  1219

Query  766   AADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHG  945
               D T Y+ ++G LQYL+ T PD+ Y +NRLSQFMH P   H QA+KR+LRYL GT  HG
Sbjct  1220  LTDPTEYRGIVGSLQYLAFTRPDISYAVNRLSQFMHMPTEEHLQALKRILRYLAGTPNHG  1279

Query  946   LLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaey  1125
             + L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEY
Sbjct  1280  IFLKKGNTLSLHAYSDADWTGDKDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEY  1339

Query  1126  ralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFV  1305
             R++AN ++E+ W+ +LL ++G+ L   PV++CDN+ A Y+C N V+HSRMKH+A+DY F+
Sbjct  1340  RSVANTSSEMQWICSLLTELGIRLTRPPVIYCDNVGATYLCANPVFHSRMKHIAIDYHFI  1399

Query  1306  RVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
             R  + +G LRV HV    Q+A  LTK L R  F++F SK+GV+
Sbjct  1400  RNQVQSGALRVVHVSTHDQLADTLTKPLSRTAFQNFASKIGVT  1442



>emb|CAN65555.1| hypothetical protein VITISV_009833 [Vitis vinifera]
Length=325

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/280 (46%), Positives = 184/280 (66%), Gaps = 3/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLGVEV     GLFLSQ++Y +D+L++  M +AK + TP V    L     + T+ +
Sbjct  30    LHYFLGVEVQANEKGLFLSQTKYALDLLQRASMIDAKPISTPFVVGQHL---SAEGTLFS  86

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T+++ + G LQYL+IT PD+ + +N + QFMH P   H+ A+KR+LRY+KGT  HGL 
Sbjct  87    DPTLFRSLAGALQYLTITRPDLSFSVNSICQFMHAPTEDHFCALKRILRYVKGTAHHGLQ  146

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L + +   L  +SD+DW G  D  RSTTGY +FFG+N+ISW S +Q  V+  S EAEYR+
Sbjct  147   LHKQSTRDLLGYSDADWAGCPDTRRSTTGYAIFFGANLISWSSKKQSTVSRSSAEAEYRS  206

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA AAA++ W+  LL+D+ V L   P + CDN SA+++  N V   R KH+A+DY FVR 
Sbjct  207   LAVAAADIAWIIQLLRDLHVTLSVPPKILCDNQSAIFMAVNPVTRPRSKHIAIDYHFVRE  266

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              +  GTL++  VP+  Q+A  LTKG+ +  F  FRSK+ V
Sbjct  267   LVDKGTLKIDFVPSHLQLADSLTKGVTKPQFYIFRSKLSV  306



>dbj|BAK41507.1| polyprotein [Arabidopsis thaliana]
Length=1447

 Score =   250 bits (638),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 135/283 (48%), Positives = 189/283 (67%), Gaps = 6/283 (2%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIV-SP-VDLFRPKDQSTV  765
             LH+FLG+E    P GL LSQ +Y +D+L + +M  AK V TP+  SP + L+      T 
Sbjct  1164  LHYFLGIEAKRVPTGLHLSQRRYILDLLARTNMITAKPVTTPMAPSPKLSLY----SGTK  1219

Query  766   AADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHG  945
               D T Y+ ++G LQYL+ T PD+ Y +NRLSQFMH P   H QA+KR+L+YL GT  HG
Sbjct  1220  LTDPTEYRGIVGSLQYLAFTRPDISYAVNRLSQFMHMPTEEHLQALKRILQYLAGTPNHG  1279

Query  946   LLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaey  1125
             + L++   L L A+SD+DW G  D   ST GY+++ G + ISW S +QK V   STEAEY
Sbjct  1280  IFLKKGNTLSLHAYSDADWTGDKDDYVSTNGYIVYLGHHPISWSSKKQKGVVRSSTEAEY  1339

Query  1126  ralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFV  1305
             R++AN ++E+ W+ +LL ++G+ L   PV++CDN+ A Y+C N V+HSRMKH+A+DY F+
Sbjct  1340  RSVANTSSEMQWICSLLTELGIRLTRPPVIYCDNVGATYLCANPVFHSRMKHIAIDYHFI  1399

Query  1306  RVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
             R  + +G LRV HV    Q+A  LTK L R  F++F SK+GV+
Sbjct  1400  RNQVQSGALRVVHVSTHDQLADTLTKPLSRTAFQNFASKIGVT  1442



>ref|XP_009772944.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104223244 
[Nicotiana sylvestris]
Length=1016

 Score =   247 bits (631),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 130/283 (46%), Positives = 188/283 (66%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L+ FL VEV+   DG+ LSQS Y  +IL + +M +    +TP+ S  ++ +  D + 
Sbjct  730   LGNLNFFLRVEVLRVADGITLSQSNYISEILSEENMKDCNSAKTPMSS-TEVLQQNDGAE  788

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                +AT Y+RV+G LQYLS T PD+ + +N+LSQFMH+P  +HW+A+KRVLRYL+GT+  
Sbjct  789   -PTNATRYRRVLGKLQYLSFTRPDISFSVNKLSQFMHSPSELHWKALKRVLRYLQGTIQF  847

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL ++R     L  ++D+DW G      STTGY+LFFG N +SW S +Q+ VA  STEAE
Sbjct  848   GLRIQRDNDFKLHMYADADWAGDATDRASTTGYILFFGQNPVSWSSRKQRTVARSSTEAE  907

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+A+A AE  WV NLL ++ V +P +P ++CDN+ A Y+C+N V+HSRMKH+A+D+ F
Sbjct  908   YRAVASALAETNWVTNLLNELHVSIPQAPTIYCDNVGATYLCENPVFHSRMKHIAVDFHF  967

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +    +R+ H+    Q+A  LTK L +  F+    K+GV
Sbjct  968   VRKQVQQNQVRIVHIHTADQLADTLTKALPKPAFDRHLFKLGV  1010



>gb|AAC02664.1| polyprotein [Arabidopsis thaliana]
Length=1451

 Score =   249 bits (636),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 144/310 (46%), Positives = 195/310 (63%), Gaps = 14/310 (5%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             I+++F+  L +R S  +  L  + +FLG+E   T  GL L Q +Y +D+L+K +M  A  
Sbjct  1148  IITRFIANLAARFSLKD--LGEMSYFLGIEATRTSKGLHLMQKRYVLDLLEKTNMLAAHP  1205

Query  706   VRTPIVSPVDLF-----RPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFM  870
             V TP+ SP         +P D+       + Y+ V+G LQYL  T PD+ Y +NRLSQ+M
Sbjct  1206  VLTPM-SPTPKLSLTSGKPLDK------PSEYRAVLGSLQYLLFTRPDIAYAVNRLSQYM  1258

Query  871   HNPLLIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLF  1050
             H P  +HWQA KR+LRYL GT  HG+ +R  T L L A+SD+DW G  D   ST  Y+L+
Sbjct  1259  HCPTDLHWQAAKRILRYLAGTPSHGIFIRADTPLTLHAYSDADWAGDIDNYNSTNAYILY  1318

Query  1051  FGSNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNL  1230
              GSN ISW S +QK VA  STEAEYRA+ANA +E+ WV +LL ++G+ L   PV++CDN+
Sbjct  1319  LGSNPISWSSKKQKGVARSSTEAEYRAVANATSEIRWVCSLLTELGITLSSPPVVYCDNV  1378

Query  1231  SAMYVCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEH  1410
              A Y+  N V+HSRMKH+ALD+ FVR  +  G LRV HV    Q+A  LTK L R+ F  
Sbjct  1379  GATYLSANPVFHSRMKHIALDFHFVRESVQAGALRVTHVSTKDQLADALTKPLPRQPFTT  1438

Query  1411  FRSKMGVSDG  1440
               SK+GV+  
Sbjct  1439  LISKIGVAKA  1448



>emb|CAA16691.1| retrotransposon - like protein [Arabidopsis thaliana]
 dbj|BAB10674.1| copia-like retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1021

 Score =   245 bits (626),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 131/279 (47%), Positives = 179/279 (64%), Gaps = 2/279 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L++FLG+E   T  GL LSQ +Y +D+L++ +M  AK V TP+ S   L          +
Sbjct  27    LNYFLGLEDHRTSKGLHLSQRKYILDLLQRYNMINAKPVGTPMASSPKLTL--MSGITLS  84

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y++++G LQYL+ T  D+ Y +NRLSQFMH P   HWQA KRVLRYL GT  H + 
Sbjct  85    DPTEYRKLVGSLQYLAFTRLDIAYAVNRLSQFMHRPTNDHWQAAKRVLRYLAGTTTHDIF  144

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                  +L L AFSD+DW G  +   ST  Y+++ G N ISW + +QK+VA  STEAEYR+
Sbjct  145   FAAQNELSLHAFSDADWAGDSEDCVSTNAYIVYLGKNPISWTAKKQKSVARSSTEAEYRS  204

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN A E+ W+ +LL ++G+ LP  PV++CDN+ A ++C N V+HSRMKH+A+DY F+R 
Sbjct  205   VANTACEIQWICSLLTELGITLPKPPVVYCDNVGATFLCANPVFHSRMKHIAIDYHFIRG  264

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMG  1428
              +  G LRV HV    Q+A  LTK L R  F   R K+G
Sbjct  265   QVQQGILRVAHVNTRDQLADALTKPLPRNHFTELRDKIG  303



>ref|XP_009145096.1| PREDICTED: uncharacterized protein LOC103868780 [Brassica rapa]
Length=2690

 Score =   249 bits (636),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 138/302 (46%), Positives = 195/302 (65%), Gaps = 6/302 (2%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             +++QF+ ML  R S  +  L  + +FLG+E   T  GL L Q++Y  D+L K +M  AK 
Sbjct  1807  LVNQFIAMLAQRFSIKD--LGHISYFLGIEATRTSKGLHLMQNKYIQDLLAKTNMLNAKT  1864

Query  706   VRTPIVS-PVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPL  882
             V TP+ + P    R     T   + T Y++V+G LQYL+ T PD+ Y +N+LSQFMH P 
Sbjct  1865  VSTPLATHPKLTLR---SGTPLLNPTDYRQVVGSLQYLAFTRPDIAYAVNKLSQFMHQPT  1921

Query  883   LIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSN  1062
               HWQA KRVLRYL GT   G+ +RR +   L A+SD+DW G  D   ST  Y+++ G+ 
Sbjct  1922  EDHWQAAKRVLRYLAGTSKQGIWIRRDSPPTLHAYSDADWAGDPDDYISTNAYIIYIGTT  1981

Query  1063  VISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMY  1242
              ISW + +Q  VA  STEAEYR++AN AAE++WV +L++++ + +  SPV++CDN+ A Y
Sbjct  1982  PISWSAKKQSGVARSSTEAEYRSVANTAAELMWVCSLMKELHIPVTSSPVIYCDNIGATY  2041

Query  1243  VCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSK  1422
             +C N V+H+RMKH+ALDY F+R H+ +G LRV HV    Q+A  LTK L R  F+   SK
Sbjct  2042  LCANPVFHTRMKHVALDYHFIRAHVQSGALRVSHVSTKDQLADALTKPLSRLRFQELCSK  2101

Query  1423  MG  1428
             +G
Sbjct  2102  IG  2103



>emb|CAN67588.1| hypothetical protein VITISV_036280 [Vitis vinifera]
Length=1379

 Score =   247 bits (630),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/296 (46%), Positives = 198/296 (67%), Gaps = 4/296 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+EV   PDG FLSQ +Y  DIL +  + ++K V TP++    L     + T
Sbjct  501   LGPLSYFLGLEVSYIPDGFFLSQVKYATDILARAQLLDSKPVPTPMIVSQRL---SSEGT  557

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               AD T+Y+ ++G LQYL+IT P++ + IN +SQF+H P  +H+QAVKR+LRY++GT+  
Sbjct  558   PFADPTLYRSLVGALQYLTITRPNLAHSINSVSQFLHAPTEVHFQAVKRILRYVQGTLHF  617

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL     + + L A+SD+DW G  D  RST+GY +F G+N++SW + +Q  V+  S E+E
Sbjct  618   GLKFTSCSSMGLVAYSDADWAGCPDTRRSTSGYSIFLGNNLVSWSAKKQPTVSRSSCESE  677

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRALA  AA+V+W+ +LL+D+ V L H P+L CDN SA+++  N V H R KH+ LDY F
Sbjct  678   YRALALTAAKVLWLTHLLRDLRVTLTHRPLLLCDNKSAIFLSSNPVSHKRAKHVDLDYHF  737

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSI-LRGRIK  1467
             +R  IV GTLR+QH+P+  Q+A + TK + R L+  FRSK+ V    ++ LRG ++
Sbjct  738   LRELIVAGTLRIQHIPSHLQLADVFTKSVSRDLYVFFRSKLRVCVNPTLSLRGAVE  793



>ref|XP_010686475.1| PREDICTED: uncharacterized protein LOC104900682 [Beta vulgaris 
subsp. vulgaris]
Length=4583

 Score =   249 bits (635),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 148/322 (46%), Positives = 204/322 (63%), Gaps = 15/322 (5%)
 Frame = +1

Query  511   PTLYFIMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDM  690
             PTL   +S F+  L  R S  +  L +L +FLGVEV PT  G+FLSQ +Y +D+L +  M
Sbjct  1061  PTL---VSSFIAALGDRFSLKD--LGSLSYFLGVEVQPTTRGIFLSQRKYIMDLLTRAHM  1115

Query  691   HEAKIVRTPI--VSPVDLFR--PKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRL  858
              +AK V TP+   S + L    P D      + T Y+ ++G LQYL +T PDV + +N+L
Sbjct  1116  SDAKPVTTPMDPNSSLSLHDGPPHD------NPTEYRTLVGSLQYLGLTRPDVAFSVNKL  1169

Query  859   SQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTG  1038
             SQFMH P   HWQA+KR+LRYL GT+ +GL +  ++   L AFSDSDW G  D   ST  
Sbjct  1170  SQFMHCPTAPHWQALKRLLRYLCGTLTYGLNISHNSPHTLHAFSDSDWAGDKDDFISTGA  1229

Query  1039  YVLFFGSNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLH  1218
             Y+++ GSN ISW S +Q++VA  STEAEYR+LA  AAE+ W+ N+LQ++G+     P + 
Sbjct  1230  YIVYLGSNPISWSSKKQRSVARSSTEAEYRSLAQTAAELTWLTNVLQELGLSRSSPPTIF  1289

Query  1219  CDNLSAMYVCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRR  1398
             CDN+ A  +  N V+HSRMKHL +D++F+R  + +G+LRV  V    Q+A  LTK L RR
Sbjct  1290  CDNIGATQLAANPVFHSRMKHLGIDFYFIREKVQSGSLRVTRVVNDDQLADALTKPLARR  1349

Query  1399  LFEHFRSKMGVSDGSSILRGRI  1464
                   SK+G+S   SILRG +
Sbjct  1350  RLTMLLSKIGLSPRPSILRGHV  1371



>gb|AAC02669.1| polyprotein [Arabidopsis thaliana]
Length=1451

 Score =   246 bits (629),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 143/310 (46%), Positives = 194/310 (63%), Gaps = 14/310 (5%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             I+++F+  L +R S  +  L  + +FLG+E   T  GL L Q +Y +D+L+K +M  A  
Sbjct  1148  IITRFIANLAARFSLKD--LGEMSYFLGIEATRTSKGLHLMQKRYVLDLLEKTNMLAAHP  1205

Query  706   VRTPIVSPVDLF-----RPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFM  870
             V TP+ SP         +P D+       + Y+ V+G LQYL  T PD+ Y +NRLSQ+M
Sbjct  1206  VLTPM-SPTPKLSLTSGKPLDK------PSEYRAVLGSLQYLLFTRPDIAYAVNRLSQYM  1258

Query  871   HNPLLIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLF  1050
             H P  +HWQA KR+LRYL GT  HG+ +R  T L L A+SD+DW G  D   ST  Y+L+
Sbjct  1259  HCPTDLHWQAAKRILRYLAGTPSHGIFIRADTPLTLHAYSDADWAGDIDNYNSTNAYILY  1318

Query  1051  FGSNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNL  1230
              GSN ISW S +QK VA  STEAEYRA+ANA +E+ WV +LL ++G+ L   PV++CDN+
Sbjct  1319  LGSNPISWSSKKQKGVARSSTEAEYRAVANATSEIRWVCSLLTELGITLSSPPVVYCDNV  1378

Query  1231  SAMYVCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEH  1410
              A Y+  N V+ SRMKH+ALD+ FVR  +  G LRV HV    Q+A  LTK L R+ F  
Sbjct  1379  GATYLSANPVFDSRMKHIALDFHFVRESVQAGALRVTHVSTKDQLADALTKPLPRQPFTT  1438

Query  1411  FRSKMGVSDG  1440
               SK+GV+  
Sbjct  1439  LISKIGVAKA  1448



>gb|AAC02666.1| polyprotein [Arabidopsis thaliana]
Length=1451

 Score =   246 bits (628),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 143/310 (46%), Positives = 194/310 (63%), Gaps = 14/310 (5%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             I+++F+  L +R S  +  L  + +FLG+E   T  GL L Q +Y +D+L+K +M  A  
Sbjct  1148  IITRFIANLAARFSLKD--LGEMSYFLGIEATRTSKGLHLMQKRYVLDLLEKTNMLAAHP  1205

Query  706   VRTPIVSPVDLF-----RPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFM  870
             V TP+ SP         +P D+       + Y+ V+G LQYL  T PD+ Y +NRLSQ+M
Sbjct  1206  VLTPM-SPTPKLSLTSGKPLDK------PSEYRAVLGSLQYLLFTRPDIAYAVNRLSQYM  1258

Query  871   HNPLLIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLF  1050
             H P  +HWQA KR+LRYL GT  HG+ +R  T L L A+SD+DW G  D   ST  Y+L+
Sbjct  1259  HCPTDLHWQAAKRILRYLAGTPSHGIFIRADTPLTLHAYSDADWAGDIDNYNSTNAYILY  1318

Query  1051  FGSNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNL  1230
              GSN ISW S +QK VA  STEAEYRA+ANA +E+ WV +LL ++G+ L   PV++CDN+
Sbjct  1319  LGSNPISWSSKKQKGVARSSTEAEYRAVANATSEIRWVCSLLTELGITLSSPPVVYCDNV  1378

Query  1231  SAMYVCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEH  1410
              A Y+  N V+ SRMKH+ALD+ FVR  +  G LRV HV    Q+A  LTK L R+ F  
Sbjct  1379  GATYLSANPVFDSRMKHIALDFHFVRESVQAGALRVTHVSTKDQLADALTKPLPRQPFTT  1438

Query  1411  FRSKMGVSDG  1440
               SK+GV+  
Sbjct  1439  LISKIGVAKA  1448



>ref|XP_002444548.1| hypothetical protein SORBIDRAFT_07g023610 [Sorghum bicolor]
 gb|EES14043.1| hypothetical protein SORBIDRAFT_07g023610 [Sorghum bicolor]
Length=791

 Score =   241 bits (616),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 177/286 (62%), Gaps = 0/286 (0%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LHHFLGV V P P GLFL Q Q+T DIL++  M + K   TP+ +   L   +    
Sbjct  506   LGVLHHFLGVTVEPRPSGLFLHQRQFTCDILERAGMTDCKSCSTPVDTQGKLSEAEGPML  565

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D+T Y+ + G LQYL+ T PD+ Y + +L  +MH P   H  A+KR+LRYL+GT+ +
Sbjct  566   GPEDSTAYRSLAGALQYLTFTRPDITYAVQQLCLYMHAPREPHLAAMKRLLRYLRGTLGY  625

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GLLL RS+   L  ++D+DW G  D  RST+GY +F G N++SW S RQ  V+  S EAE
Sbjct  626   GLLLSRSSSAELVVYTDADWAGCPDTRRSTSGYAVFLGGNLVSWSSKRQPVVSRSSAEAE  685

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+AN  AE  W+  LL ++   L  S +++CDN+SA+Y+  N V H R KH+ +D  F
Sbjct  686   YRAVANGVAEAAWLRQLLAELHRPLARSSLVYCDNVSAVYLSTNPVQHQRTKHVEIDLHF  745

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDG  1440
             VR H+  G +RV HVP TSQ A I TKGL    F  FRS + V+ G
Sbjct  746   VRDHVAIGDIRVLHVPTTSQFADIFTKGLPSSTFAEFRSSLNVTGG  791



>emb|CAB46043.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB80958.1| retrotransposon like protein [Arabidopsis thaliana]
Length=1474

 Score =   245 bits (626),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 140/280 (50%), Positives = 180/280 (64%), Gaps = 2/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E   T  GL L Q +Y  D+L K +M +AK V TP+ +   L       T   
Sbjct  1191  LHYFLGIEATRTKQGLHLMQRKYIKDLLAKHNMADAKPVLTPLPTSPKLTL--HGGTKLN  1248

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DA+ Y+ V+G LQYL+ T PD+ Y +NRLSQ M  P   HWQA KRVLRYL GT  HG+ 
Sbjct  1249  DASEYRSVVGSLQYLAFTRPDIAYAVNRLSQLMPQPTEDHWQAAKRVLRYLAGTSTHGIF  1308

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L  ++ L+L AFSD+DW G  D   ST  YV++ G N ISW S +Q+ VA  STE+EYRA
Sbjct  1309  LDTTSPLNLHAFSDADWAGDSDDYVSTNAYVIYLGKNPISWSSKKQRGVARSSTESEYRA  1368

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +ANAA+EV W+ +LL  + + LP  P + CDN+ A Y+C N V+HSRMKH+A+DY FVR 
Sbjct  1369  VANAASEVKWLCSLLSKLHIRLPIRPSIFCDNIGATYLCANPVFHSRMKHIAIDYHFVRN  1428

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              I +G LRV HV    Q+A  LTK L R  F+  R K+GV
Sbjct  1429  MIQSGALRVSHVSTRDQLADALTKPLSRAHFQSARFKIGV  1468



>emb|CAN66863.1| hypothetical protein VITISV_013500 [Vitis vinifera]
Length=1112

 Score =   243 bits (619),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/259 (50%), Positives = 176/259 (68%), Gaps = 4/259 (2%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPI-VSPVDLFRPKDQS  759
             L  L +FLGVEV    +GLFLSQ +Y  D+L +  M EAK   TP+  SP+   +     
Sbjct  841   LGPLTYFLGVEVTSHTNGLFLSQHKYIADLLNRTHMTEAKPAPTPLATSPILTLQ---SG  897

Query  760   TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVF  939
             T  ++ T Y+ ++G LQYLS+T PD+ Y +N+LSQFMH P   HW AVKR+LRYL GT+ 
Sbjct  898   TPLSNPTEYRTMVGSLQYLSLTRPDIAYTVNKLSQFMHQPTSDHWNAVKRLLRYLCGTLD  957

Query  940   HGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTea  1119
             HG+ LRR++ L L  FSDSDW G  D   ST+ Y+++ G N ISW S +Q+ VA  ST+A
Sbjct  958   HGITLRRTSPLALHVFSDSDWAGNKDDFTSTSAYIIYLGHNPISWSSKKQRTVARSSTKA  1017

Query  1120  eyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYF  1299
             EYR++A+ AAE+ W+ +LL ++GV LP  PV++CDN+ A  +  N V+HSRMKH+ALDY 
Sbjct  1018  EYRSVASTAAEICWICSLLTELGVTLPQQPVIYCDNVGATNLYSNPVFHSRMKHVALDYH  1077

Query  1300  FVRVHIVNGTLRVQHVPAT  1356
             F+R  + NG LRV H+ A+
Sbjct  1078  FIREQVQNGLLRVSHISAS  1096



>gb|KFK33814.1| hypothetical protein AALP_AA5G063400 [Arabis alpina]
Length=563

 Score =   236 bits (601),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/283 (47%), Positives = 181/283 (64%), Gaps = 2/283 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E   T  GL ++Q +Y +DIL K +M  AK V TP+ +   L       T  +
Sbjct  280   LHYFLGLEAHRTTLGLHINQRKYILDILHKYNMTNAKPVMTPMATSPKLTL--HGGTNLS  337

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             +   Y+ +IG LQYL+ T PD+ Y +NRLSQFMH P   HWQA KR+LRYL GT  HG+ 
Sbjct  338   EPKEYRTLIGSLQYLAFTRPDIAYAVNRLSQFMHKPTEDHWQAAKRILRYLAGTPTHGIF  397

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                + +L L A+SD+DW G  D   ST  ++++ G + ISW + +QK VA  STEAEYRA
Sbjct  398   YSATNKLTLHAYSDADWAGDSDDYVSTNAHIVYLGRHPISWSAKKQKGVARSSTEAEYRA  457

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN  +EV W+ N+L ++G+ LP  P++ CDN+ A ++C N V+HSRMKH+ALDY FVR 
Sbjct  458   VANTVSEVQWICNVLTELGLTLPIPPLVLCDNVGATFLCANPVFHSRMKHIALDYHFVRG  517

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDG  1440
             +I  G L+V HV    Q+A  LTK L R  F    +K+GV+  
Sbjct  518   YIQRGALQVAHVNTKDQLADALTKPLPRSHFITLINKIGVTKA  560



>gb|KFK29449.1| hypothetical protein AALP_AA7G135900 [Arabis alpina]
Length=605

 Score =   235 bits (600),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 136/303 (45%), Positives = 192/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  529   MSQFLVMLLSRCS-KANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             + +F+ +L  R S K  G    L +FLG+EV  T  GL ++Q++Y  D+L++V+M +AK 
Sbjct  303   VQKFIELLGERFSLKDQG---PLSYFLGLEVYRTAAGLKVTQTKYINDLLRRVNMLDAKS  359

Query  706   VRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLL  885
             V TP+     L   K   T   D T Y+ VIG LQYL +T PDV + +N+L+QFM  P  
Sbjct  360   VATPMADKPPLT--KRCGTSLTDPTEYRMVIGSLQYLLLTRPDVAFAVNKLAQFMECPST  417

Query  886   IHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNV  1065
              HW A KRVLRYL GT   GL        +L A+SD+DW G  D   ST  Y+++ G ++
Sbjct  418   EHWSAAKRVLRYLCGTRDRGLFFSADNPTYLHAYSDADWAGDKDDYTSTGAYLVYLGKHL  477

Query  1066  ISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYV  1245
             ISW S +Q  VA  STEAEYR+++  A+EV W+ +LL ++GV L  +PV++CDN+ A Y+
Sbjct  478   ISWSSKKQPTVARSSTEAEYRSVSFTASEVQWIQSLLGELGVSLSKTPVIYCDNVGATYL  537

Query  1246  CQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
             C N V+HSRMKHLA+DY ++R  + +G+LRV HV +  Q+A  LTK L R  F    +K+
Sbjct  538   CANPVFHSRMKHLAVDYHYIRGLVQSGSLRVAHVSSADQLADGLTKPLPRTRFMTLTNKI  597

Query  1426  GVS  1434
             G+S
Sbjct  598   GLS  600



>emb|CAN73071.1| hypothetical protein VITISV_032383 [Vitis vinifera]
Length=1239

 Score =   242 bits (617),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 138/302 (46%), Positives = 199/302 (66%), Gaps = 13/302 (4%)
 Frame = +1

Query  571   ANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPK  750
             A   L +L +FLG+E  PTPDGLF+SQ +Y  DIL +  + ++K V TP+V    L    
Sbjct  926   ATKDLGSLSYFLGLEASPTPDGLFISQLKYARDILTRAQLLDSKPVHTPMVVSQHL----  981

Query  751   DQSTVA----ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLR  918
                TVA    ++ T+Y+ ++G LQYL+IT PD+ + +N +SQF+H P + H+ AVKR+LR
Sbjct  982   ---TVAGSPFSNPTLYRSLVGALQYLTITRPDIAHAVNSVSQFLHAPTIDHFLAVKRILR  1038

Query  919   YLKGTVFHGLLLRRST-QLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKA  1095
             Y+KGT+  GL  R ST    L A+SD+DW G  D  RST+GY ++ G+N++SW + +Q  
Sbjct  1039  YVKGTLHFGLTFRPSTIPSALVAYSDADWAGCPDTRRSTSGYSIYLGNNLVSWSAKKQPT  1098

Query  1096  VAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRM  1275
             V+  S E+EYRALA  AAE++W+ +LL D+ V +P  P+L CDN SA+++  N V H R 
Sbjct  1099  VSRSSCESEYRALAMTAAELLWLTHLLHDLKVPIPXQPLLLCDNKSAIFLSSNPVSHKRA  1158

Query  1276  KHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSI-L  1452
             KH+ LDY F+R  +V G LR ++VP+  Q+A I TK + R LFE FRSK+ +    ++ L
Sbjct  1159  KHVELDYHFLRELVVAGKLRTEYVPSHLQVADIFTKSVSRPLFEFFRSKLHIRSNPTLSL  1218

Query  1453  RG  1458
             RG
Sbjct  1219  RG  1220



>gb|EEC76475.1| hypothetical protein OsI_14210 [Oryza sativa Indica Group]
Length=391

 Score =   229 bits (585),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 120/281 (43%), Positives = 176/281 (63%), Gaps = 0/281 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV    DGL LSQ +Y  D+L++V M+E K V TP+ +   L   +       
Sbjct  103   LHYFLGIEVHKVKDGLMLSQEKYASDLLRRVGMYECKPVSTPLSTSEKLSVNEGTLLGPQ  162

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D+T Y+ V+G LQYL++T PD+ + IN++ QF+H P   HW AVKR+LRY+K TV  GL 
Sbjct  163   DSTQYRSVVGALQYLTLTRPDISFSINKVCQFLHAPTTTHWAAVKRILRYVKYTVDTGLK  222

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
               R+  L ++ FSD+DW G  D  RST G+ +F G N++SW + +Q  V+  S EAEY+A
Sbjct  223   FCRNPSLLVSGFSDADWAGSPDDRRSTGGFAVFLGPNLVSWSARKQATVSRSSIEAEYKA  282

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA AE++WV  LLQ++GV  P +  L CDNL A Y+  N ++H+R KH+ +D+ FVR 
Sbjct  283   LANATAEIMWVQTLLQELGVESPRAAKLWCDNLGAKYLSANPIFHARTKHIEVDFHFVRE  342

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
              +    L + ++    Q+A   TK +  R  E F++ + + 
Sbjct  343   RVARKLLEIAYISTKDQVADGFTKAIPVRQMEMFKNNLNLE  383



>gb|AAP20859.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
Length=352

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/289 (41%), Positives = 181/289 (63%), Gaps = 2/289 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV   P G+ +SQ +Y  D+LK+V+M + K V TP+ +   L   K       
Sbjct  64    LHYFLGIEVTKIPGGILMSQEKYASDLLKRVNMSDCKSVATPLSASEKLIAGKGTILGPN  123

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DAT Y+ ++G LQYL++T  D+ + +N++ QF+HNP   HW AVKR+LRY+K     GL 
Sbjct  124   DATQYRSIVGALQYLTLTRLDIAFSVNKVCQFLHNPTTEHWAAVKRILRYIKQCTGLGLR  183

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             + +S+ + ++ +SD+DW G  D  RST G+ ++ G N++SW + +Q  V+  STEAEY+A
Sbjct  184   ICKSSSMIVSGYSDADWAGCLDDRRSTGGFAVYLGDNLVSWNAKKQATVSRSSTEAEYKA  243

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA AE++WV  LLQ++ +V P    L CDN+ A Y+  N V+H+R KH+ +DY FVR 
Sbjct  244   LANATAEIMWVQTLLQELNIVSPAMAQLWCDNMGAKYLSFNPVFHARTKHIEVDYHFVRE  303

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
              +    L+V +V    Q+A   TK L  +  E+F+  + +  G  ++ G
Sbjct  304   RVARKLLQVDYVSTNDQVADGFTKALPVKQLENFKYNLNL--GKVVIEG  350



>ref|YP_514636.1| hypothetical protein OrsaiPp07 [Oryza sativa Indica Group]
 ref|YP_003433855.1| hypothetical protein OrrupM_p18 [Oryza rufipogon]
 gb|AAZ99275.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AAZ99329.1| hypothetical protein (mitochondrion) [Oryza sativa Japonica Group]
 gb|AAZ99382.1| hypothetical protein (mitochondrion) [Oryza sativa Japonica Group]
 dbj|BAI67959.1| hypothetical protein [Oryza rufipogon]
 dbj|BAI67987.1| hypothetical protein [Oryza sativa Indica Group]
 gb|AER12982.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AER13050.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AEZ03755.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AEZ03764.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 dbj|BAN67511.1| hypothetical protein (mitochondrion) [Oryza rufipogon]
 dbj|BAN67513.1| hypothetical protein (mitochondrion) [Oryza rufipogon]
Length=490

 Score =   229 bits (584),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/300 (41%), Positives = 186/300 (62%), Gaps = 13/300 (4%)
 Frame = +1

Query  544   VMLLSRCSKANGILV-------------ALHHFLGVEVIPTPDGLFLSQSQYTIDILKKV  684
             +++ S C KA   L+             ALH+FLG+EV    DG+ L+Q +Y  D+LK+V
Sbjct  182   IIVASSCEKATSALLQDLKEEFALKDLGALHYFLGIEVNKVHDGIILTQEKYATDLLKRV  241

Query  685   DMHEAKIVRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQ  864
              MH  K + TP+ +   L   + +   A D+T Y+ ++G LQYL++T PD+ + +N++ Q
Sbjct  242   GMHGCKEINTPLSTTDKLLAKEGEPLGAEDSTRYRSIVGALQYLTLTRPDIAFPVNKVCQ  301

Query  865   FMHNPLLIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYV  1044
             ++H P  +HW AVKR+LRYLKG++  GL + +S    ++AFSD+DW G  D  +ST G+ 
Sbjct  302   YLHAPTSLHWTAVKRILRYLKGSLGLGLRICKSDSTLVSAFSDADWAGCPDDRKSTGGFA  361

Query  1045  LFFGSNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCD  1224
             +F G+N+ISW + +Q  V+  STEAEY+ALANA AE+I V  LL++ G+  P +  L CD
Sbjct  362   VFLGANLISWNAWKQATVSRSSTEAEYKALANATAEIISVQTLLKERGIAQPRAACLWCD  421

Query  1225  NLSAMYVCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLF  1404
             N+ A  +  N V+H+R KH+ +DY FVR  +  G L ++ VP+  Q+A   T    RR +
Sbjct  422   NIGATSLSANPVFHARTKHIEVDYHFVRERVSQGLLDIRFVPSGDQVADGFTCNRPRRQY  481



>ref|YP_002000554.1| orf490 [Oryza sativa Japonica Group]
 dbj|BAC19858.1| orf490 [Oryza sativa Japonica Group]
Length=490

 Score =   229 bits (584),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/300 (41%), Positives = 186/300 (62%), Gaps = 13/300 (4%)
 Frame = +1

Query  544   VMLLSRCSKANGILV-------------ALHHFLGVEVIPTPDGLFLSQSQYTIDILKKV  684
             +++ S C KA   L+             ALH+FLG+EV    DG+ L+Q +Y  D+LK+V
Sbjct  182   IIVASSCEKATSALLQDLKEEFALKDLGALHYFLGIEVNKVHDGIILTQEKYATDLLKRV  241

Query  685   DMHEAKIVRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQ  864
              MH  K + TP+ +   L   + +   A D+T Y+ ++G LQYL++T PD+ + +N++ Q
Sbjct  242   GMHGCKEINTPLSTTDKLLAKEGEPLGAEDSTRYRSIVGALQYLTLTRPDIAFPVNKVCQ  301

Query  865   FMHNPLLIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYV  1044
             ++H P  +HW AVKR+LRYLKG++  GL + +S    ++AFSD+DW G  D  +ST G+ 
Sbjct  302   YLHAPTSLHWTAVKRILRYLKGSLGLGLRICKSDSTLVSAFSDADWAGCPDDRKSTGGFA  361

Query  1045  LFFGSNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCD  1224
             +F G+N+ISW + +Q  V+  STEAEY+ALANA AE+I V  LL++ G+  P +  L CD
Sbjct  362   VFLGANLISWNAWKQATVSRSSTEAEYKALANATAEIISVQTLLKERGIAQPRAACLWCD  421

Query  1225  NLSAMYVCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLF  1404
             N+ A  +  N V+H+R KH+ +DY FVR  +  G L ++ VP+  Q+A   T    RR +
Sbjct  422   NIGATSLSANPVFHARTKHIEVDYHFVRERVSQGLLDIRFVPSGDQVADGFTCNRPRRQY  481



>emb|CAN75351.1| hypothetical protein VITISV_031045 [Vitis vinifera]
Length=300

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 177/274 (65%), Gaps = 3/274 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLGVEV     GLFLSQ++Y +D+L++  M +AK + TP V    L     + T+ +
Sbjct  30    LHYFLGVEVQANEKGLFLSQTKYALDLLQRASMIDAKPISTPFVVGQHL---SAEGTLFS  86

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T+++ + G LQYL+IT PD+ + +N + QFMH P   H++A+KR+LRY+KGT  HGL 
Sbjct  87    DPTLFRSLAGALQYLTITSPDLSFSVNSICQFMHAPTEDHFRALKRILRYVKGTAHHGLQ  146

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L + +   L  +SD+DW G  D  RSTTGY +FFG+N+ISW S +Q  V+  S EAEYR+
Sbjct  147   LHKQSTRDLLGYSDADWDGCPDTRRSTTGYAIFFGANLISWSSKKQSTVSRSSAEAEYRS  206

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA A A++ W+  LL+D+ V L   P + CDN S +++  N +   R KH+A+DY FV  
Sbjct  207   LAVATADIAWIIQLLRDLHVTLSMPPKILCDNQSTIFMAVNPITRPRSKHIAIDYHFVCE  266

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHF  1413
              +  GTL++  VP+  Q+A  LTKG+ +  F  F
Sbjct  267   LVDKGTLKIDFVPSHLQLADSLTKGVTKPQFYIF  300



>gb|KHN05629.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1248

 Score =   238 bits (606),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 135/293 (46%), Positives = 187/293 (64%), Gaps = 4/293 (1%)
 Frame = +1

Query  529   MSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIV  708
             +S+ +  L +R S  +  L  L +FLGVEVIP+  G+FLSQ +Y ID+L K  M   K  
Sbjct  948   LSKLIATLAARFSLKD--LGCLSYFLGVEVIPSAAGMFLSQRKYIIDLLHKSGMTNTKPA  1005

Query  709   RTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLI  888
              TP+ + V L   KD   +      Y+ ++G LQYLS+T PD+ +  N+L+QFM NP   
Sbjct  1006  STPLSASVQLL--KDSGDLLPSPNEYRTLVGSLQYLSLTRPDIAFSTNKLAQFMQNPRTA  1063

Query  889   HWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVI  1068
             HW A+KRVLRYL G+   G+ +  +T L   A+SD+DW G  D   STTGY+L+ G+  I
Sbjct  1064  HWSALKRVLRYLAGSCDKGVFISATTALTFHAYSDADWAGDKDDYVSTTGYLLYLGNTPI  1123

Query  1069  SWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVC  1248
             SW S +Q++VA  STEAEY+ALA+ A+E++WV +L  ++G +   +PV++CDNL A  + 
Sbjct  1124  SWSSRKQRSVARSSTEAEYKALADTASELLWVLSLFTELGHMPTANPVIYCDNLGATNLS  1183

Query  1249  QNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFE  1407
              N V+HSRMKH+AL Y FVR H+ +G  RV  V    Q+A ILTK L R  FE
Sbjct  1184  ANPVFHSRMKHIALAYHFVREHVQHGKFRVSFVSTDDQLADILTKPLLRPRFE  1236



>gb|ABA95366.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=552

 Score =   229 bits (585),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/283 (41%), Positives = 181/283 (64%), Gaps = 0/283 (0%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG+EV  T DG+ L+Q +Y  DIL++V M + K V TP+++   L   +    
Sbjct  266   LEELHYFLGIEVNKTSDGIMLTQEKYASDILRRVGMQDCKPVSTPLLASEKLLVHEGTLL  325

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D T Y+ ++G L YL++T PD+ + +N++ QF+H+P  +HW  VKR+LRYLK TV  
Sbjct  326   GQKDTTQYRSIVGALPYLTLTRPDISFSVNKVCQFLHSPTTVHWTVVKRILRYLKYTVNC  385

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL + +S+ L ++ F D+DW G  D  RST G+ +F GSN++SW + +Q  V+  STEAE
Sbjct  386   GLRISKSSSLLVSGFCDADWAGCLDDRRSTGGFAVFLGSNLVSWSARKQTTVSRSSTEAE  445

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             Y+ALA+  AE++W+  LL ++G+  P +  + CDN+ A Y+  N ++H+R KH+ +DY+ 
Sbjct  446   YKALADTKAEIMWLQTLLYEIGIETPKAAKVWCDNVGAKYLSVNPMFHARTKHIEVDYYI  505

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +    L ++++ +  QIA   TK L  R FE F+S + +
Sbjct  506   VRERVSRKLLEIEYISSKDQIAYGFTKSLTVRPFEVFKSNLNI  548



>emb|CAN83506.1| hypothetical protein VITISV_027576 [Vitis vinifera]
Length=1172

 Score =   236 bits (601),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 140/311 (45%), Positives = 194/311 (62%), Gaps = 13/311 (4%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             ++++++ +L +R S  +  L  L +FLGVE++P   G  LSQ +Y +D+L +  M EAK 
Sbjct  862   LVNRYIHLLANRFSLKD--LGKLSYFLGVEIVPNSQGFLLSQRRYLLDLLARTHMSEAKP  919

Query  706   VRTPIVSPVDL-FRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPL  882
             V+TP+ S   +     D+    +D T ++ V+G LQYL +T  D+ +  N+LSQFMH P 
Sbjct  920   VQTPLPSGTKISLHSGDK---LSDPTEFRAVVGSLQYLLLTRLDIAFAANKLSQFMHTPT  976

Query  883   LIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDS-------DWGGVHDGGRSTTGY  1041
               HW  VKR+LRYL GT  H L L   + L L AFSD+       DW G  D   ST  Y
Sbjct  977   TEHWTLVKRLLRYLCGTPDHSLQLYCDSPLSLHAFSDALHAYSDADWAGDPDDFSSTGAY  1036

Query  1042  VLFFGSNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHC  1221
             +++ G N ISW S +QK +A  STEAEYR +AN AAE+ WV +LL D+G+ LP  PV++C
Sbjct  1037  IVYLGRNPISWSSKKQKNIARSSTEAEYRFVANTAAELNWVSSLLCDLGIQLPTCPVIYC  1096

Query  1222  DNLSAMYVCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRL  1401
             DN+ A  VC N V+HSRMKH+A D+ F+R  +  G LRV HV +T Q+A +LTK L R  
Sbjct  1097  DNVGATQVCSNPVFHSRMKHVAFDFHFIRDQVQKGILRVAHVSSTDQLADLLTKSLPRAR  1156

Query  1402  FEHFRSKMGVS  1434
             F   R K+G+S
Sbjct  1157  FLFLRDKIGLS  1167



>gb|KHN17953.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Glycine 
soja]
Length=1294

 Score =   236 bits (602),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 134/293 (46%), Positives = 186/293 (63%), Gaps = 4/293 (1%)
 Frame = +1

Query  529   MSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIV  708
             +S+ +  L +R S  +  L  L +FLGVEVIP+  G+FLSQ +Y ID+L K  M   K  
Sbjct  983   LSKLIATLAARFSLKD--LGCLSYFLGVEVIPSAAGMFLSQRKYIIDLLHKSGMTNTKPA  1040

Query  709   RTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLI  888
              TP+ + V L   KD   +      Y+ ++G LQYLS+T PD+ +  N+L+QFM NP   
Sbjct  1041  STPLSASVQLL--KDSGDLLPSPNEYRTLVGSLQYLSLTRPDIAFSTNKLAQFMQNPRTA  1098

Query  889   HWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVI  1068
             HW A+KRVLRYL G+   G+ +  +  L   A+SD+DW G  D   STTGY+L+ G+  I
Sbjct  1099  HWSALKRVLRYLAGSCDKGVFISATAPLTFHAYSDADWAGDKDDYVSTTGYLLYLGNTPI  1158

Query  1069  SWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVC  1248
             SW S +Q++VA  STEAEY+ALA+ A+E++WV +L  ++G +   +PV++CDNL A  + 
Sbjct  1159  SWSSRKQRSVARSSTEAEYKALADTASELLWVLSLFTELGHMPTANPVIYCDNLGATNLS  1218

Query  1249  QNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFE  1407
              N V+HSRMKH+AL Y FVR H+ +G  RV  V    Q+A ILTK L R  FE
Sbjct  1219  ANPVFHSRMKHIALAYHFVREHVQHGKFRVSFVSTDDQLADILTKPLLRPRFE  1271



>ref|XP_002453623.1| hypothetical protein SORBIDRAFT_04g009135 [Sorghum bicolor]
 gb|EES06599.1| hypothetical protein SORBIDRAFT_04g009135 [Sorghum bicolor]
Length=801

 Score =   233 bits (593),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 130/286 (45%), Positives = 176/286 (62%), Gaps = 2/286 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LHHFLGV V P P GL L Q QYT+DIL++  M   K   TP+ +   L   + + +
Sbjct  518   LGVLHHFLGVTVEPRPTGLLLHQRQYTLDILERAGMTGCKPCPTPVDTQGKLS--EAEGS  575

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               AD T Y+ + G LQYL+ T PD+ Y + ++   MH+P   H  A+KR+LRYL+GTV +
Sbjct  576   PVADPTAYRSLAGALQYLTFTRPDITYAVQQVCLHMHDPREPHLTALKRLLRYLRGTVDY  635

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GLLL RS    L  ++D+DW G  D  RST+GY +F G N++SW S RQ  V+  S EAE
Sbjct  636   GLLLHRSPSTELVVYTDADWAGCPDTRRSTSGYAVFLGGNLMSWSSKRQLVVSRSSAEAE  695

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+AN  AE  W+  LL ++   L  S +++CDN+SA+Y+  N V H R KH+ +D  F
Sbjct  696   YRAVANGVAEASWLRQLLAELHSPLSRSTLVYCDNVSAVYLSTNPVQHQRTKHVEIDLHF  755

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDG  1440
             VR  +  G +RV HVP TSQ A I TKGL    F  FR+ + ++ G
Sbjct  756   VRDRVAVGDVRVLHVPTTSQFADIFTKGLPSSTFAEFRTSLNITGG  801



>emb|CAN65591.1| hypothetical protein VITISV_042091 [Vitis vinifera]
Length=1427

 Score =   236 bits (601),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 137/284 (48%), Positives = 182/284 (64%), Gaps = 15/284 (5%)
 Frame = +1

Query  583   LVALHHFLGVE-VIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQS  759
             L  L +FLGVE  I T DG+FLSQ QY  D+L K ++   K   TP+ S   L    +  
Sbjct  1120  LGPLSYFLGVEGAISTSDGMFLSQHQYVRDLLAKFNLEGIKDSSTPMSSTGHLTL--NDG  1177

Query  760   TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVF  939
             +   +AT ++ +IG LQYL +T  D+ + +N+L+QFMH P   HW A KR+LRYLK T+ 
Sbjct  1178  SPPXNATQFRSLIGGLQYLQLTRLDIAFAVNKLAQFMHAPTQTHWTAAKRLLRYLKHTIH  1237

Query  940   HGLLLRRSTQLHLAAFSD------------SDWGGVHDGGRSTTGYVLFFGSNVISWRSV  1083
              GL  RR   LHL A+SD            +DW G  D  +STT +VLF G + ISW S 
Sbjct  1238  LGLTFRRXQPLHLQAYSDVTPPLDLRAYSDADWAGDPDSYKSTTAFVLFLGGHPISWCSK  1297

Query  1084  RQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVY  1263
             +QK VA  STEAEYRA+A+ AAEV WV +LL ++G+ L  SP ++CDNLSA Y+C N ++
Sbjct  1298  KQKTVARSSTEAEYRAVASTAAEVTWVSHLLSELGITLQQSPTIYCDNLSATYLCVNPLF  1357

Query  1264  HSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGR  1395
             HSRMKH+ALDY FVR  + +G+L+V HV   SQ+A +LTK L +
Sbjct  1358  HSRMKHVALDYHFVREKVXDGSLKVSHVNTQSQLADVLTKPLSK  1401



>emb|CAE04646.2| OSJNBa0061G20.2 [Oryza sativa Japonica Group]
Length=542

 Score =   226 bits (577),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/292 (43%), Positives = 181/292 (62%), Gaps = 2/292 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  +H FLG++V  T DG FLSQ QY  D+L +  + + K   TPI +   +     Q  
Sbjct  249   LGPVHFFLGIQVRRTADGFFLSQEQYAGDVLDRAGLADCKPAPTPIDTKAKVSSTTGQPY  308

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               +D T Y+ ++G LQYL++T PD+ Y + ++   MH+P  +HW  VKR+LRY++GT   
Sbjct  309   --SDPTFYRSIVGALQYLTLTRPDLSYAVQQVCLHMHSPRDVHWTLVKRILRYVRGTTHK  366

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL LRRS+   L A+SD DW G  D  RST+G+ +FFG +  SW S RQ  V+  S EAE
Sbjct  367   GLQLRRSSTPSLTAYSDVDWAGCPDTRRSTSGFCVFFGDSSESWSSKRQSVVSRSSAEAE  426

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YR +ANAAAE  W+ +LL ++ V L  + +++CDN+SA+Y+ +N ++H R KH+ LD  F
Sbjct  427   YRGVANAAAECCWLRHLLGELHVKLDKATLVYCDNISAVYLSKNPLHHGRAKHVELDVHF  486

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
             VR  +  G +RV H+P   Q+A I+TK L   LFE FRS + + D +    G
Sbjct  487   VREKVAVGDIRVAHIPTRQQLADIMTKRLPTALFEDFRSSLCIVDDAPTAGG  538



>ref|NP_001175678.1| Os08g0544300 [Oryza sativa Japonica Group]
 dbj|BAH94406.1| Os08g0544300 [Oryza sativa Japonica Group]
Length=821

 Score =   231 bits (589),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 121/281 (43%), Positives = 177/281 (63%), Gaps = 0/281 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV    DGL LSQ +Y  D+L++V M+E K V TP+ +   L   +       
Sbjct  533   LHYFLGIEVHKVKDGLMLSQEKYASDLLRRVGMYECKPVSTPLSTSEKLSVNEGTLLGPQ  592

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D+T Y+ V+G LQYL++T PD+ + IN++ QF+H P   HW AVKR+LRY+K TV  GL 
Sbjct  593   DSTQYRSVVGALQYLTLTRPDISFSINKVCQFLHAPTTTHWAAVKRILRYVKYTVDTGLK  652

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
               R+  L ++ FSD+DW G  D  RST G+ +F G N++SW + +Q  V+  STEAEY+A
Sbjct  653   FCRNPSLLVSGFSDADWAGSPDDRRSTGGFAVFLGPNLVSWSARKQATVSRSSTEAEYKA  712

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA AE++WV  LLQ++GV  P +  L CDNL A Y+  N ++H+R KH+ +D+ FVR 
Sbjct  713   LANATAEIMWVQTLLQELGVESPRAAKLWCDNLGAKYLSANPIFHARTKHIEVDFHFVRE  772

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
              +    L + ++    Q+A   TK +  R  E F++ + + 
Sbjct  773   RVARKLLEIAYISTKDQVADGFTKAIPVRQMEMFKNNLNLE  813



>emb|CAN61640.1| hypothetical protein VITISV_021909 [Vitis vinifera]
Length=1361

 Score =   234 bits (597),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 184/280 (66%), Gaps = 3/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLGVEV     GLFLSQ++Y +D+L++  M +AK + TP V    L     + T+ +
Sbjct  1066  LHYFLGVEVQANEKGLFLSQTKYALDLLQRASMIDAKPISTPFVVGQHL---SAEGTLFS  1122

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T+++ + G LQYL+IT PD+ + +N + QFMH P   H++A+KR+LRY+KGT  HGL 
Sbjct  1123  DPTLFRSLAGALQYLTITRPDLSFSVNSIFQFMHAPTEDHFRALKRILRYVKGTAHHGLQ  1182

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L + +   L  +SD+DW G  D  RSTTGY +FFG+N+ISW S +Q  V+  S EAEYR+
Sbjct  1183  LHKQSTRDLLGYSDADWAGCPDTRRSTTGYAIFFGANLISWSSKKQSTVSRSSAEAEYRS  1242

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA A A++ W+  LL+D+ V L   P + CDN SA+++  N V   R KH+A+DY FVR 
Sbjct  1243  LAVATADIAWIIQLLRDLHVTLSVPPKILCDNQSAIFMAVNPVTRPRSKHIAIDYHFVRE  1302

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              +  GTL++  VP+  Q+A  LTKG+ +  F  FRSK+ V
Sbjct  1303  LVDKGTLKIDFVPSHLQLADSLTKGVTKPQFYLFRSKLSV  1342



>gb|AAK02020.2|AC074283_1 Putative gag-pol polyprotein [Oryza sativa]
 gb|AAP52036.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1058

 Score =   231 bits (589),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/295 (42%), Positives = 185/295 (63%), Gaps = 2/295 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG+EV      + L+Q +Y  +I+K+V M   K V TP+ +   L   + +  
Sbjct  766   LGELHYFLGIEVKKASGNILLNQERYASEIVKRVSMENCKSVGTPLSTVEKLSAYEGEKL  825

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                DAT Y+ V+G LQYL++T PD+ + +N++ QF+ NP  +HW  VKR+LRY+KGT+  
Sbjct  826   GEKDATQYRSVVGALQYLTLTRPDISFSVNKVCQFLQNPTTVHWATVKRILRYVKGTLGL  885

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL + +S+   ++A+SD+DW    D  RST G+ +F GSN+ISW + +Q  V+  STEAE
Sbjct  886   GLKVEKSSSNIVSAYSDADWADCLDDKRSTGGFAVFLGSNLISWNARKQATVSRSSTEAE  945

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             Y+ALANA AE++WV  LL+++G+  P    L CDN+ A Y+  N V+H+R KH+ +DY F
Sbjct  946   YKALANATAEIMWVRKLLEELGISHPGPSQLWCDNIGATYLSVNPVFHARTKHIEIDYHF  1005

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
             VR  +    L +Q VP+  Q+A   TK L  R  + FR+ + + D    LRG ++
Sbjct  1006  VREQVAQKQLALQFVPSQDQVADGFTKALPVRQLQMFRNNLNLVD--LRLRGSVR  1058



>ref|XP_002489074.1| hypothetical protein SORBIDRAFT_0139s002040 [Sorghum bicolor]
 gb|EES20269.1| hypothetical protein SORBIDRAFT_0139s002040 [Sorghum bicolor]
Length=1822

 Score =   234 bits (596),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 131/287 (46%), Positives = 177/287 (62%), Gaps = 3/287 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LHHFLGV V P P GL L Q QYT+DIL++  M + K   TP+ +   L   + + T
Sbjct  1538  LGQLHHFLGVTVEPHPAGLLLHQRQYTLDILERAGMTDCKPCSTPVDTQGKLS--EAEGT  1595

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D T Y+ + G LQYL+ T PD+ Y + ++   MH+P   H  A+KR+LRYL+G+V  
Sbjct  1596  PVTDPTAYRSLAGALQYLTFTRPDITYAVQQICLHMHDPREPHLTALKRILRYLRGSVDF  1655

Query  943   GLLL-RRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTea  1119
             GLLL RRS+   L  ++D+DW G  D  RST+GY +F G N++SW S RQ  V+  S EA
Sbjct  1656  GLLLHRRSSSTELVVYTDADWAGCPDTRRSTSGYAVFLGGNLVSWSSKRQPVVSRSSAEA  1715

Query  1120  eyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYF  1299
             EYRA+AN  AE  W+  LL ++   L  S +++CDN+SA+Y+  N V H R KH+ +D  
Sbjct  1716  EYRAVANGVAEASWLRQLLAELHSPLSQSALVYCDNVSAVYLSTNPVQHQRTKHVEIDLH  1775

Query  1300  FVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDG  1440
             FVR  +  G +RV HVP TSQ A I TKGL    F  FRS + ++ G
Sbjct  1776  FVRDRVAVGDVRVLHVPTTSQFADIFTKGLPSSTFAEFRSSLNITSG  1822



>gb|AEJ07956.1| putative polyprotein [Sorghum propinquum]
Length=534

 Score =   224 bits (572),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/284 (45%), Positives = 177/284 (62%), Gaps = 5/284 (2%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLF-RPKDQSTVA  768
             LHHFLG+ V  +  G+FLSQ QYT+DIL++  M   K    P  +PVDL  +  +     
Sbjct  253   LHHFLGISVTRSAKGMFLSQRQYTLDILERAGMSACK----PCSTPVDLHSKLSEDGPPV  308

Query  769   ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGL  948
              DAT Y+ + G LQYL+ T PD+ Y + ++  +MH+P   H  A+KR+LRYL+GT   GL
Sbjct  309   GDATQYRSLAGALQYLTFTRPDIAYAVQQICLYMHDPREPHLAALKRILRYLQGTTTLGL  368

Query  949   LLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
              + RS+   L  ++D+DW G  D  RST+GY +F G N++SW S RQ  V+  S EAEYR
Sbjct  369   TMCRSSPTELVVYTDADWAGCPDTRRSTSGYAVFLGDNLVSWSSKRQHTVSRSSAEAEYR  428

Query  1129  alanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
             A+AN  AE  W+  LL ++      + +++CDN+SA+Y+  N V H R KH+ +D  FVR
Sbjct  429   AVANGVAEATWLRQLLLELQRPPRRATLVYCDNVSAVYLSSNPVQHQRTKHVEIDLHFVR  488

Query  1309  VHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDG  1440
             V +  G +RV HVP TSQ A + TKGL   +F+ FRS + VSD 
Sbjct  489   VKVALGHVRVTHVPTTSQYADVFTKGLPTSVFQEFRSSLTVSDA  532



>ref|XP_002460196.1| hypothetical protein SORBIDRAFT_02g024427 [Sorghum bicolor]
 gb|EER96717.1| hypothetical protein SORBIDRAFT_02g024427 [Sorghum bicolor]
Length=1575

 Score =   233 bits (593),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 130/284 (46%), Positives = 176/284 (62%), Gaps = 3/284 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LHHFLGV V P P GL L Q QYT+DIL++  M + K   TP+ +   L   + + T   
Sbjct  1294  LHHFLGVTVEPHPAGLLLHQRQYTLDILERAGMTDCKPCSTPVDTQGKLS--EAEGTPVT  1351

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ + G LQYL+ T PD+ Y + ++   MH+P   H  A+KR+LRYL+G+V  GLL
Sbjct  1352  DPTAYRSLAGALQYLTFTRPDITYAVQQICLHMHDPREPHLTALKRILRYLRGSVDFGLL  1411

Query  952   L-RRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
             L RRS+   L  ++D+DW G  D  RST+GY +F G N++SW S RQ  V+  S EAEYR
Sbjct  1412  LHRRSSSTELVVYTDADWAGCPDTRRSTSGYAVFLGGNLVSWSSKRQPVVSRSSAEAEYR  1471

Query  1129  alanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
             A+AN  AE  W+  LL ++   L  S +++CDN+SA+Y+  N V H R KH+ +D  FVR
Sbjct  1472  AVANGVAEASWLRQLLAELHSPLSRSALVYCDNVSAVYLSTNPVQHQRTKHVEIDLHFVR  1531

Query  1309  VHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDG  1440
               +  G +RV HVP TSQ A I TKGL    F  FRS + ++ G
Sbjct  1532  DRVAVGDVRVLHVPTTSQFADIFTKGLPSSTFAEFRSSLNITSG  1575



>ref|XP_002438095.1| hypothetical protein SORBIDRAFT_10g007953 [Sorghum bicolor]
 gb|EER89462.1| hypothetical protein SORBIDRAFT_10g007953 [Sorghum bicolor]
Length=1330

 Score =   232 bits (591),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 130/287 (45%), Positives = 177/287 (62%), Gaps = 3/287 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L ALHHFLGV V P P GL L Q QYT+DIL++  M + K   TP+ +   +   + +  
Sbjct  1046  LGALHHFLGVTVEPHPAGLLLHQRQYTLDILERAGMTDCKPCSTPVDTQGKIS--EAEGI  1103

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D T Y+ + G LQYL+ T PD+ Y + ++   MH+P   H  A+KR+LRYL+GTV  
Sbjct  1104  PVTDPTAYRSLAGALQYLTFTRPDITYAVQQICLHMHDPREPHLAALKRILRYLRGTVDF  1163

Query  943   GLLL-RRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTea  1119
             GLLL RRS+   L  ++D+DW G  D  RST+GY +F G N++SW S RQ  V+  S EA
Sbjct  1164  GLLLHRRSSSTELVVYTDADWAGCPDTRRSTSGYAVFLGGNLVSWSSKRQPVVSRSSAEA  1223

Query  1120  eyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYF  1299
             EYRA+AN  AE  W+  LL ++   L  S +++CDN+SA+Y+  N V H R KH+ +D  
Sbjct  1224  EYRAVANGVAEASWLRQLLAELHSPLSRSALVYCDNVSAVYLSTNPVQHQRTKHVEIDLH  1283

Query  1300  FVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDG  1440
             FVR  +  G +RV HVP TSQ A I TKGL    F  FR+ + ++ G
Sbjct  1284  FVRDRVAVGDVRVLHVPTTSQFADIFTKGLPSSTFTEFRTSLNITSG  1330



>ref|XP_002456118.1| hypothetical protein SORBIDRAFT_03g030787 [Sorghum bicolor]
 gb|EES01238.1| hypothetical protein SORBIDRAFT_03g030787 [Sorghum bicolor]
Length=1567

 Score =   232 bits (592),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 130/284 (46%), Positives = 176/284 (62%), Gaps = 3/284 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LHHFLGV V P P GL L Q QYT+DIL++  M + K   TP+ +   L   + + T   
Sbjct  1286  LHHFLGVTVEPHPAGLLLHQRQYTLDILERAGMTDCKPCSTPVDTQGKLS--EAEGTPVT  1343

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ + G LQYL+ T PD+ Y + ++   MH+P   H  A+KR+LRYL+G+V  GLL
Sbjct  1344  DPTAYRSLAGALQYLTFTRPDITYAVQQICLHMHDPREPHLTALKRILRYLRGSVDFGLL  1403

Query  952   L-RRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
             L RRS+   L  ++D+DW G  D  RST+GY +F G N++SW S RQ  V+  S EAEYR
Sbjct  1404  LHRRSSSTELVVYTDADWAGCPDTRRSTSGYAVFLGGNLVSWLSKRQPVVSRSSAEAEYR  1463

Query  1129  alanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
             A+AN  AE  W+  LL ++   L  S +++CDN+SA+Y+  N V H R KH+ +D  FVR
Sbjct  1464  AVANGVAEASWLRQLLAELHSPLSQSALVYCDNVSAVYLSTNPVQHQRTKHVEIDLHFVR  1523

Query  1309  VHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDG  1440
               +  G +RV HVP TSQ A I TKGL    F  FRS + ++ G
Sbjct  1524  DRVAVGDVRVLHVPTTSQFADIFTKGLPSSTFAEFRSSLNITSG  1567



>emb|CAN61827.1| hypothetical protein VITISV_027629 [Vitis vinifera]
Length=638

 Score =   225 bits (574),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 125/280 (45%), Positives = 181/280 (65%), Gaps = 3/280 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FL VEV     GLFL+Q +Y +D+L++  M +AK + TP V    L     + T+ +
Sbjct  343   LHYFLRVEVQANEKGLFLNQMKYALDLLQRASMIDAKPISTPFVVGQHL---SAEGTLFS  399

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             + T+++ + G LQYL+IT PD+ + +N + QFMH P   H++A+KR+LRY+KG   HGL 
Sbjct  400   NPTLFRSLAGALQYLTITRPDLSFSVNSICQFMHAPTEDHFRALKRILRYVKGXAHHGLQ  459

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L + +   L  +SD+DW G  D  RSTTGY +FFG+N+ISW S +Q  V+H S EAEYR+
Sbjct  460   LHKQSTRDLLGYSDADWAGCPDXRRSTTGYAIFFGANLISWSSKKQSXVSHSSAEAEYRS  519

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA A A++ W+  LL+D+ V L   P + CDN SA+++  N V   R KH+A+DY FVR 
Sbjct  520   LAIATADIAWIIXLLRDLHVTLSMPPKILCDNQSAIFMAVNPVTRPRSKHIAIDYHFVRE  579

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              +  GTL++  VP+  Q+A  LTKG+ +  F  F SK+ V
Sbjct  580   LVDKGTLKIDFVPSHLQLANSLTKGVTKPQFYLFXSKLSV  619



>ref|XP_008350549.1| PREDICTED: uncharacterized protein LOC103413885 [Malus domestica]
Length=1668

 Score =   231 bits (590),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 134/278 (48%), Positives = 181/278 (65%), Gaps = 3/278 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+++     GLF+SQ++Y  D+L KVDM +AK   TP +    L   K + T+  
Sbjct  1370  LHYFLGLQITYKSTGLFVSQTKYIQDLLAKVDMQDAKSCATPCLPYHRL--SKTEGTLYH  1427

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
                 Y+ ++G LQYL+ T PD+ + +N+  QFMHNPL IH  AVKR+LRYL GT+  G+ 
Sbjct  1428  SPEQYRSIVGALQYLTFTRPDIAFAVNQCCQFMHNPLDIHVVAVKRILRYLSGTLDFGIH  1487

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                S  LHL A+SD+DW G  +  RST+GYV++ G+  ISW S +Q  V+  STEAEYRA
Sbjct  1488  FN-SGPLHLQAYSDADWAGDPNDRRSTSGYVVYLGNTPISWASKKQHTVSRSSTEAEYRA  1546

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA  AAEV W+  LL D+ V L  +PVL CDN+SA+ +  N V+HSR+KH+ +DY FVR 
Sbjct  1547  LAITAAEVSWIRKLLCDLHVPLYDAPVLFCDNISAIALSSNPVFHSRVKHIEIDYHFVRE  1606

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
              ++ G L VQHV +  Q A ILTKGL   LF+   S +
Sbjct  1607  RVIRGDLAVQHVSSKEQFADILTKGLSISLFQDHCSNL  1644



>gb|ACY72569.1| unknown [Oryza sativa Japonica Group]
Length=1436

 Score =   230 bits (587),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/281 (42%), Positives = 175/281 (62%), Gaps = 0/281 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV   P+G+ L+Q +Y  D+LK+V+M   K V TP+     L   +       
Sbjct  1154  LHYFLGIEVTKVPNGIVLTQEKYANDLLKRVNMSNCKPVSTPLSVSEKLTLYEGSPLGPN  1213

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DAT Y+ ++G LQYL++T PD+ Y +N++ QF+H P   HW AVKR+LRYL      GL 
Sbjct  1214  DATQYRSIVGALQYLTLTRPDIAYSVNKVCQFLHAPTTDHWTAVKRILRYLNQCTSLGLN  1273

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             + +S    +  +SD+DW G  D  +ST G+ +F GSN++SW + +Q  V+  STEAEY+A
Sbjct  1274  IHKSASTLVHGYSDADWAGSVDDRKSTGGFAVFLGSNLVSWSARKQPTVSRSSTEAEYKA  1333

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN  AE+IWV  LL+++G+  P +  + CDNL A Y+  N V+H+R KH+ +DY FVR 
Sbjct  1334  VANTTAELIWVQTLLRELGIDSPKAAKIWCDNLGAKYLSANPVFHARTKHIEVDYHFVRE  1393

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
              +    L +  VP+  Q+A   TK L  RL EHF+  + ++
Sbjct  1394  RVSQKLLEIDFVPSGDQVADGFTKALSVRLLEHFKHNLNLT  1434



>ref|XP_009604985.1| PREDICTED: uncharacterized protein LOC104099639 [Nicotiana tomentosiformis]
Length=863

 Score =   227 bits (578),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 180/292 (62%), Gaps = 2/292 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH FLGVEV+ TP  ++LSQ +Y +D+  ++ M E K V TP+ S         ++  A 
Sbjct  573   LHFFLGVEVLSTPTAIYLSQHKYVMDLRDELHMAECKGVPTPMTSTCSF--ADSEADSAV  630

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D ++Y+++IG L YLS T PD+ + I++LSQFMH P + HW+A+KR+LRYLK T   G+ 
Sbjct  631   DISLYKKIIGKLHYLSFTRPDIGFAISKLSQFMHYPKVSHWKAIKRLLRYLKHTSTMGVK  690

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L R     L  +SD DW G      STTGYV++ G++ ISW S +Q+ V   STEAEYR 
Sbjct  691   LCRQPTDRLLVYSDFDWAGNPQDRTSTTGYVVYLGNSPISWSSKKQRFVLRSSTEAEYRV  750

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +A   +EV W+ NLL ++   L   P + CDN+S  Y+C N ++HSRMKH+A+D+ FV  
Sbjct  751   VAAVVSEVNWLTNLLHELHFPLSTPPTVLCDNVSTTYICANPLFHSRMKHVAIDFHFVPE  810

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
              +    L V+H+ +  Q+A ILTK L R  F      +G+   +  LRGRIK
Sbjct  811   QVQQKALEVRHLHSADQVADILTKPLLRTTFLRNFHNLGLVPVTPNLRGRIK  862



>emb|CAN64509.1| hypothetical protein VITISV_041217 [Vitis vinifera]
Length=1269

 Score =   229 bits (584),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 175/296 (59%), Gaps = 30/296 (10%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTP-IVSPVDLFRPKDQS  759
             L  L +FLGVEV    +GLFLSQ +Y  D+L +  M EAK   TP   SP+   +     
Sbjct  998   LGPLTYFLGVEVTSHTNGLFLSQRKYIADLLNRTHMTEAKPTLTPXATSPILTLQ---SG  1054

Query  760   TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVF  939
             T  +D T Y+ ++G LQYLS+T PD+ Y +N+LSQFMH     HW AVKR+LRYL GT+ 
Sbjct  1055  TXLSDXTEYRTMVGSLQYLSLTRPDIAYTVNKLSQFMHQSTSDHWNAVKRLLRYLCGTLD  1114

Query  940   HGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTea  1119
             HG+ LRR++ L L AFSDSDW G  D   ST+ Y+++ G N ISW S +Q+ VA  STEA
Sbjct  1115  HGITLRRTSPLALHAFSDSDWAGNKDDFTSTSAYIIYLGHNPISWSSKKQRTVARSSTEA  1174

Query  1120  eyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYF  1299
             E                  + + +V          N+ A  +C N V+HSRMKH+ALDY 
Sbjct  1175  E-----------------YRSLFIVY---------NVGATNLCFNPVFHSRMKHVALDYH  1208

Query  1300  FVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
             F+R  + NG LRV H+  + Q+A  LTK L R  F+  ++K+G++   SILRG  K
Sbjct  1209  FIREQVQNGLLRVSHISVSDQLADALTKPLARPQFDSLKAKIGLAPRPSILRGHDK  1264



>emb|CAN79884.1| hypothetical protein VITISV_002539 [Vitis vinifera]
Length=1453

 Score =   229 bits (585),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 189/296 (64%), Gaps = 16/296 (5%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+EV   PDG FLSQ +Y  DIL +  + ++K V TP++    L     + T
Sbjct  1048  LGPLSYFLGLEVSYIPDGFFLSQVKYATDILARAQLLDSKPVPTPMIVSQRL---SSEGT  1104

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               AD T+Y+ ++G LQYL+ITCPD+ + +N +SQF+H P  +H+QAVKR+LRY++GT+  
Sbjct  1105  PFADPTLYRSLVGALQYLTITCPDLAHSVNSVSQFLHAPTEVHFQAVKRILRYVQGTLHF  1164

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL     + + L A+SD DW G  D  RST+GY            + +Q  V+  S E+E
Sbjct  1165  GLKFTSCSSMGLVAYSDEDWAGCPDTRRSTSGY------------AKKQPTVSRSSCESE  1212

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRALA  AAEV+W+ +LL+D+ V L H P+L CDN SA+++  N V H R KH+ LDY F
Sbjct  1213  YRALALTAAEVLWLTHLLRDLRVTLTHRPLLLCDNKSAIFLSSNPVSHKRAKHVDLDYHF  1272

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSI-LRGRIK  1467
             +R  IV GTLR+QH+P+  Q+A + TK + R L+  FRSK+ V    ++ LRG ++
Sbjct  1273  LRELIVAGTLRIQHIPSHLQLADVFTKSVSRDLYVFFRSKLRVCVNPTLSLRGAVE  1328



>ref|XP_007019438.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY16663.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=579

 Score =   222 bits (565),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 123/294 (42%), Positives = 178/294 (61%), Gaps = 38/294 (13%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L +LH+FLG+EV+ T  G FLSQ +Y  DIL K  M  AK   TPI +   L      +T
Sbjct  252   LGSLHYFLGIEVVLTAQGFFLSQHRYISDILIKTGMSGAKASTTPISTTTRLCLHDGSAT  311

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               AD   +++++G LQYL +T  D+ +V+N+LSQFMH P  +H+QA+KRVLRYLK T+FH
Sbjct  312   --ADDEAFRKIVGCLQYLVLTRLDICFVVNKLSQFMHKPSTLHFQALKRVLRYLKRTLFH  369

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL +++     L  F++SDW G  +   ST+ ++++ G   +SW   +QKA A  S+EAE
Sbjct  370   GLFIKKELSPSLQVFTNSDWAGSPNDKTSTSVFIIYLGGTPVSWSLKKQKAFARSSSEAE  429

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA++ A +E  W+ +LL ++ +VLP SP ++CDNLSA Y C+N V+H++MKHL LD+FF
Sbjct  430   YRAISTAVSEATWIQSLLHELQLVLPSSPSVYCDNLSATYTCKNSVFHTKMKHLQLDFFF  489

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRI  1464
             V                                    R K+GV++G++ILRG I
Sbjct  490   V------------------------------------REKIGVTNGATILRGHI  507



>emb|CAH67061.1| H0112G12.6 [Oryza sativa Indica Group]
Length=811

 Score =   225 bits (574),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 128/283 (45%), Positives = 175/283 (62%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L ALHHFLGV V     GL LSQ QY IDIL++  M + K   TP+ +   L        
Sbjct  530   LGALHHFLGVSVTRNSAGLVLSQRQYCIDILERAGMADCKPCNTPVDTTAKLS--SSDGP  587

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               AD T ++ + G LQYL+ T PD+ Y + ++   MH+P   H  A+KR+LRY++G++  
Sbjct  588   PVADPTDFRSLAGALQYLTFTRPDISYAVQQVCLHMHDPREPHLAALKRILRYIRGSMDL  647

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL ++RS+   LA +SD+DW G  D  RST+GY +F G N++SW S RQ  V+  S EAE
Sbjct  648   GLHIQRSSACDLAVYSDADWAGCPDTRRSTSGYAVFLGDNLVSWSSKRQHTVSRSSAEAE  707

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+ANA AEV W+  LLQ++      + +++CDN+SA+Y+  N V H R KH+ +D  F
Sbjct  708   YRAVANAVAEVTWLRQLLQELHSPPSRATLVYCDNVSAVYLSSNPVQHQRTKHVEIDLHF  767

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +  G +RV HVP TSQ A I TKGL   +F  FRS + V
Sbjct  768   VRERVAVGAVRVLHVPTTSQYADIFTKGLPTPVFTEFRSSLNV  810



>gb|AAR88589.1| putative copia-like retrotransposon protein [Oryza sativa Japonica 
Group]
Length=1399

 Score =   228 bits (582),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 120/281 (43%), Positives = 176/281 (63%), Gaps = 0/281 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV    DGL LSQ +Y  D+L++V M+E K V TP+ +   L   +       
Sbjct  1111  LHYFLGIEVHKVKDGLMLSQEKYASDLLRRVGMYECKPVSTPLSTSEKLSVNEGTLLGPQ  1170

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D+T Y+ V+G LQYL++T PD+ + IN++ QF+H P   HW AVKR+LRY+K TV  GL 
Sbjct  1171  DSTQYRSVVGALQYLTLTRPDISFSINKVCQFLHAPTTTHWAAVKRILRYVKYTVDTGLK  1230

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
               R+  L ++ FSD+DW G  D  RST G+ +F G N++SW + +Q  V+  S EAEY+A
Sbjct  1231  FCRNPSLLVSGFSDADWAGSPDDRRSTGGFAVFLGPNLVSWSARKQATVSRSSIEAEYKA  1290

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA AE++WV  LLQ++GV  P +  L CDNL A Y+  N ++H+R KH+ +D+ FVR 
Sbjct  1291  LANATAEIMWVQTLLQELGVESPRAAKLWCDNLGAKYLSANPIFHARTKHIEVDFHFVRE  1350

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
              +    L + ++    Q+A   TK +  R  E F++ + + 
Sbjct  1351  RVARKLLEIAYISTKDQVADGFTKAIPVRQMEMFKNNLNLE  1391



>gb|KHN21230.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1429

 Score =   228 bits (582),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 132/287 (46%), Positives = 188/287 (66%), Gaps = 7/287 (2%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDG-LFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQS  759
             L  L +FLG+E   TP G L LSQ++Y  DIL +  M + K + TP+  P +L   K  +
Sbjct  1138  LGTLEYFLGIECKLTPSGALHLSQAKYIRDILHRAGMEDCKGISTPL--PANLKLSKTGA  1195

Query  760   TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVF  939
                 + T+Y+ ++G LQY +IT P++ Y ++++ QF   PL+ HW AVKR+LRYLKG++ 
Sbjct  1196  DPFDNPTLYRSIVGALQYATITRPELGYSVSKVCQFFAQPLVSHWSAVKRILRYLKGSID  1255

Query  940   HGLLL---RRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFS  1110
             HGL L     S  L + AF D+DW    D  RST+G  +FFG N++SW S +Q  VA  S
Sbjct  1256  HGLTLLPATTSAPLSINAFCDADWASDIDDRRSTSGACIFFGPNLVSWWSKKQTLVAKSS  1315

Query  1111  TeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLAL  1290
              EAEYR+LA+AA+EV+W+ +LL ++ V +P  PV++CDN SA+ +  N V HSR KH+ L
Sbjct  1316  AEAEYRSLAHAASEVLWLQSLLHELKVPIP-PPVIYCDNQSAVAISHNPVLHSRTKHMEL  1374

Query  1291  DYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             D FFVR  ++N +L V ++PA  Q+A ILTK L + LF +FRSK+ V
Sbjct  1375  DIFFVREKVLNKSLVVSYIPAQLQVADILTKSLSKHLFYNFRSKLRV  1421



>gb|ACF87376.2| unknown [Zea mays]
Length=526

 Score =   220 bits (560),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 187/309 (61%), Gaps = 10/309 (3%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             ++S  +  L S  S ++  L  L HFLG+EV P+  GL LSQ QY +DIL + +M     
Sbjct  221   LLSHIISQLCSEFSMSD--LGPLRHFLGIEVTPSDTGLVLSQKQYALDILARANMTHCN-  277

Query  706   VRTPIVSPVDLFRPKDQST---VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHN  876
                P  +PVD    K  ST   + +  TVY+ + G LQYL++T PD+ Y + ++  FMH 
Sbjct  278   ---PCHTPVDT-NSKPASTDGCLLSQPTVYRSLAGALQYLTLTRPDISYAVQQVCLFMHA  333

Query  877   PLLIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFG  1056
             P   H   +KR+LRY++GT+ +GL + RS+ L L A+SD+DW G  D  RST+GY +F G
Sbjct  334   PRDTHMSLLKRILRYVRGTLDYGLHIYRSSSLDLLAYSDADWAGCPDTRRSTSGYCVFLG  393

Query  1057  SNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSA  1236
             +N+++W S RQ  V+  S EAEYR +ANA AE+ W+  LL ++      + V+ CDN+S 
Sbjct  394   ANLVAWSSKRQHTVSRSSAEAEYRGVANAVAEICWLRQLLTELCHPPRRAAVVFCDNVST  453

Query  1237  MYVCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFR  1416
             MY+  N V H R KH+ +D  FVR  +  G ++V HVP++ Q A I TKGL   LF+ FR
Sbjct  454   MYLASNPVQHQRTKHVEIDLHFVRERVSLGEVKVIHVPSSLQFADIFTKGLSSSLFKEFR  513

Query  1417  SKMGVSDGS  1443
             S + +   +
Sbjct  514   SNLQIKPAT  522



>ref|XP_002449547.1| hypothetical protein SORBIDRAFT_05g018930 [Sorghum bicolor]
 gb|EES08535.1| hypothetical protein SORBIDRAFT_05g018930 [Sorghum bicolor]
Length=619

 Score =   222 bits (565),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 125/292 (43%), Positives = 180/292 (62%), Gaps = 2/292 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LHHFLG+ V  + DGLFLSQ QY +D+L+K  M E  +  TP+ S   L     + T
Sbjct  329   LGELHHFLGISVTRSSDGLFLSQRQYAVDLLQKAGMAECHLTSTPVDSRAKL--SATEGT  386

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               AD + Y+ + G LQYL++T PD+ Y + ++  FMH+P   H   +KR+LRY+KGT+  
Sbjct  387   PVADPSAYRSLAGSLQYLTLTRPDLAYAVQQVCLFMHDPREAHLALIKRILRYVKGTLSA  446

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL +       L A+SD+DW    D  RST+G+ +F G +++SW S RQ  V+  S EAE
Sbjct  447   GLHIGTGPVDKLIAYSDADWARCPDSRRSTSGFCVFLGDSLVSWSSKRQTTVSRSSAEAE  506

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+A+  AE  W+  LLQ++ V L  + V++CDN+SA+Y+  N V+H R KH+ +D  F
Sbjct  507   YRAVAHVVAECCWLLQLLQELHVPLKVATVVYCDNISAVYMIANPVHHRRTKHIEIDIHF  566

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
             VR  +  G + V HVP+  Q A I+TKGL  +LFE FRS + +    ++  G
Sbjct  567   VREKVALGEVCVLHVPSKYQFADIMTKGLPIQLFEDFRSSLCIRHPDALTEG  618



>ref|XP_008356535.1| PREDICTED: uncharacterized protein LOC103420252 [Malus domestica]
Length=1312

 Score =   228 bits (580),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 189/295 (64%), Gaps = 8/295 (3%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG+EV  + DGLFL QS+Y  D+L K  M  AK    P ++P+   +      
Sbjct  1015  LGPLHYFLGLEVQRSADGLFLHQSKYISDLLHKTRMAGAK----PCLTPLGSHKLDHTGP  1070

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             +  D T Y+ ++G LQYL+ T PD+ + +N++ QFMH P   H QA KR+LR+LK TV H
Sbjct  1071  LLHDPTEYRSIVGALQYLTWTRPDLSFAVNQVCQFMHAPREPHLQAAKRILRFLKATVSH  1130

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL  ++ T +HL A+SD+DW G     RST+GY +F GSN+ISW + +Q  VA  STEAE
Sbjct  1131  GLWFKKGT-VHLTAYSDADWAGCPFDRRSTSGYCIFLGSNLISWSAKKQPTVARSSTEAE  1189

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YR+LA+ AAE+ W+  + +D+G+ LP  P L CDNLSA+ +  N V+H+R KH+ LDY +
Sbjct  1190  YRSLAHTAAEITWICKVFKDLGLHLPQVPSLWCDNLSAISLASNPVFHARTKHIELDYHY  1249

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSK--MGVSDGSSI-LRG  1458
             +R  ++   L+VQ+V +  Q+A I TK L +  F + +SK  +G  D S   LRG
Sbjct  1250  IRELVLANLLKVQYVCSHVQLADIHTKSLSKSRFLYLQSKLALGPFDASKFSLRG  1304



>gb|AAK55460.1|AC069300_15 putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|AAP54977.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1031

 Score =   226 bits (575),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 179/281 (64%), Gaps = 0/281 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV    DG+ L+Q +Y +D+LK+V+M + K V TP+     L   +       
Sbjct  748   LHYFLGIEVKEVNDGIVLTQEKYAMDVLKRVNMSDCKAVNTPLSISEKLSAHEGNPLGPE  807

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D+T Y+ ++G LQYL++T PD+ + +N++ Q++H     HW A KR+LRYLK TV  GL 
Sbjct  808   DSTRYRSLVGALQYLTLTRPDLSFSVNKVCQYLHAATTKHWVAAKRILRYLKHTVKLGLK  867

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             + +S  L ++AFSD+DW G  D  RST G+ +F G N++SW + +Q  V+  STEAEY+A
Sbjct  868   ISKSNSLLVSAFSDADWAGCLDDRRSTGGFAVFIGPNLVSWSARKQATVSRSSTEAEYKA  927

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA AE++W+  LL ++G+ +P    + CDN+ A Y+  N V+H+R KH+ +DY FVR 
Sbjct  928   LANATAEIMWIQTLLHELGIQVPKIAKVWCDNIGAKYMTANPVFHARTKHIEVDYHFVRE  987

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
              +    L+V+++    Q+A   TK L  R  E FR+ + ++
Sbjct  988   RVARKLLQVEYISTKDQVADGFTKTLSVRQLEMFRNNLNLT  1028



>ref|XP_002489126.1| hypothetical protein SORBIDRAFT_0019s003280 [Sorghum bicolor]
 gb|EES20370.1| hypothetical protein SORBIDRAFT_0019s003280 [Sorghum bicolor]
Length=761

 Score =   224 bits (570),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 176/287 (61%), Gaps = 2/287 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LHHFLG+ V    + LFLSQ QYT+DI+ +  M + K   TP+ +   +      S 
Sbjct  470   LGPLHHFLGMHVEQQGNSLFLSQRQYTLDIITRNGMSDCKPCSTPVDTCAKVSASDGPSV  529

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D T Y+ + G LQYL+ T PD+ Y + ++   MH+P   H  A KR+LRYLKGT+ +
Sbjct  530   T--DPTAYRSLAGALQYLTFTRPDIAYAVQQICLHMHDPRESHLTAAKRILRYLKGTLDY  587

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL++ RS+   L  ++D+DW G  D  RST+GY +F GS+++SW S RQ  V+  S EAE
Sbjct  588   GLVIPRSSPSQLTVYTDADWAGCPDTRRSTSGYAVFLGSSLVSWSSKRQPTVSRSSAEAE  647

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+AN  AE  W+H LLQ++   +  + +++CDN+SA+Y+  N V H R KH+ +D  F
Sbjct  648   YRAVANGVAEASWLHQLLQELHHPMSSACLVYCDNVSAVYLSTNPVQHQRTKHVEIDLHF  707

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGS  1443
             VR  +  G +RV HVP TSQ A + TKGL   +F  FRS + V   +
Sbjct  708   VRERVAIGVVRVLHVPTTSQFADVFTKGLPSSVFTDFRSSLNVQPAT  754



>ref|XP_002455933.1| hypothetical protein SORBIDRAFT_03g027495 [Sorghum bicolor]
 gb|EES01053.1| hypothetical protein SORBIDRAFT_03g027495 [Sorghum bicolor]
Length=682

 Score =   222 bits (566),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 171/283 (60%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LHHFLG+ V    D + LSQ QYT+DIL +  M   K   TP+ +   +  P D   
Sbjct  392   LGPLHHFLGIAVQCHRDSILLSQRQYTLDILARHGMSNCKPCSTPVDTCAKV--PADADP  449

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               AD T Y+ ++G LQYL+ T PD+ Y + ++   MH+P   H  A KR+LRYL+GT+ H
Sbjct  450   SVADPTAYRSLVGALQYLTFTRPDIAYSVQQVCLHMHDPRETHLVAAKRILRYLQGTLNH  509

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL++ R+    L  ++D+DW G  D  RST+GY +F G +++SW S RQ  V+  S EAE
Sbjct  510   GLVIPRTAPTQLRVYTDADWAGCPDTRRSTSGYAVFLGGSLVSWSSKRQPTVSRSSAEAE  569

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+AN  AE  W+  LLQ++   L  + +++CDN+SA Y+  N V H R KH+ +D  F
Sbjct  570   YRAVANGVAEATWLRQLLQELHHPLDSACLIYCDNVSACYLSTNPVQHQRTKHVEIDLHF  629

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +  G +RV H P TSQ A + TKGL   +F  FRS + V
Sbjct  630   VRERVAMGAVRVLHAPTTSQFADVFTKGLPSSIFMDFRSSLNV  672



>emb|CCH50966.1| T4.5 [Malus x robusta]
Length=1670

 Score =   228 bits (580),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 132/292 (45%), Positives = 186/292 (64%), Gaps = 5/292 (2%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             +++FLG+EV  +  GL L Q++Y +D+LKK DM  AK    P  +PV   +     T+ +
Sbjct  1374  INYFLGIEVHKSDQGLLLHQAKYALDLLKKTDMLGAK----PCATPVSTSKLDHSGTLLS  1429

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+  +G LQYL+ T PD+ + +N++ Q+MH+P  IH QAVKR+LRYLKGTV  GL 
Sbjct  1430  DPTSYRSTVGALQYLTWTRPDLAFAVNQVCQYMHSPQTIHLQAVKRILRYLKGTVDLGLW  1489

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
               + +Q  L A+SD+DW G     RST+GY +F GSN+ISW + +Q  VA  STEAEYR+
Sbjct  1490  FTKGSQC-LTAWSDADWAGCPVDRRSTSGYCVFLGSNLISWSAKKQATVARSSTEAEYRS  1548

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LAN AAE+ WV  +L D+   L  +PV++CDN S + +  N V+H+R KH+ +DY ++R 
Sbjct  1549  LANTAAEITWVCKILHDISFPLLKTPVIYCDNKSVIALAFNPVFHARTKHVEIDYHYIRE  1608

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
              ++ G + VQHV +  QIA I TK L    F    SK+ V   S  LRG +K
Sbjct  1609  KVLLGHIGVQHVASLLQIADIFTKPLAADRFAALTSKLSVRSPSFSLRGCVK  1660



>emb|CAN60276.1| hypothetical protein VITISV_028253 [Vitis vinifera]
Length=579

 Score =   220 bits (560),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/298 (41%), Positives = 184/298 (62%), Gaps = 4/298 (1%)
 Frame = +1

Query  571   ANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPK  750
             A   L +L +FL +E   T DGL +SQ +Y  DIL    + ++K V TP++    L    
Sbjct  276   ATKDLGSLSYFLSLEATSTTDGLLISQLKYARDILNXAQLLDSKPVHTPMIVSQHL---T  332

Query  751   DQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKG  930
                   +D T+Y+ ++G+ QYL+ITCPD+ +V+N +SQF+H P + H+ AVKR+LRY+KG
Sbjct  333   SDGPAFSDPTLYRSLVGVFQYLTITCPDIAHVVNSVSQFLHAPTMDHFLAVKRILRYVKG  392

Query  931   TVFHGLLLRRSTQL-HLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHF  1107
             T+  GL  R ST    L A+SD+DW G  D   ST+GY ++ G+N++S  + +Q  V+H 
Sbjct  393   TLHFGLTFRPSTAPGALVAYSDTDWAGCLDTRHSTSGYSIYLGNNLVSSSAKKQPIVSHS  452

Query  1108  STeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLA  1287
             S E+EY ALA    E++W+ +LL D+ V +   P+L CDN SA+++  NLV H R KH+ 
Sbjct  453   SYESEYCALAATXVELLWLTHLLHDLKVPISPKPILXCDNKSAIFLSSNLVSHKRAKHVE  512

Query  1288  LDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGR  1461
             LDY F+R   V   LR Q+VP+  Q+A + T+ + R LF+ F +K+ V    ++  G 
Sbjct  513   LDYHFLRELXVVSKLRTQYVPSHLQVADLFTQSVSRPLFDLFHTKLHVCSNPTLSLGE  570



>emb|CAR66103.1| RT-RNaseH [Triticum turgidum subsp. durum]
Length=420

 Score =   216 bits (550),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/290 (39%), Positives = 178/290 (61%), Gaps = 10/290 (3%)
 Frame = +1

Query  595   HHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAAD  774
             H+FLG+EV P  DG+ L+Q +Y  D+L++V +   K+V TP+ +   L     +   A D
Sbjct  129   HYFLGIEVKPIKDGILLTQEKYATDVLRRVGLEHCKLVSTPLSTSEKLTVEGGELLGADD  188

Query  775   ATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLL  954
             AT Y+ V+G LQYL++T PD+ Y +N++ Q++H P  +HW  VKR+LR+LK T+  G+ +
Sbjct  189   ATNYRSVVGALQYLTLTRPDISYSVNKICQYLHAPSTVHWTTVKRILRHLKFTMGLGIKI  248

Query  955   RRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyral  1134
              +S  + ++A+SD+D     D  RST G+ +F GSN++SW + +Q  V+  STEAEY+AL
Sbjct  249   TKSPSMLVSAYSDADRAECADDRRSTGGFAVFLGSNLVSWSARKQATVSRSSTEAEYKAL  308

Query  1135  anaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYH----------SRMKHL  1284
             ANA AEV+W+  LL ++G+  P +  L CDN+ A Y+  N V+H          +R KH+
Sbjct  309   ANATAEVMWIQTLLYELGIKAPQAARLWCDNIGATYLSANPVFHPCVMECKETGARTKHI  368

Query  1285  ALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
              +D+ FVR  +    L ++ +P   Q+A   TK L  R  + F+  + +S
Sbjct  369   EVDFHFVRERVARKLLEIRFIPTGDQLADGFTKPLSERRLDEFKYNLNLS  418



>ref|NP_001174286.1| Os05g0235100 [Oryza sativa Japonica Group]
 dbj|BAH93014.1| Os05g0235100, partial [Oryza sativa Japonica Group]
Length=841

 Score =   224 bits (570),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 182/292 (62%), Gaps = 8/292 (3%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH FLG+ V  + DGLFLSQ QY +D+LK+  M E     TP+ +     R K  +T  A
Sbjct  553   LHFFLGISVTRSSDGLFLSQRQYVVDLLKRAGMSECHSTATPVDA-----RSKLSATDGA  607

Query  772   ---DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D T Y+ ++G LQYL++T P++ Y + ++  FMH+P   H   +KR+LRY+KGT+  
Sbjct  608   PVSDPTEYRSLVGALQYLTLTRPELAYAVQQVCLFMHDPREPHLALIKRILRYIKGTLHI  667

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL L  +    L A+SD+DW G  D  RST+GY +F G N++SW S RQ  V+  S EAE
Sbjct  668   GLHLGTTPVDSLTAYSDADWAGCPDSHRSTSGYCVFLGDNLVSWSSKRQTTVSRSSAEAE  727

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+A+A AE  W+  LL ++ + L  + V++CDN+SA+Y+  N V+H R KH+ +D  F
Sbjct  728   YRAVAHAIAECCWLRQLLSELHISLTSATVVYCDNVSAVYMAANPVHHRRTKHIEIDIHF  787

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
             VR  +  G +RV H+P++ Q A I+TKGL  +LF  FRS + V D  +   G
Sbjct  788   VREKVALGQVRVLHLPSSHQFADIMTKGLPVQLFTEFRSSLCVRDNPASTAG  839



>ref|XP_004963727.1| PREDICTED: uncharacterized protein LOC101777694 [Setaria italica]
Length=1416

 Score =   226 bits (575),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 126/283 (45%), Positives = 174/283 (61%), Gaps = 0/283 (0%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LHHFLG+ V  +  GL LSQ Q+ ++IL +  M + K  +TP+ +   L        
Sbjct  1123  LGQLHHFLGMHVQRSGKGLLLSQRQFMVEILDRAGMTDCKSCQTPVDTNPKLSDSDGNLL  1182

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
              AA A+ Y+ + G LQYL+ T PD+ Y + ++   MH P   H  A+KR+LRY++GT+  
Sbjct  1183  SAAAASDYRSLAGALQYLTFTRPDISYAVQQVCLHMHAPRDSHLAALKRILRYVRGTLHL  1242

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GLLLR S Q     +SD+DW G  D  +ST+GY +F G N++SW S RQ AV+  S EAE
Sbjct  1243  GLLLRPSVQTEFVVYSDADWAGCPDTRKSTSGYAVFLGDNLVSWSSKRQNAVSRSSAEAE  1302

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+ANA AEV W+  LL ++ V L  + +++CDN+S MY+  N + H R KH+ +D  F
Sbjct  1303  YRAVANAVAEVTWLRQLLHELRVPLRRTALVYCDNISTMYMSSNPIQHQRTKHVEIDLHF  1362

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +  G +RV HVP TSQ A I TKGL   +F  FRS + V
Sbjct  1363  VRERVATGEVRVLHVPTTSQYADIFTKGLPSSVFTEFRSSLNV  1405



>ref|XP_010541762.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 [Tarenaya hassleriana]
Length=813

 Score =   222 bits (565),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 188/299 (63%), Gaps = 4/299 (1%)
 Frame = +1

Query  538   FLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTP  717
             F+ +L  R S  +  L  L  FLGVEV  +  GL LSQ +Y  DIL +  M +AK + TP
Sbjct  177   FISLLAGRFSLKD--LGNLSFFLGVEVKRSSAGLALSQRRYIDDILTRHKMSDAKPMPTP  234

Query  718   IVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQ  897
             + S   L    +  +V  D T +++V+G LQYL +T PD+ + +N+LSQ+MH P   HWQ
Sbjct  235   LSSTSSLS--LNSGSVLEDPTEFRQVLGSLQYLLLTRPDLAFAVNKLSQYMHRPTTDHWQ  292

Query  898   AVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWR  1077
             AVKR+LRY+ GT   GL    S    L A+SD+DWGG  D   ST  ++++   + ISW 
Sbjct  293   AVKRILRYVGGTRPLGLFFAASNTASLHAYSDADWGGDRDDFSSTGAHIVYLSRHPISWS  352

Query  1078  SVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNL  1257
             S +Q+  A  STEAEY++++  A+EV WV  LL ++GV +  +P ++CDN+ A Y+  N 
Sbjct  353   SKKQRFAAKSSTEAEYKSVSTTASEVQWVSALLSELGVSITATPTIYCDNVGATYLSANP  412

Query  1258  VYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
             V+HSRMKH+A+DY F+R  + +  LRV H+ +T Q+A  LTK L R  FE  R+K+GVS
Sbjct  413   VFHSRMKHVAIDYHFIRGLVQSSKLRVIHISSTDQLADALTKALPRTRFELLRTKIGVS  471



>ref|XP_004986808.1| PREDICTED: uncharacterized protein LOC101773259 [Setaria italica]
Length=1950

 Score =   226 bits (575),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 126/311 (41%), Positives = 187/311 (60%), Gaps = 2/311 (1%)
 Frame = +1

Query  532   SQFLVMLLSRCSKANGI--LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             S  L  +++R S    +  L ALHHFLG+ V  + DGLFLSQ QY +++L++  M E   
Sbjct  1638  SALLQRIMARLSSEFAMTDLGALHHFLGITVTRSSDGLFLSQRQYAVELLQRAGMAECHP  1697

Query  706   VRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLL  885
               TP+ +   L           DA+ Y+ + G LQYL++T PD+ Y + ++  FMH P  
Sbjct  1698  TTTPVDTHAKLSAADGDLLSEKDASEYRSLAGALQYLTLTRPDLAYAVQQVCLFMHAPRE  1757

Query  886   IHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNV  1065
              H   +KR+LR+++GT+  GL +   +   L A+SD+DW G  D  RST+G+ ++ G N+
Sbjct  1758  PHRALIKRILRFVQGTLSSGLHIGTGSVDKLTAYSDADWAGCPDSRRSTSGFCVYLGDNL  1817

Query  1066  ISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYV  1245
             +SW S RQ  V+  S EAEYRA+A+  AE  W+  LLQ++ + LP + V+ CDN+SA+Y+
Sbjct  1818  VSWSSKRQTTVSRSSAEAEYRAVAHVVAECCWLRQLLQELHIRLPSATVVFCDNVSAVYM  1877

Query  1246  CQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
               N V+H R KH+ +D  FVR  +  G +RV HVP++ Q A I+TKGL   LF  FRS +
Sbjct  1878  TANPVHHKRTKHIEIDIHFVREKVALGEIRVLHVPSSHQFADIMTKGLPTALFREFRSSL  1937

Query  1426  GVSDGSSILRG  1458
              V +  +   G
Sbjct  1938  CVREPPAATAG  1948



>gb|AAT85031.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF96679.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1437

 Score =   225 bits (573),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/289 (41%), Positives = 181/289 (63%), Gaps = 2/289 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV   P G+ +SQ +Y  D+LK+V+M + K V TP+ +   L   K       
Sbjct  1149  LHYFLGIEVTKIPGGILMSQEKYASDLLKRVNMSDCKSVATPLSASEKLIAGKGTILGPN  1208

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DAT Y+ ++G LQYL++T  D+ + +N++ QF+HNP   HW AVKR+LRY+K     GL 
Sbjct  1209  DATQYRSIVGALQYLTLTRLDIAFSVNKVCQFLHNPTTEHWAAVKRILRYIKQCTGLGLR  1268

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             + +S+ + ++ +SD+DW G  D  RST G+ ++ G N++SW + +Q  V+  STEAEY+A
Sbjct  1269  ICKSSSMIVSGYSDADWAGCLDDRRSTGGFAVYLGDNLVSWNAKKQATVSRSSTEAEYKA  1328

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA AE++WV  LLQ++ +V P    L CDN+ A Y+  N V+H+R KH+ +DY FVR 
Sbjct  1329  LANATAEIMWVQTLLQELNIVSPAMAQLWCDNMGAKYLSFNPVFHARTKHIEVDYHFVRE  1388

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
              +    L+V +V    Q+A   TK L  +  E+F+  + +  G  ++ G
Sbjct  1389  RVARKLLQVDYVSTNDQVADGFTKALPVKQLENFKYNLNL--GKVVIEG  1435



>gb|AAL66754.1|AF464738_5 putative copia-like retrotransposon Hopscotch polyprotein [Zea 
mays]
Length=1313

 Score =   224 bits (571),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/281 (42%), Positives = 178/281 (63%), Gaps = 0/281 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L++FLG+EV    DG+ L+Q +Y  D+LKKV M + K + TP+ +   L   +       
Sbjct  1031  LNYFLGIEVNKVRDGIILTQDKYASDLLKKVGMSDCKPISTPLSTSEKLSIHEGSPLGEK  1090

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ ++G LQYL++T PD+ + +N++ QF+H P  +HW AVKR+LRY+K     GL 
Sbjct  1091  DITQYRSIVGALQYLTLTRPDIAFSVNKVCQFLHAPTTLHWAAVKRILRYIKQCTNLGLH  1150

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             + RS    ++AFSD+DW G  D  +ST G+ +F GSN++SW + +Q  V+  STE+EY+A
Sbjct  1151  IHRSDSTLVSAFSDADWAGSVDDRKSTGGFAVFLGSNLVSWSARKQPTVSRSSTESEYKA  1210

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA AE+IWV  LL ++ +  P +  L CDNL A Y+  N ++H+R KH+ +DY FVR 
Sbjct  1211  LANATAELIWVQILLTEISIKSPRAAKLWCDNLGAKYLSANPIFHARTKHIEVDYHFVRD  1270

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
              +    L +++VP   Q+A   TK L  RL E+F+  + ++
Sbjct  1271  RVAKKLLDIEYVPTGDQVADGFTKPLSVRLLENFKVNLNLT  1311



>gb|ACA61613.1| hypothetical protein AP2_E11.1 [Arabidopsis lyrata subsp. petraea]
Length=471

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/282 (42%), Positives = 175/282 (62%), Gaps = 6/282 (2%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRP--KDQSTV  765
             LHHFLGV+      GLFLSQS Y  +I+++  M + K    P+ +PVDL      D   +
Sbjct  183   LHHFLGVKADFNTKGLFLSQSVYAQEIIQRAGMEDCK----PLATPVDLQSKLSVDDGEL  238

Query  766   AADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHG  945
               + T Y+R+ G LQYL+ T PD+ Y ++++  +MH P + H QA+KR++RYL+GT+ +G
Sbjct  239   IENPTFYRRLAGALQYLTFTRPDISYAVHQVCLYMHKPRVPHLQALKRIIRYLQGTLSYG  298

Query  946   LLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaey  1125
             + + R     L A+SD+DW G  D  RST+GY +F G N+ISW + RQ   +  STEAEY
Sbjct  299   IQMTRGRIDTLTAYSDADWAGCPDTRRSTSGYCVFLGPNLISWSAKRQPTPSRSSTEAEY  358

Query  1126  ralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFV  1305
             + +AN  AE+ W+ NLL ++   +  + +++CDN+S++Y+  N V H R KH+ LD  FV
Sbjct  359   KGVANTVAELTWIRNLLLEIHRPISAASIVYCDNVSSVYLSTNPVQHQRTKHIELDIHFV  418

Query  1306  RVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             R  +  G ++V HVP + Q A I TKGL   +   FRS + V
Sbjct  419   RDKVAIGEVKVFHVPTSLQYADIFTKGLPSTIHSEFRSSLTV  460



>ref|XP_002444329.1| hypothetical protein SORBIDRAFT_07g020255 [Sorghum bicolor]
 gb|EES13824.1| hypothetical protein SORBIDRAFT_07g020255 [Sorghum bicolor]
Length=987

 Score =   221 bits (564),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 127/286 (44%), Positives = 173/286 (60%), Gaps = 2/286 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LHHFLGV V P P GL L Q QYT+DIL++  M   K   TP+ +   L   + + +
Sbjct  704   LGVLHHFLGVTVEPRPTGLLLHQRQYTLDILERAGMTGCKPCPTPVDTQGKLS--EAEGS  761

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             + AD T Y+ + G LQYL+ T PD+ Y + ++   MH+P   H  A+K +LRYL+GTV +
Sbjct  762   LVADPTAYRNLAGALQYLTFTRPDITYAVQQVCLHMHDPREPHLTALKCLLRYLRGTVDY  821

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GLLL RS    L  + D+DW G  D  RST+GY +F G N++SW S RQ  V+  S EAE
Sbjct  822   GLLLHRSPSSELVVYIDADWAGCPDTRRSTSGYAVFLGGNLVSWSSKRQLVVSRSSAEAE  881

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+AN  AE  W+  LL ++   L  S +++ DN+S +Y+  N V H R KH+ +D  F
Sbjct  882   YRAVANGVAEASWLRQLLAELHSPLSRSTLVYYDNVSVVYLSTNPVQHQRTKHVEIDLHF  941

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDG  1440
             VR  +  G +RV HVP TSQ A I TKGL    F  FR+ + ++ G
Sbjct  942   VRDRVAVGDVRVLHVPTTSQFADIFTKGLPSSTFAEFRTSLNITSG  987



>ref|XP_010684978.1| PREDICTED: uncharacterized protein LOC104899479 [Beta vulgaris 
subsp. vulgaris]
Length=1367

 Score =   224 bits (570),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 122/283 (43%), Positives = 175/283 (62%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+ V  T  GLFLSQ +Y  +IL++ +M   K   TP+ +   L      S 
Sbjct  1076  LGPLSYFLGISVTKTAGGLFLSQKKYAAEILERANMSSCKPSATPVDTKAKLSASSGPS-  1134

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               AD T+++ + G LQYL+ T PD+ Y + ++  FMH+P   H QA+KR+LRY++GT+  
Sbjct  1135  -VADPTLFRSLAGALQYLTFTRPDISYAVQQICLFMHDPREPHLQALKRILRYVQGTLHL  1193

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL L  S    L +++D+DWGG  D  RST+GY +F G N+ISW S RQ  ++  S E+E
Sbjct  1194  GLHLYASRDSRLVSYTDADWGGCPDTRRSTSGYCVFLGDNLISWSSKRQPTLSRSSAESE  1253

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YR +AN  +E  W+ NLL ++   +  + +++CDN+SA+Y+  N V H R KH+ +D  F
Sbjct  1254  YRGVANVVSETCWLRNLLLELHFPVRRATLVYCDNVSAVYLSGNPVQHQRTKHIEMDIHF  1313

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +  G +RV HVP+  Q A I TKGL R LFE FRS + V
Sbjct  1314  VREKVAKGLVRVLHVPSRYQYADIFTKGLPRPLFEEFRSSLSV  1356


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 81/163 (50%), Gaps = 30/163 (18%)
 Frame = +1

Query  832   DVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKG----TVFHGLLLRRSTQLHLAAFSDSD  999
             D+ + I+ +S+FM +P   H Q VKR+ RYL+      +F G++L        + +SDSD
Sbjct  271   DLAHAISVVSRFMGHPGKEHQQTVKRIFRYLEVRLILVLFMGMIL--------SVYSDSD  322

Query  1000  WGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQ  1179
             +    DG RS  G+V   G +V+SW++  +  +     +AEY AL  AA E IW+     
Sbjct  323   YAEDVDGKRSMIGHVFTLGGSVVSWKATLRATITLSPAKAEYMALTEAAKEGIWLKGY--  380

Query  1180  DMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
                             LSA+ + ++  +H R  H+ + Y F+R
Sbjct  381   ----------------LSAICLAKDQAHHERTIHIDMRYHFLR  407



>gb|AAT93988.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1480

 Score =   224 bits (570),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 182/292 (62%), Gaps = 8/292 (3%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH FLG+ V  + DGLFLSQ QY +D+LK+  M E     TP+ +     R K  +T  A
Sbjct  1192  LHFFLGISVTRSSDGLFLSQRQYVVDLLKRAGMSECHSTATPVDA-----RSKLSATDGA  1246

Query  772   ---DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D T Y+ ++G LQYL++T P++ Y + ++  FMH+P   H   +KR+LRY+KGT+  
Sbjct  1247  PVSDPTEYRSLVGALQYLTLTRPELAYAVQQVCLFMHDPREPHLALIKRILRYIKGTLHI  1306

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL L  +    L A+SD+DW G  D  RST+GY +F G N++SW S RQ  V+  S EAE
Sbjct  1307  GLHLGTTPVDSLTAYSDADWAGCPDSHRSTSGYCVFLGDNLVSWSSKRQTTVSRSSAEAE  1366

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+A+A AE  W+  LL ++ + L  + V++CDN+SA+Y+  N V+H R KH+ +D  F
Sbjct  1367  YRAVAHAIAECCWLRQLLSELHISLTSATVVYCDNVSAVYMAANPVHHRRTKHIEIDIHF  1426

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
             VR  +  G +RV H+P++ Q A I+TKGL  +LF  FRS + V D  +   G
Sbjct  1427  VREKVALGQVRVLHLPSSHQFADIMTKGLPVQLFTEFRSSLCVRDNPASTAG  1478



>gb|ABA95721.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=900

 Score =   221 bits (562),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 125/289 (43%), Positives = 181/289 (63%), Gaps = 9/289 (3%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV  TP  L LSQ +YT ++L++V+M   K V TP+ +   L          +
Sbjct  610   LHYFLGIEVKRTPQTLLLSQERYTTELLERVNMTSCKPVSTPLSTAEKLSVEIGDELGPS  669

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ ++G LQYL++T PD+ Y +N++ QF+  P   HW AVKR+LRYLKGT+  GL 
Sbjct  670   DVTQYRSIVGALQYLTLTRPDISYSVNKVCQFLQTPTTAHWSAVKRILRYLKGTLDLGLK  729

Query  952   LRRSTQLHLAAFSDSDWGGVHD-----GG----RSTTGYVLFFGSNVISWRSVRQKAVAH  1104
             + +S+   ++AFSD+DW G  D     GG    RST G+ +FFG N+ISW + +Q  V+ 
Sbjct  730   IVKSSSNLVSAFSDADWAGSVDDRRSTGGFADRRSTGGFAVFFGDNLISWSARKQATVSR  789

Query  1105  FSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHL  1284
              STEAEY+ALANAAAE+IWV  LL ++G++ P++  L CDNL A Y+  N V+H+R KH+
Sbjct  790   SSTEAEYKALANAAAEIIWVRKLLTELGILHPNAARLWCDNLGATYMTANPVFHARTKHI  849

Query  1285  ALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              +DY FVR  +    L +  V +  Q+A   TK +  +    FR  + +
Sbjct  850   EVDYHFVREQVAQKLLDIHFVSSQDQVADGFTKPISLQQLIGFRHNLNL  898



>gb|AAU10819.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAV24907.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1679

 Score =   224 bits (570),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 128/283 (45%), Positives = 174/283 (61%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L ALHHFLGV V     GL LSQ QY IDIL++  M + K   TP+ +   L        
Sbjct  1398  LGALHHFLGVSVTRNSAGLVLSQRQYCIDILERAGMADCKPCNTPVDTTAKLS--SSDGP  1455

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               AD T ++ + G LQYL+ T PD+ Y + ++   MH+P   H  A+KR+L Y++G+V  
Sbjct  1456  PVADPTDFRSLAGALQYLTFTRPDISYAVQQVCLHMHDPREPHLAALKRILHYIRGSVDL  1515

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL ++RS+   LA +SD+DW G  D  RST+GY +F G N++SW S RQ  V+  S EAE
Sbjct  1516  GLHIQRSSACDLAVYSDADWAGCPDTRRSTSGYAVFLGDNLVSWSSKRQHTVSRSSAEAE  1575

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+ANA AEV W+  LLQ++      + +++CDN+SA+Y+  N V H R KH+ +D  F
Sbjct  1576  YRAVANAVAEVTWLRQLLQELHSPPSRATLVYCDNVSAVYLSSNPVQHQRTKHVEIDLHF  1635

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +  G +RV HVP TSQ A I TKGL   +F  FRS + V
Sbjct  1636  VRERVAVGAVRVLHVPTTSQYADIFTKGLPTPVFTEFRSSLNV  1678



>ref|XP_008376990.1| PREDICTED: uncharacterized protein LOC103440084 [Malus domestica]
Length=1106

 Score =   222 bits (565),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 129/295 (44%), Positives = 186/295 (63%), Gaps = 8/295 (3%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG+EV  +  GLFL QS+Y +D+L K +M  AK    P ++P+         +
Sbjct  809   LGPLHYFLGLEVQRSSAGLFLHQSKYILDLLHKTNMAGAK----PCLTPLGSVXLDHXGS  864

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             +  D   Y+ ++G LQYL+ T PD+ + +N++ QFMH P   H QA KR+LR+LK  V H
Sbjct  865   LLPDPHEYRSIVGALQYLTWTRPDLSFAVNQVCQFMHAPREPHLQAAKRILRFLKAXVSH  924

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL  ++   +HL A+SD+DW G     RST+GY +F GSN+ISW + +Q  VA  STEAE
Sbjct  925   GLWFKKG-DIHLTAYSDADWAGCPFDRRSTSGYCIFLGSNLISWSAKKQPTVARSSTEAE  983

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YR+LA+ AAE+ W+  + +D+G  LPH P L CDNLSA+ +  N V+H+R KH+ LDY +
Sbjct  984   YRSLAHTAAEITWICKVFKDLGXHLPHVPSLWCDNLSAISLASNPVFHARTKHIELDYHY  1043

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSK--MGVSDGSSI-LRG  1458
             +   ++   L+VQ+V +  Q+A I TK L +  F + +SK  +G  D S   LRG
Sbjct  1044  IXELVLANLLKVQYVCSQDQLADIHTKSLSKSRFLYLQSKLSLGPFDASKFSLRG  1098



>emb|CAN72527.1| hypothetical protein VITISV_009255 [Vitis vinifera]
Length=1095

 Score =   221 bits (564),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 132/315 (42%), Positives = 196/315 (62%), Gaps = 20/315 (6%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             +++QF+  L S  +  +  L  L +FLG+EV   PDG FLSQ +Y  DIL +  + ++K 
Sbjct  787   LINQFISQLHSEFAVKD--LGPLSYFLGLEVSYIPDGFFLSQVKYATDILARAQLLDSKP  844

Query  706   VRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLL  885
             V TP++    L     + T  AD T+Y+ ++G LQYL+IT PD+ + +N           
Sbjct  845   VTTPMIVSQRL---SSEGTPFADPTLYRSLVGALQYLTITRPDIAHSVN-----------  890

Query  886   IHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNV  1065
                 AVKR+LRY++GT+  GL     + + L A+SD+DW G  D  RST+GY +F G+N+
Sbjct  891   ---SAVKRILRYVQGTLHFGLKFTSCSSMGLVAYSDADWAGCPDTRRSTSGYSIFLGNNL  947

Query  1066  ISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYV  1245
             +SW + +Q  V+  S E+EYRALA  AAEV+W+ +LL+D+ V L H P+L CDN SA+++
Sbjct  948   VSWSAKKQPTVSRSSCESEYRALALTAAEVLWLTHLLRDLRVTLTHRPLLLCDNNSAIFL  1007

Query  1246  CQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
               N V H R KH+ LDY F+R  IV GTLR+QH+P+  Q+A + TK + R L+  F SK+
Sbjct  1008  SSNPVSHKRAKHIDLDYHFLRELIVAGTLRLQHIPSHLQLADVFTKSVSRDLYVFFHSKL  1067

Query  1426  GVSDGSSI-LRGRIK  1467
              V    ++ LRG ++
Sbjct  1068  RVCVNPTLRLRGAVE  1082



>gb|AAD22155.1|AF061282_8 polyprotein [Sorghum bicolor]
Length=1012

 Score =   221 bits (562),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 117/283 (41%), Positives = 172/283 (61%), Gaps = 0/283 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV      + L+Q +Y  ++LK+  M +   V TP+ S   L         + 
Sbjct  730   LHYFLGIEVKRGNTSMLLTQERYATEVLKRSGMDKCHPVDTPLCSSEKLSIEDGNKLGSE  789

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DAT Y  V+G LQYL++T PD+ + +N++ QF+H+P  IHW AVKR+LRY+KGT   G+ 
Sbjct  790   DATKYCSVVGALQYLTLTRPDISFAVNKVCQFLHSPTTIHWSAVKRILRYIKGTTKLGIK  849

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
               +S  + ++AF+D+DW G  D  RST G+ +F G+N+ISW + +Q  V+  STEAEY+A
Sbjct  850   FSKSESMLVSAFADADWAGCVDDRRSTGGFAVFLGNNLISWTAKKQPTVSRSSTEAEYKA  909

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA AE+IWV  LL ++GV  P    L CDNL A Y+  N ++H+R KH+ +D+ FVR 
Sbjct  910   LANATAEMIWVQKLLNELGVRHPPRARLWCDNLGATYLSANPIFHARTKHIEIDFHFVRE  969

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDG  1440
              +    L V+ +    Q+A   TK L     + FR  + +  G
Sbjct  970   RVAQKLLEVRFISTGDQLADGFTKALPVIKLKKFRDNLNLQSG  1012



>emb|CAN81099.1| hypothetical protein VITISV_017741 [Vitis vinifera]
Length=1455

 Score =   223 bits (567),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 123/296 (42%), Positives = 189/296 (64%), Gaps = 3/296 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  +H+FLG++V  T +GL LSQ++Y  D+L+K  M   K  RTP+ + + L R  D   
Sbjct  1160  LGEVHYFLGIQVSHTNNGLHLSQTKYIRDLLQKTKMVHCKPARTPLPTGLKL-RVGDGDP  1218

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             V  D   Y+  +G LQY++IT P++ + +N++ QFM NP   HW+ VKR+LRYL+GT+ H
Sbjct  1219  VE-DLHGYRSTVGALQYVTITRPELSFSVNKVCQFMQNPTEEHWKVVKRILRYLQGTLQH  1277

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL L++S+ L L  F D+DW    D  RST+G+ +F G N+ISW+S +Q  V+  S E E
Sbjct  1278  GLHLKKSSNLDLIGFCDADWASDLDDRRSTSGHCVFLGPNLISWQSKKQHIVSRSSIEIE  1337

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YR+LA   AE+ W+ +LL ++ + L   P++ CDNLS + +  N V H+R KH+ LD +F
Sbjct  1338  YRSLAGLVAEITWLRSLLSELQLPLAKPPLVWCDNLSTVLLSANPVLHARTKHIELDLYF  1397

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSI-LRGRIK  1467
             VR  ++   + V+HVP+  Q+A +LTK +    F  FR K+ + + S++ LRG ++
Sbjct  1398  VREKVIRKEVEVRHVPSADQLADVLTKTVSSTQFIEFRHKLRIENLSTLSLRGDVR  1453



>gb|AAT07563.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAT07631.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1431

 Score =   223 bits (567),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/281 (41%), Positives = 177/281 (63%), Gaps = 0/281 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV    +G+ L+Q +Y +D+LK+V+M + K V TP+     L   +       
Sbjct  1148  LHYFLGIEVKEVNNGIVLTQEKYAMDVLKRVNMSDCKAVNTPLSISEKLSAHEGNPFGPE  1207

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D+T Y+ ++G LQYL++T PD+ + +N++ Q++H P   HW A KR+LRYLK TV  GL 
Sbjct  1208  DSTRYRSLVGALQYLTLTRPDLSFSVNKVCQYLHAPTTKHWAAAKRILRYLKHTVKLGLK  1267

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             + +S  L ++AFSD+DW G  D   ST G+ +F G N++SW + +Q  V+  STEAEY+A
Sbjct  1268  ISKSNSLLVSAFSDADWAGCLDDRHSTGGFAVFIGPNLVSWSARKQATVSRSSTEAEYKA  1327

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LAN  AE++W+  LL ++G+  P    + CDN+ A Y+  N V+H+R KH+ +DY FVR 
Sbjct  1328  LANVTAEIMWIQTLLHELGIQAPKIAKVWCDNIGAKYMTANPVFHARTKHIEVDYHFVRE  1387

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
              +    L+V+++    Q+A   TK L  R  E FR+ + ++
Sbjct  1388  RVARKFLQVEYISTKDQVADGFTKTLSVRQLEMFRNNLNLT  1428



>gb|ACP30598.1| disease resistance protein [Brassica rapa subsp. pekinensis]
Length=2301

 Score =   223 bits (569),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 121/293 (41%), Positives = 183/293 (62%), Gaps = 3/293 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             +H+FLG++      G+FLSQ +Y  D+L    M E   V TP+  P+ L +   Q     
Sbjct  1119  MHYFLGIQATFHSSGMFLSQERYAKDLLATAGMSECTTVATPL--PLQLSKVPHQDKKFE  1176

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T ++ + G LQYL++T PD+ Y +N + Q MH P +  +  +KR+LRY++GT+ +G+ 
Sbjct  1177  DPTYFRSLAGKLQYLTLTRPDLQYSVNYVCQKMHEPTVSDFMLLKRILRYVQGTLDYGVN  1236

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             + + T   L A+SDSDW G H+  RST G+  + G N+ISW S +Q  V+  STEAEYR+
Sbjct  1237  IFKDTDFTLRAYSDSDWAGCHNTRRSTGGFCTYLGLNIISWSSKKQPTVSRSSTEAEYRS  1296

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             L+  A+E+ W+ ++L+++GV +  +P L+CDNLSA+Y+  N  YH R KH  LDY +VR 
Sbjct  1297  LSETASELSWMCSILREIGVPIQTTPELYCDNLSAVYLTANPAYHKRSKHFELDYHYVRE  1356

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV-SDGSSILRGRIK  1467
              +  G L V+H+PA  Q+A I TK L  + F+  R K+GV S  +  LRG ++
Sbjct  1357  RVALGALLVKHIPAHLQLADIFTKPLTFKAFDSLRYKLGVDSSPTPSLRGAVE  1409



>gb|AAP53968.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=932

 Score =   219 bits (559),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 117/275 (43%), Positives = 166/275 (60%), Gaps = 0/275 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV     GL LSQ+ Y  DILK+  M   K   TP+ +   L           
Sbjct  652   LHYFLGIEVKKVSQGLVLSQAWYASDILKRAGMSICKPASTPLSTTEKLSIEDGDFLGQN  711

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DA+ Y+ ++G LQYL++T  D+ +++N++ QF+H+P  +HW AVKR+LRY+KGTV  GL 
Sbjct  712   DASHYRSIVGALQYLTLTRSDLSFLVNKVCQFLHSPTTVHWSAVKRILRYIKGTVEFGLR  771

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
               +S  + ++AFSD+DW G  D  RST G+ +F G N+ISW + +Q  V+  STEAEY+A
Sbjct  772   FGKSDSMLISAFSDADWAGCSDDRRSTGGFAVFLGPNLISWSARKQATVSRSSTEAEYKA  831

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA  EV WV  +L ++ +  P    L CDNL A Y+  N V+H+R KH+ +DY FVR 
Sbjct  832   LANATTEVTWVRKILDELRIARPSVAQLWCDNLGATYLSANPVFHARTKHIEIDYHFVRE  891

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFR  1416
              +    L +Q +  T Q+A   TK L       +R
Sbjct  892   QVAKKLLDIQFISTTDQLADGFTKSLPAPSLAQYR  926



>ref|XP_006595215.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=275

 Score =   207 bits (527),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 115/276 (42%), Positives = 173/276 (63%), Gaps = 3/276 (1%)
 Frame = +1

Query  604   LGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAADATV  783
             LG+E++ T DGL LSQS Y + IL++ +M + K   TP+ + + +      +T   D + 
Sbjct  3     LGIEILQTTDGLHLSQSHYALTILERANMVDYKPKITPLEAKMKM---TSNNTPLDDPSY  59

Query  784   YQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLLRRS  963
             +  ++G LQYL++T PD+ Y +N +SQFM++P  +H Q   R+LRY+KGT+  GL    +
Sbjct  60    FCGLVGSLQYLTLTRPDISYSVNFVSQFMNSPTTMHLQMAHRILRYVKGTIDVGLHFTSN  119

Query  964   TQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyralana  1143
             T L L AFSD+DW       RSTTGY ++ G N+ISW + +Q  V+H STEAEYRA+AN 
Sbjct  120   TTLDLFAFSDADWACSPTTRRSTTGYCIYLGGNLISWCAKKQPTVSHSSTEAEYRAMANT  179

Query  1144  aaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVHIVN  1323
               E+ W+  LL D+ + LP  P+L+CDNLSA ++  N V+H+R K++ LDY +VR  +  
Sbjct  180   TVELTWLTFLLHDLRISLPSLPLLYCDNLSAFHMTINHVFHARNKYIELDYHYVRERVAF  239

Query  1324  GTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
               L   H+P   Q+  + TK + +    HFR+K+ V
Sbjct  240   VHLVTHHIPTHDQVVDLFTKPVSKATLMHFRTKLCV  275



>emb|CAN76473.1| hypothetical protein VITISV_016007 [Vitis vinifera]
Length=1002

 Score =   220 bits (560),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 119/277 (43%), Positives = 174/277 (63%), Gaps = 2/277 (1%)
 Frame = +1

Query  601   FLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAADAT  780
             FLG E + T  GL L+QS+YT D+L K  MH AK V TP+ + + L          +D T
Sbjct  721   FLGFEALRTTTGLHLTQSKYTTDLLIKTKMHSAKPVPTPMSAALKLH--AASGPAFSDPT  778

Query  781   VYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLLRR  960
             +Y+  IG LQYL+ T PD+ + +N+LSQ++  P  +HW A KRVLRYLKG V  GL    
Sbjct  779   LYRSTIGALQYLTYTRPDIAFAVNKLSQYLQQPTELHWTACKRVLRYLKGIVHRGLHFTP  838

Query  961   STQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyralan  1140
             ++ LHL  ++D+DW    D  RSTTGY +F G+N+ +W S +Q  VA  ST+AEYRALA+
Sbjct  839   ASSLHLQVYTDADWASSIDDRRSTTGYCVFLGTNLFTWSSRKQPVVARSSTKAEYRALAH  898

Query  1141  aaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVHIV  1320
             A+ EV W+ +L  ++G+ L ++PV+ CDN  A  +  N V+HSR KH+ +D  +VR  ++
Sbjct  899   ASXEVAWLRSLFSELGISLVNTPVIWCDNQGAGALAANPVFHSRTKHIEVDVXYVREQVL  958

Query  1321  NGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             +  L V +VP+  Q A + TK L    F++  +K+ +
Sbjct  959   DKKLVVSYVPSVEQXADLFTKPLSIPRFQYLLTKLNL  995



>gb|AAL34933.1|AC079037_6 Putative gag-pol polyprotein [Oryza sativa]
 gb|AAP51877.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=725

 Score =   218 bits (554),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 120/289 (42%), Positives = 175/289 (61%), Gaps = 2/289 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+EV  T DG  LSQS+Y  ++L++  M   K V TP  +   L    D+  +  
Sbjct  397   LKYFLGIEVQRTADGFVLSQSKYATNVLERAGMANCKAVATPADAKPKL--SSDEGPLFQ  454

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D++ Y+ + G LQYL++T PD+ Y + ++   MH P   H   +KR+LRY+KGT   GL 
Sbjct  455   DSSWYRSITGALQYLTLTRPDIAYAVQQVCLHMHAPREAHVTLLKRILRYIKGTAAFGLH  514

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             LR ST   L AFSD+DW G  D  RST+G+ +F G ++ISW S RQ  V+  S EAEYR 
Sbjct  515   LRASTSPTLTAFSDADWAGCPDTRRSTSGFCIFLGDSLISWSSKRQTTVSRSSAEAEYRG  574

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +ANA AE  W+  LL ++   +P + + +CDN+S++Y+ +N V+H R+KH+ LD  FVR 
Sbjct  575   VANAVAECTWLRQLLGELHCRVPQATIAYCDNISSVYMSKNPVHHKRIKHIELDIHFVRE  634

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
              +  G LRV  + +  Q A + TKGL   +F  FR+ + V D ++   G
Sbjct  635   KVALGELRVLPISSAHQFADVFTKGLPSSMFNEFRASLCVGDTTAATAG  683



>ref|XP_008228040.1| PREDICTED: uncharacterized protein LOC103327479 [Prunus mume]
Length=1047

 Score =   220 bits (560),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 127/271 (47%), Positives = 172/271 (63%), Gaps = 3/271 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+++  T  GLFLSQS+Y  D+L K +M EAK   TP +    L   KD      
Sbjct  768   LHYFLGIQISRTDSGLFLSQSKYVQDLLVKTEMTEAKACDTPCLPYHRLL--KDDGQPYG  825

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             + T+Y+ ++G LQYL+ T PD+ + ++++ QFM NP++ H+ AVKR+LRYLKGT+  GL 
Sbjct  826   NPTLYRSIVGALQYLTFTRPDIAFSVHQVCQFMQNPMVSHFTAVKRILRYLKGTLHFGLS  885

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
               R   L+L AFSD+DW G  +  RSTTG V+F GSN +SW S +Q+ V+  STEAEYRA
Sbjct  886   YTRG-NLNLTAFSDADWAGDPNDRRSTTGLVVFLGSNPVSWSSKKQQTVSRSSTEAEYRA  944

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             L+  +AE+ W+  LL  + V +   PVL CDNLSA+ +  N V H R KH+ +D  FVR 
Sbjct  945   LSTTSAELDWIKQLLVFLQVPIAQQPVLFCDNLSAIALSFNPVQHQRTKHIEIDVHFVRE  1004

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLF  1404
              +    L VQ V +  Q A I TKGL   LF
Sbjct  1005  RVAKQQLFVQFVSSKEQFADIFTKGLSAPLF  1035



>emb|CAN69344.1| hypothetical protein VITISV_006017 [Vitis vinifera]
Length=383

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 178/269 (66%), Gaps = 2/269 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+E+  + DGL+++Q++Y  D+L +  + ++K V TP+     L  P     ++ 
Sbjct  101   LSYFLGLEITHSTDGLYITQAKYAXDLLSQAGLTDSKTVDTPVELNAHL-TPLGGKPLS-  158

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             + ++Y+R++G L YL++T PD+ Y ++++SQ++  P   H+ AV R+LRYLKGT+FHGL 
Sbjct  159   NPSLYRRLVGSLVYLTVTRPDISYAVHQVSQYLSAPRSTHYAAVLRILRYLKGTLFHGLF  218

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                 + L L AFSD+DW G     RSTTGY    GS++ISWRS +Q  VA  STEAEYRA
Sbjct  219   YSAQSPLILRAFSDADWAGDPTDRRSTTGYCFLLGSSLISWRSKKQTFVARSSTEAEYRA  278

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA+  +E++W+  LL+D+GV    +  L+CDN SA+++  N V+H R KH+ +D  F+R 
Sbjct  279   LADTTSELLWLRWLLKDLGVSTSSATPLYCDNQSAIHIAHNDVFHERTKHIEIDCHFIRY  338

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRR  1398
             H+++G L++  V +  Q+A I TK L +R
Sbjct  339   HLLHGALKLFSVSSKDQLADIFTKSLPKR  367



>gb|AAN06870.1| Putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|ABF94109.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1247

 Score =   221 bits (562),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 173/280 (62%), Gaps = 0/280 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV     G+ L+Q +Y  D+L++V+M + K V TP+ +   L   +       
Sbjct  965   LHYFLGIEVTKVSGGIVLTQDKYVNDLLRRVNMFDCKPVSTPLSTSEKLSINEGDPLGPN  1024

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DAT Y+ V+G LQYL++T PD+ + +N++ QF+H P   HW AVKR+LRYLK     GL 
Sbjct  1025  DATHYRSVVGALQYLTLTRPDIAFPVNKVCQFLHAPTTHHWAAVKRILRYLKQCTRLGLK  1084

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L +S  + ++A+SD+DW G  D  RST G+ +F G N++SW + +Q  V+  STE+EY+A
Sbjct  1085  LSKSRSMLVSAYSDADWAGSLDDRRSTGGFAVFLGDNLVSWSARKQATVSRSSTESEYKA  1144

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA AE++WV  LL ++ V  P    L CDNL A Y+  N V+H+R KH+ +DY FVR 
Sbjct  1145  LANATAEIMWVQTLLAELQVESPSMAKLWCDNLGAKYLSANPVFHARTKHIEVDYHFVRE  1204

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              +    L +  VP   Q+A   TK L  R  E+F+  + +
Sbjct  1205  RVSRKLLEIDFVPTGDQVADGFTKALSVRQLENFKYNLNL  1244



>gb|AAK53860.1|AC016781_14 Putative retroelement [Oryza sativa Japonica Group]
Length=1096

 Score =   220 bits (560),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 178/284 (63%), Gaps = 0/284 (0%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG+EV    DG+ L+Q +Y  D+LK+V+M + K V TP+     L   +    
Sbjct  812   LGELHYFLGIEVKKVNDGIVLTQEKYAKDVLKRVNMSDCKAVNTPLSISEKLSAYEGTPL  871

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D+T Y+ ++G L YL++T PD+ + +N++ Q++H P   HW A KR+LRYLK TV  
Sbjct  872   GPVDSTWYRSLVGALHYLTLTRPDLSFSVNKVCQYLHAPTTEHWAAAKRILRYLKHTVKL  931

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL + +S  L ++AFSD+DW G  D  RST G+ +F G N++SW + +Q  V+  STEAE
Sbjct  932   GLKIGKSNSLLVSAFSDADWAGCLDDRRSTGGFAVFIGPNLVSWSARKQATVSRSSTEAE  991

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             Y+AL NA AE++W+  LL ++G+ +P +  + CDN+ A Y+  N V+++R KH+ +DY F
Sbjct  992   YKALENATAEIMWIQTLLHELGIQVPKTAKVWCDNIGATYMIANPVFYARTKHIEVDYHF  1051

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
             VR  +    L+V+++    Q+    TK L  +  E FR+ + ++
Sbjct  1052  VRERVAQKLLQVEYISTNDQVVDGFTKTLTVKQVEMFRNNLNLT  1095



>emb|CAN81355.1| hypothetical protein VITISV_039158 [Vitis vinifera]
Length=1402

 Score =   221 bits (563),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 184/295 (62%), Gaps = 2/295 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+EV      L LSQ +Y  D+L++  M ++K   TP    V L   +    
Sbjct  1091  LGQLSYFLGIEVTYDGGSLHLSQRKYITDLLQRTSMLDSKAAATP--GTVGLSLSQFDGD  1148

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             +  D T+Y+ V+G LQY ++T PD+ + IN+  QFMH P   HW +VKR+LRYLKGT+ H
Sbjct  1149  LMDDVTMYRSVVGALQYATLTRPDIAFSINKACQFMHRPTSTHWSSVKRILRYLKGTITH  1208

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GLLL+ S    + A++D+DWG   D  RS++GY+++ G+N++SW + +QK V+  S E+E
Sbjct  1209  GLLLQPSAHFTIQAYTDADWGAQPDDRRSSSGYLVYLGNNLVSWTASKQKVVSRSSAESE  1268

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YR LA A AE+IW   LL+++ + +   P L+ DN+SA Y+ +N V+H+R KH+ +D  F
Sbjct  1269  YRGLAIATAEIIWTQALLRELCISITSIPTLYYDNISAYYMAKNPVFHARTKHIEIDLHF  1328

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
             +R  +++  L++Q++P+T Q A ILTK L    F   RS + +      LRG  K
Sbjct  1329  IRDQVLHNKLQLQYIPSTDQPADILTKHLTSSRFLSLRSHLCLVPRPFSLRGDDK  1383



>emb|CAA19715.1| putative protein [Arabidopsis thaliana]
 emb|CAB79576.1| putative protein [Arabidopsis thaliana]
Length=1318

 Score =   221 bits (562),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/314 (40%), Positives = 189/314 (60%), Gaps = 5/314 (2%)
 Frame = +1

Query  532   SQFLVMLLSRCSKANGI--LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             SQ L  LL+  +K   +  +  LH+FLG++V    +GLF+SQ +Y  D+L    M     
Sbjct  918   SQTLTSLLAALNKEFRMTDMGQLHYFLGIQVQRQQNGLFMSQQKYAEDLLIAASMEHCTP  977

Query  706   VRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLL  885
             + TP+  PV L R   Q  + +D T ++ + G LQYL++T PD+ + +N + Q MH P +
Sbjct  978   LPTPL--PVQLDRVPHQEELFSDPTYFRSIAGKLQYLTLTRPDIQFAVNFVCQKMHQPTI  1035

Query  886   IHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNV  1065
               +  +KR+LRY+KGT+  G+   R +   L A+SDSDWG      RS  G   F G+N+
Sbjct  1036  SDFHLLKRILRYIKGTITMGISYSRDSPTLLQAYSDSDWGNCKQTRRSVGGLCTFMGTNL  1095

Query  1066  ISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYV  1245
             +SW S +   V+  STEAEY++L++AA+E++W+  LL+++ + LP +P L CDNLSA+Y+
Sbjct  1096  VSWSSKKHPTVSRSSTEAEYKSLSDAASEILWLSTLLRELRIPLPDTPELFCDNLSAVYL  1155

Query  1246  CQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
               N  +H+R KH  +D+ FVR  +    L V+H+P + QIA I TK L    F H R K+
Sbjct  1156  TANPAFHARTKHFDIDFHFVRERVALKALVVKHIPGSEQIADIFTKSLPYEAFIHLRGKL  1215

Query  1426  GVS-DGSSILRGRI  1464
             GV+   +  LRG I
Sbjct  1216  GVTLSPTPSLRGTI  1229



>gb|KHN41724.1| Copia protein, partial [Glycine soja]
Length=260

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 173/263 (66%), Gaps = 6/263 (2%)
 Frame = +1

Query  688   MHEAKIVRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQF  867
             M + K + TP+  P +L   K  +    + T+Y+ ++G LQY +IT P++ Y ++++ QF
Sbjct  1     MEDCKGISTPL--PANLKLSKTGADPFDNPTLYRSIVGALQYATITRPELGYSVSKVCQF  58

Query  868   MHNPLLIHWQAVKRVLRYLKGTVFHGLLLRRSTQ---LHLAAFSDSDWGGVHDGGRSTTG  1038
                PL+ HW AVKR+LRYLKG++ HGL L  +T    L + AF D+DW    D  RST+G
Sbjct  59    FAQPLVSHWSAVKRILRYLKGSIDHGLTLLPATTSAPLSINAFCDADWASDIDDRRSTSG  118

Query  1039  YVLFFGSNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLH  1218
               +FFG N++SW S +Q  VA  S EAEYR+LA+AA+EV+W+ +LL ++ V +P  PV++
Sbjct  119   ACIFFGPNLVSWWSKKQTLVAKSSAEAEYRSLAHAASEVLWLQSLLHELKVPIP-PPVIY  177

Query  1219  CDNLSAMYVCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRR  1398
             CDN SA+ +  N V HSR KH+ LD FFVR  ++N +L V ++PA  Q+A ILTK L + 
Sbjct  178   CDNQSAVAISHNPVLHSRTKHMELDIFFVREKVLNKSLVVSYIPAQLQVADILTKSLSKH  237

Query  1399  LFEHFRSKMGVSDGSSILRGRIK  1467
             LF +FRSK+ V   + ++ G ++
Sbjct  238   LFYNFRSKLRVLSTAELVGGVLE  260



>gb|AAU43956.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU44069.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1447

 Score =   221 bits (563),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 174/280 (62%), Gaps = 0/280 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV    D + L+Q +Y  D+L++V+M + K V TP+ +   L   +       
Sbjct  1165  LHYFLGIEVNKVTDEIILTQDKYACDLLRRVNMFDCKPVSTPLSTSEKLSAHEGDLLGPL  1224

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DAT Y+ V+G LQYL++T PD+ + +N++ QF+H P  +HW AVKR+LRYLK     GL 
Sbjct  1225  DATNYRSVVGALQYLTLTRPDIAFPVNKVCQFLHAPTTVHWAAVKRILRYLKQCTKLGLK  1284

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L +S  + ++A+SD+DW G  D  RST G+ +F G N++SW + +Q  V+  STE+EY+A
Sbjct  1285  LCKSKSMLVSAYSDADWAGSLDDRRSTGGFAVFLGDNLVSWCARKQATVSRSSTESEYKA  1344

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA AE++WV  LL ++ V  P    L CDNL A Y+  N V+H+R KH+ +DY FVR 
Sbjct  1345  LANATAEIMWVQTLLTELQVQSPPMAKLWCDNLGAKYLSSNPVFHARTKHIEVDYHFVRE  1404

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              +    L +  VP   Q+A   TK L  R  E+F+  + +
Sbjct  1405  RVSQKLLEIDFVPTGDQVADGFTKALPVRQLENFKHNLNL  1444



>gb|AAT69582.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAU44112.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1256

 Score =   220 bits (561),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/283 (41%), Positives = 175/283 (62%), Gaps = 0/283 (0%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG+EV     G+ L+Q +Y  D+L++V M + K V TP+ +   L   +    
Sbjct  971   LGDLHYFLGIEVNKASSGIVLTQEKYVTDLLRRVGMTDCKPVSTPLSTSEKLTLHEGDLL  1030

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                DA+ Y+ V+G LQYL++T PD+ + +N++ QF+H P ++HW A+KR+LRYLK     
Sbjct  1031  GPNDASNYRSVVGALQYLTLTRPDIYFPVNKVCQFLHAPTIVHWAAMKRILRYLKQCTKL  1090

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL + +S  + ++ +SD+DW G  D  RST G+ +F G N++SW + +Q  V   STE+E
Sbjct  1091  GLKISKSKSMLVSGYSDADWAGNIDDRRSTGGFAVFLGDNLVSWNAKKQATVPRSSTESE  1150

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             Y+ALANA AE++W+  LL+++ V  P    L CDNL A Y+  N V+H+R KH+ +DY F
Sbjct  1151  YKALANATAEIMWIQTLLEELSVPSPPMARLWCDNLGAKYLSSNPVFHARTKHIEVDYHF  1210

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +    L V+ +P   Q+A   TK L  R  E+F+  + V
Sbjct  1211  VRERMQRKLLEVEFIPTGDQVADGFTKALSARQLENFKYNLNV  1253



>ref|XP_004966848.1| PREDICTED: uncharacterized protein LOC101777861 [Setaria italica]
Length=2179

 Score =   221 bits (564),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 126/281 (45%), Positives = 175/281 (62%), Gaps = 3/281 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LHHFLGV V    D LFLSQ QY +DIL++  M   K   TP+ +   L  P D  +V+ 
Sbjct  1257  LHHFLGVSVQRRDDSLFLSQRQYMLDILERAGMSHCKPSSTPVDTHSKL--PVDGVSVS-  1313

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D + Y+ + G LQYL+ T PD+ Y + ++  +MH+P   H  A+KR+LRYL+GT+  GL 
Sbjct  1314  DPSQYRSLAGALQYLTFTRPDIAYAVQQVCLYMHDPREPHLSALKRILRYLQGTLDLGLH  1373

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L R++   L  ++D+DW G  D  +ST+GY +F G N+ISW S RQ  V+  S EAEYRA
Sbjct  1374  LHRTSPADLTVYTDADWAGCPDTRKSTSGYAVFLGDNLISWSSKRQPTVSRSSAEAEYRA  1433

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN  AE  W+  LL ++   L  + V++CDN+SA+Y+  N V H R KH+ +D  FVR 
Sbjct  1434  VANGVAEACWLRQLLTELRCPLRRATVVYCDNVSAVYLSTNPVQHQRTKHIEIDLHFVRE  1493

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
              +  G +RV HVP TSQ A I TKGL   +F  FRS + ++
Sbjct  1494  RVALGEVRVLHVPTTSQYADIFTKGLPTSVFTEFRSSLNLA  1534



>ref|XP_010555983.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104825359 
[Tarenaya hassleriana]
Length=1643

 Score =   221 bits (563),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 181/295 (61%), Gaps = 4/295 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L +L +F+G+EV    D LFLSQ +Y +D+L++     AK+VRTPI    + F+ + +  
Sbjct  1315  LDSLKYFIGIEVCRVFDDLFLSQRKYVLDLLRETGKLGAKLVRTPIE---EHFKDQREGE  1371

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             +  +A  Y+RV+G L YL+IT PD+ + ++++SQ+MH P   HWQ V R+L+YLKGT   
Sbjct  1372  LLENAEQYRRVVGKLIYLTITRPDLSFAVHQVSQWMHAPTTSHWQMVDRILKYLKGTPNK  1431

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL +RR+    + A+ D+DW G     +STTGY  F G NV++W+S +Q  V+  S EAE
Sbjct  1432  GLWMRRNKHTEIIAYCDADWAGDRSDRKSTTGYCTFVGGNVVTWKSKKQNVVSRSSAEAE  1491

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+AN  +E++W+  LL+++GV       LHCDN  AM++  N V+H R KH+ +D  F
Sbjct  1492  YRAMANTTSEIVWLKQLLEELGVKTSKPIPLHCDNQVAMHIAANSVFHERTKHIEVDCHF  1551

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD-GSSILRGRI  1464
             +R  I NG +      +  QIA ILTK     +      K+G++D    ILRG +
Sbjct  1552  IREKIANGLISTVFTRSQHQIADILTKATSSFVLNKMLFKIGLTDIRRPILRGNV  1606



>emb|CAN62447.1| hypothetical protein VITISV_024007 [Vitis vinifera]
Length=1144

 Score =   219 bits (557),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 161/240 (67%), Gaps = 2/240 (1%)
 Frame = +1

Query  589   ALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVA  768
             +LH+FLGVEVIPT  G+FLSQ +Y  DIL+   M  AK V TP+ +   L       T A
Sbjct  906   SLHYFLGVEVIPTTAGVFLSQHKYVRDILENTHMAGAKDVSTPLSTTQSLHL--VDGTNA  963

Query  769   ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGL  948
              ++T Y+RVIG LQYLS+T PD+ + +N+LSQFMH P + HW A KR+LRYLK T+FHGL
Sbjct  964   VNSTEYRRVIGSLQYLSLTRPDIXFAVNKLSQFMHKPTVTHWTATKRLLRYLKKTIFHGL  1023

Query  949   LLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
              L+ +    L  ++D+DW G  D   ST+ Y+ F G N ISW S +Q+AVA  +TEAEYR
Sbjct  1024  HLKSAAAPCLTTYTDADWAGNIDDRTSTSAYITFLGCNPISWSSKKQRAVARSTTEAEYR  1083

Query  1129  alanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
             ALAN A+E +W+  LLQ++G  L   P L CDNL A ++  N V HSRMKH+ +D  FVR
Sbjct  1084  ALANGASETMWLLALLQELGFSLKLPPSLLCDNLGATHLSFNPVQHSRMKHIQIDLHFVR  1143



>ref|XP_008349120.1| PREDICTED: uncharacterized protein LOC103412315 [Malus domestica]
Length=1326

 Score =   219 bits (559),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 175/274 (64%), Gaps = 3/274 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH FLG+++  TP+GLFLSQ +Y  ++L K +MHE+K   TP +    L   KD   
Sbjct  1037  LGPLHFFLGIQISQTPNGLFLSQHKYIQELLVKTEMHESKACDTPCLPYNRLL--KDDGE  1094

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                + ++Y+ V+G LQYL+ T PD+ + ++++SQFM NP+  H+ AVKR+LRYLKGTV  
Sbjct  1095  PYPNPSLYRSVVGALQYLTFTRPDIAFSVHQVSQFMQNPMASHFTAVKRILRYLKGTVDV  1154

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL   R   L L AFSD+DW G  +  RSTTG V+F G+N ISW S +Q+ V+  STEAE
Sbjct  1155  GLTYSRG-DLDLHAFSDADWAGDPNDRRSTTGLVVFLGNNPISWSSKKQQTVSRSSTEAE  1213

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRAL++ AAE+ W+  +L  + + L   PVL CDNLSA+ +  N V H R KH+ +D  F
Sbjct  1214  YRALSSTAAELDWIQQILAFLHLPLSAPPVLFCDNLSAIALSFNPVQHQRTKHIEVDVHF  1273

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLF  1404
             VR  +    L VQ V +  Q A ILTKGL   LF
Sbjct  1274  VRERVATHKLLVQFVSSKEQFADILTKGLSAPLF  1307



>gb|AAK51235.1|AF287471_1 polyprotein [Arabidopsis thaliana]
Length=1453

 Score =   219 bits (559),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 125/316 (40%), Positives = 190/316 (60%), Gaps = 7/316 (2%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             ++ + L+ L  R S  +  L A  +FLGVE+  +P+GLFL Q+ Y  DIL +  M     
Sbjct  1092  LLQELLMSLNKRFSMKD--LGAPSYFLGVEIESSPEGLFLHQTAYAKDILHQAAMSNCNS  1149

Query  706   VRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLL  885
             + TP+   ++       S +  + T ++ + G LQYL+IT PD+ + +N + Q MH+P  
Sbjct  1150  MPTPLPQHIENL----NSDLFPEPTYFRSLAGKLQYLTITRPDIQFAVNFICQRMHSPTT  1205

Query  886   IHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNV  1065
               +  +KR+LRY+KGT+  GL ++++  L L A+SDSDW G  +  RSTTG+    G N+
Sbjct  1206  ADFGLLKRILRYVKGTIHLGLHIKKNQNLSLVAYSDSDWAGCKETRRSTTGFCTLLGCNL  1265

Query  1066  ISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYV  1245
             ISW + RQ+ V+  STEAEYRAL   A E+ W+  LL+D+GV   H  ++ CDNLSA+Y+
Sbjct  1266  ISWSAKRQETVSKSSTEAEYRALTAVAQELTWLSFLLRDIGVTQTHPTLVKCDNLSAVYL  1325

Query  1246  CQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
               N   H+R KH   DY ++R  +  G +  +H+ AT Q+A I TK L RR F   R K+
Sbjct  1326  SANPALHNRSKHFDTDYHYIREQVALGLVETKHISATLQLADIFTKPLPRRAFIDLRIKL  1385

Query  1426  GVSD-GSSILRGRIKK  1470
             GV++  ++ LRG + +
Sbjct  1386  GVAEPPTTSLRGNVSE  1401



>ref|XP_006605007.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=298

 Score =   206 bits (523),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 118/283 (42%), Positives = 168/283 (59%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+ V      LFLSQ +Y ++I+    M   K   TP+ + + L      ST
Sbjct  4     LGQLSYFLGIAVTHHAGDLFLSQKKYAMEIIDHAGMSSCKSSPTPVDTKLKL--SATSST  61

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D T+Y+ ++G LQYL+ T PD+ Y + +L  FMH+P   H  A+KR+L Y++GT+ H
Sbjct  62    PFEDPTLYRSLVGALQYLTFTRPDITYAVQQLCLFMHDPKDEHMHALKRILCYIQGTIDH  121

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL L  S+   L +++D++WGG  D  RST GY +F G N+ISW + RQ  ++  S EAE
Sbjct  122   GLHLYPSSTSTLVSYTDANWGGCPDRRRSTFGYCVFLGDNLISWSAKRQATLSRSSAEAE  181

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YR +AN   E  W+ NLL +    +  + +++CDN+SA+Y+  N V H R KH+ +D  F
Sbjct  182   YRGVANVVLESCWLQNLLLEHHCPIQKATLVYCDNVSAIYLAGNPVQHQRTKHIDMDIHF  241

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +  G +RV HVP+  QIA I TKGL   LFE FR    V
Sbjct  242   VREKVARGQVRVLHVPSRYQIADIFTKGLPLVLFEDFRDSFSV  284



>gb|AAL86510.1|AC099040_14 putative retrotransposon protein [Oryza sativa Japonica Group]
Length=1139

 Score =   218 bits (556),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 115/256 (45%), Positives = 166/256 (65%), Gaps = 0/256 (0%)
 Frame = +1

Query  595   HHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAAD  774
             ++FLG+EV    DGL LSQ +YT DILK++ M   K   TP+ +   L   +       D
Sbjct  751   YYFLGIEVKKISDGLVLSQDKYTHDILKRIGMSTCKPAPTPLSTSEKLSVQEGSLLGPGD  810

Query  775   ATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLL  954
             AT Y+ ++G LQYL++T PD+ + IN++ QF+H+P L HW AVKR++RYL+GTV  GL +
Sbjct  811   ATNYRSIVGALQYLTLTRPDIAFSINKVCQFLHSPTLTHWSAVKRIIRYLRGTVGMGLKI  870

Query  955   RRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyral  1134
             ++S  + + AFSD+DW G  D  RST+G+ +F GSN+ISW   +Q  V+  STEAEY+AL
Sbjct  871   QKSQSMLVNAFSDADWAGCVDDRRSTSGFAVFLGSNLISWSVRKQATVSRSSTEAEYKAL  930

Query  1135  anaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVH  1314
             ANA AEVIWV  LL+++G+  P    L CDNL A Y+  N ++H+R KH+ + + FVR  
Sbjct  931   ANATAEVIWVQTLLKELGIQCPSMARLWCDNLGATYLSANPIFHARTKHIEVYFHFVRER  990

Query  1315  IVNGTLRVQHVPATSQ  1362
             +    L ++   A  +
Sbjct  991   VAQKLLEIEGASAVDE  1006



>ref|XP_004292511.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Fragaria vesca subsp. vesca]
Length=291

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 167/273 (61%), Gaps = 5/273 (2%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+E+  +P  LFL+Q +Y +D+L +  M + K  RTP+ S + L    +  T   
Sbjct  23    LKYFLGIEIDQSPHSLFLNQRKYVVDLLDEAGMKDIKPARTPLDSKLKLDITGENLT---  79

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D   YQR++G L YL+IT PD+ Y ++ +SQF+H+P   H   VKR+LRYLKGTV  G++
Sbjct  80    DVCSYQRLVGKLIYLTITRPDLTYAVSLVSQFLHSPTTHHLSIVKRILRYLKGTVSRGIV  139

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             +R ++   +A +SDSDW G     +ST GY  F G N+++W+S +Q  VA  S EAEYRA
Sbjct  140   MRNNSHFKMAGYSDSDWAGNAIDRKSTAGYCTFIGGNLVTWKSKKQTVVARSSAEAEYRA  199

Query  1132  lanaaaeVIWVHNLLQDMGV-VLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
             +A+   E+IW+ +LL D+G     H P LHCDN +AM++  N V+H R KH+ +D  FVR
Sbjct  200   MASTTCELIWLKSLLADLGFQTTAHIP-LHCDNQAAMHIAANPVFHERTKHIEVDCHFVR  258

Query  1309  VHIVNGTLRVQHVPATSQIAAILTKGLGRRLFE  1407
               +    +   +  +  Q+A + TK L    FE
Sbjct  259   NQVQAKLIETVYTRSCDQLADVFTKVLASAQFE  291



>gb|ABA98049.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1460

 Score =   219 bits (559),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 117/283 (41%), Positives = 174/283 (61%), Gaps = 0/283 (0%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG+EV    +G+ L+Q +Y  D+LKKV M + K   TP+     L   +    
Sbjct  1168  LGELHYFLGIEVSKVQNGIVLNQDKYANDLLKKVGMIDCKPANTPLSVSEKLSLHEGSLL  1227

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                DA+ Y+ V+G LQYL++T PD+ + +N++ QF+H P  +HW AVKR+LRYLK     
Sbjct  1228  GPEDASHYRSVVGALQYLTLTRPDIAFSVNKVCQFLHAPTTVHWIAVKRILRYLKQCTRL  1287

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL + +S    ++ FSD+DW G  D  RST G+ +F GSN++SW + +Q  V+  STE+E
Sbjct  1288  GLEIHKSGSTLVSGFSDADWAGCLDDRRSTGGFAIFLGSNLVSWNARKQATVSRSSTESE  1347

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             Y+A+ANA AE++WV  LL ++ +  P +  + CDNL A Y+  N V+H+R KH+ +DY F
Sbjct  1348  YKAIANATAEIMWVQTLLAELEIKSPKAAKIWCDNLGAKYLSANPVFHARTKHIEVDYHF  1407

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +    L +  V    Q+A   TK L  RL E+F+S + +
Sbjct  1408  VRERVSQKLLEIDFVSTNDQVADGFTKPLSVRLLENFKSNLNL  1450



>emb|CAN69851.1| hypothetical protein VITISV_009554 [Vitis vinifera]
Length=1282

 Score =   219 bits (557),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 122/299 (41%), Positives = 184/299 (62%), Gaps = 10/299 (3%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFR----PK  750
             L  L +FLG+EV      + LSQ++Y  D+L + +M + K  +TP     +L +    P 
Sbjct  979   LXQLSYFLGIEVSYHEGSMNLSQTKYVSDLLHRTEMFDTKPAKTPGAVGKNLSKFDGDPM  1038

Query  751   DQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKG  930
             D+       T Y+ V+G LQYL+IT PD+ + +N+  QFM  P   HW +VKR+LRYLKG
Sbjct  1039  DE------VTQYRSVVGALQYLTITRPDIAFAVNKTCQFMQQPTSAHWLSVKRILRYLKG  1092

Query  931   TVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFS  1110
             T+  GLLL  ST L +  FSD+DWG   D  RS++GY+++ G N++SW S +QK V+  S
Sbjct  1093  TMQDGLLLSPSTNLTIEGFSDADWGAQPDDRRSSSGYLVYLGGNLVSWSSTKQKVVSRSS  1152

Query  1111  TeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLAL  1290
              ++EYRALA A AE+IW+  LLQ++ V +P  P+L  DN+SA ++ +N V+H+R KH+ +
Sbjct  1153  AKSEYRALALATAEIIWMQALLQELCVPIPAIPLLWYDNISAYHMAKNPVFHARTKHIEI  1212

Query  1291  DYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
             D  F+R  ++ G +++  VP   Q A +LTK L    F   +S++ ++     LRG  K
Sbjct  1213  DLHFIRDQVIRGKIQLHFVPTEDQPADLLTKHLTSSRFLSLKSQLCIAPRPFHLRGDDK  1271



>gb|AAB82754.1| retrofit [Oryza longistaminata]
Length=1445

 Score =   219 bits (558),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 114/281 (41%), Positives = 172/281 (61%), Gaps = 0/281 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV    +G+ L+Q +Y  D+LK+V+M   K V TP+     L   +       
Sbjct  1163  LHYFLGIEVTKVSNGVILTQEKYANDLLKRVNMSNCKPVSTPLSVSEKLTLYEGSPLGPN  1222

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DA  Y+ ++G LQYL++T PD+ Y +N++ QF+H P   HW AVKR+LRYL      GL 
Sbjct  1223  DAIQYRSIVGALQYLTLTRPDIAYSVNKVCQFLHAPTTSHWIAVKRILRYLNQCTSLGLH  1282

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             + +S    +  +SD+DW G  D  +ST G+ +F GSN++SW + +Q  V+  STEAEY+A
Sbjct  1283  IHKSASTLVHGYSDADWAGSIDDRKSTGGFAVFLGSNLVSWSARKQPTVSRSSTEAEYKA  1342

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN  AE+IWV  LL+++G+  P +  + CDNL A Y+  N V+H+R KH+ +DY FVR 
Sbjct  1343  VANTTAELIWVQTLLKELGIESPKAAKIWCDNLGAKYLSANPVFHARTKHIEVDYHFVRE  1402

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
              +    L +  VP+  Q+A   TK L   L E+F+  + ++
Sbjct  1403  RVSQKLLEIDFVPSGDQVADGFTKALSACLLENFKHNLNLA  1443



>gb|ABB47033.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1142

 Score =   218 bits (555),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 115/256 (45%), Positives = 166/256 (65%), Gaps = 0/256 (0%)
 Frame = +1

Query  595   HHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAAD  774
             ++FLG+EV    DGL LSQ +YT DILK++ M   K   TP+ +   L   +       D
Sbjct  745   YYFLGIEVKKISDGLVLSQDKYTHDILKRIGMSTCKPAPTPLSTSEKLSVQEGSLLGPGD  804

Query  775   ATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLL  954
             AT Y+ ++G LQYL++T PD+ + IN++ QF+H+P L HW AVKR++RYL+GTV  GL +
Sbjct  805   ATNYRSIVGALQYLTLTRPDIAFSINKVCQFLHSPTLTHWSAVKRIIRYLRGTVGMGLKI  864

Query  955   RRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyral  1134
             ++S  + + AFSD+DW G  D  RST+G+ +F GSN+ISW   +Q  V+  STEAEY+AL
Sbjct  865   QKSQSMLVNAFSDADWAGCVDDRRSTSGFAVFLGSNLISWSVRKQATVSRSSTEAEYKAL  924

Query  1135  anaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVH  1314
             ANA AEVIWV  LL+++G+  P    L CDNL A Y+  N ++H+R KH+ + + FVR  
Sbjct  925   ANATAEVIWVQTLLKELGIQCPSMARLWCDNLGATYLSANPIFHARTKHIEVYFHFVRER  984

Query  1315  IVNGTLRVQHVPATSQ  1362
             +    L ++   A  +
Sbjct  985   VAQKLLEIEGASAVDE  1000



>gb|AAM18766.1|AC099325_22 putative copia-like retrotransposon Hopscotch polyprotein [Oryza 
sativa Japonica Group]
Length=1150

 Score =   218 bits (555),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/256 (45%), Positives = 166/256 (65%), Gaps = 0/256 (0%)
 Frame = +1

Query  595   HHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAAD  774
             ++FLG+EV    DGL LSQ +YT DILK++ M   K   TP+ +   L   +       D
Sbjct  783   YYFLGIEVKKISDGLVLSQDKYTHDILKRIGMSTCKPAPTPLSTSEKLSVQEGSLLGPGD  842

Query  775   ATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLL  954
             AT Y+ ++G LQYL++T PD+ + IN++ QF+H+P L HW AVKR++RYL+GTV  GL +
Sbjct  843   ATNYRSIVGALQYLTLTRPDIAFSINKVCQFLHSPTLTHWSAVKRIIRYLRGTVGMGLKI  902

Query  955   RRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyral  1134
             ++S  + + AFSD+DW G  D  RST+G+ +F GSN+ISW   +Q  V+  STEAEY+AL
Sbjct  903   QKSQSMLVNAFSDADWAGCVDDRRSTSGFAVFLGSNLISWSVRKQATVSRSSTEAEYKAL  962

Query  1135  anaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVH  1314
             ANA AEVIWV  LL+++G+  P    L CDNL A Y+  N ++H+R KH+ + + FVR  
Sbjct  963   ANATAEVIWVQTLLKELGIQCPSMARLWCDNLGATYLSANPIFHARTKHIEVYFHFVRER  1022

Query  1315  IVNGTLRVQHVPATSQ  1362
             +    L ++   A  +
Sbjct  1023  VAQKLLEIEGASAVDE  1038



>emb|CAN80475.1| hypothetical protein VITISV_027529 [Vitis vinifera]
Length=353

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/286 (40%), Positives = 181/286 (63%), Gaps = 2/286 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+E+  + DGL+++Q++Y  ++L +  + ++K V TP+     L  P     ++ 
Sbjct  7     LSYFLGLEITHSTDGLYITQAKYASNLLSQAGLIDSKTVDTPVELNAHL-TPSGGKPLS-  64

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             + ++Y+R++G L YL++T PD+ YV++R+SQ++  P   H+ AV R+LRYLKGT+FHGL 
Sbjct  65    NPSLYRRLVGNLVYLTVTRPDISYVVHRVSQYLSAPRSTHYAAVLRILRYLKGTLFHGLF  124

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                 + L L AFSD+DW G     RSTTGY    GS++ISWRS ++  VA  STEAEY A
Sbjct  125   YSAQSPLVLRAFSDADWAGDPTDRRSTTGYCFLLGSSLISWRSKKKTFVARSSTEAEYHA  184

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA+  +E++W+  LL+D+GV    +   +CDN S +++  N V+H R KH+ +D  F+R 
Sbjct  185   LADTTSELLWLRWLLKDLGVSTSSATPFYCDNQSVIHIAHNDVFHERTKHIDIDCHFIRY  244

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSI  1449
             H+V+G L++  V +  Q+A I TK L +R        + +   S+I
Sbjct  245   HLVHGALKLFSVSSKDQLADIFTKSLPKRRTRDLVDNLKLKSTSTI  290



>pir||T02087 gag/pol polyprotein - maize retrotransposon Hopscotch
 gb|AAA57005.1| copia-like retrotransposon Hopscotch polyprotein [Zea mays]
Length=1439

 Score =   219 bits (558),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/275 (44%), Positives = 170/275 (62%), Gaps = 0/275 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV    DGL L Q +Y  D+LK+V M   K V TP+ +   L           
Sbjct  1151  LHYFLGIEVHRKGDGLLLCQEKYARDLLKRVGMECCKPVHTPVATSEKLSASAGTLLSPE  1210

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             + T Y+ V+G LQYL++T PD+ Y INR+ QF+H P  +HW AVKR+LR ++ T+  GL 
Sbjct  1211  ETTKYRSVVGALQYLTLTRPDLSYAINRVCQFLHAPTDLHWTAVKRILRNIQHTIGLGLT  1270

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             +R S  L L+AFSD+DW G  D  +ST GY LF G N+ISW S +Q  V+  STEAEY+A
Sbjct  1271  IRPSLSLMLSAFSDADWAGCPDDRKSTGGYALFLGPNLISWNSKKQSTVSRSSTEAEYKA  1330

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +ANA AEVIW+ +LL ++G+ L   P L CDNL A Y+    ++++R KH+ +D+ FVR 
Sbjct  1331  MANATAEVIWLQSLLHELGIRLTGIPRLWCDNLGATYLSSKPIFNARTKHIEVDFHFVRD  1390

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFR  1416
              +++  L ++ +    Q+A   TK L       FR
Sbjct  1391  RVLSKKLDIRLISTNDQVADGFTKALTIGRLNEFR  1425



>emb|CAN81057.1| hypothetical protein VITISV_033321 [Vitis vinifera]
Length=331

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 171/289 (59%), Gaps = 2/289 (1%)
 Frame = +1

Query  601   FLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAADAT  780
             F G+EV  TP G+  S+++Y ID+L    M +AK   TP+ S  +L           + +
Sbjct  39    FSGLEVHRTPTGIHPSRAKYIIDLLTWAAMLDAKPCPTPMSSNTNL--SLHDGVALENGS  96

Query  781   VYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLLRR  960
              Y   +G LQY  +T P++ + +N++ QFMH+P  +HWQ VKR+LRYLKGT   GL L+ 
Sbjct  97    DYHSFVGALQYCIMTSPNIVFTVNKVCQFMHHPSDVHWQVVKRILRYLKGTYHFGLFLQP  156

Query  961   STQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyralan  1140
             S   ++  ++D+DW    D  RST+GY LF GSN++SW S +QK V+   TE++Y+  AN
Sbjct  157   SLNFNITCYTDADWASCLDDRRSTSGYCLFLGSNLVSWSSSKQKVVSRSRTESKYQGAAN  216

Query  1141  aaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVHIV  1320
               AE+ W  +LL+++ +     P++ CDN++A Y+  N + H+R KH+ ++Y FVR H++
Sbjct  217   EVAEIAWTKSLLRELFITPTRPPLILCDNINATYLVANPILHARTKHVEINYHFVREHVL  276

Query  1321  NGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
               +L  Q   +  Q+   +TK L  + F   RSK+ V      LRG +K
Sbjct  277   QCSLFFQFTHSDDQLVDCMTKPLSTQCFITLRSKLTVLTRPMSLRGDVK  325



>ref|XP_004963982.1| PREDICTED: uncharacterized protein LOC101777276 [Setaria italica]
Length=1188

 Score =   218 bits (555),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 173/295 (59%), Gaps = 8/295 (3%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LHHFLG+ V    D LFLSQ QY +DIL +  M + K   TP+ +   L       T   
Sbjct  874   LHHFLGISVERRGDCLFLSQRQYLLDILDRAGMRDCKPCSTPVETHSKL---SADGTPVT  930

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DAT Y+ + G LQYL+ T PD+ + + ++  FMH+P   H  A+KR+LRYL+G+   GL 
Sbjct  931   DATDYRSIAGALQYLTFTHPDIAFAVQQVCLFMHDPREPHLAAMKRILRYLQGSQDLGLH  990

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L RS    L  +SD+DW G  D  RST+G+ +F G N+ISW + RQ  V+  S EAEYR 
Sbjct  991   LSRSAPDTLTVYSDADWAGCPDTRRSTSGFAVFLGDNLISWSAKRQATVSRSSAEAEYRG  1050

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN  AE  W+  LL ++   L  + +++CDN+SA+Y+  N V H R KH+ +D  FVR 
Sbjct  1051  VANGVAEACWLRQLLGELRCPLRRATIVYCDNISAVYLSTNPVQHQRTKHVEIDLHFVRE  1110

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV-----SDGSSILRGR  1461
              +  G +RV HVP +SQ A I TKGL   +F  FRS + V     SD   +L  R
Sbjct  1111  RVALGEVRVLHVPTSSQYADIFTKGLPTSVFTEFRSSLNVRGAPTSDCGGVLDSR  1165



>ref|XP_010669333.1| PREDICTED: copia protein isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010669334.1| PREDICTED: copia protein isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010669335.1| PREDICTED: copia protein isoform X1 [Beta vulgaris subsp. vulgaris]
Length=977

 Score =   216 bits (550),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/312 (41%), Positives = 187/312 (60%), Gaps = 10/312 (3%)
 Frame = +1

Query  538   FLVMLLSRCSKANGI--LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVR  711
              L  ++SR S    +  L AL +FLGV V     GLFLSQ QY  +I+ +  M   K   
Sbjct  669   LLKSIISRLSSEFAMKDLGALSYFLGVAVTRHAGGLFLSQRQYASEIIDRAGMSTCK---  725

Query  712   TPIVSPVDLFRPKDQSTVAA---DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPL  882
              P  +PVD  +PK  +T  A   D + Y+ + G LQYL+ T PD+ Y + ++  +MH+P 
Sbjct  726   -PSATPVDT-KPKLGATSTAPYADPSHYRSLAGALQYLTFTRPDISYAVQQVCLYMHDPR  783

Query  883   LIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSN  1062
               H  A+KR++RYL+GT+ HGL L  ST   L +++D+DWGG  D  RST+GY +F G N
Sbjct  784   DAHMHALKRIIRYLQGTLDHGLHLYPSTTSTLISYTDADWGGCPDTRRSTSGYCVFLGDN  843

Query  1063  VISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMY  1242
             ++SW + RQ  ++  S EAEYR +AN  +E  W+ NLL ++   +  + +++CDN+SA+Y
Sbjct  844   LLSWSAKRQPTLSRSSAEAEYRGVANVVSESCWLRNLLLELHCPIRKATLVYCDNVSAIY  903

Query  1243  VCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSK  1422
             +  N V H R KH+ +D  FVR  +  G +RV HVP+  QIA I TKGL   LFE FR+ 
Sbjct  904   LSGNPVQHQRTKHIEMDIHFVREKVARGQVRVLHVPSRYQIADIFTKGLPLVLFEDFRNS  963

Query  1423  MGVSDGSSILRG  1458
             + + +  +   G
Sbjct  964   LSIREPPASTEG  975



>gb|ABF97142.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=658

 Score =   213 bits (543),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/269 (41%), Positives = 170/269 (63%), Gaps = 0/269 (0%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG+EV    DG+ L+Q +Y  D+LK+V+M + K V TP+     L   +    
Sbjct  33    LGELHYFLGIEVKKVNDGIVLTQEKYAKDVLKRVNMSDCKAVNTPLSISEKLSAYEGTPL  92

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D+T Y+ ++G L YL++T PD+ + +N++ Q++H P   HW A KR+LRYLK TV  
Sbjct  93    GPVDSTWYRSLVGALHYLTLTRPDLSFSVNKVCQYLHAPTTEHWAAAKRILRYLKHTVKL  152

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL + +S  L ++AFSD+DW G  D  RST G+ +F G N++SW + +Q  V+  STEAE
Sbjct  153   GLKIGKSNSLLVSAFSDADWAGCLDDRRSTGGFAVFIGPNLVSWSARKQATVSRSSTEAE  212

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             Y+AL NA AE++W+  LL ++G+ +P +  + CDN+ A Y+  N V+++R KH+ +DY F
Sbjct  213   YKALENATAEIMWIQTLLHELGIQVPKTAKVWCDNIGATYMIANPVFYARTKHIEVDYHF  272

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGL  1389
             VR  +    L+V+++    Q+    TK L
Sbjct  273   VRERVAQKLLQVEYISTNDQVVDGFTKTL  301



>emb|CAN59952.1| hypothetical protein VITISV_006720 [Vitis vinifera]
Length=1365

 Score =   218 bits (556),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/295 (40%), Positives = 180/295 (61%), Gaps = 2/295 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+EV      + LSQS+Y  D+L++  M ++K   TP    V L   +    
Sbjct  1054  LGQLSYFLGIEVTYDGGSMHLSQSKYITDLLQRTSMLDSKAAATP--GTVGLSLSQFDGD  1111

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             +  D T+Y+ V+G LQY ++T PD+ + +N+  QFMH P   HW +VKR+LRYLKGT  H
Sbjct  1112  LMDDVTMYRSVVGALQYATLTRPDIAFSVNKACQFMHRPTSTHWSSVKRILRYLKGTTTH  1171

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL L+ S    + A++D+DWG   D  RS++GY+++ G+N++SW + +QK V+  S E+E
Sbjct  1172  GLXLQPSAHFTVQAYTDADWGAQPDDRRSSSGYLVYLGNNLVSWTASKQKVVSXSSAESE  1231

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YR LA A  E+IW   LL ++ +     P L+ DN+SA Y+ +N V+H+R KH+ +D  F
Sbjct  1232  YRGLAIATXEIIWTQALLSELCISJTSIPTLYYDNISAYYMAKNPVFHARTKHIEIDLHF  1291

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
             +R  +++  L++Q++P+T Q A ILTK L    F   RS + +      LRG  K
Sbjct  1292  IRDQVLHNKLQLQYIPSTDQPADILTKHLTSSRFLSLRSHLCLVPRPFSLRGDDK  1346



>emb|CAA19714.1| putative protein [Arabidopsis thaliana]
 emb|CAB79575.1| putative protein [Arabidopsis thaliana]
Length=819

 Score =   215 bits (547),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 176/289 (61%), Gaps = 3/289 (1%)
 Frame = +1

Query  601   FLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAADAT  780
             FLG++V    +GLF+SQ +Y  D+L    M     + TP+  PV L R   Q  + +D T
Sbjct  444   FLGIQVQRQQNGLFMSQQKYAEDLLIAASMEHCTPLPTPL--PVQLDRVPHQEELFSDPT  501

Query  781   VYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLLRR  960
              ++ + G LQYL++T PD+ + +N + Q MH P +  +  +KR+LRY+KGT+  G+   R
Sbjct  502   YFRSIAGKLQYLTLTRPDIQFAVNFVCQKMHQPTISDFHLLKRILRYIKGTITMGISYSR  561

Query  961   STQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyralan  1140
              +   L A+SDSDWG      RS  G   F G+N++SW S +   V+  STEAEY++L++
Sbjct  562   DSPTLLQAYSDSDWGNCKQTRRSVGGLCTFMGTNLVSWSSKKHPTVSRSSTEAEYKSLSD  621

Query  1141  aaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVHIV  1320
             AA+E++W+  LL+++ + LP +P L CDNLSA+Y+  N  +H+R KH  +D+ FVR  + 
Sbjct  622   AASEILWLSTLLRELRIPLPDTPELFCDNLSAVYLTANPAFHARTKHFDIDFHFVRERVA  681

Query  1321  NGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS-DGSSILRGRI  1464
                L V+H+P + QIA I TK L    F H R K+GV+   +  LRG I
Sbjct  682   LKALVVKHIPGSEQIADIFTKSLPYEAFIHLRGKLGVTLPPTPSLRGTI  730



>emb|CAN67403.1| hypothetical protein VITISV_025614 [Vitis vinifera]
Length=1271

 Score =   217 bits (553),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 185/298 (62%), Gaps = 12/298 (4%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTP-----IVSPVDLFRPKDQ  756
             +++FLG+EV+ +     LSQ +YT D+L +  M ++K   TP      +S +D       
Sbjct  938   VNYFLGIEVVRSGTMFHLSQHKYTQDLLSRTAMLDSKPATTPGLLGQTLSHLD-------  990

Query  757   STVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTV  936
                 +DAT+Y+  +G LQYL++T PD+ + +N+  QFM  P   HW AVKR+LRYLKGT+
Sbjct  991   GEPFSDATLYRSTVGALQYLTLTRPDISFAVNKACQFMATPTTTHWLAVKRILRYLKGTL  1050

Query  937   FHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTe  1116
              +G+ +++ST L +  ++D+DW    D  RST GY +F G N++SW S +QK V+  S E
Sbjct  1051  SYGIQMQQSTSLDIHGYTDADWASCPDDRRSTGGYGIFLGPNLVSWSSNKQKVVSRSSAE  1110

Query  1117  aeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDY  1296
             +EYRALA+A +E+IW+  +LQ++ +     P+L CDN SA ++  N V+H+R KH+ +D 
Sbjct  1111  SEYRALASATSEMIWIQYVLQELCLSSSSPPLLWCDNKSAAHLAANPVFHARTKHIEMDL  1170

Query  1297  FFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIKK  1470
              F+R H++   L +Q++P+  Q+A I TK +    F  FR+K+ V      LRG  ++
Sbjct  1171  HFIRDHVLRKQLVIQYLPSAEQVADIFTKHISSSQFLSFRTKLSVVPSPVSLRGDDRR  1228



>emb|CAN83392.1| hypothetical protein VITISV_041406 [Vitis vinifera]
Length=1262

 Score =   217 bits (552),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/285 (42%), Positives = 177/285 (62%), Gaps = 3/285 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDG-LFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQS  759
             L  L +FLG+EV  T DG L LSQ +Y  D+LKK  M  AK + TP++S + L       
Sbjct  972   LGELSYFLGIEVKKTADGGLHLSQKKYIQDLLKKTKMDGAKSLPTPMLSGLKL--SAGMG  1029

Query  760   TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVF  939
                 +   Y+ V+G LQY++IT P++ + +N++ QFM  PL  HW+AVKR+LRYL GT  
Sbjct  1030  DPIDNVFEYRSVVGALQYITITRPEIAFSVNKVCQFMQKPLDTHWKAVKRILRYLNGTTD  1089

Query  940   HGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTea  1119
              G++L+ S  ++L  F D+DWG   D  RST+G+ +F G +++SW S +Q   +  STEA
Sbjct  1090  LGIVLKPSETMNLVGFCDADWGSDVDDRRSTSGHCVFLGKSLVSWSSKKQHTTSRSSTEA  1149

Query  1120  eyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYF  1299
             EYR+LA+  +E++W+ +LL ++   +   PV+ CDN+S + +  N V HSR KH+ LD +
Sbjct  1150  EYRSLASLTSEMLWLQSLLSELQTKMTMVPVIWCDNISTVSLSANPVLHSRTKHMELDLY  1209

Query  1300  FVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
             FVR  ++   L V HVP   Q+A + TK L  R F+  R K+ V+
Sbjct  1210  FVREKVMERKLVVNHVPTEDQVADVFTKPLSFRFFDKLREKLTVA  1254



>gb|AAM08751.1|AC025098_18 Putative copia-type polyprotein [Oryza sativa Japonica Group]
Length=1803

 Score =   218 bits (555),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 121/284 (43%), Positives = 174/284 (61%), Gaps = 8/284 (3%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPK---DQST  762
             L +FLG+EV  T DG  LSQS+Y  D+L++  M   K V TP  +     +PK   D+  
Sbjct  1121  LKYFLGIEVQRTADGFVLSQSKYATDVLERAGMANCKAVATPADA-----KPKLSSDEGP  1175

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             +  D++ Y+ + G LQYL++T PD+ Y + ++   MH P   H   +KR+LRY+KGT   
Sbjct  1176  LFQDSSWYRSIAGALQYLTLTRPDIAYAVQQVCLHMHAPREAHVTLLKRILRYIKGTAAF  1235

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL LR ST   L AFSD+DW G  D  RST+G+ +F G ++ISW S RQ  V+  S EAE
Sbjct  1236  GLHLRASTSPTLTAFSDADWAGCPDTRRSTSGFCIFLGDSLISWSSKRQTTVSRSSAEAE  1295

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YR +ANA AE  W+  LL ++   +P + + +CDN+S++Y+ +N V+H R KH+ LD  F
Sbjct  1296  YRGVANAVAECTWLRQLLGELHCRVPQATIAYCDNISSVYMSKNPVHHKRTKHIELDIHF  1355

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
             VR  +  G LRV  +P+  Q A + TKGL   +F  FR+ + V+
Sbjct  1356  VREKVALGELRVLPIPSAHQFADVFTKGLPSSMFNEFRASLCVA  1399



>ref|XP_006465491.1| PREDICTED: uncharacterized protein LOC102624640 [Citrus sinensis]
Length=1682

 Score =   217 bits (553),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 119/296 (40%), Positives = 183/296 (62%), Gaps = 2/296 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+EV  T  G++LSQS+Y  DIL K +M +   V TP+ +    +  K   +
Sbjct  548   LGKLSYFLGIEVTKTASGIYLSQSKYIADILAKHNMADCSPVPTPMAT--GHYLTKGSGS  605

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             V ++++ Y+  +G LQY+++T P++ + +N+LSQF+ +P   HW++ KR+LRYLKGT+  
Sbjct  606   VISNSSQYKSAVGALQYVTLTRPEIAFSVNKLSQFLASPTAEHWESCKRLLRYLKGTIHF  665

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL       + +  FSDSDW    D  +S  GY ++ GSN++SW S +Q  V+  STEAE
Sbjct  666   GLHFYHYGTMQINCFSDSDWACDKDDRKSVAGYAVYLGSNLVSWSSKKQAVVSRSSTEAE  725

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRALA A AEV W+ +LL+++ + L  +P++ CDN SA+ +  N VYH++ KH+ LD  F
Sbjct  726   YRALAQATAEVTWIQSLLKELHIHLVTAPIMWCDNQSAIALAHNPVYHAKTKHVELDIHF  785

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIKK  1470
             +R  +    + VQ +P+  Q A +LTK L    F + RSK+ V  G   LR  + +
Sbjct  786   IRDKVTAKQITVQFIPSEDQNADVLTKALTFNQFHYLRSKLNVHPGQFSLREDVTE  841



>emb|CAN69838.1| hypothetical protein VITISV_008389 [Vitis vinifera]
Length=336

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 171/282 (61%), Gaps = 3/282 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FL +EV  + +G+F+SQ +Y ++I++   +     + TP+   + L    D+S +  
Sbjct  53    LKYFLSIEVSASKNGIFISQRKYALEIIEDAGLLGTAPIDTPMERGLKL---SDKSDLLK  109

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D   Y+R++G L YL+++ PD+ YV++ LSQFMH P   H +A  RV+RYLK     GLL
Sbjct  110   DQGRYRRLVGRLIYLTVSRPDITYVVHVLSQFMHQPRKAHMEAALRVVRYLKNATGQGLL  169

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                +    L A+ DSDW       RST GY +F G ++ISW+S RQK ++  S +AEYRA
Sbjct  170   FSSNNDFRLRAYYDSDWASCPLTRRSTIGYCVFLGPSLISWKSKRQKTMSLSSVKAEYRA  229

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +     E+ W+  LL+D+GV+     +LHCDN +A+++  N V+H R +H+ +DY ++R 
Sbjct  230   MIGTCCELTWLRYLLRDLGVLHQEPALLHCDNKAALHIATNPVFHERTRHIEMDYHYIRD  289

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
              I +G++  +HV +  Q+  ILTK LG+ +F     K+GV D
Sbjct  290   KIQDGSIITRHVSSAHQLPDILTKPLGKEIFAPMIRKLGVQD  331



>ref|XP_008389560.1| PREDICTED: uncharacterized protein LOC103451895 [Malus domestica]
Length=1300

 Score =   216 bits (551),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 175/275 (64%), Gaps = 3/275 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG++V+ T  GLFLSQS+Y +D+LKKV+M + K   TP +    L   KD  T
Sbjct  1004  LGELHYFLGIQVLHTATGLFLSQSKYILDLLKKVEMVDCKPCDTPCLPYTRLV--KDDGT  1061

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                + T Y+ ++G LQYL+ T PD+ + ++++ QFM +P++ H+ AVKR+LRYLKGT+  
Sbjct  1062  PYNNPTAYRSIVGALQYLTFTRPDIAFSVHQVCQFMQSPMMSHFTAVKRILRYLKGTLSV  1121

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             G+   R   L L AFSD+DW G  +  RSTTG V+F G+N ISW S +Q  V+  STEAE
Sbjct  1122  GMSYTRG-DLLLKAFSDADWAGDPNDRRSTTGLVVFLGNNPISWSSKKQHTVSRSSTEAE  1180

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRAL+   AE+ W+  LL+ + +   H PVL  DNLSA+ +  N V H R KH+ +D  F
Sbjct  1181  YRALSTTLAELDWIQQLLEFLLIKPAHPPVLFYDNLSAIALSFNSVQHQRTKHIEIDVHF  1240

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFE  1407
             VR  +    L VQ V +  Q A ILTKGL   LF+
Sbjct  1241  VRERVAQQKLCVQFVSSREQFADILTKGLSTSLFQ  1275



>emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera]
Length=1354

 Score =   216 bits (551),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 178/281 (63%), Gaps = 9/281 (3%)
 Frame = +1

Query  616   VIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAADATVYQRV  795
             V+P   G+ LSQ +Y  D+L + +M +AK V TP+ +           T  +D T Y+  
Sbjct  1070  VVPHRLGILLSQRRYIQDLLIRTNMADAKPVLTPLPTSSTAIS-LTSGTPLSDPTPYRAA  1128

Query  796   IGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLLRR--STQ  969
             +G LQYLS+T PD+ + +NR++QFMH P   HW  VKR+LRYL GT+  GLLL R  S  
Sbjct  1129  VGSLQYLSLTRPDISFAVNRMAQFMHQPTSEHWVLVKRILRYLCGTLDKGLLLYRDSSIP  1188

Query  970   LH-----LAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyral  1134
             LH     L AFSD+DW G  D   ST+ Y+++ G N++SW S +Q+ VA  STEAEYR++
Sbjct  1189  LHGFSDSLHAFSDADWAGNKDDYSSTSAYLVYLGRNLVSWSSKKQQTVARSSTEAEYRSV  1248

Query  1135  anaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVH  1314
             A  AAE+ WV +LL D+G+    SPV++CDN+ A  +  N ++HSRMKH+A+DY F+R  
Sbjct  1249  AATAAELCWVGSLLSDLGIKFTTSPVVYCDNVGATQLSSNPIFHSRMKHVAIDYHFIRDQ  1308

Query  1315  IVNGTLRVQHVPATSQIAAILTKGLGR-RLFEHFRSKMGVS  1434
             + +G LRV HV +  Q+A +LTK L     F   R K+G+S
Sbjct  1309  VQSGLLRVAHVSSADQLADLLTKPLPTYSQFLLLRDKIGLS  1349



>gb|ABA93844.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1099

 Score =   215 bits (547),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 125/283 (44%), Positives = 173/283 (61%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LHHFLG+ V     GL LSQ QY+I+IL++  M + K   TP+ +   L    D S 
Sbjct  818   LGTLHHFLGITVTSDSSGLLLSQRQYSIEILERAGMSDCKPCSTPVDTNAKLSS-TDGSP  876

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             V  D T Y+ +   LQYL+ T PD+ YV+ ++   MH+P   H   +KR+LRY++GT+  
Sbjct  877   VL-DPTDYRSLASALQYLTFTRPDISYVVQQVCLHMHDPRDSHLATLKRILRYVRGTLDL  935

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL +R S    L A+SD++W G  D  +ST+GY +F G N++SW S RQ  V+  S EAE
Sbjct  936   GLHIRHSPSTDLVAYSDANWAGCPDTRKSTSGYAVFLGDNLVSWSSKRQHTVSRSSAEAE  995

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+ANA AE  W+  LL ++      + +++CDN+SA+Y+  N V H R KH+ +D  F
Sbjct  996   YRAMANAVAETCWLRQLLHELHTPPSKATLVYCDNVSAVYLSTNPVQHQRTKHVEIDLHF  1055

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +  G++RV HVP TSQ A I TKGL   LF  FRS + V
Sbjct  1056  VRDRVAVGSVRVLHVPTTSQYADIFTKGLPSSLFVEFRSSLNV  1098



>emb|CAN83285.1| hypothetical protein VITISV_004139 [Vitis vinifera]
Length=1556

 Score =   216 bits (551),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 187/311 (60%), Gaps = 5/311 (2%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             ++S F+ +L S  +  +  L  +H+FLG+E+  T DGL LSQS Y   IL++ +M + K 
Sbjct  1211  LVSTFIQLLSSEFAMKD--LGQIHYFLGIEISQTADGLHLSQSHYAFTILERANMVDCKP  1268

Query  706   VRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLL  885
             + TP+ +          S +  D + ++ ++G LQYL++T PD+ Y +N  SQFMH P L
Sbjct  1269  MSTPLEAKTKTL---PNSVLLEDPSYFRGLVGALQYLTLTRPDLSYSVNYASQFMHAPTL  1325

Query  886   IHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNV  1065
             +H + V+R+LRY+KGT+  GL     T L L AFSD+DW G     RS TGY  F G N+
Sbjct  1326  VHLKMVRRILRYVKGTIDIGLHFTSHTTLDLCAFSDADWAGCLTTRRSITGYCTFLGGNI  1385

Query  1066  ISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYV  1245
             ISW + +Q  ++  STEAEYRA+A+  AE+ W+  +L D  + L  +P L+ DN SA+++
Sbjct  1386  ISWCAKKQHTISRSSTEAEYRAMAHTTAELTWMSFILNDFHIPLASTPTLYYDNTSALHM  1445

Query  1246  CQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
               N V+H+R KH+ LDY FVR  +  G L  QH+    Q+A + TK + +    +F++K+
Sbjct  1446  AINPVFHARSKHIELDYHFVRERVALGLLVTQHISTEKQVADLFTKPMSKAALSNFQTKL  1505

Query  1426  GVSDGSSILRG  1458
              +    S+  G
Sbjct  1506  CLQARHSLREG  1516



>dbj|BAB90546.1| putative rice retrotransposon retrofit gag/pol polyprotein [Oryza 
sativa Japonica Group]
Length=1448

 Score =   216 bits (550),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 173/281 (62%), Gaps = 0/281 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV    +G+ L+Q +Y  D+LK+V+M   K V TP+     L   +       
Sbjct  1166  LHYFLGIEVTKVSNGVILTQEKYANDMLKRVNMSNCKPVSTPLSVSEKLTLYEGSPLGPN  1225

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DAT Y+ ++G LQYL++T PD+ Y +N++ QF+H P   HW AVKR+LRYL      GL 
Sbjct  1226  DATQYRSIVGALQYLTLTRPDIAYSVNKVCQFLHAPTTSHWIAVKRILRYLNQCTSLGLH  1285

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             + +S    +  +SD+D  G  D  +ST G+ +F GSN++SW + +Q  V+  STEAEY+A
Sbjct  1286  VHKSASTLVHGYSDADGAGSIDDRKSTGGFAVFLGSNLVSWSARKQPTVSRSSTEAEYKA  1345

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN  AE+IWV  +L+++G+  P +  + CDNL A Y+  N V+H++ KH+ +DY FVR 
Sbjct  1346  VANTTAELIWVQTVLKELGIESPKAAKIWCDNLGAKYLSANPVFHAKTKHIHVDYHFVRE  1405

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
              +    L +  VP+  Q+A   TK L  RL E+F+  + ++
Sbjct  1406  RVSQKLLEIDFVPSGDQVADGFTKALSARLLENFKHNLNLT  1446



>gb|AAO26690.1|AF478377_1 gag-pol polyprotein [Vitis vinifera]
Length=326

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 165/283 (58%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+EV  +  G+FLSQ +Y +D+LK+    EAK   TP+V  V L    D   
Sbjct  39    LGELKYFLGIEVSRSKKGMFLSQRKYVLDLLKETGKIEAKPCTTPMVPNVQLM--PDDGD  96

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                +   Y+RV+G L YL++T PD+ Y ++ +SQF   P + HW A++++L YLK     
Sbjct  97    PFYNPERYRRVVGKLNYLTVTRPDIAYAVSVVSQFTSAPTIKHWAALEQILCYLKKAPSL  156

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             G+L R      +  FSD+DW G     RSTTGY +FFG N+++W+S +Q  V+  S E+E
Sbjct  157   GILYRSQGHTRIECFSDADWAGSKFDRRSTTGYCVFFGGNLVAWKSKKQSVVSRSSAESE  216

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+A A  E+IW+H LL ++G+       L CDN +A+++  N VYH R KH+ +D  F
Sbjct  217   YRAMAQATCEIIWIHQLLCEVGMKCTMPAKLWCDNQAALHIAANPVYHERTKHIEVDCHF  276

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             +R  I    +   +V    Q+  I TK L     E+F +K+G+
Sbjct  277   IREKIEENLVSTDYVKTGEQLGDIFTKALNGTRVEYFCNKLGM  319



>ref|XP_008387250.1| PREDICTED: uncharacterized protein LOC103449699 [Malus domestica]
Length=1313

 Score =   216 bits (549),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 172/274 (63%), Gaps = 3/274 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH FLG+++  T  GLFLSQ +Y +D+LKK DM +AK   TP +    L   KD   
Sbjct  1023  LGPLHFFLGIQISKTAHGLFLSQEKYIVDLLKKTDMTDAKPAVTPCLPYNRLL--KDDGQ  1080

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                +  +Y+ V+G LQYL  T PD+ + ++++SQFM  P+L H+ AVKR+LRYLKG++  
Sbjct  1081  PFNNPGLYRSVVGALQYLVFTRPDIAFSVHQVSQFMQAPMLSHFTAVKRILRYLKGSLSK  1140

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             G+   +  +L L AFSD+DW G  +  RSTTG V+F G+N ISW S +Q+ V+  STEAE
Sbjct  1141  GITYSQG-ELLLKAFSDADWAGDPNDRRSTTGLVVFLGNNPISWSSKKQQTVSRSSTEAE  1199

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA++   AE+ W+  LL  + +     P+L CDN+SA+ +  N V H R KH+ +D  F
Sbjct  1200  YRAMSTTTAELDWIQQLLAFLQIQPSDPPMLFCDNMSAIALSFNPVNHQRTKHIEVDVHF  1259

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLF  1404
             VR  + N  L+VQ V ++ Q A I TKGL   LF
Sbjct  1260  VRERVANKKLQVQFVSSSEQFADIFTKGLSTPLF  1293



>emb|CAN73437.1| hypothetical protein VITISV_031733 [Vitis vinifera]
Length=1322

 Score =   216 bits (549),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/282 (42%), Positives = 174/282 (62%), Gaps = 3/282 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+EV  +  G+ +SQ +YT++ILK      AK V  P+   + L    D S +  
Sbjct  1039  LKYFLGIEVSRSKKGISISQRKYTLEILKDGGFLGAKPVNFPMEQNIKL---SDSSELLK  1095

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D + Y+R++G L YL+IT PD+ Y ++ LS+FMH P   H +A  RVLRYLK +   GL 
Sbjct  1096  DPSQYRRLVGRLIYLTITRPDITYSVHVLSRFMHAPRRPHMEAALRVLRYLKNSPGQGLF  1155

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                   L L AFSDSDW G     RSTTGY +F GS++ISWR+ RQK V+  S EAEYRA
Sbjct  1156  FPSQNDLSLRAFSDSDWAGCPISRRSTTGYCVFLGSSLISWRTKRQKTVSLSSAEAEYRA  1215

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +     E+ W+ +LL+D+ ++ P   +L+CDN +A+++  N V+H R +H+ +D  F+R 
Sbjct  1216  MTGTCCELSWLRSLLKDLRILHPKPALLYCDNTTALHIAANPVFHERTRHIEMDCHFIRE  1275

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
              I +G+   +H+ +T+Q+A + TK LG+  F     K+GV D
Sbjct  1276  KIQDGSFVTKHIASTNQLADVFTKPLGKETFSTMIHKLGVLD  1317



>ref|XP_008359393.1| PREDICTED: uncharacterized protein LOC103423104 [Malus domestica]
Length=1498

 Score =   216 bits (549),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 175/274 (64%), Gaps = 3/274 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDG-LFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVA  768
             L +FLG+++    +G +F++QS+Y  D+L K  M   +   T       L   KD+    
Sbjct  1216  LTYFLGLQIAYRBNGDIFINQSKYVTDLLNKAGMMHCRPCSTXSKPHTQLL--KDEGQPM  1273

Query  769   ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGL  948
             A+ TVY  ++G L YL+ T PD+ Y +N   QFM  P   H+  +KR+LRYLKGT+  GL
Sbjct  1274  ABPTVYXSMVGALXYLTFTRPDIAYAVNYACQFMTTPTEEHFCLIKRILRYLKGTLQCGL  1333

Query  949   LLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
                   ++ L A+SD+DW    +  RSTTGY++F GSN +SW S +Q +V+  STEAEY+
Sbjct  1334  TYSAQGKMELLAYSDADWAADINTRRSTTGYIVFIGSNPVSWXSKKQGSVSRSSTEAEYK  1393

Query  1129  alanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
             ALANAAA+V WV ++L+D+ V LP +P+LHCDNLS + +C N V+H+ +KHL  D+ FVR
Sbjct  1394  ALANAAADVAWVRSVLKDLHVFLPSAPLLHCDNLSTLALCSNPVFHTXIKHLDTDFHFVR  1453

Query  1309  VHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEH  1410
               +  G L VQ++P  +Q+A +LTKGL   LF H
Sbjct  1454  ERVQKGDLEVQYIPTEAQVADVLTKGLHSPLFVH  1487



>gb|KHN30958.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1237

 Score =   215 bits (547),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 129/293 (44%), Positives = 178/293 (61%), Gaps = 15/293 (5%)
 Frame = +1

Query  529   MSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIV  708
             +S+ +  L +R S  +  L  L +FLGVEVIP+  G+FLSQ +Y ID+L K  M   K  
Sbjct  948   LSKLIATLAARFSLKD--LGCLSYFLGVEVIPSAAGMFLSQRKYIIDLLHKSGMTNTKPA  1005

Query  709   RTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLI  888
              TP+ + V L   KD   +      Y+ ++G LQYLS+T PD+ +  N+L+QFM NP   
Sbjct  1006  STPLSASVQLL--KDSGDLLPSPNEYRTLVGSLQYLSLTRPDIAFSTNKLAQFMQNPRTA  1063

Query  889   HWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVI  1068
             HW A+KRVLRYL G+   G+ +  +  L   A+SD+DW G  D   STTGY         
Sbjct  1064  HWSALKRVLRYLAGSCDKGVFISATAPLTFHAYSDADWAGDKDDYVSTTGYF--------  1115

Query  1069  SWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVC  1248
                S +Q++VA  STEAEY+ALA+ A+E++WV +L  ++G +   +PV++CDNL A  + 
Sbjct  1116  ---SRKQRSVARSSTEAEYKALADTASELLWVLSLFTELGHMPTANPVIYCDNLGATNLS  1172

Query  1249  QNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFE  1407
              N V+HSRMKH+AL Y FVR H+ +G  RV  V    Q+A ILTK L R  FE
Sbjct  1173  ANPVFHSRMKHIALAYHFVREHVQHGKFRVSFVSTNDQLADILTKPLLRPRFE  1225



>emb|CAB40035.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB81170.1| retrotransposon like protein [Arabidopsis thaliana]
Length=1515

 Score =   216 bits (549),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 181/295 (61%), Gaps = 5/295 (2%)
 Frame = +1

Query  589   ALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVA  768
             ALH+FLG++     DGLFLSQ +YT D+L    M +   + TP+   +DL +  ++    
Sbjct  1145  ALHYFLGIQAHYHNDGLFLSQEKYTSDLLVNAGMSDCSSMPTPLQ--LDLLQGNNKP--F  1200

Query  769   ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGL  948
              + T ++R+ G LQYL++T PD+ + +N + Q MH P +  +  +KR+L YLKGT+  G+
Sbjct  1201  PEPTYFRRLAGKLQYLTLTRPDIQFAVNFVCQKMHAPTMSDFHLLKRILHYLKGTMTMGI  1260

Query  949   LLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
              L  +T   L  +SDSDW G  D  RST G+  F G N+ISW + R   V+  STEAEYR
Sbjct  1261  NLSSNTDSVLRCYSDSDWAGCKDTRRSTGGFCTFLGYNIISWSAKRHPTVSKSSTEAEYR  1320

Query  1129  alanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
              L+ AA+EV W+  LLQ++G+     P ++CDNLSA+Y+  N   HSR KH  +DY++VR
Sbjct  1321  TLSFAASEVSWIGFLLQEIGLPQQQIPEMYCDNLSAVYLSANPALHSRSKHFQVDYYYVR  1380

Query  1309  VHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS-DGSSILRGRIKK  1470
               +  G L V+H+PA+ Q+A I TK L +  F   R K+GV     + LRG IK+
Sbjct  1381  ERVALGALTVKHIPASQQLADIFTKSLPQAPFCDLRFKLGVVLPPDTSLRGCIKQ  1435



>gb|AAC35532.1| contains similarity to proteases [Arabidopsis thaliana]
Length=1392

 Score =   215 bits (548),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 181/295 (61%), Gaps = 5/295 (2%)
 Frame = +1

Query  589   ALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVA  768
             ALH+FLG++     DGLFLSQ +YT D+L    M +   + TP+   +DL +  ++    
Sbjct  1022  ALHYFLGIQAHYHNDGLFLSQEKYTSDLLVNAGMSDCSSMPTPLQ--LDLLQGNNKP--F  1077

Query  769   ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGL  948
              + T ++R+ G LQYL++T PD+ + +N + Q MH P +  +  +KR+L YLKGT+  G+
Sbjct  1078  PEPTYFRRLAGKLQYLTLTRPDIQFAVNFVCQKMHAPTMSDFHLLKRILHYLKGTMTMGI  1137

Query  949   LLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
              L  +T   L  +SDSDW G  D  RST G+  F G N+ISW + R   V+  STEAEYR
Sbjct  1138  NLSSNTDSVLRCYSDSDWAGCKDTRRSTGGFCTFLGYNIISWSAKRHPTVSKSSTEAEYR  1197

Query  1129  alanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
              L+ AA+EV W+  LLQ++G+     P ++CDNLSA+Y+  N   HSR KH  +DY++VR
Sbjct  1198  TLSFAASEVSWIGFLLQEIGLPQQQIPEMYCDNLSAVYLSANPALHSRSKHFQVDYYYVR  1257

Query  1309  VHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS-DGSSILRGRIKK  1470
               +  G L V+H+PA+ Q+A I TK L +  F   R K+GV     + LRG IK+
Sbjct  1258  ERVALGALTVKHIPASQQLADIFTKSLPQAPFCDLRFKLGVVLPPDTSLRGCIKQ  1312



>ref|XP_008386299.1| PREDICTED: uncharacterized protein LOC103448812 [Malus domestica]
Length=1255

 Score =   215 bits (547),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 126/274 (46%), Positives = 173/274 (63%), Gaps = 3/274 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG++V  T  GLFLSQS+Y  D+L+KV+M ++K   TP +    L   KD  T
Sbjct  957   LGVLHYFLGIQVTKTAQGLFLSQSKYIQDLLQKVEMMDSKACDTPCLPNNRLL--KDDGT  1014

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                + TVY+ ++  LQYL+ T PD+ + ++++ QFM +P++ H+ AVKR+LRYLKGT+  
Sbjct  1015  PYNNPTVYRSIVSALQYLTFTRPDIAFSVHQVCQFMQSPMMSHFTAVKRILRYLKGTLSV  1074

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             G+   R   L L AF D+DW G  +  RSTTG V+F G+N ISW S +Q  V+  STEAE
Sbjct  1075  GMAYTRG-DLTLKAFGDADWAGDPNDRRSTTGLVIFLGNNPISWSSKKQNTVSRSSTEAE  1133

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA++  +AE+ W+  +L  M V    +PVL CDNLSA+ +  N V H R KH+ +D  F
Sbjct  1134  YRAMSTTSAELDWIQQVLGFMHVKSTTTPVLFCDNLSAIALSFNPVQHQRTKHIEIDVHF  1193

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLF  1404
             VR  +    L VQ V +  Q A ILTKGL   LF
Sbjct  1194  VRERVAKRQLVVQFVSSREQFADILTKGLSAPLF  1227



>gb|AAD21687.1| Strong similarity to gi|3600044 T12H20.12 protease homolog from 
Arabidopsis thaliana BAC gb|AF080119 and is a member of the 
reverse transcriptase family PF|00078 [Arabidopsis thaliana]
Length=1415

 Score =   215 bits (548),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/314 (40%), Positives = 190/314 (61%), Gaps = 7/314 (2%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             ++   L  L +R S  +  L    +FLG+++    +GLFL Q+ Y  DIL++  M +   
Sbjct  1066  LLEDLLQALKNRFSMKD--LGPPRYFLGIQIEDYANGLFLHQTAYATDILQQAGMSDCNP  1123

Query  706   VRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLL  885
             + TP+   +D       S + A+ T ++ + G LQYL+IT PD+ + +N + Q MH+P  
Sbjct  1124  MPTPLPQQLDNL----NSELFAEPTYFRSLAGKLQYLTITRPDIQFAVNFICQRMHSPTT  1179

Query  886   IHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNV  1065
               +  +KR+LRY+KGT+  GL ++R++ L L+A+SDSD  G  +  RSTTG+ +  GSN+
Sbjct  1180  SDFGLLKRILRYIKGTIGMGLPIKRNSTLTLSAYSDSDHAGCKNTRRSTTGFCILLGSNL  1239

Query  1066  ISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYV  1245
             ISW + RQ  V++ STEAEYRAL  AA E+ W+  LL+D+G+       ++CDNLSA+Y+
Sbjct  1240  ISWSAKRQPTVSNSSTEAEYRALTYAAREITWISFLLRDLGIPQYLPTQVYCDNLSAVYL  1299

Query  1246  CQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
               N   H+R KH   DY ++R  +  G +  QH+ AT Q+A + TK L RR F   RSK+
Sbjct  1300  SANPALHNRSKHFDTDYHYIREQVALGLIETQHISATFQLADVFTKSLPRRAFVDLRSKL  1359

Query  1426  GVSDGSSI-LRGRI  1464
             GVS   +  LRG +
Sbjct  1360  GVSGSPTPSLRGSV  1373



>ref|XP_008358596.1| PREDICTED: uncharacterized protein LOC103422324 [Malus domestica]
Length=1195

 Score =   214 bits (546),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 121/273 (44%), Positives = 173/273 (63%), Gaps = 4/273 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+++  T +GLF+SQS+Y  +++ KVD+   K   TP +    L   KD      
Sbjct  926   LHYFLGLQISHTAEGLFVSQSKYISELVAKVDLQACKPCATPCLPCHRLL--KDDGKPYH  983

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
                 Y+ ++G LQYL+ T PD+ + +N+  QFMHNP+  H   VKR++RYLKGT  +GL 
Sbjct  984   SPDQYRSIVGALQYLTFTRPDIAFFVNQACQFMHNPMESHVIVVKRIIRYLKGTPDYGLH  1043

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
              +    L L ++SD+DW G  +  RST+G+++F GSN ISW S +Q  V+  ST AEYRA
Sbjct  1044  FKPGP-LSLLSYSDADWAGDPNDRRSTSGFIVFLGSNPISWSSKKQXTVSRSSTXAEYRA  1102

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA  AAE+ W+  LL D+ + L H+P++HCDN+SA+ +  N V+H++ KH+ +DY FV  
Sbjct  1103  LAITAAELSWIRQLLXDLHI-LSHAPMIHCDNISAIALSTNPVFHAKSKHIEIDYHFVCE  1161

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEH  1410
              +  G L VQHV +  Q A I TKGL   LF H
Sbjct  1162  KVTRGDLHVQHVSSADQFADIFTKGLFAPLFHH  1194



>ref|XP_004294137.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Fragaria vesca subsp. vesca]
Length=331

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/285 (38%), Positives = 174/285 (61%), Gaps = 3/285 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+E+  + +G+F+ Q +Y ++I+K   +  A  V TP+   + L    D+S 
Sbjct  45    LGELKYFLGIEISSSRNGIFMCQRKYALEIVKDAGLLGAAPVDTPMERGLKL---SDKSD  101

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             +  D + Y+R++G L YL+++ PD+ Y ++ LS+FMH P   H +A  RV+RYLKG    
Sbjct  102   LLRDPSRYRRLVGRLIYLTVSRPDITYAVHVLSRFMHQPRKSHMEAALRVIRYLKGAPGQ  161

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL    ++ L L A+ DSDWG      RSTTGY +F G ++ISW+S RQK V+  S EAE
Sbjct  162   GLFFSSTSDLKLRAYCDSDWGDCPLTRRSTTGYCVFLGPSLISWKSKRQKTVSLSSAEAE  221

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             Y  +  A  E+ W+  LL+D+G++      L CDN +A+++  N V+H R +H+ +D  +
Sbjct  222   YHVMTGACCELTWLRYLLRDLGLIHHEPASLSCDNKAALHIAANPVFHERRRHIEMDCHY  281

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
             +R  I +G++  ++V +T Q+A +LTK LG+  F     K+GV +
Sbjct  282   IRDKIQDGSVVAKYVSSTHQLADVLTKPLGKETFVPMVRKLGVQN  326



>gb|KHN45997.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1235

 Score =   214 bits (546),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 129/293 (44%), Positives = 178/293 (61%), Gaps = 15/293 (5%)
 Frame = +1

Query  529   MSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIV  708
             +S+ +  L +R S  +  L  L +FLGVEVIP+  G+FLSQ +Y ID+L K  M   K  
Sbjct  946   LSKLIATLAARFSLKD--LGCLSYFLGVEVIPSAAGMFLSQRKYIIDLLHKSGMTNTKPA  1003

Query  709   RTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLI  888
              TP+ + V L   KD   +      Y+ ++G LQYLS+T PD+ +  N+L+QFM NP   
Sbjct  1004  STPLSASVQLL--KDSGDLLPSPNEYRTLVGSLQYLSLTRPDIAFSTNKLAQFMQNPRTA  1061

Query  889   HWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVI  1068
             HW A+KRVLRYL G+   G+ +  +  L   A+SD+DW G  D   STTGY         
Sbjct  1062  HWSALKRVLRYLAGSCDKGVFISATAPLTFHAYSDADWAGDKDDYVSTTGYF--------  1113

Query  1069  SWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVC  1248
                S +Q++VA  STEAEY+ALA+ A+E++WV +L  ++G +   +PV++CDNL A  + 
Sbjct  1114  ---SRKQRSVARSSTEAEYKALADTASELLWVLSLFTELGHMPTANPVIYCDNLGATNLS  1170

Query  1249  QNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFE  1407
              N V+HSRMKH+AL Y FVR H+ +G  RV  V    Q+A ILTK L R  FE
Sbjct  1171  ANPVFHSRMKHIALAYHFVREHVQHGKFRVSFVSTDDQLADILTKPLLRPRFE  1223



>dbj|BAK64102.1| gag-pol polyprotein [Eustoma exaltatum subsp. russellianum]
Length=1591

 Score =   215 bits (548),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/295 (40%), Positives = 181/295 (61%), Gaps = 6/295 (2%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVS--PVDLFRPKDQ  756
             L  L +FLG+EV+ + +G+++SQ +Y +D+L +V + +AK   TP+V    +D+     Q
Sbjct  1300  LGGLKYFLGIEVLRSAEGIYISQRKYILDLLTEVGLLDAKPADTPMVQNHKLDIV----Q  1355

Query  757   STVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTV  936
                +AD   YQR++G L YLS T PD+ Y +  +SQFMH+P   H +AV R++RYLKGT 
Sbjct  1356  GAASADREQYQRLVGKLIYLSHTRPDIAYAVGVVSQFMHSPQKHHLEAVFRIMRYLKGTP  1415

Query  937   FHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTe  1116
               GLL + +  L++ A++D+DW G     RST+GY    G NV++WRS +QK VA  S E
Sbjct  1416  GRGLLFKNNGHLNIEAYTDADWAGSQIDRRSTSGYFTLVGGNVVTWRSKKQKVVALSSAE  1475

Query  1117  aeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDY  1296
             AEYR +    +EV+W+  LLQ++G  +     L CDN +++ + +N V H R KH+ +D 
Sbjct  1476  AEYRGIVKGVSEVLWIRKLLQELGFPVTDPTCLMCDNKASISISENPVQHDRTKHVEIDR  1535

Query  1297  FFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGR  1461
              FV+  I +G + + HV +  Q+A ILTK +  R+FE    K+ + D +  L G 
Sbjct  1536  HFVKEKIEDGIIALPHVRSEDQLADILTKAVNGRIFEFILRKLNIVDPTIQLEGE  1590



>ref|XP_010683797.1| PREDICTED: uncharacterized protein LOC104898410 [Beta vulgaris 
subsp. vulgaris]
Length=1116

 Score =   214 bits (544),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/283 (42%), Positives = 170/283 (60%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+ V     GLFLSQ +Y  +I+ +  M   K   TP+ +   L        
Sbjct  826   LGTLSYFLGISVTKHAGGLFLSQKKYAEEIIARAHMASCKPSATPVDTKAKLS--ASSGP  883

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               AD T+++ + G LQYL+ T PD+ Y + ++  FMH+P   H  A+KR++RY++GT+  
Sbjct  884   PVADPTLFRSLAGALQYLTFTRPDISYAVQQICLFMHDPRESHLHALKRIIRYVQGTLHL  943

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL L  S    L +++D+DWGG  D  RST+GY +F G N+ISW S RQ  ++  S E+E
Sbjct  944   GLHLYSSPSTRLVSYTDADWGGCPDTRRSTSGYCVFLGDNLISWSSKRQPTLSRSSAESE  1003

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YR +AN  +E  W+ NLL ++   +  + +++CDN+SA+Y+  N V H R KH+ LD  F
Sbjct  1004  YRGVANVVSETCWLRNLLLELHCPVRRATLVYCDNVSAVYLSGNPVQHQRTKHIELDIHF  1063

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +  G +RV HVP+  Q A I TKGL R LFE FRS + V
Sbjct  1064  VREKVAKGLVRVLHVPSRFQYADIFTKGLPRPLFEEFRSSLSV  1106



>gb|ABF95666.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
Length=976

 Score =   213 bits (541),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 121/286 (42%), Positives = 177/286 (62%), Gaps = 8/286 (3%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDL---FRPKD  753
             L  L+HFLG+ V P   GL L+Q QY ++IL++  M + K    P ++PVD    F  + 
Sbjct  685   LGPLNHFLGINVTPHSGGLLLTQRQYCLEILERAGMSDCK----PCLTPVDTSAKFSTEG  740

Query  754   QSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGT  933
               +V+ D T ++ + G LQYL+ T PD+ Y + ++   MH+P   H  A+KR+LRY++GT
Sbjct  741   SPSVS-DPTDFRSLAGALQYLTFTRPDISYAVQQVCLHMHDPRESHLTALKRILRYIRGT  799

Query  934   VFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFST  1113
             + +GL ++RS+   L A+SD++W G  D  +ST GY +F G N+ISW S RQ  V+  S 
Sbjct  800   LEYGLHIQRSSSFDLMAYSDANWAGCPDTRKSTFGYAVFLGDNLISWSSKRQNTVSRSSA  859

Query  1114  eaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALD  1293
             EAEYRA+ANA AE  W+  LL ++      + +++CDN+SA+Y+  N V H R KH+ +D
Sbjct  860   EAEYRAVANAVAETSWLRQLLHELYAPPSKATLVYCDNVSAVYLSTNPVQHQRTKHVEID  919

Query  1294  YFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
               FV   +  G +RV HVP TSQ A + TKGL   +F  FRS + V
Sbjct  920   LHFVHERVDVGAVRVLHVPTTSQYANVFTKGLPSPVFNEFRSSLNV  965



>ref|XP_008341155.1| PREDICTED: uncharacterized protein LOC103404078 [Malus domestica]
Length=986

 Score =   213 bits (541),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 123/281 (44%), Positives = 177/281 (63%), Gaps = 5/281 (2%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             +H+FLG+EV  +  GLFL QS+Y ID+LKK DM   K    P  +PV   +     +  +
Sbjct  393   IHYFLGIEVHRSAKGLFLHQSKYAIDLLKKSDMLGVK----PCSTPVGSAKLDHSGSPLS  448

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D + Y+  +G LQYL+ T PD+ + +N++ Q MH+P  +H QAVKR+LRYLKGT+  GL 
Sbjct  449   DPSFYRSTVGALQYLTWTRPDLAFAVNQVCQHMHSPRTVHLQAVKRILRYLKGTLHFGLW  508

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L +  Q +L A+SD+DW G     RST+GY +F G N+ISW + +Q  VA  STEAEYR+
Sbjct  509   LTKGPQ-YLTAWSDADWAGCLVDRRSTSGYCVFLGPNLISWSAKKQCXVARSSTEAEYRS  567

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA+ AAE+ WV  +LQD+   L  +P + CDN SA+ +  N V+H+R KH+ +DY ++  
Sbjct  568   LAHTAAELSWVCQVLQDLSFPLLKTPAIFCDNKSAIALAFNPVFHARTKHVEIDYHYIXE  627

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
              ++ G + V HV +  QIA I TK L    F    SK+ ++
Sbjct  628   KVLCGKVSVHHVASLLQIADIFTKSLPSDRFAXLASKLSIT  668



>ref|XP_010493723.1| PREDICTED: uncharacterized protein LOC104770945 [Camelina sativa]
 ref|XP_010497182.1| PREDICTED: uncharacterized protein LOC104774223 [Camelina sativa]
Length=739

 Score =   211 bits (537),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 182/302 (60%), Gaps = 4/302 (1%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             +M Q LV L S     +  L  LH+FLG++ +    GLFL+Q +Y  D+L    M +   
Sbjct  420   LMDQLLVSLSSIFRMKD--LGPLHYFLGIQALFHDGGLFLNQEKYATDLLVTAGMADCAP  477

Query  706   VRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLL  885
             + TP+  P+   +   QS + ++ T ++ + G LQYL++T PD+ + +N + Q MH+P  
Sbjct  478   MPTPL--PLQPGKIAGQSKLFSNPTYFRSLAGKLQYLTLTRPDIQFAVNFVCQKMHSPSE  535

Query  886   IHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNV  1065
               +  +KR+LRY+KGTV  G+ L  +T   L  +SDS W G  D  RST G+  F G+N+
Sbjct  536   DDFFLLKRILRYVKGTVRLGINLSNTTDSTLRVYSDSGWSGCKDTSRSTGGFCTFLGANI  595

Query  1066  ISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYV  1245
             ISW S R   V+H STE+EYR L+ A+ E++W++NLL++ GV  P +P ++CDNLS +++
Sbjct  596   ISWSSKRHPTVSHSSTESEYRTLSLASREIMWLNNLLRETGVAQPVTPKMYCDNLSVVHL  655

Query  1246  CQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
               N   HS+MKH A D+  VR  +  G L V+H+PA  Q+A I TK L    F   R K+
Sbjct  656   TVNPALHSKMKHFARDFHHVREQVALGALIVEHIPAQDQLADIFTKSLPPAAFCDLRFKL  715

Query  1426  GV  1431
             G+
Sbjct  716   GL  717



>emb|CAN70361.1| hypothetical protein VITISV_033646 [Vitis vinifera]
Length=1013

 Score =   213 bits (541),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 178/269 (66%), Gaps = 2/269 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+E+  + DGL+++Q++Y  D+L +V + ++K V TP+     L   + +    +
Sbjct  731   LSYFLGLEITHSTDGLYITQAKYASDLLSQVGLTDSKNVDTPVELNAHLTPSRGKPL--S  788

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             + ++Y+R++G L YL++T PD+ Y ++++SQ++  P   H+ AV R+LRYLKGT+FHGL 
Sbjct  789   NPSLYRRLVGNLVYLTVTRPDISYAVHQVSQYLSAPRSTHYAAVLRILRYLKGTIFHGLF  848

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                 + L L AFSD+DW G     RSTTGY    GS++ISWRS +Q  VA  STEAEYRA
Sbjct  849   YSAQSPLVLRAFSDADWAGDPTDRRSTTGYCFLLGSSLISWRSKKQTFVARSSTEAEYRA  908

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA+  +E+IW+  LL+D+GV    +  L+CDN SA+++  N V+H R KH+ +D  F+R 
Sbjct  909   LADTTSELIWLRWLLKDLGVSTSSATPLYCDNQSAIHIAHNDVFHERTKHIKIDCHFIRY  968

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRR  1398
             H+V+G L++  V +  Q+A I TK L  R
Sbjct  969   HLVHGALKLFFVSSKDQLADIFTKSLPTR  997



>emb|CAN67546.1| hypothetical protein VITISV_027734 [Vitis vinifera]
Length=1635

 Score =   215 bits (547),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 121/299 (40%), Positives = 183/299 (61%), Gaps = 10/299 (3%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFR----PK  750
             L  L +FLG+EV      + LSQ++Y  D+L + +M + K  +TP V   +L +    P 
Sbjct  905   LGQLSYFLGIEVSYHEGSMNLSQTKYVSDLLHRTEMFDTKPAKTPGVVGKNLSKFDGDPM  964

Query  751   DQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKG  930
             D+       T Y+ V+G LQYL+IT PD+ + +N+  QFM  P   HW ++KR+LRYLKG
Sbjct  965   DE------VTQYRSVVGALQYLTITRPDIAFAVNKACQFMQQPTSAHWLSIKRILRYLKG  1018

Query  931   TVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFS  1110
             T+  GLLL  ST L +  FSD++WG   D  RS++GY+++ G N++SW S +QK V+  S
Sbjct  1019  TMQDGLLLSPSTNLTIEXFSDANWGAQPDDRRSSSGYLVYLGGNLVSWSSTKQKVVSRSS  1078

Query  1111  TeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLAL  1290
              E+EYR LA A AE+IW+  LLQ++ V +P  P+L  DN+SA ++ +N V+H+R KH+ +
Sbjct  1079  AESEYRGLALATAEIIWMQALLQELCVPIPAIPLLWYDNISAYHMAKNPVFHARTKHIEI  1138

Query  1291  DYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
             D  F+R  ++ G +++  VP   Q A +LTK L    F   +S + ++     LRG  K
Sbjct  1139  DLHFIRDQVIRGKIQLHFVPTEDQPADLLTKHLTSSRFLSLKSHLCIASRPFHLRGDDK  1197



>ref|XP_008356672.1| PREDICTED: uncharacterized protein LOC103420386 [Malus domestica]
Length=1486

 Score =   214 bits (546),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 177/277 (64%), Gaps = 3/277 (1%)
 Frame = +1

Query  628   PDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLL  807
             P GLF+SQ++Y  D+L KVD+ ++K   TP +    L   K + T       Y+ ++G L
Sbjct  785   PQGLFVSQTKYIKDLLXKVDLQDSKPCNTPCLPYHRL--SKXEGTPYHSPXQYRSIVGAL  842

Query  808   QYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAF  987
             QYL+ T PD+ + +N+  QFMHNP+  H  AVKR+LRYL GT  +GL  +   +L L A+
Sbjct  843   QYLTFTRPDIAFSVNQCCQFMHNPMDSHVVAVKRILRYLSGTXHYGLQFQPG-KLQLQAY  901

Query  988   SDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVH  1167
             SD+DW G  +  RST+G++++ GS+ ISW S +Q  V+  STEAEYRALA AAAE+ W+ 
Sbjct  902   SDADWAGDPNDRRSTSGHIVYLGSSPISWASKKQHTVSRSSTEAEYRALAIAAAELAWIR  961

Query  1168  NLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHV  1347
              +L D+ V    +PVL+CDN+SA+ +  N V+HSR+KH+ +DY FVR  ++ G L V HV
Sbjct  962   QVLCDLCVPJFTAPVLYCDNISAIALSSNXVFHSRVKHIEIDYHFVRERVIRGDLHVLHV  1021

Query  1348  PATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
              +  Q A ILTKGL   LF+H  S + +     ++ G
Sbjct  1022  SSKEQFADILTKGLSAPLFQHHCSNLMLGSSKHMIEG  1058



>gb|ACV42639.1| gag/pol [Oryza sativa Japonica Group]
Length=1448

 Score =   214 bits (546),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/281 (40%), Positives = 172/281 (61%), Gaps = 0/281 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV    +G+ L+Q +Y  D+LK+V+M     V TP+     L   +       
Sbjct  1166  LHYFLGIEVTKVSNGVILTQEKYANDMLKRVNMSNCTPVSTPLSVSEKLTLYEGSPLGPN  1225

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DAT Y+ ++G LQYL++T PD+ Y +N++ QF+H P   HW AVKR+LRYL      GL 
Sbjct  1226  DATQYRSIVGALQYLTLTRPDIAYSVNKVCQFLHAPTTSHWIAVKRILRYLNQCTSPGLH  1285

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             + +S    +  +SD+D  G  D  +ST G+ +F GSN++SW + +Q  V+  STEAEY+A
Sbjct  1286  VHKSASTLVHGYSDADGAGSIDDRKSTGGFAVFLGSNLVSWSARKQPTVSRSSTEAEYKA  1345

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +AN  AE+IWV  +L+++G+  P +  + CDNL A Y+  N V+H++ KH+ +DY FVR 
Sbjct  1346  VANTTAELIWVQTVLKELGIESPKAAKIWCDNLGAKYLSANPVFHAKTKHIHVDYHFVRE  1405

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
              +    L +  VP+  Q+A   TK L  RL E+F+  + ++
Sbjct  1406  RVSQKLLEIDFVPSGDQVADGFTKALSARLLENFKHNLNLT  1446



>gb|EPS67678.1| hypothetical protein M569_07096 [Genlisea aurea]
Length=892

 Score =   211 bits (538),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/278 (43%), Positives = 173/278 (62%), Gaps = 3/278 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LHHFLGV++  T DG+ L+Q+ Y + +L +    E K   TP+VS V+L  P   S + +
Sbjct  596   LHHFLGVQLKYTEDGVLLTQAHYALSVLDRFGYKECKPAETPLVSKVNLQLP---SKLLS  652

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T ++ ++G LQYL+ T PD+ Y +N ++QFM +P   H     R+L+Y+K T+  GL 
Sbjct  653   DPTPFRALVGALQYLTFTRPDIAYSVNFVAQFMQSPSEYHHLLATRILKYVKHTIHLGLY  712

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
               R++ L L A+SD+DW       RS TGY +  G N ISW S +Q  V+  STEAEYRA
Sbjct  713   YERNSPLQLNAYSDADWAACPLTRRSVTGYCVLLGQNPISWSSKKQHTVSRSSTEAEYRA  772

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +A+ AAEV W+  LL+D+ V L  +PVLHCDNLSA+++  N V+H+R KH+ +DY FVR 
Sbjct  773   MAHTAAEVTWIQFLLRDIKVELIKTPVLHCDNLSALHLTVNPVFHARSKHVEIDYHFVRE  832

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
              +  G L  +H+P   Q+A + TK +        +SK+
Sbjct  833   RVALGYLTTRHIPTRHQLADLFTKRMTCERLTFLKSKL  870



>ref|XP_010665060.1| PREDICTED: uncharacterized protein LOC104882664 [Vitis vinifera]
Length=824

 Score =   211 bits (538),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/290 (41%), Positives = 177/290 (61%), Gaps = 8/290 (3%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L + LGVEV+P   G+ LSQ +Y  D+LK+ +M +AK V TP+ +   +       T
Sbjct  530   LGPLSYSLGVEVVPHRLGILLSQRRYIQDLLKRTNMVDAKPVLTPLPTSSTVIS-LTSGT  588

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               +D T Y+  +G LQYLS+T PD+ + +NR++QFMH P   HW  VKR+LRYL GT+  
Sbjct  589   PLSDPTPYRAAVGSLQYLSLTHPDISFAVNRMAQFMHQPTSEHWVLVKRILRYLCGTIDK  648

Query  943   GLLLRRSTQLHLAAFSDS-------DWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVA  1101
             GL+  R   L L  FSDS       DW    D   ST+ Y ++ G N++SW S +Q+ VA
Sbjct  649   GLIFYRDFPLTLHGFSDSFHAFSDVDWASNKDDYSSTSAYFVYLGRNLVSWSSKKQQTVA  708

Query  1102  HFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKH  1281
               STEAEYR++A  +A++ WV +L+ ++G+ L  SP+++CDN+ A  +  N ++HS MK 
Sbjct  709   RSSTEAEYRSVAATSAKLHWVGSLISELGISLTTSPIVYCDNVGATQLSSNPIFHSCMKQ  768

Query  1282  LALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             +A+DY F+R  + +G LR  HV +  Q+A +L+K L    F   R K+ +
Sbjct  769   VAIDYHFIRDQVQSGLLRNAHVSSADQVANLLSKPLPTSQFMLLRDKISL  818



>emb|CAN81985.1| hypothetical protein VITISV_001567 [Vitis vinifera]
Length=336

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 176/292 (60%), Gaps = 20/292 (7%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  +HHFLG+E+  T DGL LSQS Y + IL++ +M + K + TP+ + +   R      
Sbjct  4     LDQIHHFLGIEISQTSDGLHLSQSHYALTILERANMVDCKPMSTPLEAKI---RTSSNEV  60

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             +  D + ++ ++G LQYL++T PD+ Y +N  SQFMH P+++H + V+R+LRY+KGT+  
Sbjct  61    LLEDPSYFRGLVGALQYLTLTRPDLSYSVNNASQFMHAPIVVHLKMVRRILRYVKGTIDI  120

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
              L    +T L L AFSD+DW                   N+ISW + +Q  ++  STE E
Sbjct  121   DLHFTSNTTLDLCAFSDADWA-----------------RNLISWCAKKQHTISRSSTEVE  163

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+AN AAE+ W+  +L+D+ + L  +P L+CD+ SA+++  NLV+H+R KH+ LDY F
Sbjct  164   YRAMANTAAELTWMSFILKDLHIPLASTPTLYCDDTSALHMTINLVFHARSKHIELDYHF  223

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
             VR  +  G L  QH+    Q+A + TK + +    +F++K+ +    S+  G
Sbjct  224   VREQVALGLLFTQHISTEKQVANLFTKPMSKAALSNFQTKLCLQPQHSLREG  275



>emb|CAN65808.1| hypothetical protein VITISV_033389 [Vitis vinifera]
Length=1279

 Score =   212 bits (540),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 118/282 (42%), Positives = 173/282 (61%), Gaps = 3/282 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+EV  +  G+ +SQ +YT++ILK      AK V  P+     L    D   +  
Sbjct  996   LKYFLGIEVSRSKKGISISQRKYTLEILKDGGFLGAKPVNFPMEQNTKL---SDSGELLK  1052

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D + Y+R++G L YL+IT PD+ Y ++ LS+FMH P   H +A  RVLRYLK +   GL 
Sbjct  1053  DPSQYRRLVGRLIYLTITRPDITYSVHVLSRFMHAPRRPHMEAALRVLRYLKNSPGQGLF  1112

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                   L L AFSDSDW G     RSTTGY +F GS++ISWR+ RQK V+  S EAEYRA
Sbjct  1113  FPSQNDLSLRAFSDSDWAGCPISRRSTTGYCVFLGSSLISWRTKRQKTVSLSSAEAEYRA  1172

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +A    E+ W+ +LL+D+ ++ P   +L+CDN +A+++  N V+H R +H+ +D  F+R 
Sbjct  1173  MAGTCCELSWLRSLLKDLRILHPKPALLYCDNTAALHIAANPVFHERTRHIEMDCHFIRD  1232

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
              I +G++  +H+ +T Q+A + TK LG+  F     K+GV D
Sbjct  1233  KIQDGSVVTKHIASTBQLADVFTKPLGKETFSTMIHKLGVLD  1274



>gb|AID60162.1| copia-like LTR-retrotransposon [Brassica napus]
Length=643

 Score =   207 bits (528),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/279 (40%), Positives = 168/279 (60%), Gaps = 4/279 (1%)
 Frame = +1

Query  598   HFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAADA  777
             +FLG+E+  T +GLF+ QS Y  D+L + +M     + TP+ + +D      Q  +  + 
Sbjct  222   YFLGIEIEQTTEGLFIHQSAYAEDVLHQANMSTCNPMPTPLPTTLDTL----QEDLFPEP  277

Query  778   TVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLLR  957
             T ++ + G LQYL+I+ PD+ + +N + Q MH P +  +  +KR++RY++GT   G+ +R
Sbjct  278   TYFRSIAGKLQYLTISRPDIQFAVNFVCQRMHEPTVGDFGLLKRIMRYVRGTCSMGIHIR  337

Query  958   RSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyrala  1137
             +   + L+ F DSDW G  +  RST+G     GSN+ISW + RQ  V+  STEAEYRAL 
Sbjct  338   KQADMILSGFCDSDWSGCRETRRSTSGICTLLGSNLISWSAKRQDTVSGSSTEAEYRALT  397

Query  1138  naaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVHI  1317
              AA E+ W+  LL+D+G+      +L CDNLSA+Y+  N   H R KH   D+ ++R  +
Sbjct  398   AAAREISWLSYLLRDLGIHQMDPTLLQCDNLSAVYLSANPALHKRSKHFENDWHYIREQV  457

Query  1318  VNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
               G +  QH+ A  Q+A I TK L RR FE  R+K+GVS
Sbjct  458   ALGHIETQHISAKDQLADIFTKPLPRRQFEELRNKLGVS  496



>ref|XP_009359358.1| PREDICTED: uncharacterized protein LOC103949948 [Pyrus x bretschneideri]
Length=1243

 Score =   212 bits (539),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 134/329 (41%), Positives = 196/329 (60%), Gaps = 12/329 (4%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLGVEV      + L QS+Y +D+L + +  EAK + TP+ S   L     +S 
Sbjct  751   LGPLHYFLGVEVKYNGTAMHLCQSKYALDLLSRTNFTEAKPISTPVPSGHKLSAYVGESY  810

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D  VY+ V+G LQY++IT PD+ Y +N++ QFMH+P   HW AVKR+LRYLK T  H
Sbjct  811   DKPD--VYRSVVGALQYITITRPDLSYAVNQVCQFMHSPKTTHWMAVKRILRYLKATHTH  868

Query  943   GLLLRR-STQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTea  1119
             GLL +  STQ  ++AFSD+D+ G  +   ST G+ ++ GSN++SW S +QK V+  S EA
Sbjct  869   GLLYKPGSTQ--ISAFSDADYAGNPNSLHSTGGFCIYHGSNLVSWSSKKQKTVSWSSAEA  926

Query  1120  eyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYF  1299
             EYR LA  AAE+ W  +L +D+ + L   P + CDN+S++ +  N V+H+R KHL +DY 
Sbjct  927   EYRQLAYTAAELSWFRSLFKDLHLHL-DRPQIWCDNISSIALASNPVFHARTKHLEVDYH  985

Query  1300  FVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIKK*YY  1479
             +VR  +V G L V ++ +  Q+A + TKGL    F+   SK+ V      LRG +++  +
Sbjct  986   YVREKVVRGQLLVNYICSQDQLADLFTKGLSSSRFQSLVSKLPVVPQPVSLRGAVRQDQH  1045

Query  1480  WLLLFSHFVFKFTCLPY-----YSPLLVC  1551
               L+     F   C P+     + P L C
Sbjct  1046  AKLIAETCGFS-GCNPFLVSRVFKPNLSC  1073



>gb|AAO26684.1|AF478370_1 gag-pol polyprotein [Vitis vinifera]
Length=326

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/283 (39%), Positives = 164/283 (58%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+EV  +  G+FLSQ +Y +D+LK+    EAK   TP+V  V L    D   
Sbjct  39    LGELKYFLGIEVSRSKKGMFLSQRKYVLDLLKETGKIEAKPCTTPMVPNVQLM--PDDGD  96

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                +   Y+RV+G L YL++T PD+ Y ++ +SQF   P + HW A++++L YLK     
Sbjct  97    PFYNPERYRRVVGKLNYLTVTRPDIAYAVSVVSQFTSAPTIKHWAALEQILCYLKKAPGL  156

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             G+L        +  FSD+DW G     RSTTGY +FFG N+++W+S +Q  V+  S E+E
Sbjct  157   GILYSSQGHTRIECFSDADWAGSKFDRRSTTGYCVFFGGNLVAWKSKKQSVVSRSSAESE  216

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA++ A  E+IW+H LL ++G+       L CDN +A+++  N VYH R KH+ +D  F
Sbjct  217   YRAMSQATCEIIWIHQLLCEVGMKCTMPAKLWCDNQAALHIAANPVYHERTKHIEVDCHF  276

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             +R  I    +   +V    Q+  I TK L     E+F +K+G+
Sbjct  277   IREKIEENLVSTGYVKTGEQLGDIFTKALNGTRVEYFCNKLGM  319



>emb|CAN60203.1| hypothetical protein VITISV_036059 [Vitis vinifera]
Length=1412

 Score =   212 bits (540),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/311 (39%), Positives = 186/311 (60%), Gaps = 5/311 (2%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             ++S F+ +L S  +  +  L  +H+F+G+E+  T DGL LSQS Y   IL++ +M + K 
Sbjct  973   LVSTFIQLLSSEFAMKD--LGQIHYFIGIEISQTSDGLHLSQSHYAFTILERANMIDCKP  1030

Query  706   VRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLL  885
             + TP+ +     +    + +  D + ++ ++G LQYL++T PD+ Y +N  SQFMH P L
Sbjct  1031  MSTPLEAKT---KTSPNNVLLEDPSHFRGLVGALQYLTLTRPDLSYSVNYASQFMHAPTL  1087

Query  886   IHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNV  1065
             +H + V+R+LRY+KGT+  GL     T L L AFSD+DW G      S TGY  F G N+
Sbjct  1088  MHLKMVRRILRYVKGTIDIGLHFTSHTTLDLCAFSDADWAGXPTTXXSITGYCTFLGXNL  1147

Query  1066  ISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYV  1245
             ISW + +Q  +   STEAEYRA+A+  AE+ W+  +L D+   L  +P L+CDN SA+++
Sbjct  1148  ISWCAKKQHTIXXSSTEAEYRAMAHTXAELTWMSFILNDLHXPLAXTPTLYCDNTSALHM  1207

Query  1246  CQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
               N V+H+R KH+ LDY FVR  +  G L  QH+    Q+A + TK + +     F++K+
Sbjct  1208  TINPVFHARSKHIELDYHFVRERVALGLLVTQHISTEXQVADLFTKPMSKAALSXFQTKL  1267

Query  1426  GVSDGSSILRG  1458
              +    S+  G
Sbjct  1268  CLQPRHSLREG  1278



>ref|XP_002445301.1| hypothetical protein SORBIDRAFT_07g008525 [Sorghum bicolor]
 gb|EES14796.1| hypothetical protein SORBIDRAFT_07g008525 [Sorghum bicolor]
Length=659

 Score =   207 bits (528),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 121/286 (42%), Positives = 166/286 (58%), Gaps = 3/286 (1%)
 Frame = +1

Query  589   ALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVA  768
             ALHHFL V V    D LF+SQ QY +DIL +  M   K   TP+ +   L          
Sbjct  377   ALHHFLSVSVQRQCDSLFISQRQYILDILDRAGMLSCKPCSTPVDTHSKL---SADGAAV  433

Query  769   ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGL  948
              D + Y+ + G LQYL+ T PD+ Y + ++  +MH+P   H  A+KR+LRYL+GT+  GL
Sbjct  434   TDPSSYRSIAGALQYLTFTRPDIAYAVQQVCLYMHDPREPHLGAMKRILRYLQGTLDLGL  493

Query  949   LLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
              L R++ + L  ++D+DW G  D  +ST+GY +F   N+ISW   RQ  V+  S EAEYR
Sbjct  494   HLHRTSPVDLTVYTDADWAGYPDTRKSTSGYAVFLVDNLISWSFKRQPTVSRSSAEAEYR  553

Query  1129  alanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
             A+AN  AE  W+   LQ++   L  + V++CDN+SA+Y+  N V H R KH+ +D  FVR
Sbjct  554   AVANGVAEACWLRQQLQELHHPLRRATVVYCDNISAVYLSSNPVQHQRTKHIEIDLHFVR  613

Query  1309  VHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSS  1446
               +  G  RV HVP TSQ A   TKGL   +F  FRS + V    S
Sbjct  614   ERVALGEARVLHVPTTSQYADFFTKGLPTSVFTEFRSSLNVRGAPS  659



>ref|XP_010534024.1| PREDICTED: uncharacterized protein LOC104809678 [Tarenaya hassleriana]
Length=2364

 Score =   213 bits (541),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 110/283 (39%), Positives = 178/283 (63%), Gaps = 5/283 (2%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPI-VSPVDLFRPKDQSTVA  768
             L +FLG+EV  + DGLFLSQ +YT+D+L       AK  +TPI VS    ++ + +    
Sbjct  1890  LRYFLGIEVTRSNDGLFLSQRKYTLDLLGSAGKLGAKPAKTPIEVS----YKYQREGEPL  1945

Query  769   ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGL  948
              D+  Y++++G L YL+IT PD+ + + ++SQFMH P   HW+ V+R+L+YLKG+   G+
Sbjct  1946  EDSERYRKIVGKLIYLTITRPDLSFAVGQVSQFMHAPTTRHWEMVERILKYLKGSPGKGI  2005

Query  949   LLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyr  1128
              + R+ Q+ +  + D+DW G     +ST+GY  F G N+++W+S +Q  VA  S EAEYR
Sbjct  2006  WMSRNKQVDIVGYCDADWAGDQQDRKSTSGYCTFIGGNLVTWKSKKQNVVARSSAEAEYR  2065

Query  1129  alanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
             A+A AA+E++W+  LL D+G++  ++  LHCDN +A+++  N V+H R KH+ +D  F+R
Sbjct  2066  AMATAASELVWLKGLLGDLGIITDYAIPLHCDNQAAIHIAANQVFHERTKHIEIDCHFIR  2125

Query  1309  VHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
               +  G +   +  +  Q+A + TK    R  E+   K+GV+D
Sbjct  2126  EKVTQGIIATPYTRSEDQLADLFTKAPNVRNHENILVKLGVAD  2168



>ref|XP_010039234.1| PREDICTED: uncharacterized protein LOC104427926 [Eucalyptus grandis]
Length=851

 Score =   209 bits (531),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 122/297 (41%), Positives = 189/297 (64%), Gaps = 5/297 (2%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPI-VSPVDLFRPKDQS  759
             L +LH+FLG+E   T D LFL Q++Y +D+L +  M ++K V TP+ + P  L    + +
Sbjct  509   LRSLHYFLGIEATRTSDYLFLCQTKYALDLLTRAHMLDSKPVSTPLSLKPPVLI---NDT  565

Query  760   TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVF  939
                 + T Y+ ++G LQYL++T PD+ Y  N L Q M    +  +  +KRVLRY+KGT+ 
Sbjct  566   IPLTNPTEYRSLVGGLQYLTLTRPDIAYATNILCQRMQQLTIADFNHLKRVLRYIKGTLK  625

Query  940   HGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTea  1119
              GL L   + +HL  FSD+DW G  +  RSTTG+ ++ GSN+ISW + +Q +V+  STEA
Sbjct  626   LGLFLHSHSTMHLYGFSDADWAGCAETRRSTTGFCIYLGSNLISWAAKKQPSVSRSSTEA  685

Query  1120  eyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYF  1299
             EYRALA+A A++ WV  +L+D+G  L     L+CDN SA+ +  N V H+R KH+ +D+ 
Sbjct  686   EYRALASATADLTWVSFVLRDIGCSLTPPIHLYCDNKSAISLTLNPVLHARTKHIEVDFH  745

Query  1300  FVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGS-SILRGRIK  1467
             FVR  + +G+L+V+++P+  Q+A + TK L R    + R+K+G+   S   LRG ++
Sbjct  746   FVREKVSSGSLQVKYIPSPYQLADVFTKPLTRSSHSYMRTKLGICTLSIPNLRGDVR  802



>ref|XP_002457887.1| hypothetical protein SORBIDRAFT_03g018791 [Sorghum bicolor]
 gb|EES03007.1| hypothetical protein SORBIDRAFT_03g018791 [Sorghum bicolor]
Length=683

 Score =   207 bits (527),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 161/264 (61%), Gaps = 2/264 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L ALHHFLGV V P P GL + Q QYT+DIL++  M + K   TP+ +   +   + + T
Sbjct  419   LGALHHFLGVTVEPHPAGLLIHQGQYTLDILERAGMTDCKPCSTPLDTQGKIS--EAEGT  476

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D T Y+ + G LQYL+ T PD+ Y + ++   MH+P   H  A+KR+L YL+GTV  
Sbjct  477   PVTDPTAYRSLAGALQYLTFTRPDITYAVQQICLHMHDPREPHLTALKRILHYLRGTVDF  536

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GLL RRS+   L  ++D+DW G  D  RST+ Y +F G N++SW S RQ  V+  S EAE
Sbjct  537   GLLHRRSSSTELVVYTDADWAGCPDTRRSTSSYAVFLGGNLVSWSSKRQPVVSRSSAEAE  596

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+AN  AE  W+  LL ++ + L  S +++CDN+SA Y+  N V H R KH+ +D   
Sbjct  597   YRAVANGVAEASWLRQLLAELHIPLSRSALVYCDNVSAGYLSTNPVQHQRTKHVEIDLHL  656

Query  1303  VRVHIVNGTLRVQHVPATSQIAAI  1374
             VR  +  G +RV HVP TSQ   I
Sbjct  657   VRDRVAVGDVRVLHVPTTSQFTDI  680



>emb|CAN83877.1| hypothetical protein VITISV_014760 [Vitis vinifera]
Length=707

 Score =   207 bits (527),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 176/282 (62%), Gaps = 5/282 (2%)
 Frame = +1

Query  592   LHHFLGVEV-IPTPDGLFLS-QSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTV  765
             LH FL  EV +  P G     Q++Y +D+L++  M +AK + TP V    L       T+
Sbjct  410   LHGFLNEEVYMEQPPGYTDPYQTKYDLDLLQRASMIDAKPISTPFVVGQHL---SVGGTL  466

Query  766   AADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHG  945
              +D T+++ + G LQYL+IT PD+ + +N + QF+H P   H+ A+KR+LRY+KGT  HG
Sbjct  467   FSDPTLFRSLAGALQYLTITRPDLSFSVNSICQFIHAPTEDHFHALKRILRYVKGTAHHG  526

Query  946   LLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaey  1125
             L L + +   L  +SDSDW G  D  RSTTGY +FFG+N+ISW S +Q  V+  S EAEY
Sbjct  527   LQLHKQSTRDLLGYSDSDWAGCPDTRRSTTGYAIFFGANLISWSSKKQSIVSRSSAEAEY  586

Query  1126  ralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFV  1305
             R+LA A A++ W+  LL+D+ V L   P + CDN S +++  N +   R KH+A+DY FV
Sbjct  587   RSLAIATADIAWIIQLLRDLHVTLSVPPKILCDNQSTIFMAVNPITRPRSKHIAIDYHFV  646

Query  1306  RVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             R  +  GTL++  VP+  Q+A  LTKG+ +  F  FRSK+ V
Sbjct  647   RELVDKGTLKIDFVPSHLQLADSLTKGVTKPQFYLFRSKLSV  688



>emb|CAN64963.1| hypothetical protein VITISV_002891 [Vitis vinifera]
Length=1318

 Score =   211 bits (537),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 180/269 (67%), Gaps = 2/269 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L++FLG+E+  + DGL+++Q++Y  D+L +  + ++K V TP+   V L   + +    +
Sbjct  1036  LNYFLGLEITHSTDGLYITQAKYASDLLSQAGLTDSKTVDTPVELNVHLTPSRGKPL--S  1093

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             + ++Y+R++G L YL++T PD+ Y ++++SQ++  P   H+ AV  +LRYLKGT+FHGL 
Sbjct  1094  NPSLYRRLVGSLVYLTVTRPDISYAVHQVSQYLSAPRSTHYAAVLCILRYLKGTLFHGLF  1153

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                 + L L AFSD+DW G     RSTTGY    GS++ISWRS +Q  VAH STEAEYRA
Sbjct  1154  YSAQSPLVLRAFSDADWAGDPIDHRSTTGYCFLLGSSLISWRSKKQTFVAHSSTEAEYRA  1213

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA+  +E++W+  LL+D+GV    +  L+CDN SA+++  N V+H R KH+ +D  F+R 
Sbjct  1214  LADTTSELLWLRWLLKDLGVSTSSATPLYCDNQSAIHIAHNDVFHERTKHIDIDCHFIRY  1273

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRR  1398
             H+++G L++  V +  Q+A I TK L +R
Sbjct  1274  HLIHGALKLFSVSSKDQLADIFTKSLPKR  1302



>emb|CAN70115.1| hypothetical protein VITISV_020105 [Vitis vinifera]
Length=642

 Score =   206 bits (524),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 115/283 (41%), Positives = 168/283 (59%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+E+  +  G+ +SQ +Y +D+L +  M   K   TP+ S V L   +   +
Sbjct  355   LGNLKYFLGMEIARSKKGIAVSQRKYVLDLLNETGMLGCKPAETPMGSTVKL--EESDGS  412

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D   YQR++G L YLS T PD+ + ++ +SQFM+NP   H  AV R+LRYLK T   
Sbjct  413   APVDKGRYQRLVGKLIYLSHTRPDIGFSVSVVSQFMNNPTKKHMTAVIRILRYLKMTPGK  472

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL  +R+T+  +  FSD+DW G     RST+GY  F   N+++WRS +Q  VA  S EAE
Sbjct  473   GLFFQRTTKKEIEIFSDADWAGSVTDRRSTSGYCSFVWGNLVTWRSKKQSVVARSSAEAE  532

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             +RA+A    E IW++ LL+++ V L H  VL+CDN +A+ + +N V+H R KH+ +D  F
Sbjct  533   FRAMAQGICEGIWLNRLLEELRVPLKHPMVLYCDNQAAISIAKNPVHHDRTKHVEIDRHF  592

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             ++  I  G  +V + P   Q A ILTK L R  FE    K+G+
Sbjct  593   IKEKIEEGVFKVSYTPTNCQTADILTKALTRVNFEDLTEKLGM  635



>gb|AID60119.1| hypothetical protein [Brassica napus]
Length=848

 Score =   208 bits (529),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 111/279 (40%), Positives = 168/279 (60%), Gaps = 4/279 (1%)
 Frame = +1

Query  598   HFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAADA  777
             +FLG+E+  T +GLF+ QS Y  D+L + +M     + TP+ + +D      Q  +  + 
Sbjct  503   YFLGIEIEQTTEGLFIHQSAYAEDVLHQANMSTCNPMPTPLPTTLDTL----QEDLFPEP  558

Query  778   TVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLLR  957
             T ++ + G LQYL+I+ PD+ + +N + Q MH P +  +  +KR++RY++GT   G+ +R
Sbjct  559   TYFRSIAGKLQYLTISRPDIQFAVNFVCQRMHEPTVGDFGLLKRIMRYVRGTCSMGIHIR  618

Query  958   RSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyrala  1137
             +   + L+ F DSDW G  +  RST+G     GSN+ISW + RQ  V+  STEAEYRAL 
Sbjct  619   KQADMILSGFCDSDWSGCRETRRSTSGICTLLGSNLISWSAKRQDTVSGSSTEAEYRALT  678

Query  1138  naaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVHI  1317
              AA E+ W+  LL+D+G+      +L CDNLSA+Y+  N   H R KH   D+ ++R  +
Sbjct  679   AAAREISWLSYLLRDLGIHQMDPTLLQCDNLSAVYLSANPALHKRSKHFENDWHYIREQV  738

Query  1318  VNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVS  1434
               G +  QH+ A  Q+A I TK L RR FE  R+K+GVS
Sbjct  739   ALGHIETQHISAKDQLADIFTKPLPRRQFEELRNKLGVS  777



>gb|AAO26683.1|AF478369_1 gag-pol polyprotein [Vitis vinifera]
Length=326

 Score =   198 bits (504),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 109/283 (39%), Positives = 163/283 (58%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+EV  +  G+FLSQ +Y +D+LK+    EAK   TP+V  V L    D   
Sbjct  39    LGELKYFLGIEVSRSKKGMFLSQRKYVLDLLKETGKIEAKPCTTPMVPNVQLM--PDDGD  96

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                +   Y+RV+G L YL++T PD+ Y ++ +SQF   P + HW A++++L YLK     
Sbjct  97    PFYNPERYRRVVGKLNYLTVTRPDIAYAVSVVSQFTSAPTIKHWAALEQILCYLKKAPGL  156

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             G+L        +  FSD+DW G     RSTTGY +FFG N+++W+S +Q  V+  S E+E
Sbjct  157   GILYSSQGHTRIECFSDADWAGSKFDRRSTTGYCVFFGGNLVAWKSKKQSVVSRSSAESE  216

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA++ A  E+IW+H LL ++G+       L CDN +A+++  N VYH R KH+ +D  F
Sbjct  217   YRAMSRATCEIIWIHQLLCEVGMKCTMPAKLWCDNQAALHIAANPVYHERTKHIEVDCHF  276

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             +R  I    +   +V    Q+  I TK L     E F +K+G+
Sbjct  277   IREKIEENLVSTGYVKTGEQLGDIFTKALNGTRVECFCNKLGM  319



>emb|CAE03643.1| OSJNBa0060N03.8 [Oryza sativa Japonica Group]
Length=343

 Score =   199 bits (505),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 110/285 (39%), Positives = 170/285 (60%), Gaps = 3/285 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+E+  +  G+ LSQ +Y +D+L    M   +   TPI     L     QS 
Sbjct  57    LGPLRYFLGIEIARSSKGIVLSQRKYVLDLLTDTGMLGCRASTTPIDRNHQLCA---QSG  113

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D   YQR++G L YL  T PD+ Y ++ +S++MH+P   H   V ++LRYLKGT   
Sbjct  114   DPVDKEAYQRLVGRLIYLCHTRPDISYAVSVVSRYMHDPRTGHLDVVHKILRYLKGTPGK  173

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL   ++  L++  + D+DW    D  RST+GY +F G N++SWRS +Q  VA  + EAE
Sbjct  174   GLWFMKNGHLNVEGYCDADWASSMDDRRSTSGYYVFVGGNLVSWRSKKQAVVARSTAEAE  233

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+A + +E++W+ +L  ++ V+   + +LHCDN SA+ +  N V H R KH+ +D FF
Sbjct  234   YRAMALSLSEMLWMRSLFTELRVLRSDTVMLHCDNRSAISIANNPVQHDRTKHVEIDRFF  293

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
             ++  I +G LR++++ +  Q+A  LTKGLG    +   +KMG+ D
Sbjct  294   IKEKINSGVLRLEYIKSCEQLADYLTKGLGPSEIQSICNKMGMID  338



>gb|KDP32454.1| hypothetical protein JCGZ_13379 [Jatropha curcas]
Length=254

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 158/249 (63%), Gaps = 1/249 (0%)
 Frame = +1

Query  718   IVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQ  897
             + +P++L     ++  + DAT+Y+ ++G LQYL++T PD+ + +N +SQFM +P ++H +
Sbjct  1     MTTPLELKPSVTKAAASVDATLYRSIVGALQYLTLTRPDIAFAVNFVSQFMQDPTVVHMK  60

Query  898   AVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWR  1077
              + R+ RY+KGT+ HGL     + + L  F+D+DW G     RSTTGY  F+GSN+ISW 
Sbjct  61    FLHRIKRYVKGTLTHGLYFTSHSTMQLHGFADADWAGCPVTRRSTTGYCTFWGSNLISWC  120

Query  1078  SVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNL  1257
             + +Q  V+  STEAEYRA+A+ A E+ W+  LL+D  + L +  VL CDNLSA+Y+  N 
Sbjct  121   AKKQHTVSQSSTEAEYRAMAHTAVELTWLTYLLKDFAIPLTNPSVLFCDNLSALYLTVNP  180

Query  1258  VYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
             V+H+R KH+ LDY FVR  +  G L  +HVP T QI  I  K + +     F SK+ +  
Sbjct  181   VFHARSKHIELDYHFVRERVAQGNLVTKHVPTTQQITDIFMKPIHKSALALFHSKLHLGP  240

Query  1438  GSSILRGRI  1464
               S LRG +
Sbjct  241   RPS-LRGDV  248



>ref|XP_010065142.1| PREDICTED: uncharacterized protein LOC104452376 [Eucalyptus grandis]
Length=1169

 Score =   209 bits (532),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 126/300 (42%), Positives = 184/300 (61%), Gaps = 15/300 (5%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV  T   LFLSQ++Y +D+L + +M + + V TP+       RP   + +  
Sbjct  620   LHYFLGIEVKQTTQDLFLSQTKYALDLLTRANMKDCRPVSTPLS-----LRP---AAIIT  671

Query  772   DATV------YQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGT  933
             D  +      Y+ ++G LQYL+IT PD+ Y  N L Q M  P L  +  +KRVLRY+KGT
Sbjct  672   DDILLQHPLEYRSLVGGLQYLTITRPDIAYATNLLCQKMQQPTLGDFHKLKRVLRYVKGT  731

Query  934   VFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFST  1113
             V  GL +  ++ +HL  F+D+DW G     RSTTG+  + GSN+ISW + RQ  V+  ST
Sbjct  732   VTLGLTIHSNSFMHLYGFADADWAGCSTTRRSTTGFCTYLGSNLISWSAKRQSTVSRSST  791

Query  1114  eaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALD  1293
             EAEYRALA+A A++ WV  +L+D+G+ L     L CDN SA+ +  N V H+R KH+ +D
Sbjct  792   EAEYRALASATADLTWVSFVLRDIGIGLSAPTSLFCDNKSAIALSLNPVLHARTKHIEVD  851

Query  1294  YFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD-GSSILRGRIKK  1470
             + FVR  + +G+L V ++P+  Q+A I TK L R L    R+K+G+       LRG +K+
Sbjct  852   FHFVREKVASGSLIVSYIPSARQLADIFTKSLPRYLHFSLRTKLGLGYLPPPNLRGDVKE  911



>gb|ABA99152.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=989

 Score =   207 bits (528),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/286 (43%), Positives = 173/286 (60%), Gaps = 8/286 (3%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LHHFLG++V      LFLSQ QY ++IL +  M E K    P  +PVD   PK  + 
Sbjct  693   LGKLHHFLGMQVQHRNGCLFLSQQQYMMEILDRAGMAECK----PCSTPVDT-NPKLSAV  747

Query  763   VA---ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGT  933
                   D + ++ +   LQYL+ T PD+ Y + ++   MH+P   H  A+K +L Y++GT
Sbjct  748   TGDPVQDPSDFRSLAIALQYLTFTRPDIAYAVQQVCLHMHDPREPHLAALKWILWYVRGT  807

Query  934   VFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFST  1113
             +  GL+LR + Q  L A+SD+DW G  D  +ST+GY +F G N+ISW S RQ  V+  S 
Sbjct  808   LHLGLVLRPTAQHELIAYSDADWAGCPDTRKSTSGYAVFLGDNLISWSSKRQNTVSRSSA  867

Query  1114  eaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALD  1293
             EAEY A+ANA AE  W+H LL ++   L  + +++CDN+SA+Y+  N V H R KH+ +D
Sbjct  868   EAEYHAVANAVAEASWLHQLLSELQSPLQRATLVYCDNISAVYMSANPVQHQRTKHIEID  927

Query  1294  YFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
               FVR H+  G +RV HVP TSQ A I TKG+   LF  F++ + V
Sbjct  928   LHFVREHVALGAVRVLHVPTTSQDADIFTKGVPSSLFTEFKTSLNV  973



>ref|XP_002446435.1| hypothetical protein SORBIDRAFT_06g016046 [Sorghum bicolor]
 gb|EES10763.1| hypothetical protein SORBIDRAFT_06g016046 [Sorghum bicolor]
Length=856

 Score =   207 bits (526),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/267 (44%), Positives = 162/267 (61%), Gaps = 2/267 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LHHFLGV V    D L LSQ QYT+DIL +  M + K   TP+ +   +    D   
Sbjct  579   LGPLHHFLGVAVQRHKDQLTLSQRQYTLDILARHGMSDCKPCTTPVDTCAKVS--ADAGP  636

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               AD T Y+ + G LQYL+ T PD+ Y + ++   MH+P   H  A KR+LRYL+GT+  
Sbjct  637   AVADPTAYRSLAGALQYLTFTRPDIAYAVQQICLHMHDPREAHLVAAKRILRYLQGTLHF  696

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL++ RS    L  ++D+DW G  D  RST+GY +F G +++SW S RQ  V+  S EAE
Sbjct  697   GLIIPRSAPTQLVVYTDADWAGCPDTRRSTSGYAVFLGGSLVSWSSKRQPTVSRSSAEAE  756

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+AN  AEV W+  LLQ++   L  + +++CDN+SA+Y+  N + H R KH+ +D  F
Sbjct  757   YRAVANGVAEVSWLQQLLQELHHPLQSASIVYCDNVSAVYLSSNPIQHQRTKHVEIDLHF  816

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTK  1383
             VR  +  G +RV HVP TSQ A +  K
Sbjct  817   VRERVAIGAVRVLHVPTTSQFADVFPK  843



>emb|CAN62227.1| hypothetical protein VITISV_008101 [Vitis vinifera]
Length=514

 Score =   202 bits (514),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 119/284 (42%), Positives = 172/284 (61%), Gaps = 4/284 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             LV LH+FL VEV     GLFLSQ++Y  D L+   M  AK +  P V    L     +  
Sbjct  214   LVDLHYFLNVEVQANEKGLFLSQTKYAFDPLQCASMINAKPISIPCVVDQHL---STEGK  270

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             + +D T++  + G LQYL+IT  D+ + +N + QFMH P   H++A+KR+LRY+KGT  H
Sbjct  271   LFSDPTMFHSLAGALQYLTITRSDLSFSVNSICQFMHAPTEDHFRALKRILRYVKGTPHH  330

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYV-LFFGSNVISWRSVRQKAVAHFSTea  1119
             GL L + +   + A+SD+DW G  D  R TTGY   FF +N++S  S +Q  V+  S EA
Sbjct  331   GLQLHQQSTHDILAYSDADWAGCPDTYRCTTGYANFFFCTNLVSCSSKKQSIVSQSSAEA  390

Query  1120  eyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYF  1299
             EYR+LA A  ++ W+  LL+D+ V L  +P + CDN SA+++  N V     KH+A+DY 
Sbjct  391   EYRSLAIATVDIAWIVQLLRDLHVTLSTTPKILCDNQSAIFMAVNPVTCPHSKHIAIDYH  450

Query  1300  FVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             FVR  + NGT +V  +P+  Q+A  LTKG+ +  F  FR K+ +
Sbjct  451   FVRELVANGTSKVDFIPSHLQLADSLTKGVTKPQFFLFRCKLSI  494



>gb|KHN22040.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1417

 Score =   209 bits (533),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 181/287 (63%), Gaps = 7/287 (2%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDG-LFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQS  759
             L  + +FLG+EV   P G L L+Q++Y  D+L K  M ++  + +P+VS   L   K  S
Sbjct  1134  LGQIDYFLGIEVHHLPSGALLLNQTKYIRDLLCKAHMEDSAPIGSPMVSSCRL--SKYGS  1191

Query  760   TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVF  939
                 D T+Y+ ++G LQY ++T PD+ + +N++ QFM +PL  HW+AVKR+LRYL GT+ 
Sbjct  1192  DTMTDPTLYRSIVGALQYATLTRPDIAFSVNKVCQFMAHPLESHWKAVKRILRYLNGTLS  1251

Query  940   HGLLLR---RSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFS  1110
             HGLLL     S    L A+SD+DW    D  RST+G  ++FG N+ISW S +Q+ VA  S
Sbjct  1252  HGLLLTPSPTSPPFSLRAYSDADWATDQDDRRSTSGSCIYFGPNLISWGSKKQQLVARSS  1311

Query  1111  TeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLAL  1290
             TEAEYR++AN  A+++W+ +LL+++ V    +P L CDNLSA+ +  N + HS+ KH+ L
Sbjct  1312  TEAEYRSMANTTADLLWIQSLLRELQVPF-LTPTLLCDNLSAVSLSHNPILHSKTKHIEL  1370

Query  1291  DYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             D  FVR  +++  L + HVPA  Q+A  LTK L        R+K+ V
Sbjct  1371  DIHFVREKVLSKQLNILHVPAQDQLADPLTKPLSPSQHTAIRTKLKV  1417



>gb|KHN36156.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1417

 Score =   209 bits (533),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 181/287 (63%), Gaps = 7/287 (2%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDG-LFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQS  759
             L  + +FLG+EV   P G L L+Q++Y  D+L K  M ++  + +P+VS   L   K  S
Sbjct  1134  LGQIDYFLGIEVHHLPSGALLLNQTKYIRDLLCKAHMEDSAPIGSPMVSSCRL--SKYGS  1191

Query  760   TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVF  939
                 D T+Y+ ++G LQY ++T PD+ + +N++ QFM +PL  HW+AVKR+LRYL GT+ 
Sbjct  1192  DTMTDPTLYRSIVGALQYATLTRPDIAFSVNKVCQFMAHPLESHWKAVKRILRYLNGTLS  1251

Query  940   HGLLLR---RSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFS  1110
             HGLLL     S    L A+SD+DW    D  RST+G  ++FG N+ISW S +Q+ VA  S
Sbjct  1252  HGLLLTPSPTSPPFSLRAYSDADWATDQDDRRSTSGSCIYFGPNLISWGSKKQQLVARSS  1311

Query  1111  TeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLAL  1290
             TEAEYR++AN  A+++W+ +LL+++ V    +P L CDNLSA+ +  N + HS+ KH+ L
Sbjct  1312  TEAEYRSMANTTADLLWIQSLLRELQVPF-LTPTLLCDNLSAVSLSHNPILHSKTKHIEL  1370

Query  1291  DYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             D  FVR  +++  L + HVPA  Q+A  LTK L        R+K+ V
Sbjct  1371  DIHFVREKVLSKQLNILHVPAQDQLADPLTKPLSPSQHTAIRTKLKV  1417



>ref|XP_006493639.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
Length=1668

 Score =   209 bits (533),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 123/299 (41%), Positives = 179/299 (60%), Gaps = 10/299 (3%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+EV+   D ++LSQ +Y  D+L KVDM E K V TP+ S  D    K Q  V  
Sbjct  194   LSYFLGIEVLYDQDCIYLSQKKYIRDLLAKVDMLECKRVTTPMCSGKD---SKLQKVVKG  250

Query  772   -------DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKG  930
                    DAT Y+ ++G LQYL +T P++ Y +++LSQ++  P + H  A KRVL+YLK 
Sbjct  251   ELGYYVEDATHYRSIVGGLQYLILTRPEIAYSVHKLSQYVSAPTMQHLMACKRVLKYLKE  310

Query  931   TVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFS  1110
             T  +GL   +   L + AF+D DWG   D  +S   Y ++ G+N+ISW S +Q  V   S
Sbjct  311   TQDYGLKFVKDGDLKITAFTDVDWGSDLDDRKSIGAYCVYLGNNLISWSSKKQTVVTKSS  370

Query  1111  TeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLAL  1290
              E+EYRA A+AA+E+ W+ +L  +M V     P + CDN+SA  + +N V+HSR KH+ +
Sbjct  371   AESEYRAFASAASEIAWLKSLFLEMEVYCVERPTIWCDNISATELAKNPVFHSRTKHIEI  430

Query  1291  DYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
             D  F+R  +++G L++ +VP+  QIA ILTK L    F + R K+ V      LRG +K
Sbjct  431   DVHFIRDKVLSGDLKICYVPSEDQIADILTKPLSSPQFNYLRDKLNVFSCPLSLRGAVK  489



>emb|CAN75041.1| hypothetical protein VITISV_027174 [Vitis vinifera]
Length=1381

 Score =   209 bits (532),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 179/274 (65%), Gaps = 12/274 (4%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPI-----VSPVDLFRPKDQ  756
             L +FLG+E+  + DGL+++Q++Y  D+L +  + ++K V TP+     ++P+        
Sbjct  1099  LSYFLGLEITHSTDGLYITQAKYASDLLSQAGLTDSKTVDTPVELNAHLTPLG-------  1151

Query  757   STVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTV  936
                 ++ ++Y+R++G L YL++T PD+ Y ++++SQ++  P   H+ AV R+LRYLKGT+
Sbjct  1152  GKPLSNPSLYRRLVGSLVYLTVTRPDISYAVHQVSQYLSAPRSTHYAAVLRILRYLKGTL  1211

Query  937   FHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTe  1116
             FHGL     + L L AFSD+DW G     RSTTGY    GS++ISWRS +Q  VA  STE
Sbjct  1212  FHGLFYSAQSPLILXAFSDADWAGDPTDRRSTTGYCFLLGSSLISWRSKKQTFVARSSTE  1271

Query  1117  aeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDY  1296
             AEYRALA+  +E++W+  LL+D+GV    +  L+CDN SA+++  N V+H R KH+ +D 
Sbjct  1272  AEYRALADTTSELLWLRWLLKDLGVSTSSATPLYCDNQSAIHIAHNDVFHERTKHIEIDC  1331

Query  1297  FFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRR  1398
              F+R H+++G L++  V +  Q+A I TK L +R
Sbjct  1332  HFIRYHLLHGALKLFSVSSKDQLADIFTKSLPKR  1365



>emb|CAN59963.1| hypothetical protein VITISV_022756 [Vitis vinifera]
Length=530

 Score =   202 bits (515),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/295 (40%), Positives = 175/295 (59%), Gaps = 9/295 (3%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQS-  759
             L  L  FLG++       L L+Q +Y  D+LK+  M  +K    P  +P  L R   QS 
Sbjct  209   LXPLXXFLGIQAHQLGSVLHLTQHKYIXDLLKRTQMETSK----PAPTPGRLGRTLSQSD  264

Query  760   -TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTV  936
                 +D + Y+R +G LQY+++  PD+ + +N+  QFM  P  +HW AVKR+LRYLKGT+
Sbjct  265   GVSLSDPSEYRRTVGALQYVTLXRPDIAFAVNKXCQFMAKPSDVHWMAVKRILRYLKGTI  324

Query  937   FHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTe  1116
               GL  + +  + L  +SD+DW    D  RST+GY +F GSN+I W S +Q+ V+  S E
Sbjct  325   HLGLHFQPAASMELQGYSDADWASCPDDRRSTSGYCVFLGSNLIFWSSSKQRLVSKSSAE  384

Query  1117  aeyralanaaaeVIWVHNLLQDMGVVLPHS-PVLHCDNLSAMYVCQNLVYHSRMKHLALD  1293
             + YR L +  AE++W+ +LLQ++   LP S P+L CDN SA ++  N V+HSR KH+ LD
Sbjct  385   SXYRGLVSLTAELVWIQSLLQEL--CLPTSPPILWCDNQSAAHLAANPVFHSRSKHIELD  442

Query  1294  YFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
               F+R  ++   L++ +VP+  Q+A I TK L    F + RSK+ V+     L+G
Sbjct  443   LHFIREXVLRQELQICYVPSGDQLADIFTKHLPITQFCNLRSKLTVTYPPLSLKG  497



>emb|CAE05417.1| OSJNBa0035I04.5 [Oryza sativa Japonica Group]
 emb|CAE05956.3| OSJNBb0088C09.15 [Oryza sativa Japonica Group]
Length=1246

 Score =   209 bits (531),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 119/282 (42%), Positives = 170/282 (60%), Gaps = 2/282 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH FLG+ V  TPD LFLSQ QY +D+L++  M E     TP+ +   L     +    A
Sbjct  958   LHFFLGISVRRTPDDLFLSQRQYAVDLLQRAGMSEYHPTATPVDARAKLS--ASEGAPVA  1015

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ +   LQYL++T P++ Y + ++ +FMH+P   H   VKR++RY+KG++  GL 
Sbjct  1016  DPTEYRSLADALQYLTLTRPEIAYAVQQVCRFMHDPHEPHLALVKRIMRYIKGSLSAGLH  1075

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             +       L A+SD+DW G  D  RST+GY +F G N++SW S RQ  V+  S EAEYRA
Sbjct  1076  IGTGPVGSLTAYSDADWAGCPDSRRSTSGYCIFLGDNLVSWSSKRQTTVSRSSAEAEYRA  1135

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +A+A AE   +  LLQ++   +  + V+ CDN+SA Y+  N V+H   KH+ +D  FVR 
Sbjct  1136  VAHAIAECCCLRQLLQELHAPISTTTVVFCDNVSAAYMTANPVHHRCTKHIEIDIHFVRE  1195

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
              +  G +RV HVP+T Q    +TKGL  +LF  FRS + V D
Sbjct  1196  KVALGQVRVLHVPSTHQFPDFMTKGLPVQLFTDFRSSLCVRD  1237



>gb|ABA97658.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1597

 Score =   209 bits (533),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 124/283 (44%), Positives = 171/283 (60%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L ALHHFLGV V     GL L Q QY++DIL++  M + K   T +V         D   
Sbjct  1306  LGALHHFLGVTVTRRDTGLLLHQRQYSLDILERPGMTDCKPCAT-LVDTCAKLSSTDAPP  1364

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             VA D T Y+ + G LQYL+ T PD+ Y + ++   MH+P  +H  A+KR+LRY++GT+  
Sbjct  1365  VA-DPTDYRSLAGALQYLTFTRPDISYAVQQVCLHMHDPREVHLAALKRILRYVRGTIDL  1423

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL ++RS    L   SD+DW G  D  +ST+GY +F G N++SW S RQ  V+  S EAE
Sbjct  1424  GLHIQRSQATDLVVCSDADWAGCPDTRKSTSGYAVFLGDNLVSWSSKRQNTVSRSSAEAE  1483

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+ANA AE  W+  LL ++      + +++CDN+SA+Y+  N V H R KH+ +D  F
Sbjct  1484  YRAVANAVAEASWLRQLLHELHSPPSKATLVYCDNVSAVYLSSNPVQHQRTKHVKIDLHF  1543

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +  G +RV HVP +SQ A I TKGL   +F  FRS + V
Sbjct  1544  VRDKVALGAVRVLHVPTSSQYADIFTKGLPSPVFVEFRSSLNV  1586



>emb|CAN83125.1| hypothetical protein VITISV_015109 [Vitis vinifera]
Length=1355

 Score =   209 bits (532),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/286 (41%), Positives = 177/286 (62%), Gaps = 5/286 (2%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+EV  +  GLFL+Q +YTID+L+  +M  +K   TP  S + L +  D   
Sbjct  1069  LGPLKYFLGIEVATSRKGLFLNQRKYTIDLLRDSNMLNSKPANTPFDSKLQLDKLGDP--  1126

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                    YQ+++G L YL+IT PD+ + ++ +SQ+MH P ++H   VKR+LRYLK T+  
Sbjct  1127  -LDSPNYYQKLVGKLIYLTITRPDISFAVSLVSQYMHAPTVVHLCMVKRILRYLKKTIGR  1185

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             G+++RR+    +  FSDSDW G     RSTTGY +F G N++SW+S +Q  VA  S EAE
Sbjct  1186  GIVMRRNGHXDIIGFSDSDWAGNTIDRRSTTGYCMFVGGNLVSWKSKKQPVVARSSAEAE  1245

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPV-LHCDNLSAMYVCQNLVYHSRMKHLALDYF  1299
             YRA+A A+ E++W+ NLL D+G   P SP+ L CDN +AM++  N V+H R KH+ +D  
Sbjct  1246  YRAMAAASCEMVWLKNLLTDLGFS-PTSPMKLFCDNQAAMHIAANPVFHERTKHIEVDCH  1304

Query  1300  FVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
             F+R  + +  ++  ++ ++ Q+A   TK L   +F     K+G  D
Sbjct  1305  FIRQQVQSKVIQTHYIRSSDQLADAFTKVLSSTVFHRLMFKLGSID  1350



>emb|CAN80320.1| hypothetical protein VITISV_034560 [Vitis vinifera]
Length=1261

 Score =   209 bits (531),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 177/269 (66%), Gaps = 2/269 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+E+  + DGL+++Q++Y  ++L +  + ++K V TPI     L  P     ++ 
Sbjct  990   LSYFLGLEITHSTDGLYITQAKYASNLLSQAGLTDSKTVDTPIELNAHL-TPSGGKPLS-  1047

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             + ++Y+R++G L YL++T PD+ YV++++SQ+   P   H+ AV R+LRYLKGT+FHGL 
Sbjct  1048  NPSLYRRLVGSLVYLTVTRPDISYVVHQVSQYFSAPRSTHYAAVLRILRYLKGTLFHGLF  1107

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                 + L L AFSD+DW G     RSTTGY    GS++ISWRS +Q  VA  +TEAEYRA
Sbjct  1108  YSAQSPLVLRAFSDADWAGDPTDRRSTTGYCFLLGSSLISWRSKKQTFVARSNTEAEYRA  1167

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LAN  +E+ W+  LL+D+GV    +  L+CDN SA+++  N V+H R KH+ +D  F+R 
Sbjct  1168  LANTTSELFWLRWLLKDLGVSTSSATPLYCDNQSAIHIAHNNVFHERTKHIEIDCHFIRY  1227

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRR  1398
             H+V+G L++  V +  Q+A I TK L +R
Sbjct  1228  HLVHGALKLFSVSSKDQLADIFTKSLPKR  1256



>gb|AAG09097.1|AC009323_8 Putative retroelement polyprotein [Arabidopsis thaliana]
Length=1486

 Score =   209 bits (532),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 175/282 (62%), Gaps = 2/282 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+EV  +P+G++L Q +Y +DI+ +  +   K    P+     L     ++    
Sbjct  1202  LRYFLGIEVARSPEGIYLCQRKYALDIITETGLLGVKPASFPLDQNHKLAFATGETI--D  1259

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D   Y+R++G + YL+ T P++ YVI+ LSQFMHNP   HW+A  RV+RYLK +   G+L
Sbjct  1260  DPLRYRRLVGRIIYLATTRPELSYVIHILSQFMHNPKPAHWEAALRVVRYLKSSPGQGIL  1319

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             LR +T L L+A+ DSD+G      RS TG+ +  G + +SW++ +Q  V+  S EAEYRA
Sbjct  1320  LRANTPLVLSAWCDSDFGACPHSDRSLTGWFIQLGGSPLSWKTQKQNVVSRSSAEAEYRA  1379

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +A   +E+IW+  LL  +G+       LH D+LSA+ +  N VYH+R KH+  D  F+R 
Sbjct  1380  MAETVSEIIWIRELLPALGIPCTAPTTLHSDSLSAISLAANPVYHARTKHVRRDVHFIRD  1439

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
              +VNGT+  +HV  TSQ+A ILTK LGR+ F  F +K+G+ +
Sbjct  1440  ELVNGTIATKHVSTTSQLADILTKALGRKEFADFLAKLGICN  1481



>gb|ABF94964.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=846

 Score =   206 bits (524),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 168/280 (60%), Gaps = 12/280 (4%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+E             +Y  D+L++V+M + K V TP+ +   L   +       
Sbjct  576   LHYFLGIE------------DKYACDLLRRVNMFDCKPVSTPLSTSEKLSAHEGDLLGPL  623

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DAT Y+ V+G LQYL++T PD+ + +N++ QF+H P  IHW AVKR+LRYLK     GL 
Sbjct  624   DATNYRSVVGALQYLTLTRPDIAFPVNKVCQFLHAPTTIHWVAVKRILRYLKHCTKLGLK  683

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             L +S  + ++A+SD+DW G  D  RST G+ +F G N++SW + +Q  V+  STE+EY+A
Sbjct  684   LCKSKSMLVSAYSDADWAGSLDDRRSTGGFAVFLGDNLVSWCARKQATVSRSSTESEYKA  743

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA AE++WV  LL ++ V  P    L CDNL A Y+  N V+H+R KH+ +DY FVR 
Sbjct  744   LANATAEIMWVQTLLTELQVQSPPMAKLWCDNLGAKYLSSNPVFHTRTKHIEVDYHFVRE  803

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
              +    L +  VP   Q+A   TK L  R  E+F+  + +
Sbjct  804   RVSQKLLEIDFVPTGDQVADGFTKALPVRQLENFKHNLNL  843



>emb|CAN78451.1| hypothetical protein VITISV_005945 [Vitis vinifera]
Length=773

 Score =   206 bits (523),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 119/295 (40%), Positives = 177/295 (60%), Gaps = 9/295 (3%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQS-  759
             L  L +FLG++       L L+Q +Y  D+L +  M  +K    P  +P  L R   QS 
Sbjct  429   LGPLSYFLGIQAQQLGSVLHLNQHKYIADLLNRTQMETSK----PAPTPGRLGRTLSQSD  484

Query  760   -TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTV  936
                 +D + Y+R +G LQY+++T PD+ + +N+  QFM  P  +HW AVKR+LRYLKGT+
Sbjct  485   GVSLSDPSEYRRTVGALQYVTLTRPDIAFAVNKACQFMAKPSDVHWMAVKRILRYLKGTI  544

Query  937   FHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTe  1116
               GL  + +  +    +SD+DW    D  RST+GY +F GSN+ISW S +Q+ V+  S E
Sbjct  545   HLGLHFQPAASMEXQGYSDADWASCPDDRRSTSGYCVFLGSNLISWSSSKQRLVSKSSAE  604

Query  1117  aeyralanaaaeVIWVHNLLQDMGVVLPHS-PVLHCDNLSAMYVCQNLVYHSRMKHLALD  1293
             +EYR L +  AE++W+ +LLQ++   LP S P+L CDN SA ++  N V+HSR KH+ LD
Sbjct  605   SEYRGLVSLTAELVWIQSLLQEL--CLPTSPPILWCDNQSAAHLAANPVFHSRSKHIELD  662

Query  1294  YFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
               F+R  ++   L++ +VP+  Q+A I TK L    F + RSK+ V+     LRG
Sbjct  663   LHFIREKVLRQELQICYVPSGDQLADIFTKHLPITQFCNLRSKLTVTYPPLSLRG  717



>gb|EMT21953.1| ABC transporter C family member 10 [Aegilops tauschii]
Length=3041

 Score =   210 bits (534),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/263 (42%), Positives = 168/263 (64%), Gaps = 0/263 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH FLG+EV  T DGL LSQ +Y  D++++  +   K   TP+ S   L   +       
Sbjct  2501  LHFFLGIEVKKTEDGLHLSQEKYAADLVRRAGLQGCKASPTPLSSTEKLSLEEGDLLGQE  2560

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D+T Y+ ++G LQYL++T PD+ + +N++ QF+H P  +H  A KR++RY+K T+  GL 
Sbjct  2561  DSTRYRSLVGALQYLTLTRPDISFAVNKVCQFLHAPTTVHLTAAKRIVRYVKNTMSLGLT  2620

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
               +S+   ++AFSDSDW G  D  RST G+ +FFG N+ISW   +Q  V+  STEAEY+A
Sbjct  2621  FTKSSSTLVSAFSDSDWAGCIDDRRSTGGFAVFFGPNLISWCVKKQATVSRSSTEAEYKA  2680

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA AE+IWV ++L+++GV    +P L CDNL A Y+  N V+H+R KH+ +D+ FVR 
Sbjct  2681  LANATAEIIWVQSMLRELGVKHTKTPCLWCDNLGATYLSANPVFHARTKHIKIDFHFVRE  2740

Query  1312  HIVNGTLRVQHVPATSQIAAILT  1380
              +    L ++ V +  Q+++ L+
Sbjct  2741  RVARRQLDIRFVHSRDQVSSDLS  2763



>emb|CAH66488.1| OSIGBa0076I14.9 [Oryza sativa Indica Group]
Length=1455

 Score =   209 bits (531),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 119/282 (42%), Positives = 170/282 (60%), Gaps = 2/282 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH FLG+ V  TPD LFLSQ QY +D+L++  M E     TP+ +   L     +    A
Sbjct  1167  LHFFLGISVRRTPDDLFLSQRQYAVDLLQRAGMSEYHPTATPVDARAKLS--ASEGAPVA  1224

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ +   LQYL++T P++ Y + ++ +FMH+P   H   VKR++RY+KG++  GL 
Sbjct  1225  DPTEYRSLADALQYLTLTRPEIAYAVQQVCRFMHDPHEPHLALVKRIMRYIKGSLSAGLH  1284

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             +       L A+SD+DW G  D  RST+GY +F G N++SW S RQ  V+  S EAEYRA
Sbjct  1285  IGTGPVGSLTAYSDADWAGCPDSRRSTSGYCIFLGDNLVSWSSKRQTTVSRSSAEAEYRA  1344

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +A+A AE   +  LLQ++   +  + V+ CDN+SA Y+  N V+H   KH+ +D  FVR 
Sbjct  1345  VAHAIAECCCLRQLLQELHAPISTTTVVFCDNVSAAYMTANPVHHRCTKHIEIDIHFVRE  1404

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
              +  G +RV HVP+T Q    +TKGL  +LF  FRS + V D
Sbjct  1405  KVALGQVRVLHVPSTHQFPDFMTKGLPVQLFTDFRSSLCVRD  1446



>ref|XP_008342226.1| PREDICTED: uncharacterized protein LOC103405031 [Malus domestica]
Length=1076

 Score =   207 bits (527),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 172/274 (63%), Gaps = 3/274 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG+++  T  GLFLSQ +Y  D+L K +M ++K   TP +    L   KD   
Sbjct  724   LGPLHYFLGIQISKTAKGLFLSQQKYVQDLLVKTEMLDSKPCDTPCLPSNRLL--KDDGD  781

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                + T+Y+ V+G LQYL+ T PD+ + ++++ QFM +P++ H+ AVKR+ RYLKGT+  
Sbjct  782   PYPNPTLYRSVVGALQYLTFTRPDIAFSVHQVCQFMQHPMVSHFTAVKRIXRYLKGTMSC  841

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             G+   +   L L+AFSD+DW G  +  RSTTG V+F  +N ISW S +Q+ V   STEAE
Sbjct  842   GITYSQG-DLALSAFSDADWAGDPNDRRSTTGSVVFLXNNPISWSSKKQQTVXRSSTEAE  900

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRAL++ AAE+ W+  +L  +   +   PVL+CDNLSA+ +  NLV H R KH+ +D  F
Sbjct  901   YRALSSNAAELDWIQQILAFLHFPISAPPVLYCDNLSAIALSFNLVQHQRTKHIEIDVHF  960

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLF  1404
             VR  +    L VQ V +  Q A ILTKGL   LF
Sbjct  961   VRERVSQNKLVVQFVSSKEQFADILTKGLSSSLF  994



>emb|CAN63683.1| hypothetical protein VITISV_030301 [Vitis vinifera]
Length=1272

 Score =   208 bits (529),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 178/295 (60%), Gaps = 9/295 (3%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQS-  759
             L  L +FLG++       L L+Q +Y  D+LK+  M  +K    P  +P  L R   QS 
Sbjct  951   LGPLSYFLGIQAQQLGSVLHLNQHKYIADLLKRTQMETSK----PAPTPGRLGRTLSQSD  1006

Query  760   -TVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTV  936
                 +D   Y+R +G LQY+++T PD+ + +N+  QFM  P  +HW AVKR+LRYLKGT+
Sbjct  1007  GVSLSDPLEYRRTVGALQYVTLTRPDIAFAVNKACQFMAKPSDVHWMAVKRILRYLKGTI  1066

Query  937   FHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTe  1116
               GL  + +  + L  +SD+DW    D  RST+GY +F GSN+ISW S +Q+ V+  S E
Sbjct  1067  HLGLHFQPAASMELQGYSDADWASCPDDRRSTSGYCVFLGSNLISWSSSKQRLVSKSSAE  1126

Query  1117  aeyralanaaaeVIWVHNLLQDMGVVLPHS-PVLHCDNLSAMYVCQNLVYHSRMKHLALD  1293
             +EYR L +  AE++W+ +LLQ++   LP S P+L CDN SA ++  N V+HSR KH+ LD
Sbjct  1127  SEYRGLVSLTAELVWIQSLLQEL--CLPTSPPILWCDNQSAXHLAANPVFHSRSKHIELD  1184

Query  1294  YFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
               F+R  ++   L++ +VP+  Q+A I TK L    F + RSK+ V+     LRG
Sbjct  1185  LHFIREKVLRQELQICYVPSGDQLADIFTKHLPITQFCNLRSKLTVTYPPXSLRG  1239



>gb|ABA93730.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=656

 Score =   204 bits (518),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 173/285 (61%), Gaps = 3/285 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+E+  +  G+ LSQ +Y +D+L    M   +   TPI     L     QS 
Sbjct  370   LGPLRYFLGIEIARSSKGIVLSQRKYVLDLLTDTGMLGCRASTTPIDRNHQLCA---QSG  426

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                +   YQR++G L YL  T PD+ YV++ +S++MH+P   H   V ++LRYLKGT   
Sbjct  427   DPVNKEAYQRLVGRLIYLCHTRPDISYVVSVVSRYMHDPRTGHLDVVHKILRYLKGTPGK  486

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL  R++  L++  + D+DW    D  RST+GY +F G N++SWRS +Q  VA  + EAE
Sbjct  487   GLWFRKNGHLNVEGYCDADWASSMDDRRSTSGYCVFVGGNLVSWRSKKQAVVARSTAEAE  546

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+A + +E++W+ +LL ++ V+   + +LHCDN SA+ +  N V H R KH+ +D FF
Sbjct  547   YRAMALSLSEMLWMRSLLTELRVLRSDTVMLHCDNKSAISIANNPVQHDRTKHVEIDRFF  606

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
             ++  I +G LR++++ +  Q+A  LTKGLG    +   +KMG+ D
Sbjct  607   IKEKIDSGVLRLEYIKSCEQLADCLTKGLGPSEIQSICNKMGMID  651



>ref|XP_010527127.1| PREDICTED: uncharacterized protein LOC104804512 [Tarenaya hassleriana]
Length=1215

 Score =   207 bits (528),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 115/296 (39%), Positives = 178/296 (60%), Gaps = 4/296 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L +L +FLG+E+  T + LFL Q +Y +D+L++     AK VRTPI    + F+ + +  
Sbjct  886   LGSLKYFLGIEITRTSNSLFLCQRKYILDLLQETGKIGAKPVRTPIE---EHFKDQREGE  942

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                +   Y+RV+G L YL+IT PD+ + ++++SQ+MH P   +W  V R+L+YLKGT   
Sbjct  943   SLTNPDQYRRVVGKLIYLTITRPDISFAVHQVSQWMHAPTTKNWNMVDRILKYLKGTPNK  1002

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             G+ +  +    + A+ D+DW G     +STTGY  F G N+++W+S +Q  VA  S EAE
Sbjct  1003  GIWMHNNKHSKIVAYCDADWAGDRADRKSTTGYCTFIGGNLVTWKSKKQNVVARSSAEAE  1062

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+AN  +EVIW+  LL+D+GV       LHCDN +A+++  N V+H R KH+ +D  F
Sbjct  1063  YRAMANTTSEVIWLRQLLEDLGVKTEDPTPLHCDNQAALHIASNSVFHERTKHIEVDCHF  1122

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD-GSSILRGRIK  1467
             VR  I+ G +   +  +  Q+A ILTK     +     SK+G+ +    ILRG ++
Sbjct  1123  VREKIMQGLISPMYTRSQDQLADILTKATSSFVLNKCLSKIGLLEFRRPILRGNVE  1178



>gb|ABF96081.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1180

 Score =   207 bits (527),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 163/268 (61%), Gaps = 0/268 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV    +G+ L+Q +Y  D+LK+V M + K V   + +   L   +       
Sbjct  792   LHYFLGIEVNKISNGIILTQEKYANDLLKRVGMIDCKPVSASLSTSEKLTLHEGDLLGLN  851

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DA+ Y+ V+G LQYL++T PD+ + +N++ QF+H P  IHW  VKR+LRYLK     GL 
Sbjct  852   DASNYRSVVGALQYLTLTRPDIAFPVNKVCQFLHAPTTIHWATVKRILRYLKQCTKLGLK  911

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             + +S  + ++ +SD+DW G  D  RST G+ +F G N++SW + +Q  V+  STE+EY+ 
Sbjct  912   ISKSKSMLVSGYSDTDWAGNVDDRRSTRGFAVFLGDNLVSWNARKQATVSRSSTESEYKV  971

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LANA AE++W+  LL ++GV  P    L CDNL A Y+  N V+H+R KH+ +DY FVR 
Sbjct  972   LANATAEIMWIQTLLAELGVSSPLMARLWCDNLGAKYLSSNPVFHARTKHIEVDYHFVRE  1031

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGR  1395
              +    L V  VP   Q+A   TK L  
Sbjct  1032  RVQRRLLEVDFVPTGDQVADGFTKALSE  1059



>emb|CAN69190.1| hypothetical protein VITISV_001578 [Vitis vinifera]
Length=1323

 Score =   207 bits (528),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 112/282 (40%), Positives = 173/282 (61%), Gaps = 3/282 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+EV  + +G+F+SQ +Y ++I++   +  A  + TP+   + L    D+S +  
Sbjct  1040  LKYFLGIEVSASKNGIFISQRKYALEIIEDAXLLGAAPIDTPMERGLKL---SDKSDLLK  1096

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D   Y+R++G L YL+++ PD+ Y ++ LS+FMH P   H +A  RV+RYLK     GL 
Sbjct  1097  DQGRYRRLVGRLIYLTVSRPDITYAVHVLSRFMHQPRKAHMEAAFRVVRYLKNAPGQGLF  1156

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                +    L A+ DSDW G     RSTTGY +F G ++ISWRS RQK V+  S EAEYRA
Sbjct  1157  FSSNNDFRLRAYCDSDWAGCPLTRRSTTGYCVFLGPSLISWRSKRQKTVSLSSAEAEYRA  1216

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +  A  E+ W+  LL+D+GV+     +L+CDN +A+++  N V+H R +H+ +D  ++R 
Sbjct  1217  MTGACCELTWLRYLLKDLGVLHKEPALLYCDNKAALHIAANPVFHERTRHIEMDCHYIRD  1276

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
              I +G++  +HV +  Q+A ILTK LG+  F     K+GV D
Sbjct  1277  KIQDGSIITRHVSSAHQLADILTKPLGKEFFAPMIRKLGVQD  1318



>emb|CAN65108.1| hypothetical protein VITISV_036622 [Vitis vinifera]
Length=607

 Score =   202 bits (515),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 112/283 (40%), Positives = 167/283 (59%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+E+  +  G+ +SQ +Y +D+L +  M   K   TP+ + V L   +   +
Sbjct  320   LGNLKYFLGMEIARSKKGIAVSQRKYVLDLLNETGMLGCKPAETPMDTTVKL--EESBGS  377

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D   YQR++G L YLS T PD+ + ++ +SQFM+NP   H  AV R+LRYLK T   
Sbjct  378   AXVDKGRYQRLVGKLIYLSHTRPDIGFSVSVVSQFMNNPTEKHMTAVIRILRYLKMTPGK  437

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL  +R+T+  +  FSD+DW G+    RST+ Y  F   N+++WRS +Q  VA  S EAE
Sbjct  438   GLFFQRTTKKEIEIFSDADWAGLVTDRRSTSSYCSFVWGNLVTWRSKKQSVVARSSXEAE  497

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             +RA+A    E IW++ LL+++ V L H  VL+CDN +A+ + +N V+H R KH+ +D  F
Sbjct  498   FRAMAQGICEGIWLNRLLEELRVPLKHPMVLYCDNQAAISIAKNXVHHDRTKHVXIDRHF  557

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             ++  I  G  +V + P   Q   ILTK L R  FE    K+G+
Sbjct  558   IKEKIEEGVFKVSYTPTNCQTTDILTKALARVNFEDLTEKLGM  600



>ref|XP_002442174.1| hypothetical protein SORBIDRAFT_08g015513 [Sorghum bicolor]
 gb|EES16012.1| hypothetical protein SORBIDRAFT_08g015513 [Sorghum bicolor]
Length=757

 Score =   204 bits (519),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 119/277 (43%), Positives = 170/277 (61%), Gaps = 4/277 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+EV    +GL LSQ +Y  DIL +  M ++K V TP+ S   +           
Sbjct  483   LHYFLGIEVKRDSNGLVLSQGKYANDILVRSGMSKSKPVHTPLPSTQKISITDGDKLGEE  542

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D T Y+ ++G LQYL++T PD+ + +N++ QF+H P   H  AVKR+LRY++GT   GL 
Sbjct  543   DCTRYRSLVGALQYLTLTRPDISFAVNKVCQFLHAPTTTHLSAVKRILRYIQGTSKFGLR  602

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             +R+S    ++AFS +DW G  D  RST G+ +F G N+ISW + +Q  V+  STEAEY+A
Sbjct  603   IRKSKCRIVSAFSYADWAGDVDDRRSTGGFAVFLGENLISWTAQKQATVSRSSTEAEYKA  662

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPV--LHCDNLSAMYVCQNLVYHSRMKHLALDYFFV  1305
             LANA AEV+WV  LL ++ V  PH+ V  L CDNL A Y+  N V+H+R KH+ +D+ FV
Sbjct  663   LANATAEVMWVQKLLAELCV--PHARVARLWCDNLGAKYLSANPVFHARTKHIEIDFHFV  720

Query  1306  RVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFR  1416
             R  +    L ++ + +  Q+A   TK L    F  FR
Sbjct  721   RERVAQKLLDIRFISSEDQLADGFTKSLPVTKFHKFR  757



>emb|CAN65233.1| hypothetical protein VITISV_022975 [Vitis vinifera]
Length=1277

 Score =   207 bits (526),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/274 (41%), Positives = 179/274 (65%), Gaps = 12/274 (4%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPI-----VSPVDLFRPKDQ  756
             L +FLG+E+  + DGL+++Q++Y  ++L +  + ++K V TP+     ++P+        
Sbjct  995   LSYFLGLEITHSTDGLYITQAKYASNLLSQAGLTDSKTVDTPVELNAHLTPLG-------  1047

Query  757   STVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTV  936
                 ++ ++Y+R++G L YL++T PD+ Y ++++SQ++  P   H+ AV R+LRYLKGT+
Sbjct  1048  GKPLSNPSLYRRLVGSLVYLTVTRPDISYAVHQVSQYLSAPRSTHYAAVLRILRYLKGTL  1107

Query  937   FHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTe  1116
             FHGL     + L L AFSD+DW G     RSTTGY    GS++ISWRS +Q  VA  STE
Sbjct  1108  FHGLFYSAQSPLVLRAFSDADWAGDPTDRRSTTGYCFLLGSSLISWRSKKQTFVARSSTE  1167

Query  1117  aeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDY  1296
             AEYRALA+  +E++W+  LL+D+GV    +  L+CDN SA+++  N V+H R KH+ +D 
Sbjct  1168  AEYRALADTTSELLWLRWLLKDLGVSTSSATPLYCDNQSAIHIAHNDVFHERTKHIEIDC  1227

Query  1297  FFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRR  1398
              F+R H+++G L++  V +  Q+A I TK L +R
Sbjct  1228  HFIRYHLLHGALKLFSVSSKDQLADIFTKSLPKR  1261



>ref|XP_006577466.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=387

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 120/311 (39%), Positives = 178/311 (57%), Gaps = 9/311 (3%)
 Frame = +1

Query  535   QFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRT  714
             Q +++LLS    A   L  L +FLG+ V     GLFLSQ +Y + I+    M   K   T
Sbjct  81    QSIIILLSS-EFAMKDLGQLSYFLGIAVTHHAGGLFLSQKKYAMKIIDYAGMSSCKSSPT  139

Query  715   PIVSPVDLFRPK---DQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLL  885
             P+ +     +PK     +T   D T+Y+ + G LQYL+ T PD+ Y + ++  F+H+P  
Sbjct  140   PVDT-----KPKLSATSNTPFEDPTLYRSLAGALQYLTFTKPDITYAVQQVCLFIHDPKD  194

Query  886   IHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNV  1065
              H  A+KR+L Y++GT+ HGL L  S    L +++D+DW G  + G ST GY +F G N+
Sbjct  195   EHMHALKRILCYIQGTIDHGLHLYPSFTSTLVSYTDADWSGCPNTGWSTFGYCVFLGDNL  254

Query  1066  ISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYV  1245
             ISW + RQ  ++  S EAEYR +AN  +E  W+ NLL ++   +  + +++CDN SA+Y+
Sbjct  255   ISWSAKRQATLSRSSAEAEYRGVANVVSESCWLRNLLLELHCPIQKATLVYCDNASAIYL  314

Query  1246  CQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
               N V H R KH+ +D  FV   + +G +RV HVP+  QI  I TKGL   LFE FR  +
Sbjct  315   AGNPVQHQRTKHIEMDIHFVHEKVAHGQVRVLHVPSRYQIVDIFTKGLPLMLFEDFRDSL  374

Query  1426  GVSDGSSILRG  1458
              V    ++  G
Sbjct  375   SVRRPPALTAG  385



>emb|CAN68148.1| hypothetical protein VITISV_035665 [Vitis vinifera]
Length=1813

 Score =   207 bits (528),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 115/283 (41%), Positives = 168/283 (59%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+E   +  G+F+SQ +YT+DIL+   +   K  + P+   + L    +   
Sbjct  1442  LGELKYFLGIEFSRSKKGIFMSQRKYTLDILQDTGLTGVKPEKFPMEQNLKLT--NEDGE  1499

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             +  D + Y+R++G L YL++T PD+ Y +  LSQFM+ P   HW+A  RVLRY+KG+   
Sbjct  1500  LLHDPSRYRRLVGRLIYLTVTRPDIVYSVRTLSQFMNTPRKPHWEAALRVLRYIKGSPGQ  1559

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL L     L L+AF DSDWGG     RS +GY +F GS++ISW+S +Q  V+  S EAE
Sbjct  1560  GLFLPSENNLTLSAFCDSDWGGCRMSRRSVSGYCVFLGSSLISWKSKKQTNVSRSSAEAE  1619

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+AN   E+ W+  +L+D+ V L     L CDN +A+Y+  N V+H R KH+ +D   
Sbjct  1620  YRAMANTCLELTWLRYILKDLKVELDKPAPLFCDNQAALYIAANPVFHERTKHIEIDCHI  1679

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +  G +R  +V    Q+A + TK LGR  FE   +K+G 
Sbjct  1680  VREKLQAGVIRPCYVSTKMQLADVFTKALGREQFEFLCTKLGC  1722



>emb|CAN65942.1| hypothetical protein VITISV_001716 [Vitis vinifera]
Length=1319

 Score =   207 bits (526),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 115/283 (41%), Positives = 173/283 (61%), Gaps = 10/283 (4%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFR----PK  750
             L  L +FLG+EV      + LSQ++Y  D+L + +M + K  +TP     +L +    P 
Sbjct  1043  LGQLSYFLGIEVSYHEGSMNLSQTKYVSDMLHRTEMFDTKPAKTPGAVGKNLSKFDGDPM  1102

Query  751   DQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKG  930
             D+       T Y+ V+G LQYL+IT  D+ + +N+  QFM  P   HW +VKR+LRYL+G
Sbjct  1103  DE------VTQYRSVVGALQYLTITRLDIAFAVNKACQFMQQPTSAHWLSVKRILRYLQG  1156

Query  931   TVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFS  1110
             T+  GLLL  ST L +  FSD++WG   D  RS+ GY+++ G N++SW S +QK V+H S
Sbjct  1157  TMQDGLLLSPSTNLTIKGFSDANWGAQLDDRRSSNGYLVYLGGNLVSWSSTKQKVVSHSS  1216

Query  1111  TeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLAL  1290
              E+EY  LA A AE+IW+  LLQ++ V +P  P+L  DN+SA ++ +N V+H+R KH+ +
Sbjct  1217  AESEYCGLALATAEIIWMQALLQELCVPIPAIPLLWYDNISAYHMAKNPVFHARTKHIEI  1276

Query  1291  DYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRS  1419
             D  F+R  ++ G +++  VP   Q A +LTK L    F   +S
Sbjct  1277  DLHFIRDQVIRGKIQLHFVPTEDQPADLLTKHLTSSRFLSLKS  1319



>ref|XP_008365969.1| PREDICTED: uncharacterized protein LOC103429605 [Malus domestica]
Length=1188

 Score =   206 bits (524),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 124/299 (41%), Positives = 180/299 (60%), Gaps = 10/299 (3%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+EV    D + L QS+Y +D+  +     AK + TP+ S   L      + 
Sbjct  887   LGPLSYFLGIEVKYNGDAMHLCQSKYALDLJTRTKFTXAKPISTPVSSGQKL-----SAY  941

Query  763   VA---ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGT  933
             V    A+  +Y+ V+G LQYL+IT PD+ Y +N++ QFMH+P   HW AVKR+LRYLK T
Sbjct  942   VGDPYANXEMYRSVVGALQYLTITRPDLSYAVNQICQFMHSPKNTHWMAVKRILRYLKAT  1001

Query  934   VFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFST  1113
               HGLL +  T   L A+SD+D+ G  D   ST G+ ++ GS+++SW S +QK V+  S 
Sbjct  1002  YNHGLLYKPGTAT-LTAYSDADYAGNPDTRHSTGGFCVYLGSSLVSWSSKKQKTVSRSSA  1060

Query  1114  eaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALD  1293
             EAEYR LA  AAE+ W+ +L +D+ + L   P + CDN+S++ +  N V+HSR KHL +D
Sbjct  1061  EAEYRQLAYTAAELSWLRSLYKDLHLHL-VPPTIWCDNISSIALASNPVFHSRTKHLEVD  1119

Query  1294  YFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIKK  1470
             Y +VR  +V   L V +V +  Q+A I TKGL    F+   SK+ V      LRG +++
Sbjct  1120  YHYVREKVVRKQLFVSYVCSQDQLADIFTKGLSSSRFKFLVSKLPVVPPPVSLRGAVRR  1178



>gb|AAD43604.1|AC005698_3 T3P18.3 [Arabidopsis thaliana]
Length=1309

 Score =   206 bits (525),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 177/304 (58%), Gaps = 6/304 (2%)
 Frame = +1

Query  523   FIMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAK  702
              +M + L  L +R S  +  L    +FLG+E+    +GLFL Q  Y  DIL +  M E  
Sbjct  926   LLMDKLLQALNNRFSMKD--LGPPRYFLGIEIESYNNGLFLHQHAYASDILHQAGMTECN  983

Query  703   IVRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPL  882
              + TP+   ++       S    + T ++ + G LQYL+IT PD+ Y +N + Q MH P 
Sbjct  984   PMPTPLPQHLEDL----NSEPFEEPTYFRSLAGKLQYLTITRPDIQYAVNFICQRMHAPT  1039

Query  883   LIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSN  1062
                +  +KR+LRY+KGT+  GL +R+     L+ F DSD+ G  D  RSTTG+ +  GS 
Sbjct  1040  NSDFGLLKRILRYVKGTINMGLPIRKHHNPVLSGFCDSDYAGCKDTRRSTTGFCILLGST  1099

Query  1063  VISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMY  1242
             +ISW + RQ  ++H STEAEYRAL++ A E+ W+ +LL+D+G+       + CDNLSA+Y
Sbjct  1100  LISWSAKRQPTISHSSTEAEYRALSDTAREITWISSLLRDLGISQHQPTRVFCDNLSAVY  1159

Query  1243  VCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSK  1422
             +  N   H R KH   D+ ++R  +  G +  QH+PAT Q+A + TK L RR F   R+K
Sbjct  1160  LSANPALHKRSKHFDKDFHYIRERVALGLIETQHIPATIQLADVFTKSLPRRPFITLRAK  1219

Query  1423  MGVS  1434
             +GVS
Sbjct  1220  LGVS  1223



>emb|CAN73924.1| hypothetical protein VITISV_041509 [Vitis vinifera]
Length=1434

 Score =   207 bits (526),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/295 (41%), Positives = 178/295 (60%), Gaps = 9/295 (3%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG++       L L+Q +Y  D+L +  M  +K    P  +P  L R   QS 
Sbjct  1082  LGPLSYFLGIQAQQLGSVLHLNQHKYIADLLNRTQMETSK----PAPTPGRLGRTLSQSD  1137

Query  763   --VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTV  936
                 +D + Y+R +G LQY+++T PD+ + +N+  QFM  P  +HW AVKR+LRYLKGT+
Sbjct  1138  GMSLSDPSEYRRTVGALQYVTLTRPDIAFAVNKACQFMAKPSDVHWMAVKRILRYLKGTI  1197

Query  937   FHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTe  1116
               GL  + +  + L  +SD+DW    D  RST+GY +F GSN+ISW S +Q+ V+  S E
Sbjct  1198  HLGLHFQPAASMELQGYSDADWASCPDDRRSTSGYCVFLGSNLISWSSSKQRLVSKSSAE  1257

Query  1117  aeyralanaaaeVIWVHNLLQDMGVVLPHS-PVLHCDNLSAMYVCQNLVYHSRMKHLALD  1293
             +EYR L +  AE++W+ +LLQ++   LP S P+L CDN SA ++  N V+HSR KH+ LD
Sbjct  1258  SEYRGLVSLTAELVWIQSLLQEL--CLPTSPPILWCDNQSAAHLAANPVFHSRSKHIELD  1315

Query  1294  YFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
               F+R  ++   L++ +VP+  Q+A I TK L    F + RSK+ V+     LRG
Sbjct  1316  LHFIREKVLRQELQICYVPSGDQLADIFTKHLPITQFCNLRSKLTVTYPPLSLRG  1370



>emb|CAC37623.1| copia-like polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   207 bits (526),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 177/304 (58%), Gaps = 6/304 (2%)
 Frame = +1

Query  523   FIMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAK  702
              +M + L  L +R S  +  L    +FLG+E+    +GLFL Q  Y  DIL +  M E  
Sbjct  1083  LLMDKLLQALNNRFSMKD--LGPPRYFLGIEIESYNNGLFLHQHAYASDILHQAGMTECN  1140

Query  703   IVRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPL  882
              + TP+   ++       S    + T ++ + G LQYL+IT PD+ Y +N + Q MH P 
Sbjct  1141  PMPTPLPQHLEDL----NSEPFEEPTYFRSLAGKLQYLTITRPDIQYAVNFICQRMHAPT  1196

Query  883   LIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSN  1062
                +  +KR+LRY+KGT+  GL +R+     L+ F DSD+ G  D  RSTTG+ +  GS 
Sbjct  1197  NSDFGLLKRILRYVKGTINMGLPIRKHHNPVLSGFCDSDYAGCKDTRRSTTGFCILLGST  1256

Query  1063  VISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMY  1242
             +ISW + RQ  ++H STEAEYRAL++ A E+ W+ +LL+D+G+       + CDNLSA+Y
Sbjct  1257  LISWSAKRQPTISHSSTEAEYRALSDTAREITWISSLLRDLGISQHQPTRVFCDNLSAVY  1316

Query  1243  VCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSK  1422
             +  N   H R KH   D+ ++R  +  G +  QH+PAT Q+A + TK L RR F   R+K
Sbjct  1317  LSANPALHKRSKHFDKDFHYIRERVALGLIETQHIPATIQLADVFTKSLPRRPFITLRAK  1376

Query  1423  MGVS  1434
             +GVS
Sbjct  1377  LGVS  1380



>emb|CAN61322.1| hypothetical protein VITISV_012106 [Vitis vinifera]
Length=1432

 Score =   206 bits (525),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/295 (38%), Positives = 177/295 (60%), Gaps = 2/295 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L  FLG+EV      + LSQ++Y  D+L + ++ + K   TP     +L   K    
Sbjct  1111  LGQLSFFLGIEVSYNEGSMTLSQTKYISDLLHRTELFDTKPANTPGAVGKNL--SKFDGD  1168

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D T Y+ V+G LQY+++T PD+ + +N+  QFM  P   HW +VKR+LRYL+GT+  
Sbjct  1169  PMTDVTHYRSVVGALQYVTLTRPDIAFAVNKACQFMQQPTTAHWLSVKRILRYLRGTMQD  1228

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GLL   S+ L +  F+D+DWG   D  RS++GY+++ G N++SW S +QK V+  S E+E
Sbjct  1229  GLLFSPSSNLTIEGFTDADWGAHLDDRRSSSGYLVYLGGNLVSWSSTKQKVVSRSSAESE  1288

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YR L  A AE++W+  LLQ++ V +P  P+L  DN+SA ++ +N V+H+R KH+ +D  F
Sbjct  1289  YRGLVFATAEIVWMQALLQELCVPIPAIPLLWYDNISAYHMAKNPVFHARTKHIEIDLHF  1348

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRGRIK  1467
             +R  ++ G +++Q VP   Q   +LTK L    F   +S++ ++     LRG  K
Sbjct  1349  IRDQVMRGKIQLQFVPTEEQPVDLLTKHLTSSRFLSLKSQLCIAPRPFHLRGDDK  1403



>emb|CAN71427.1| hypothetical protein VITISV_027864 [Vitis vinifera]
Length=1300

 Score =   206 bits (524),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/283 (39%), Positives = 174/283 (61%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L HFLG+EV  T +G+FL Q +Y  D+LKK  M E K + TP+     +   + +  
Sbjct  1008  LGQLKHFLGLEVDRTNEGIFLCQQKYAKDLLKKFGMLECKPISTPMEPNAKMCEHEGKDL  1067

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                DAT+Y++++G L YL++T PD+ Y +  +S++M NP   H +AV+R+LR++KGT+ +
Sbjct  1068  --KDATMYRQLVGSLLYLTLTXPDISYAVGVMSRYMQNPKKPHLEAVRRILRHVKGTIDY  1125

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GLL ++     L  + D+D+ G HD   STTGYV   GS  ISW S RQ  V+  +TEAE
Sbjct  1126  GLLYKKXEDCKLVGYCDADYAGDHDTRXSTTGYVFMLGSGAISWCSKRQPTVSLSTTEAE  1185

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA A A  E +W+  L+ D+  ++ ++  L+CDN SA+ + +N V+H+R KH+ + Y F
Sbjct  1186  YRAAAMATQESMWLIRLMNDLHQLVDYAVPLYCDNQSAVRLAENPVFHARTKHVEVHYHF  1245

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             +R  ++   + +  + +  Q+A + TKGL    FE F  ++G+
Sbjct  1246  IREKVLKEEVELNQIKSEDQVADLFTKGLSGSKFESFCHQLGM  1288



>emb|CAN73624.1| hypothetical protein VITISV_042460 [Vitis vinifera]
Length=1287

 Score =   206 bits (524),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 168/283 (59%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+E+  +  G+ +SQ +Y +D+L +  M   K   TP+ + V L   +   +
Sbjct  1000  LGNLKYFLGMEIARSKKGIAVSQRKYVLDLLNETGMLGCKPAETPMDTTVKL--EESDGS  1057

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D   YQR++G L YLS T PD+ + ++ +SQFM+NP   H  AV R+LRYLK T   
Sbjct  1058  APVDKGRYQRLVGKLIYLSHTRPDIGFSVSVVSQFMNNPTEKHMTAVIRILRYLKMTPGK  1117

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL  +R+T+  +  FSD+DW G     RST+GY  F   N+++WRS +Q  VA  S EAE
Sbjct  1118  GLFFQRTTKKEIEIFSDADWAGSVTDRRSTSGYCSFVWGNLVTWRSKKQSVVARSSAEAE  1177

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             +RA+A    E IW++ LL+++ V L H  VL+CDN +A+ + +N V+H R KH+ +D  F
Sbjct  1178  FRAMAQGICEGIWLNRLLEELRVPLKHPMVLYCDNQAAISIAKNPVHHDRTKHVEIDRHF  1237

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             ++  I  G  +V + P   Q A ILTK L R  FE    K+G+
Sbjct  1238  IKEKIEEGVFKVSYTPTNCQTADILTKALARVNFEDLTEKLGM  1280



>gb|ABA95797.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1588

 Score =   206 bits (525),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/285 (41%), Positives = 171/285 (60%), Gaps = 3/285 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+EV  +  G+ LSQ +Y +D+L +  M   +   TPI     L     QS 
Sbjct  1302  LGPLRYFLGIEVARSSKGIVLSQRKYVLDLLTETGMLGCRTSATPIDRNHQL---SAQSG  1358

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D   YQR++G L YL  T PD+ Y ++ +S++MH+P   H + V R+LRYLKGT   
Sbjct  1359  DPVDRETYQRLVGRLIYLCHTRPDISYAVSVVSRYMHDPRTTHLEVVHRILRYLKGTPGK  1418

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL  R++  L +  + D+DW    D  RST+GY +F G NV+ WRS +Q  VA  + EAE
Sbjct  1419  GLWFRKNQHLDVEGYCDADWASSVDDRRSTSGYCVFVGGNVVCWRSKKQAVVAQSTAEAE  1478

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+A + +E++WV NLL ++ +   ++ VLHCDN  A+ +  N V H R KH+ +D FF
Sbjct  1479  YRAMALSLSEMLWVKNLLLELRLFRNNTVVLHCDNKFAINIANNPVQHDRTKHIEIDRFF  1538

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
             ++  I +  LR+Q++ ++ Q+A  LTKGLG    E   +KMG+ D
Sbjct  1539  IKEKIDSRALRLQYIKSSEQLADCLTKGLGPSQSESMCNKMGMID  1583



>emb|CAN62906.1| hypothetical protein VITISV_043610 [Vitis vinifera]
Length=1498

 Score =   206 bits (523),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 172/282 (61%), Gaps = 3/282 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+EV  + +G+F+SQ +Y ++I++   +  A  + TP+   + L    D+S +  
Sbjct  1215  LKYFLGIEVSASKNGIFISQRKYALEIIEDAGLLGAAPIDTPMERGLKL---SDKSDLLK  1271

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D   Y+R++G L YL+++ PD+ Y ++ LS+FMH P   H +A  RV+RYLK     GL 
Sbjct  1272  DQGRYRRLVGRLIYLTVSRPDITYAVHVLSRFMHQPRKAHMEAAFRVVRYLKNAPGQGLF  1331

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                +    L  + DSDW G     RSTTGY +F G ++ISWRS RQK V+  S EAEYRA
Sbjct  1332  FSSNNDFRLRXYCDSDWAGCPLTRRSTTGYCVFLGPSLISWRSKRQKTVSLSSAEAEYRA  1391

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +  A  E+ W+  LL+D+GV+     +L+CDN +A+++  N V+H R +H+ +D  ++R 
Sbjct  1392  MTGACCELTWLRYLLKDLGVLHKEPALLYCDNKAALHIAANPVFHERTRHIEMDCHYIRD  1451

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
              I +G++  +HV +  Q+A ILTK LG+  F     K+GV D
Sbjct  1452  KIQDGSIITRHVSSAHQLADILTKPLGKEFFAPMIRKLGVQD  1493



>emb|CAN82483.1| hypothetical protein VITISV_006799 [Vitis vinifera]
Length=1180

 Score =   205 bits (521),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 168/283 (59%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+E+  +  G+ +SQ +Y +D+L +  M   K   TP+ + V L   +   +
Sbjct  893   LGNLKYFLGMEIARSKKGIAVSQRKYXLDLLNEXGMLGCKPAETPMDTTVKL--EESDGS  950

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D   YQR++G L YLS T PD+ + ++ +SQFM+NP   H  AV R+LRYLK T   
Sbjct  951   APIDKXRYQRLVGKLIYLSHTRPDIGFSVSVVSQFMNNPTEKHMTAVIRILRYLKMTPGK  1010

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL  +R+T+  +  FSD+DW G     RST+GY  F   N+++WRS +Q  VA  S EAE
Sbjct  1011  GLFFQRTTKKEIEIFSDADWAGSVTDRRSTSGYCSFVWGNLVTWRSKKQSVVARSSAEAE  1070

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             +RA+A    E IW++ LL+++ V L H  VL+CDN +A+ + +N V+H R KH+ +D  F
Sbjct  1071  FRAMAQGICEGIWLNRLLEELRVPLKHPMVLYCDNQAAISIAKNPVHHDRTKHVEIDRHF  1130

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             ++  I  G  +V + P   Q A ILTK L R  FE    K+G+
Sbjct  1131  IKEKIEEGVFKVSYTPTNCQTADILTKALARVNFEDLTEKLGM  1173



>ref|XP_007044242.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY00074.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=1494

 Score =   206 bits (523),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 121/281 (43%), Positives = 172/281 (61%), Gaps = 2/281 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+EV  +P G+ LSQ +Y +DIL +  +  +K +  PI     L    D   
Sbjct  1073  LGKLKYFLGIEVARSPSGIVLSQHKYVLDILSECGLMGSKPLSFPIDQQHKL--AYDTGP  1130

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               ++  +Y+R++G L YL+IT PD+ YV++ LSQFMHNP   H  AV RVLRYLK     
Sbjct  1131  FCSNPELYRRLVGHLLYLTITRPDISYVVHLLSQFMHNPRQPHLNAVFRVLRYLKNAPGQ  1190

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GLLL  +  L L A+ D+DW G     RSTTGY++F GS+ ISW+S +Q  V+  S EAE
Sbjct  1191  GLLLPSNNSLSLRAYCDADWVGCPTTRRSTTGYIIFLGSSPISWQSKKQTVVSRSSAEAE  1250

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+A  ++++IW+  LL+D+ V   +   L CDN +A+++  N V+H R KH+ +D  F
Sbjct  1251  YRAMATTSSKIIWLIRLLRDLQVPCSNPVPLFCDNQAAIHIAANPVFHERTKHIEIDCHF  1310

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
             VR HI + TL  + + +  Q+A I TK LGR  F    SK+
Sbjct  1311  VRQHIQSQTLIPRPITSKFQLADIFTKALGRDRFHELLSKL  1351



>ref|XP_008360651.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103424335 
[Malus domestica]
Length=885

 Score =   202 bits (515),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 128/303 (42%), Positives = 184/303 (61%), Gaps = 9/303 (3%)
 Frame = +1

Query  526   IMSQFLVMLLSRCSKANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKI  705
             +MS+ ++ L       N  L  LH+FLG+++     GLF+SQ+ Y  D+L KVDM +AK 
Sbjct  233   LMSKVILALTQEFDMKN--LGNLHYFLGLQITYKNTGLFISQTIYIHDLLTKVDMQDAKS  290

Query  706   VRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLL  885
               TP + P       D S   +    Y+ ++G LQ L+ T PD+ + +N+  QFMHNPL 
Sbjct  291   CATPYL-PYHRLSKTDGSPYHSPKH-YRIIVGALQCLTFTRPDIAFAVNQCCQFMHNPLD  348

Query  886   IHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNV  1065
             IH  A+KR+LRYL GT+ +G+      +L L A+SD+DW G  +  RST+GYV++ G+  
Sbjct  349   IHVVAMKRILRYLSGTLDYGIHFTPG-KLQLQAYSDADWAGDLNDRRSTSGYVVYLGNTP  407

Query  1066  ISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYV  1245
             ISW S +Q  V+  STEAEYRALA  AA+V W+  LL D+ V L  + +L CDN+SA+ +
Sbjct  408   ISWASKKQHIVSRSSTEAEYRALAITAAKVSWIQQLLHDLHVPLYDASMLFCDNISAIAL  467

Query  1246  CQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKM  1425
               N V+HSR+KH+ +DY F+R  ++ G L V    +  Q   ILTKGL   LF+   S +
Sbjct  468   SSNPVFHSRVKHIEIDYHFIRERVIKGDLAV----SKEQFVDILTKGLSTSLFQDHCSNL  523

Query  1426  GVS  1434
              +S
Sbjct  524   MLS  526



>emb|CAN62394.1| hypothetical protein VITISV_021305 [Vitis vinifera]
Length=1287

 Score =   205 bits (522),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/269 (42%), Positives = 176/269 (65%), Gaps = 2/269 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+E+  + DGL+++Q++Y  D+L +  + ++K V TP+     L  P     ++ 
Sbjct  1005  LSYFLGLEITHSTDGLYITQAKYASDLLSQAGLTDSKNVDTPVELNAHL-TPSGGKPLS-  1062

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             + ++Y+R++G L  L++T PD+ Y ++++SQ++  P   H+ AV R+LRYLKGT+FHGL 
Sbjct  1063  NPSLYRRLVGSLVCLTVTRPDISYAVHQVSQYLSAPRSTHYVAVLRILRYLKGTIFHGLF  1122

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                 + L L AFSD+DW G     RSTTGY    GS++ISWRS +Q  VA  ST+AEYRA
Sbjct  1123  YSAQSPLVLRAFSDADWAGDPXDRRSTTGYCFLLGSSLISWRSKKQTFVARSSTKAEYRA  1182

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA+  +E++W+  LL+D+GV    +  L+CDN SA+++  N V+H R KH+ +D  F+R 
Sbjct  1183  LADTTSELLWLRWLLKDLGVSTSSATPLYCDNQSAIHIAHNDVFHERTKHIEIDCHFIRY  1242

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRR  1398
             H+V+G L++  V +  Q+A I TK L  R
Sbjct  1243  HLVHGALKLFFVSSKDQLADIFTKSLPTR  1271



>emb|CAN72277.1| hypothetical protein VITISV_043408 [Vitis vinifera]
Length=388

 Score =   195 bits (496),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 113/285 (40%), Positives = 167/285 (59%), Gaps = 2/285 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+EV  +  G+ +SQ +Y +D+LK+  M   K + TP+ S   L   K+ + 
Sbjct  101   LGNLKYFLGMEVARSRKGIVVSQRKYILDLLKETGMLGCKPIDTPMDSQKKLGIEKESTP  160

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             V  D   YQR++G L YLS T PD+ + ++ +SQFMH+P   H +AV R+LRYLK T   
Sbjct  161   V--DRGRYQRLVGRLIYLSHTXPDIGFAVSAVSQFMHSPTEEHMEAVYRILRYLKMTPGK  218

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL  R++    +  +SD+DW G     RST+GY  F   N+ +WRS +Q  VA  S EAE
Sbjct  219   GLFFRKTENRDIEVYSDADWAGNIIDRRSTSGYCSFVWGNLXTWRSKKQSVVARSSAEAE  278

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRALA    E IW+  +L ++G       ++ CDN +A+ + +N V+H R KH+ +D  F
Sbjct  279   YRALAQGICEGIWIKRVLSELGQTSSSPILMMCDNQAAISIAKNPVHHDRTKHVEIDRHF  338

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
             +   + + T+++ +VP   Q A ILTK L R  FE    K+G+ D
Sbjct  339   ITEKVTSETVKLNYVPTKXQTADILTKALPRPNFEDLTCKLGLYD  383



>emb|CAN69367.1| hypothetical protein VITISV_035520 [Vitis vinifera]
Length=1083

 Score =   204 bits (519),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 119/324 (37%), Positives = 187/324 (58%), Gaps = 15/324 (5%)
 Frame = +1

Query  523   FIMSQFLVMLLSRCSKANGI-----LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVD  687
             ++ + F   + S  +K + I     L  L +FLG+EV      + LSQ++Y  ++L + +
Sbjct  754   YLDTTFPTKISSLIAKXDSIFTLRDLXQLSYFLGIEVSYHEGSMNLSQTKYVSBLLHRXE  813

Query  688   MHEAKIVRTPIVSPVDLFR----PKDQSTVAADATVYQRVIGLLQYLSITCPDVDYVINR  855
             M + K  +TP     +L +    P D+       T Y+ V+G LQYL+IT  D+ + +N+
Sbjct  814   MFDTKPAKTPXAVGKNLSKFDGDPMDE------VTQYRSVVGALQYLTITRXDIAFAVNK  867

Query  856   LSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDSDWGGVHDGGRSTT  1035
               QFM      HW + KR+LRYLKGT+  GLLL  S  L +  FSD+DWG   D  RS++
Sbjct  868   ACQFMQQXTSAHWLSXKRILRYLKGTMQDGLLLSPSNNLTIEGFSDADWGAQPDDRRSSS  927

Query  1036  GYVLFFGSNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVL  1215
             GY+++ G N++SW S +QK V+  S E+EYR LA A  E+IW+  LLQ++ V +P  P+L
Sbjct  928   GYLVYLGGNLVSWSSTKQKVVSRSSAESEYRGLALATVEIIWMQALLQELCVPIPAIPLL  987

Query  1216  HCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPATSQIAAILTKGLGR  1395
               DN+SA ++ +N V+H+R KH+ +D  F+   ++ G +++  VP   Q A +LTK L  
Sbjct  988   WYDNISAYHMAKNPVFHARTKHIEIDLHFIXDQVIRGKIQLHFVPTEDQPADLLTKHLTS  1047

Query  1396  RLFEHFRSKMGVSDGSSILRGRIK  1467
               F   +S++ ++     LRG  K
Sbjct  1048  SRFLSLKSQLCIAXRPFHLRGDDK  1071



>ref|XP_010666841.1| PREDICTED: uncharacterized protein LOC104883959 [Beta vulgaris 
subsp. vulgaris]
Length=929

 Score =   202 bits (515),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 116/283 (41%), Positives = 174/283 (61%), Gaps = 8/283 (3%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPK--DQSTV  765
             L +FLG+ V     GLFLS  +Y  +I+++  M   K    P  +PVD  +PK   Q+ V
Sbjct  641   LSYFLGIAVSRHAGGLFLSHHKYAEEIIERAGMSACK----PSPTPVDT-KPKLSAQTEV  695

Query  766   AA-DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             A  D ++Y+ + G LQYL+ + PD+ Y + ++  FMH P+  H  A+KR++RY+KGT+ +
Sbjct  696   ACRDPSLYRSLAGALQYLTFSRPDISYAVQQICLFMHQPMEDHMSALKRIIRYVKGTLEY  755

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL L  S+   L +++D+DWGG  D  RST+GY +F G N++SW S RQ  ++  S E+E
Sbjct  756   GLHLYPSSITTLISYTDADWGGCPDTRRSTSGYCVFLGDNLLSWSSKRQTTLSCSSAESE  815

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YR +AN  +E  W+ NLL ++   +  + ++ CDN+SA+Y+  N V H R KH+ ++  F
Sbjct  816   YRGVANVVSESCWLRNLLLELHCPIKKATLVFCDNVSAIYLAGNPVQHQRTKHIEMEIHF  875

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             VR  +  G +RV HVP+  QI  I TKGL   LFE FR  + V
Sbjct  876   VREKVARGEVRVLHVPSHYQIGDIFTKGLPLILFEDFRDSLSV  918



>emb|CAN69607.1| hypothetical protein VITISV_009561 [Vitis vinifera]
Length=1207

 Score =   204 bits (520),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 119/266 (45%), Positives = 171/266 (64%), Gaps = 12/266 (5%)
 Frame = +1

Query  571   ANGILVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPK  750
             A   L +L +FLG+E  PTPDGLF+ Q +Y  DIL    + ++K V TP+V    L    
Sbjct  947   ATKDLGSLSYFLGLEASPTPDGLFIGQLKYARDILTLTQLLDSKPVHTPMVVSQHL----  1002

Query  751   DQSTVA----ADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLR  918
                TVA    ++ T+Y+ ++G LQYL IT  D+ + +N +SQF+H P + H+ AVKR+LR
Sbjct  1003  ---TVAGFPFSNPTLYRSLVGXLQYLPITRLDIAHAVNSVSQFLHAPTIDHFLAVKRILR  1059

Query  919   YLKGTVFHGLLLRRST-QLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKA  1095
             Y+KGT+  GL    ST    L A+SD+DW G  D  RST+GY ++ G+N++SW + +Q  
Sbjct  1060  YVKGTLHFGLTFCPSTIPSALVAYSDADWAGCPDTRRSTSGYSIYLGNNLVSWSAKKQPT  1119

Query  1096  VAHFSTeaeyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRM  1275
             V+  S E+EYRALA  AAE++W+ +LL D+ V +P  P+L CDN  A+++  N V H R 
Sbjct  1120  VSRSSCESEYRALAMTAAELLWLTHLLHDLNVPIPQQPLLLCDNKGAIFLSSNPVSHKRA  1179

Query  1276  KHLALDYFFVRVHIVNGTLRVQHVPA  1353
             KH+ LDY F+R  +V G LR Q+VP+
Sbjct  1180  KHVELDYHFLRELVVAGKLRTQYVPS  1205



>ref|XP_008337174.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
Length=777

 Score =   201 bits (512),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 153/221 (69%), Gaps = 2/221 (1%)
 Frame = +1

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             ++T+Y+ ++G LQYL+ T PD+ + +N + QFM +P  IH+ AVK +LRYL+GT+  G++
Sbjct  554   NSTLYRSIVGSLQYLTFTRPDIAFAVNTVCQFMSSPTEIHFGAVKCILRYLQGTIHTGIM  613

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                +T   L AFSDSDW    +  RS TGYVLF G+N ISW+S +Q +V+H STEAEY+A
Sbjct  614   YSAATSPQLNAFSDSDWAADLNTRRSVTGYVLFLGNNPISWQSKKQTSVSHGSTEAEYKA  673

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA+ AA++ WV N+L+D+ V L H P LHCDN+SA+ +  N V+HSR+KHL  D+  VR 
Sbjct  674   LAHTAADIAWVSNILKDLEVFLCHPPSLHCDNMSAIALSANPVFHSRIKHLDTDFHSVRE  733

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLF-EHFRS-KMG  1428
              +  G L V +VP   QIA ILTKGL    F +HF + K+G
Sbjct  734   RVQQGDLEVLYVPTEDQIADILTKGLHSPSFVKHFHNLKLG  774



>emb|CAN68711.1| hypothetical protein VITISV_015847 [Vitis vinifera]
Length=1168

 Score =   204 bits (519),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 113/269 (42%), Positives = 176/269 (65%), Gaps = 2/269 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+E+  +  GL+++Q++Y  D+L +  + ++K V TP+     L  P     ++ 
Sbjct  886   LSYFLGLEITHSTYGLYITQAKYASDLLSQAGLTDSKNVDTPVELNAHL-TPSGGKPLS-  943

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             + ++Y+R++G L YL++T PD+ YV++++SQ++  P   H+ AV R+LRYLKGT+FHGL 
Sbjct  944   NPSLYRRLVGSLVYLTVTRPDISYVVHQVSQYLSAPRSTHYAAVLRILRYLKGTIFHGLF  1003

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                 + L L AFSD+DW G     RSTTGY     S++ISWRS +Q  VA  STEA+YRA
Sbjct  1004  YSAQSPLVLRAFSDADWAGDPTDRRSTTGYCFLLDSSLISWRSKKQTFVARSSTEAKYRA  1063

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA+  +E++W+  LL+D+GV    +  L+CDN SA+++  N V+H R KH+ +D  F+R 
Sbjct  1064  LADTTSELLWLRWLLKDLGVSTSSATPLYCDNQSAIHIAHNDVFHERTKHIEIDCHFIRY  1123

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRR  1398
             H+V+G L++  V +  Q+A I TK L  R
Sbjct  1124  HLVHGALKLFFVSSKDQLADIFTKSLPTR  1152



>emb|CAN80558.1| hypothetical protein VITISV_023041 [Vitis vinifera]
Length=900

 Score =   202 bits (514),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 155/270 (57%), Gaps = 16/270 (6%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L AL +FL +EV+ T  G+ L+Q  Y  D+L +  M  A+ V TP+V+  +L      S 
Sbjct  647   LGALSYFLDIEVLTTLFGVLLTQRHYISDLLAQTKMSGARPVATPLVTYRNL--TLHSSI  704

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                + T Y+ +IG LQYL +T PD+ Y IN+LSQFMH     HW A K +LRYL GT+ H
Sbjct  705   ALTNCTEYRTLIGNLQYLCLTHPDILYAINKLSQFMHRLTSEHWNATKLLLRYLCGTLTH  764

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL L ++    L AFSD+DW G  D   S   Y+++ G + ISW S +Q           
Sbjct  765   GLFLYKANTFSLHAFSDADWAGNKDNYTSMIAYIVYLGCHPISWSSKKQLTAT-------  817

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
                     +E+ W+ + L ++ V LP  PV++CDN+ A Y+C N V+HS MK++A+DY F
Sbjct  818   -------TSEINWICSFLTELSVTLPTPPVIYCDNVGATYLCSNPVFHSSMKYVAIDYHF  870

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLG  1392
             +R  + +G LRV H   T+Q A  LTK L 
Sbjct  871   IRDQVQSGALRVTHFSLTNQFADALTKPLS  900



>ref|XP_008358376.1| PREDICTED: uncharacterized protein LOC103422119 [Malus domestica]
Length=1261

 Score =   204 bits (520),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 169/275 (61%), Gaps = 3/275 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG+ VI T   LFLSQS+Y +D+L+KV+M + K   TP +    L   KD  T
Sbjct  969   LGELHYFLGIXVIKTATXLFLSQSKYILDLLQKVEMVDCKPCDTPCLPYNRLV--KDDGT  1026

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                + T Y  ++G LQYL+ T   + + ++++ QFM +P++ H+   KR+LRYLKGT+  
Sbjct  1027  PYNNPTAYXSIVGALQYLTFTRXXIAFSVHQVCQFMXSPMMSHFTXXKRILRYLKGTLSV  1086

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             G+   R   L L AFSD+DW G  +  RSTTG V+F G+N ISW S +Q+ V+  STEAE
Sbjct  1087  GMSYTRG-DLLLKAFSDADWAGDPNDRRSTTGLVVFLGNNPISWSSKKQQTVSRSSTEAE  1145

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA++  + E+ W+  LL+ + V     PVL CDNLSA+ +  N V H R KH+ +D  F
Sbjct  1146  YRAMSTTSVELDWIQQLLEFLHVQPARPPVLFCDNLSAIALSFNPVQHQRTKHIEIDVHF  1205

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFE  1407
             VR  +    L VQ V +  Q A ILTKGL   LF+
Sbjct  1206  VRERVAQTKLCVQFVSSREQFADILTKGLSTPLFQ  1240



>ref|XP_006576040.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=312

 Score =   192 bits (488),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 163/289 (56%), Gaps = 0/289 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L  FLG+EV  +  G+ L Q +Y +DIL    M   ++  TP+ S   L         A 
Sbjct  22    LKIFLGIEVARSQQGIHLCQRKYVLDILFDSGMLACRLASTPMDSSTHLQAGIGDPLSAE  81

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             D++ Y+R++G L YL+ T PD+ Y + +LSQFM NP   H +A  RVL YLK +   G+ 
Sbjct  82    DSSSYRRLVGRLIYLTNTRPDISYAVQQLSQFMANPTTDHSKAASRVLHYLKSSPGCGIF  141

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                +    L AFSDSDW G  D  RS TG+ +F G+++ISW S +Q  V+  S+EAEYRA
Sbjct  142   FPTTGSTRLQAFSDSDWAGCRDTRRSITGFFIFLGNSLISWHSKKQSTVSRSSSEAEYRA  201

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA    E+ W+  LLQD  +       L CDN SA+ +  N V+H R KH+ LD + VR 
Sbjct  202   LATTTCELQWLTYLLQDFRIPFTQPANLFCDNQSAIQISSNQVFHKRTKHIELDCYIVRE  261

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
               +NG L++  V ++ Q+A I TK L    F+   SK+G+ +  S L G
Sbjct  262   KSLNGLLKLLPVRSSMQLADIFTKPLSPTQFKTLISKLGMINIYSQLEG  310



>ref|XP_008348842.1| PREDICTED: uncharacterized protein LOC103412011 [Malus domestica]
Length=1719

 Score =   205 bits (521),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/279 (44%), Positives = 173/279 (62%), Gaps = 4/279 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             LH+FLG+++  T  GLFLSQ++Y  D+L K +M EAK    P +    L   K+     +
Sbjct  866   LHYFLGIQITKTAHGLFLSQTKYVEDLLVKSEMJEAKPCDXPCLPYNRLL--KEDGEPYS  923

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             + T+Y+ ++G LQYL+ T P++ + ++++ QFM NP++ H+ AVK +LRYLKGT+  G+ 
Sbjct  924   NPTLYRSLVGALQYLTFTRPBIAFSVHQVCQFMQNPMVSHFTAVKXILRYLKGTMQFGIX  983

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                   L L AFSD+DW G  +   STTG V+F G++ ISW S +Q+ V+  STEAEYRA
Sbjct  984   YTXG-DLQLKAFSDADWAGDPNDRXSTTGLVVFLGNSXISWSSKKQQTVSRSSTEAEYRA  1042

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             L   +AE+ W+  LL  + + LP  PVL CDNLSA+ +  N V H + KH+ +D  FVR 
Sbjct  1043  LXFTSAELDWIKQLLVFLHIPLPSVPVLFCDNLSAIALSFNPVQHQKTKHIEVDVHFVRE  1102

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFE-HFRSKM  1425
              +    L VQ V +  Q A ILTKGL   LF  H R+ M
Sbjct  1103  RVSQKQLSVQFVSSXEQFADILTKGLSGPLFRTHCRNLM  1141



>gb|AAP21414.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF99446.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1393

 Score =   204 bits (519),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 172/285 (60%), Gaps = 3/285 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L +FLG+E+  +  G+ LSQ +Y +D+L    M   +   TPI     L     QS 
Sbjct  1107  LGPLRYFLGIEIARSSKGIVLSQRKYVLDLLTDTGMLGCRASTTPIDRNHQLCA---QSG  1163

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                D   YQR++G L YL  T PD+ Y ++ +S++MH+P   H   V ++LRYLKGT   
Sbjct  1164  DPVDKEAYQRLVGRLIYLCHTRPDISYAVSVVSRYMHDPRTGHLDVVHKILRYLKGTPGK  1223

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GL  R++  L++  + D+DW    D  RST+GY +F G N++SWRS +Q  VA  + EAE
Sbjct  1224  GLWFRKNGHLNVEGYCDADWASSMDDRRSTSGYCVFVGGNLVSWRSKKQAVVARSTAEAE  1283

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA+A + +E++W+ +LL ++ V+   + +LHCDN SA+ +  N V H R KH+ +D FF
Sbjct  1284  YRAMALSLSEMLWMRSLLTELRVLRSDTVMLHCDNKSAISIANNPVQHDRTKHVEIDRFF  1343

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
             ++  I +G LR++++ +  Q+A  LTKGLG    +   +KMG+ D
Sbjct  1344  IKEKIDSGVLRLEYIKSCEQLADCLTKGLGPSEIQSICNKMGMID  1388



>emb|CAN75478.1| hypothetical protein VITISV_020209 [Vitis vinifera]
Length=1074

 Score =   203 bits (516),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 172/289 (60%), Gaps = 0/289 (0%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             + +FLG++V      L L+Q  Y   +L++ ++HEAK   TP      L     +     
Sbjct  771   ISYFLGIKVTRLSHALHLNQQHYIHQLLERANLHEAKSASTPGALGKLLSAADGEPLSVL  830

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DAT Y+ ++G LQY+++T P++ + +NR  Q+M  P   H QA KR+LRYLKGT  HG+ 
Sbjct  831   DATHYRSLVGALQYITLTRPEISFAVNRACQYMARPTTSHLQAAKRILRYLKGTATHGIS  890

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             +  S  L L  ++D DW    D  RST+G+ LFF +N+ISW S +Q+ V+  S E+EY A
Sbjct  891   IHASPSLSLQGYTDVDWASCPDDKRSTSGFCLFFCTNLISWSSTKQRVVSRSSAESEYWA  950

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             LA   AEV WV  LL+++ +    +P++ CDN+SA  +  N V+H+R KH+ +D+ FVR 
Sbjct  951   LALLVAEVSWVQFLLKELCIPQQDTPLIWCDNISATALAANSVFHARSKHIEIDFHFVRD  1010

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
              +++  L +Q+VP+T Q+A + TK +    F   R+++ V      LRG
Sbjct  1011  KVLHKELLIQYVPSTDQLANVFTKHVPSCQFSAARTRLSVVPRPVSLRG  1059



>emb|CAN74499.1| hypothetical protein VITISV_013001 [Vitis vinifera]
Length=993

 Score =   202 bits (514),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/269 (41%), Positives = 174/269 (65%), Gaps = 2/269 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+E+  + DGL+++Q++Y  D+L +  + ++K V TP+     L  P     ++ 
Sbjct  711   LSYFLGLEITHSTDGLYITQAKYASDLLSQAGLTDSKTVDTPVELNAHL-TPSGGKPLS-  768

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             + ++Y+R++G L YL++T PD+ YV++++SQ++      H+  V  +LRYLKGT+FHGL 
Sbjct  769   NPSLYRRLVGSLVYLTVTRPDISYVVHQVSQYLSASRSTHYAVVLSILRYLKGTLFHGLF  828

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                 + L L  FSD+DW G     RSTTGY    GS++ISWRS +Q  VA  STEAEYRA
Sbjct  829   YSAQSPLVLRVFSDADWAGDPTNRRSTTGYCFLLGSSLISWRSKKQTFVARSSTEAEYRA  888

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             L +  +E++W+  LL+D+GV    +  L+CDN SA+++  N V+H R KH+ +D  F+R 
Sbjct  889   LTDTTSELLWLRWLLKDLGVSTSSATPLYCDNQSAIHIAHNDVFHERTKHIEIDCHFIRY  948

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRR  1398
             H+V+G L++  V +  Q+A I TK L +R
Sbjct  949   HLVHGALKLFSVSSKDQLADIFTKSLPKR  977



>ref|XP_002445564.1| hypothetical protein SORBIDRAFT_07g021665 [Sorghum bicolor]
 gb|EES15059.1| hypothetical protein SORBIDRAFT_07g021665 [Sorghum bicolor]
Length=599

 Score =   199 bits (505),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 152/239 (64%), Gaps = 2/239 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L  FLGV+V     G  LSQ+QYT DIL++  M   K   TP+ +   L         A 
Sbjct  361   LRFFLGVQVRRDAAGFSLSQAQYTEDILERAGMANCKPASTPVDAKQKLS--ATDGEPAT  418

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
             DAT Y+ + G LQYL++T PD+ Y +N+   +MH+P   HW  VKR+LRYL+G++  GL 
Sbjct  419   DATFYRSITGALQYLTLTRPDIAYAVNQACLYMHSPSAAHWSLVKRILRYLRGSISDGLF  478

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
             +  S    L A+SD+DW G  D  RST+GY +F G+ ++SW S RQ  V+  S EAEYRA
Sbjct  479   ISASPSNELQAYSDADWAGCPDTRRSTSGYCIFLGNTLVSWSSKRQPTVSRSSAEAEYRA  538

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVR  1308
             +ANAAAE  W+ NLLQ++ V +  + V++CDN+SA+Y+ QN V+H R KH+ LD  FVR
Sbjct  539   VANAAAECCWLRNLLQELHVHVGKATVIYCDNISAVYLSQNPVHHRRTKHVELDIHFVR  597



>emb|CAN82526.1| hypothetical protein VITISV_028058 [Vitis vinifera]
Length=1125

 Score =   203 bits (516),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/282 (41%), Positives = 169/282 (60%), Gaps = 3/282 (1%)
 Frame = +1

Query  592   LHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAA  771
             L +FLG+EV  +  G+ +SQ +YT++ILK      AK V  P+     L    D   +  
Sbjct  842   LKYFLGIEVSRSKKGISISQRKYTLEILKDGGFLGAKPVNFPMEQNTKL---SDSGELLK  898

Query  772   DATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLL  951
               + Y+R++G L YL+IT PD+ Y ++ LS+FMH P   H +A  RVLRYLK +   GL 
Sbjct  899   GPSQYRRLVGRLIYLTITRPDITYSVHVLSRFMHAPRRPHMEAALRVLRYLKNSPGQGLF  958

Query  952   LRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyra  1131
                   L L AFSD DW G     RS TGY +F GS++ISWR+ RQK V+  S EAEYRA
Sbjct  959   FPSQNDLSLRAFSDXDWAGCPISRRSXTGYCVFLGSSLISWRTKRQKTVSLSSXEAEYRA  1018

Query  1132  lanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRV  1311
             +A    E+ W+ +LL+D+ ++ P   +L+CDN +A+++  N V+H R +H+ +D  F+R 
Sbjct  1019  MAGTCCELSWLRSLLKDLRILHPKPALLYCDNTAALHIAVNPVFHERTRHIEMDCHFIRD  1078

Query  1312  HIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSD  1437
              I +G++  +H+ +T Q A + TK LG+  F     K+GV D
Sbjct  1079  KIQDGSVVTKHIASTDQXADVFTKPLGKETFSTMIHKLGVLD  1120



>ref|XP_008345130.1| PREDICTED: uncharacterized protein LOC103408038 [Malus domestica]
Length=1355

 Score =   204 bits (518),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 170/271 (63%), Gaps = 3/271 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG++VI T  GLFLSQS+Y +D+L+KV+M + K   TP +    L   KD  T
Sbjct  1030  LGELHYFLGIQVIKTATGLFLSQSKYILDLLQKVEMVDCKPCDTPCLPYNRLV--KDDGT  1087

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                + T Y+ ++G LQYL+ T PD+ + I+++ QFM +P+L ++ AVKR+LRYLKGT++ 
Sbjct  1088  PYNNPTAYRSIVGALQYLTFTRPDIAFSIHQVCQFMQSPMLSYFTAVKRILRYLKGTLYV  1147

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             G+   R   L L AFSD++W G  +   STTG V+F G+N ISW S +Q+ V+  STEAE
Sbjct  1148  GMSYTRG-DLLLKAFSDANWAGDPNDRSSTTGLVVFLGNNPISWSSKKQQTVSRSSTEAE  1206

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA++  +AE+ W+  LL+ + V     PVL CDNLSA+ +  NLV H R KH+ +D  F
Sbjct  1207  YRAMSTTSAELDWIQQLLEFLHVQPARPPVLFCDNLSAIALSFNLVQHQRTKHIEIDVHF  1266

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGR  1395
             V   +    L VQ V +  Q +     G  R
Sbjct  1267  VCERVAQTKLCVQFVSSREQFSGCGKPGWKR  1297



>emb|CAN72673.1| hypothetical protein VITISV_024842 [Vitis vinifera]
Length=433

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/265 (41%), Positives = 160/265 (60%), Gaps = 27/265 (10%)
 Frame = +1

Query  637   LFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQSTVAADATVYQRVIGLLQYL  816
             L  +  +Y  D+L +  M  AK+V TP+V+  +L             T++          
Sbjct  190   LLFNTKRYISDLLARTKMFGAKLVATPLVTDGNL-------------TIHS---------  227

Query  817   SITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFHGLLLRRSTQLHLAAFSDS  996
                  D+ YV+N+LSQFMH P+  HW A KR+L+YL GT+ HGL L ++  L L AFSD+
Sbjct  228   -----DISYVVNKLSQFMHCPISDHWNAAKRLLQYLCGTLTHGLFLHKANTLSLHAFSDA  282

Query  997   DWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeaeyralanaaaeVIWVHNLL  1176
             DW G  D    T+ Y+++ G + ISW S +Q+ +A  STE EYR+ A+  +E+ W+ +LL
Sbjct  283   DWAGNKDDYTFTSAYIVYLGRHPISWLSKKQRTIARSSTEVEYRSFASTISEINWICSLL  342

Query  1177  QDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFFVRVHIVNGTLRVQHVPAT  1356
              ++GV LP   V++CDN+ A Y+C N V+HSRMKH+A+DY F++  + +G LRV HV +T
Sbjct  343   TELGVTLPTPLVIYCDNVGATYLCFNPVFHSRMKHVAIDYHFIQDQVQSGALRVTHVSST  402

Query  1357  SQIAAILTKGLGRRLFEHFRSKMGV  1431
              Q+   LTK L R  F+  R K+G+
Sbjct  403   DQLVDTLTKLLPRSRFQELRVKIGI  427



>ref|XP_004304542.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Fragaria vesca subsp. vesca]
Length=343

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/270 (43%), Positives = 173/270 (64%), Gaps = 3/270 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  LH+FLG++V     GL ++Q +Y  D+L K D+   K   TP+ +  +L        
Sbjct  51    LGPLHYFLGLQVHTVSQGLHINQLKYAHDLLLKHDLLLRKPASTPMSAKTNLT--ATDGA  108

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
             +  + T ++ ++G LQYL+IT PD+ + +N +SQFM  P + H+ AVKR+LRY+KG++ H
Sbjct  109   LLPNPTPFRELVGSLQYLTITRPDIAFAVNTVSQFMSQPRVPHFIAVKRILRYIKGSLSH  168

Query  943   GLLLR-RSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTea  1119
             GLL   +     L+A+SD+DW G  D  RST+GY+++ GSN+ISW S +Q  +A  S E+
Sbjct  169   GLLFTPQQGTACLSAYSDADWAGCPDSRRSTSGYLVYLGSNLISWCSKKQPTIARSSAES  228

Query  1120  eyralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYF  1299
             EYR+LA+A+AE  W+  LL ++GV + +   LHCDNLSA Y+  N V+H+R KH+ LDY 
Sbjct  229   EYRSLAHASAETTWLGYLLYELGVRIQYLVQLHCDNLSATYMASNPVFHARTKHIELDYH  288

Query  1300  FVRVHIVNGTLRVQHVPATSQIAAILTKGL  1389
             FVR  +  G+  V  +P+  Q A +LTK L
Sbjct  289   FVREKVACGSHHVCFIPSKDQPADLLTKPL  318



>ref|XP_006603195.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=309

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 167/292 (57%), Gaps = 0/292 (0%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L  FLG+EV     G+ LSQ +Y +DIL    M  ++   TP+     L        
Sbjct  16    LGTLKFFLGLEVARNNKGIHLSQRKYVLDILSDSGMLASRPASTPMDYSTRLTASLGTPL  75

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
               A +++Y+R+IG L YL+ T PD+ +V+ +LSQ+M +P   H QA  RVLRYLKG+   
Sbjct  76    SEASSSLYRRLIGRLIYLTNTRPDITHVVQQLSQYMAHPTSAHSQAAFRVLRYLKGSPGS  135

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             G+ L  +  L L AFSDSDW    D   S TG+ ++ GS++ISWRS +Q  V+  S+EAE
Sbjct  136   GIFLAANGPLQLKAFSDSDWASCRDTRHSITGFSVYLGSSLISWRSKKQPTVSRSSSEAE  195

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRALA+   E+ W+  LLQD  V       L+CDN SA+ +  N V+H R KH+ +D   
Sbjct  196   YRALASTTCELQWLTYLLQDFRVSFIQPATLYCDNKSAIQIACNPVFHERTKHIEIDCHI  255

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGVSDGSSILRG  1458
             VR  +  G L++  + +  Q+A I TK L   LF+   SK+G+ +  S L G
Sbjct  256   VRDKVNQGCLKLLPISSQLQLADIFTKSLSPSLFQGLCSKLGMLNIHSQLEG  307



>emb|CAN61340.1| hypothetical protein VITISV_007301 [Vitis vinifera]
Length=973

 Score =   201 bits (512),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/283 (40%), Positives = 176/283 (62%), Gaps = 2/283 (1%)
 Frame = +1

Query  583   LVALHHFLGVEVIPTPDGLFLSQSQYTIDILKKVDMHEAKIVRTPIVSPVDLFRPKDQST  762
             L  L HFLG+EV  T +G+FL Q +Y  D+LKK  M E K + TP+     +   + +  
Sbjct  681   LGQLKHFLGLEVDCTHEGIFLCQQKYAKDLLKKFGMLECKSISTPMEPNAKMCEHEGKDL  740

Query  763   VAADATVYQRVIGLLQYLSITCPDVDYVINRLSQFMHNPLLIHWQAVKRVLRYLKGTVFH  942
                DAT+Y++++G L YL++T PD+ Y +  +S++M NP   H +AV+R+LR++KGT+ +
Sbjct  741   --KDATMYRQLVGSLVYLTLTRPDISYAVGVMSRYMQNPKKPHLEAVRRILRHVKGTIDY  798

Query  943   GLLLRRSTQLHLAAFSDSDWGGVHDGGRSTTGYVLFFGSNVISWRSVRQKAVAHFSTeae  1122
             GLL ++     L  + D+D+ G HD  RSTTGYV   GS  ISW S RQ  V+  +TEAE
Sbjct  799   GLLYKKGEDCKLVGYCDADYAGDHDTRRSTTGYVFMLGSGAISWCSKRQPTVSLLTTEAE  858

Query  1123  yralanaaaeVIWVHNLLQDMGVVLPHSPVLHCDNLSAMYVCQNLVYHSRMKHLALDYFF  1302
             YRA A AA E  W+  L+ D+  ++ ++  L+CDN SA+ + +N V+H+R KH+ + Y F
Sbjct  859   YRAAAMAAQESTWLIRLMNDLHQLVDYAVPLYCDNQSAVRLAENPVFHARTKHVEVHYHF  918

Query  1303  VRVHIVNGTLRVQHVPATSQIAAILTKGLGRRLFEHFRSKMGV  1431
             +R  ++   + ++ + +  Q+A + TKGL    FE F  ++G+
Sbjct  919   IREKVLEEEVELKQIKSKDQVADLFTKGLSGSKFECFCHQLGM  961



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4294633319592