BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21168_g2_i1 len=2600 path=[2551:0-751 3303:752-1676 4228:1677-1701
7012:1702-2599]

Length=2600
                                                                      Score     E

ref|XP_009613682.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8   1048   0.0      
ref|XP_004232684.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8   1044   0.0      
ref|XP_009777766.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8   1043   0.0      
ref|XP_006348158.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...   1041   0.0      
gb|EYU33875.1|  hypothetical protein MIMGU_mgv1a002066mg               1016   0.0      
emb|CDP04441.1|  unnamed protein product                               1013   0.0      
ref|XP_010099162.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8               993   0.0      
ref|XP_007213628.1|  hypothetical protein PRUPE_ppa002088mg             991   0.0      
ref|XP_008224758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    984   0.0      
ref|XP_002267170.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    981   0.0      Vitis vinifera
ref|XP_010244139.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    973   0.0      
ref|XP_010252506.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    973   0.0      
ref|XP_006586762.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    972   0.0      
gb|KDP20703.1|  hypothetical protein JCGZ_21174                         971   0.0      
ref|XP_007026173.1|  STRUBBELIG-receptor family 8 isoform 1             969   0.0      
ref|XP_006467380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    967   0.0      
gb|KDO78347.1|  hypothetical protein CISIN_1g005001mg                   964   0.0      
ref|XP_011002569.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    962   0.0      
ref|XP_011046989.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    961   0.0      
ref|XP_006597598.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    960   0.0      
ref|XP_010052883.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    959   0.0      
ref|XP_006449794.1|  hypothetical protein CICLE_v10014418mg             959   0.0      
ref|XP_010052884.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    957   0.0      
ref|XP_008355924.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    957   0.0      
ref|XP_008458998.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    956   0.0      
ref|XP_004145432.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    956   0.0      
ref|XP_009357210.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    954   0.0      
ref|XP_010686780.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    954   0.0      
gb|KEH36931.1|  strubbelig-receptor family protein                      950   0.0      
ref|XP_011002570.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    947   0.0      
gb|KHG11352.1|  protein strubbelig-receptor family 8                    945   0.0      
ref|XP_007147687.1|  hypothetical protein PHAVU_006G146100g             941   0.0      
ref|XP_004293321.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    941   0.0      
ref|XP_004486188.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    939   0.0      
ref|XP_002869840.1|  kinase                                             935   0.0      
ref|XP_009357487.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    932   0.0      
ref|XP_010448928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    926   0.0      
ref|XP_011086205.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    924   0.0      
ref|XP_008384096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    924   0.0      
ref|XP_006467381.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    921   0.0      
ref|XP_006413689.1|  hypothetical protein EUTSA_v10024563mg             921   0.0      
ref|NP_193944.2|  STRUBBELIG-receptor family 8 protein                  919   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX76385.1|  BnaA08g10150D                                          917   0.0      
ref|XP_009108553.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    915   0.0      
ref|XP_010539262.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    913   0.0      
emb|CDY27444.1|  BnaC03g64840D                                          910   0.0      
ref|XP_006449793.1|  hypothetical protein CICLE_v10014418mg             910   0.0      
ref|XP_010539255.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    909   0.0      
ref|XP_010538738.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    909   0.0      
ref|XP_010434074.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    905   0.0      
gb|KFK28787.1|  hypothetical protein AALP_AA7G048200                    904   0.0      
ref|XP_010928422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    896   0.0      
ref|XP_010943263.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    894   0.0      
ref|XP_010539270.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    892   0.0      
ref|XP_002316561.2|  hypothetical protein POPTR_0011s01540g             886   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009135627.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    885   0.0      
ref|XP_008799289.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    884   0.0      
gb|KCW77015.1|  hypothetical protein EUGRSUZ_D01360                     883   0.0      
ref|XP_010943264.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    883   0.0      
emb|CDX79126.1|  BnaA01g11930D                                          883   0.0      
ref|XP_007026174.1|  STRUBBELIG-receptor family 8 isoform 2             874   0.0      
ref|XP_009386651.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    872   0.0      
ref|XP_009385265.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    870   0.0      
ref|XP_004164349.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    866   0.0      
ref|XP_008803525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    865   0.0      
ref|XP_006648399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    860   0.0      
ref|XP_008645353.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    856   0.0      
ref|XP_004951618.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    856   0.0      
ref|XP_003571057.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    855   0.0      
dbj|BAK07184.1|  predicted protein                                      852   0.0      
ref|XP_010052885.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    848   0.0      
gb|EPS69681.1|  hypothetical protein M569_05081                         849   0.0      
ref|XP_006383864.1|  hypothetical protein POPTR_0004s00710g             845   0.0      
ref|XP_002451696.1|  hypothetical protein SORBIDRAFT_04g006110          846   0.0      Sorghum bicolor [broomcorn]
ref|XP_008458999.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    835   0.0      
ref|XP_002518426.1|  Serine/threonine-protein kinase PBS1, putative     832   0.0      Ricinus communis
ref|XP_009385272.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    833   0.0      
gb|EEC72655.1|  hypothetical protein OsI_06182                          829   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001046150.1|  Os02g0190500                                       813   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004965804.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    808   0.0      
ref|XP_008799298.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    800   0.0      
ref|XP_003563583.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    803   0.0      
gb|EEC81030.1|  hypothetical protein OsI_23812                          800   0.0      Oryza sativa Indica Group [Indian rice]
gb|AFW70556.1|  putative STRUBBELIG family receptor protein kinase      791   0.0      
ref|XP_006377174.1|  hypothetical protein POPTR_0011s01540g             783   0.0      
gb|KDO78348.1|  hypothetical protein CISIN_1g005001mg                   777   0.0      
gb|KDO78349.1|  hypothetical protein CISIN_1g005001mg                   775   0.0      
dbj|BAK02781.1|  predicted protein                                      776   0.0      
ref|XP_006449792.1|  hypothetical protein CICLE_v10014418mg             768   0.0      
gb|AFW87367.1|  putative STRUBBELIG family receptor protein kinase      762   0.0      
gb|AFW87368.1|  putative STRUBBELIG family receptor protein kinase      761   0.0      
ref|XP_008659801.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    760   0.0      
gb|EEE66066.1|  hypothetical protein OsJ_22073                          755   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMS51823.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8                    746   0.0      
ref|NP_001119030.1|  STRUBBELIG-receptor family 8 protein               739   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008649054.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    738   0.0      
ref|XP_008649053.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    738   0.0      
ref|XP_006657163.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    726   0.0      
gb|EMT22844.1|  hypothetical protein F775_52608                         717   0.0      
emb|CAN77920.1|  hypothetical protein VITISV_027646                     708   0.0      Vitis vinifera
ref|XP_009383597.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    702   0.0      
gb|KDO78351.1|  hypothetical protein CISIN_1g005001mg                   695   0.0      
ref|XP_004983096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    698   0.0      
ref|XP_008659800.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    692   0.0      
gb|EMT21016.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8                    691   0.0      
ref|XP_002962278.1|  hypothetical protein SELMODRAFT_76873              686   0.0      
ref|NP_001167741.1|  uncharacterized protein LOC100381429 precursor     687   0.0      Zea mays [maize]
gb|EMS53763.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8                    679   0.0      
ref|XP_004303773.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    681   0.0      
ref|XP_006836581.1|  hypothetical protein AMTR_s00131p00083660          681   0.0      
gb|KDP40614.1|  hypothetical protein JCGZ_24613                         680   0.0      
ref|NP_001064502.1|  Os10g0389800                                       668   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004144448.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    667   0.0      
ref|XP_004165988.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    667   0.0      
gb|ACG49227.1|  leucine-rich repeat transmembrane protein kinase 1      664   0.0      Zea mays [maize]
ref|XP_006465790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    664   0.0      
ref|XP_006604928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    659   0.0      
ref|XP_010542346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    655   0.0      
gb|KEH24658.1|  strubbelig-receptor family protein                      654   0.0      
gb|KHN16389.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    654   0.0      
ref|XP_004494892.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    651   0.0      
gb|EEC82450.1|  hypothetical protein OsI_26884                          648   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAC10113.1|  putative leucine-rich repeat transmembrane prote...    648   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006604929.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    646   0.0      
ref|NP_001060286.1|  Os07g0618400                                       645   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004510591.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    642   0.0      
gb|EEC66871.1|  hypothetical protein OsI_33412                          642   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006284970.1|  hypothetical protein CARUB_v10006274mg             640   0.0      
ref|XP_006598761.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    640   0.0      
ref|XP_010479951.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    640   0.0      
ref|XP_006583189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    639   0.0      
ref|XP_010439362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    638   0.0      
ref|XP_010462281.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    638   0.0      
ref|XP_010235400.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    636   0.0      
dbj|BAD37979.1|  putative leucine-rich repeat transmembrane prote...    630   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KCW53999.1|  hypothetical protein EUGRSUZ_J03194                     635   0.0      
ref|XP_010034888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    635   0.0      
gb|ADM07445.1|  leucine-rich repeat receptor-like protein kinase        634   0.0      
gb|EMT02096.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    631   0.0      
ref|XP_010928424.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    629   0.0      
ref|XP_002513297.1|  strubbelig receptor, putative                      628   0.0      Ricinus communis
dbj|BAG99361.1|  unnamed protein product                                625   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_175777.1|  STRUBBELIG-receptor family 6                          625   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003562663.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    642   0.0      
ref|XP_006845116.1|  hypothetical protein AMTR_s00005p00184950          612   0.0      
emb|CDX82908.1|  BnaC01g13580D                                          624   0.0      
ref|NP_001077716.1|  STRUBBELIG-receptor family 6                       622   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010534991.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    621   0.0      
gb|AFW76248.1|  putative STRUBBELIG family receptor protein kinase      624   0.0      
gb|KHN01483.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    617   0.0      
gb|AFW76246.1|  putative STRUBBELIG family receptor protein kinas...    625   0.0      
emb|CDY24077.1|  BnaA06g00750D                                          616   0.0      
ref|XP_009591325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    614   0.0      
ref|XP_009147586.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    614   0.0      
ref|XP_007135353.1|  hypothetical protein PHAVU_010G122100g             613   0.0      
gb|AAK52120.1|AC079936_16  Putative leucine-rich repeat transmemb...    613   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KGN45936.1|  hypothetical protein Csa_6G024930                       612   0.0      
emb|CAA18116.1|  serine/threonine protein kinase like protein           594   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004138532.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    601   0.0      
ref|XP_002316560.2|  hypothetical protein POPTR_0011s01540g             587   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_001763842.1|  predicted protein                                  582   0.0      
ref|XP_006841742.1|  hypothetical protein AMTR_s00003p00260350          584   0.0      
ref|XP_006383865.1|  hypothetical protein POPTR_0004s00710g             573   0.0      
gb|EEE67594.1|  hypothetical protein OsJ_25142                          573   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMT07607.1|  Protein STRUBBELIG-RECEPTOR FAMILY 7                    585   0.0      
ref|XP_008649052.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    570   0.0      
ref|XP_006850050.1|  hypothetical protein AMTR_s00022p00198910          567   0.0      
ref|XP_008649051.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    570   0.0      
ref|XP_002532341.1|  Receptor protein kinase CLAVATA1 precursor, ...    563   0.0      Ricinus communis
tpg|DAA46922.1|  TPA: putative STRUBBELIG family receptor protein...    555   0.0      
dbj|BAJ88293.1|  predicted protein                                      541   0.0      
gb|AFW76250.1|  putative STRUBBELIG family receptor protein kinase      543   1e-180   
gb|AFW76249.1|  putative STRUBBELIG family receptor protein kinase      543   2e-180   
ref|XP_011075267.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    549   6e-180   
ref|XP_010928729.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    543   3e-178   
ref|XP_002521411.1|  lrr receptor-linked protein kinase, putative       541   7e-178   Ricinus communis
ref|XP_010914020.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    537   5e-175   
ref|XP_010534354.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    532   1e-173   
gb|KDP24601.1|  hypothetical protein JCGZ_25517                         530   5e-173   
ref|XP_010557935.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    529   2e-172   
ref|XP_010534352.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    528   6e-172   
gb|KDO50163.1|  hypothetical protein CISIN_1g039558mg                   526   3e-171   
dbj|BAJ87185.1|  predicted protein                                      521   4e-171   
ref|XP_009797583.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    525   1e-170   
ref|XP_006429833.1|  hypothetical protein CICLE_v10013344mg             523   8e-170   
ref|XP_001776313.1|  predicted protein                                  501   2e-166   
emb|CDP20023.1|  unnamed protein product                                509   3e-165   
ref|XP_010921975.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    509   1e-164   
ref|XP_002965192.1|  hypothetical protein SELMODRAFT_83158              490   2e-162   
gb|KCW90298.1|  hypothetical protein EUGRSUZ_A02440                     502   6e-162   
ref|XP_010913799.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    497   1e-160   
ref|XP_008775322.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    496   1e-159   
ref|XP_001783845.1|  predicted protein                                  494   4e-159   
ref|XP_010534992.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    491   9e-159   
ref|XP_010423291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    491   2e-157   
ref|XP_009797595.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    487   3e-156   
ref|XP_010557936.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    485   9e-156   
ref|XP_009416083.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    484   3e-155   
gb|ACN58180.1|  leucine-rich repeat protein                             462   2e-153   Dasypyrum villosum
gb|ABQ53156.1|  leucine-rich repeat protein                             462   5e-153   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008775327.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    478   7e-153   
emb|CBI35784.3|  unnamed protein product                                477   2e-152   
ref|XP_008775325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    477   2e-152   
ref|XP_010654359.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    477   2e-152   
ref|XP_002979973.1|  hypothetical protein SELMODRAFT_112070             462   6e-152   
ref|XP_010273793.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    475   1e-151   
ref|XP_008783422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    473   1e-150   
ref|XP_008783430.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    471   1e-150   
ref|XP_001780717.1|  predicted protein                                  455   2e-149   
ref|NP_001241934.1|  protein STRUBBELIG-RECEPTOR FAMILY 6-like          464   4e-149   
emb|CAN80221.1|  hypothetical protein VITISV_027894                     465   2e-148   Vitis vinifera
gb|AAC27894.1|  leucine-rich repeat transmembrane protein kinase 1      463   1e-147   Zea mays [maize]
ref|XP_002533323.1|  leucine-rich repeat transmembrane protein ki...    460   2e-147   Ricinus communis
ref|XP_008651696.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    463   4e-147   
ref|XP_008651693.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    464   4e-147   
emb|CDO97777.1|  unnamed protein product                                462   7e-147   
ref|XP_008465039.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    458   8e-147   
ref|XP_007217016.1|  hypothetical protein PRUPE_ppa002092mg             462   9e-147   
ref|XP_008228094.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    461   2e-146   
ref|XP_008465038.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    458   4e-146   
ref|XP_010937238.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    459   5e-146   
ref|XP_007024796.1|  Strubbelig-receptor family 6                       460   6e-146   
ref|XP_010937237.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    459   1e-145   
ref|XP_004985465.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    459   1e-145   
ref|XP_006661732.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    459   2e-145   
ref|XP_002468389.1|  hypothetical protein SORBIDRAFT_01g045010          459   2e-145   Sorghum bicolor [broomcorn]
ref|XP_008465036.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    457   3e-145   
gb|ABO31100.1|  ovule receptor-like kinase 28                           458   3e-145   Solanum chacoense
ref|XP_010033635.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    458   5e-145   
ref|XP_011072711.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    457   6e-145   
ref|XP_004985464.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    458   7e-145   
ref|XP_008465033.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    457   7e-145   
ref|XP_006342885.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    457   9e-145   
ref|XP_008465035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    457   1e-144   
ref|XP_008372915.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    457   1e-144   
ref|XP_006426818.1|  hypothetical protein CICLE_v10025011mg             457   1e-144   
gb|EYU21255.1|  hypothetical protein MIMGU_mgv1a002171mg                456   2e-144   
ref|XP_008659003.1|  PREDICTED: leucine-rich repeat transmembrane...    454   3e-144   
ref|XP_004235517.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    455   3e-144   
ref|XP_009614011.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    455   4e-144   
gb|EYU21256.1|  hypothetical protein MIMGU_mgv1a002171mg                454   6e-144   
gb|KEH18524.1|  strubbelig-receptor family 6 protein                    454   7e-144   
ref|XP_009796493.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    455   7e-144   
ref|XP_003627481.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 454   1e-143   
gb|AFW89442.1|  putative STRUBBELIG family receptor protein kinase      454   2e-143   
gb|KHG12210.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    451   8e-143   
ref|XP_009388759.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    451   2e-142   
ref|XP_009388758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    451   2e-142   
ref|XP_010913800.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    449   3e-142   
ref|NP_001049184.1|  Os03g0183800                                       450   3e-142   Oryza sativa Japonica Group [Japonica rice]
gb|KHG12209.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    451   3e-142   
ref|XP_008380807.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    451   4e-142   
ref|XP_008800485.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    449   9e-142   
gb|KHG18134.1|  protein strubbelig-receptor family 6                    449   1e-141   
ref|XP_010939842.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    447   1e-141   
ref|XP_006649512.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    449   1e-141   
ref|NP_001104882.1|  leucine-rich repeat transmembrane protein ki...    449   2e-141   Zea mays [maize]
ref|XP_003558655.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    448   2e-141   
ref|XP_010939841.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    447   3e-141   
ref|XP_004141737.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    444   5e-141   
gb|EMS47769.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    442   2e-140   
ref|XP_008462233.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    444   2e-140   
ref|XP_009386772.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    446   2e-140   
ref|XP_008462232.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    444   4e-140   
ref|XP_009619763.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    444   7e-140   
ref|XP_008462231.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    444   7e-140   
gb|KHG25534.1|  protein strubbelig-receptor family 6                    443   3e-139   
ref|XP_009788970.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    442   4e-139   
ref|XP_010685195.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    442   5e-139   
gb|KDO78353.1|  hypothetical protein CISIN_1g005001mg                   432   6e-139   
ref|XP_009788969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    441   1e-138   
ref|XP_006850999.1|  hypothetical protein AMTR_s00025p00216900          438   1e-138   
ref|XP_002467303.1|  hypothetical protein SORBIDRAFT_01g024160          439   3e-138   Sorghum bicolor [broomcorn]
ref|XP_010096526.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6               439   4e-138   
ref|XP_002304260.2|  hypothetical protein POPTR_0003s07130g             439   5e-138   Populus trichocarpa [western balsam poplar]
ref|XP_011031832.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    435   2e-136   
ref|XP_004252624.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    434   3e-136   
gb|EPS61932.1|  ovule receptor-like kinase 28                           434   3e-136   
ref|XP_006362102.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    434   6e-136   
gb|EMT09510.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    432   1e-135   
ref|XP_010487232.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    427   2e-135   
emb|CDY02495.1|  BnaA08g01020D                                          431   7e-135   
ref|XP_002461023.1|  hypothetical protein SORBIDRAFT_02g039370          431   8e-135   
ref|XP_004958321.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    430   2e-134   
emb|CDX98445.1|  BnaC05g39300D                                          430   2e-134   
ref|XP_002885038.1|  hypothetical protein ARALYDRAFT_478852             430   2e-134   
ref|XP_010501035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    429   4e-134   
ref|NP_974311.1|  STRUBBELIG-receptor family 7 protein                  427   5e-134   
ref|XP_006300068.1|  hypothetical protein CARUB_v10016296mg             429   7e-134   
ref|XP_010501850.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    428   2e-133   
ref|XP_010465325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    428   2e-133   
ref|NP_188052.2|  STRUBBELIG-receptor family 7 protein                  427   2e-133   
ref|XP_011079189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    426   2e-133   
ref|XP_009106960.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    427   3e-133   
gb|KFK38799.1|  hypothetical protein AALP_AA3G161700                    427   3e-133   
ref|XP_006392758.1|  hypothetical protein EUTSA_v10011271mg             426   6e-133   
ref|XP_006392757.1|  hypothetical protein EUTSA_v10011271mg             426   1e-132   
ref|XP_010228525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    423   2e-132   
emb|CDY25686.1|  BnaC03g69890D                                          424   2e-132   
ref|XP_010228524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    424   3e-132   
ref|XP_003557758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    424   4e-132   
ref|XP_008653346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    422   6e-132   
gb|AAV64203.1|  leucine-rich repeat transmembrane protein kinase ...    422   7e-132   
ref|XP_002891770.1|  hypothetical protein ARALYDRAFT_474507             423   8e-132   
ref|XP_008653345.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    423   9e-132   
ref|XP_006650171.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    424   1e-131   
ref|XP_006407090.1|  hypothetical protein EUTSA_v10020162mg             422   1e-131   
emb|CDX97567.1|  BnaA05g25120D                                          422   1e-131   
ref|XP_009146380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    422   2e-131   
gb|KFK35699.1|  hypothetical protein AALP_AA4G025700                    421   4e-131   
ref|XP_006657962.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    421   6e-131   
emb|CDY36601.1|  BnaC06g06540D                                          420   6e-131   
gb|ABB20817.1|  putative leucine-rich repeat transmembrane protei...    421   6e-131   
gb|AFQ91933.1|  leucine-rich repeat receptor-like kinase                421   7e-131   
ref|XP_006435523.1|  hypothetical protein CICLE_v10010883mg             405   4e-130   
gb|EAY90345.1|  hypothetical protein OsI_11922                          419   8e-130   
emb|CDY39110.1|  BnaA01g29460D                                          418   9e-130   
ref|XP_006447319.1|  hypothetical protein CICLE_v10014768mg             412   2e-129   
ref|XP_009116969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    417   2e-129   
gb|AAP12946.1|  putative leucine-rich repeat transmembrane protei...    417   5e-129   
ref|XP_010245765.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    417   7e-129   
emb|CAN60971.1|  hypothetical protein VITISV_032050                     407   3e-128   
emb|CDY33226.1|  BnaC01g36990D                                          413   6e-128   
gb|KDP25030.1|  hypothetical protein JCGZ_22565                         412   9e-128   
ref|XP_002465165.1|  hypothetical protein SORBIDRAFT_01g033190          412   1e-127   
ref|XP_011012291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    411   1e-127   
ref|XP_006357429.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    410   4e-127   
ref|XP_010278329.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    407   5e-127   
ref|XP_009350761.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    410   6e-127   
ref|XP_008341914.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    409   6e-127   
ref|XP_006491630.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    412   1e-126   
ref|XP_009775785.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    396   2e-126   
ref|XP_006488603.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    408   2e-126   
gb|EYU27953.1|  hypothetical protein MIMGU_mgv1a002415mg                407   3e-126   
ref|XP_010268782.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    410   3e-126   
emb|CDP14731.1|  unnamed protein product                                411   4e-126   
ref|XP_002517969.1|  lrr receptor-linked protein kinase, putative       407   7e-126   
ref|XP_009350757.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    409   8e-126   
ref|XP_009350736.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    409   1e-125   
ref|XP_008230238.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    409   1e-125   
ref|XP_011011656.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    406   1e-125   
ref|XP_008341912.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    409   2e-125   
ref|XP_010268781.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    409   2e-125   
ref|XP_010278322.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    408   2e-125   
ref|XP_010278328.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    407   2e-125   
ref|XP_009777356.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    403   2e-125   
ref|XP_006371595.1|  hypothetical protein POPTR_0019s13490g             408   2e-125   
ref|XP_006371594.1|  leucine-rich repeat transmembrane protein ki...    408   3e-125   
ref|XP_001778654.1|  predicted protein                                  389   7e-125   
ref|XP_010655241.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    400   1e-124   
ref|XP_007217036.1|  hypothetical protein PRUPE_ppa001617mg             407   1e-124   
gb|KDP24176.1|  hypothetical protein JCGZ_25833                         403   2e-124   
ref|XP_009777352.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    403   2e-124   
ref|XP_009777355.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    402   3e-124   
emb|CBI18374.3|  unnamed protein product                                402   7e-124   
gb|KHG30272.1|  protein strubbelig-receptor family 3                    394   8e-124   
ref|XP_002320001.2|  leucine-rich repeat transmembrane protein ki...    401   8e-124   
ref|XP_010655239.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    401   8e-124   
ref|XP_009398616.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    396   1e-123   
ref|XP_010313855.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    397   4e-123   
gb|KGN43589.1|  hypothetical protein Csa_7G047250                       402   5e-123   
ref|XP_004155482.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    402   7e-123   
ref|XP_011039760.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    399   7e-123   
ref|XP_008787303.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    395   7e-123   
ref|XP_007217699.1|  hypothetical protein PRUPE_ppa002458mg             398   7e-123   
dbj|BAF00067.1|  SRF3                                                   386   9e-123   
ref|XP_009344018.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    394   1e-122   
ref|XP_009398614.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    397   2e-122   
ref|XP_009398615.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    395   2e-122   
ref|XP_006396563.1|  hypothetical protein EUTSA_v100284771mg            386   5e-122   
ref|XP_004304119.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    400   5e-122   
ref|XP_006350044.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    398   1e-121   
ref|XP_009767606.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    397   2e-121   
ref|XP_011039757.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    398   2e-121   
ref|XP_004251794.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    397   2e-121   
ref|XP_008228078.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    395   2e-121   
ref|XP_004487313.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    397   3e-121   
ref|XP_008380426.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    390   3e-121   
ref|XP_009344017.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    394   4e-121   
ref|XP_008455343.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    397   5e-121   
ref|XP_008356124.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    397   7e-121   
ref|XP_007149883.1|  hypothetical protein PHAVU_005G106800g             396   1e-120   
ref|XP_009406399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    394   1e-120   
ref|XP_010095810.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3               396   2e-120   
ref|XP_006376519.1|  hypothetical protein POPTR_0013s14080g             390   2e-120   
ref|XP_009408730.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    393   2e-120   
ref|XP_007043518.1|  Strubbelig-receptor family 3 isoform 1             395   4e-120   
ref|XP_006594861.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    394   4e-120   
ref|XP_008380425.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    391   5e-120   
gb|KHN36613.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    393   6e-120   
emb|CDO97730.1|  unnamed protein product                                393   7e-120   
gb|KEH39081.1|  strubbelig receptor family protein                      393   9e-120   
ref|XP_002310348.1|  leucine-rich repeat transmembrane protein ki...    390   1e-119   
ref|XP_009357082.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    394   1e-119   
ref|XP_009346025.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    386   1e-119   
ref|XP_007132645.1|  hypothetical protein PHAVU_011G112700g             394   2e-119   
ref|XP_010556827.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    392   2e-119   
ref|XP_011031253.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    389   3e-119   
gb|KEH29626.1|  strubbelig receptor family protein                      390   4e-119   
ref|XP_009616311.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    389   4e-119   
ref|XP_002319371.2|  hypothetical protein POPTR_0013s14080g             390   5e-119   
gb|KDP20913.1|  hypothetical protein JCGZ_21384                         390   6e-119   
ref|XP_009616310.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    389   6e-119   
gb|KHG16784.1|  protein strubbelig-receptor family 5                    384   9e-119   
ref|XP_009623074.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    391   9e-119   
ref|XP_009625937.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    390   1e-118   
gb|KCW89495.1|  hypothetical protein EUGRSUZ_A01788                     389   1e-118   
ref|XP_010537759.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    384   2e-118   
ref|XP_010323714.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    390   2e-118   
ref|XP_010069855.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    389   3e-118   
ref|XP_009346024.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    387   3e-118   
ref|XP_011072790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    387   3e-118   
ref|XP_010455895.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    384   4e-118   
ref|XP_002872781.1|  hypothetical protein ARALYDRAFT_490225             389   5e-118   
ref|XP_010689695.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    389   6e-118   
gb|KEH29625.1|  strubbelig receptor family protein                      390   6e-118   
gb|AAL07025.1|  putative LRR receptor protein kinase                    388   7e-118   
gb|KHN22911.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    389   8e-118   
ref|XP_010689694.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    389   9e-118   
ref|NP_565489.2|  strubbelig-receptor family 1 protein                  388   9e-118   
ref|XP_010689690.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    389   1e-117   
ref|XP_008445635.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    386   1e-117   
ref|XP_010431041.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    388   1e-117   
ref|XP_010422467.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    388   1e-117   
ref|XP_004488910.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    385   2e-117   
ref|XP_009781364.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    385   2e-117   
ref|XP_010537758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    385   2e-117   
ref|XP_009781363.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    384   3e-117   
ref|XP_004507203.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    388   3e-117   
ref|XP_004305791.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    385   3e-117   
ref|XP_009781362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    385   4e-117   
ref|XP_008781708.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    384   4e-117   
emb|CDY21962.1|  BnaC09g00680D                                          385   4e-117   
ref|XP_008224986.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    385   5e-117   
gb|AAD14467.1|  putative LRR receptor-linked protein kinase             385   7e-117   
emb|CDX87418.1|  BnaA07g34550D                                          383   7e-117   
ref|XP_004241858.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    383   8e-117   
ref|XP_010526526.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    384   1e-116   
ref|XP_011085359.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    385   1e-116   
gb|ADM21174.1|  SRF3                                                    385   1e-116   
ref|NP_192248.2|  STRUBBELIG-receptor family 3                          385   1e-116   
gb|ADM21184.1|  strubbelig receptor family 3                            385   1e-116   
gb|ADM21173.1|  SRF3                                                    385   1e-116   
ref|XP_010657277.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    385   2e-116   
ref|XP_007023605.1|  Strubbelig-receptor family 5 isoform 1             388   2e-116   
ref|XP_010455893.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    385   2e-116   
gb|KHN38109.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    382   2e-116   
emb|CDY48557.1|  BnaA09g01530D                                          384   2e-116   
ref|XP_010526524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    384   2e-116   
ref|XP_003604115.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 385   2e-116   
emb|CDX88495.1|  BnaC06g39390D                                          382   2e-116   
ref|XP_009121906.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    384   2e-116   
ref|XP_006586431.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    383   2e-116   
ref|XP_009106613.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    382   3e-116   
gb|KHN41147.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    384   3e-116   
ref|XP_003539524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    383   6e-116   
ref|XP_002988579.1|  hypothetical protein SELMODRAFT_21917              368   6e-116   
gb|KHN04276.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    383   8e-116   
ref|NP_001275442.1|  LRR receptor-like kinase precursor                 383   1e-115   
gb|ADB93024.1|  leucine-rich repeat receptor-like protein kinase        364   1e-115   
gb|EYU26127.1|  hypothetical protein MIMGU_mgv1a001622mg                382   1e-115   
ref|XP_009593450.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    380   2e-115   
ref|XP_009593677.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    380   2e-115   
ref|XP_008383797.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    381   2e-115   
ref|XP_002979273.1|  hypothetical protein SELMODRAFT_110362             368   3e-115   
ref|XP_009593738.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    380   3e-115   
ref|XP_006389935.1|  hypothetical protein EUTSA_v10019668mg             379   3e-115   
gb|ACM89529.1|  leucine-rich repeat transmembrane protein kinase        364   5e-115   
ref|XP_010087069.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5               378   5e-115   
ref|XP_010417514.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    378   6e-115   
emb|CDY48203.1|  BnaCnng15940D                                          379   1e-114   
ref|XP_006301930.1|  hypothetical protein CARUB_v10022406mg             377   1e-114   
ref|NP_178019.2|  STRUBBELIG-receptor family 5                          377   2e-114   
gb|ABI81608.1|  strubbelig receptor family 1 protein isoform a          379   3e-114   
ref|XP_010474484.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    376   3e-114   
ref|XP_009134350.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    378   3e-114   
ref|XP_010316715.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    377   5e-114   
ref|XP_010316716.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    377   6e-114   
ref|XP_010316713.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    377   6e-114   
ref|XP_010316717.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    377   8e-114   
ref|XP_002889223.1|  ATP binding protein                                375   9e-114   
ref|XP_004155578.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    375   2e-113   
ref|XP_002305672.2|  hypothetical protein POPTR_0004s03720g             374   3e-113   
ref|XP_010696576.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    375   3e-113   
ref|XP_009391183.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    373   4e-113   
ref|XP_004134722.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    375   4e-113   
ref|XP_006594611.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    374   5e-113   
ref|XP_011045475.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    374   6e-113   
ref|XP_004485734.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    373   7e-113   
ref|XP_009789819.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    374   7e-113   
ref|XP_009789818.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    374   7e-113   
ref|XP_009789815.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    374   8e-113   
emb|CDX90888.1|  BnaA03g25680D                                          374   9e-113   
ref|XP_011045474.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    374   1e-112   
ref|XP_009378447.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    374   1e-112   
ref|XP_011045472.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    374   1e-112   
ref|XP_011027920.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    372   2e-112   
ref|XP_011027918.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    373   3e-112   
emb|CAN75709.1|  hypothetical protein VITISV_031422                     367   3e-112   
ref|XP_011027919.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    372   3e-112   



>ref|XP_009613682.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Nicotiana tomentosiformis]
Length=725

 Score =  1048 bits (2710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/697 (78%), Positives = 604/697 (87%), Gaps = 12/697 (2%)
 Frame = +1

Query  268   SRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIE  447
             S L  V A TDPNDLQAL+VLY SLNSPSQL+ WK++GGDPC ESWKG++CQG++VVSI+
Sbjct  31    SSLLVVEANTDPNDLQALQVLYSSLNSPSQLTNWKSNGGDPCNESWKGISCQGTSVVSIQ  90

Query  448   IPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSI  627
             IP LGLNGT+GYMLNG TSLK LD+S N IHD IPYQLPPNLTSLNLA NNI+G++PYSI
Sbjct  91    IPDLGLNGTLGYMLNGLTSLKNLDMSGNNIHDSIPYQLPPNLTSLNLAKNNISGNVPYSI  150

Query  628   SLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQ  807
             + M +LNYLN S NSL+Q IGD+FTN SDL TLDLS NNFSGDLP S  LL+NLS L +Q
Sbjct  151   AGMVTLNYLNLSRNSLSQTIGDVFTNHSDLATLDLSSNNFSGDLPPSFSLLTNLSTLHLQ  210

Query  808   NNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftp  987
             NNQL+G+LN+LV LPLT+LNVA N F+GWIPNEL+SIP F Y GNSF+N PAPPPPP+TP
Sbjct  211   NNQLSGTLNILVGLPLTNLNVAKNHFNGWIPNELLSIPNFVYDGNSFANGPAPPPPPYTP  270

Query  988   pppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsa  1167
             PPPGR     N S P S   PGS+  + D + G       +  GAI+GIVLGSS  VL A
Sbjct  271   PPPGRSRNNRNRSPPRSRTRPGSNPENGDKKKG-------LTTGAIIGIVLGSSLAVLFA  323

Query  1168  ivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATVVDLKPPPSEKVTI  1338
             +V +V+C RR K KE AAR S+GSLP++T+K   EV +QRAK  A V DLKPPP+EKVT+
Sbjct  324   LVALVFCFRRGKGKEIAARPSSGSLPVNTEKVNMEVQEQRAKPAAAVADLKPPPTEKVTV  383

Query  1339  ERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLA  1512
             ER+QGKNGS+RR  SPITAT YTVA LQT+TNSFSQENL+GEGSLGRVYRA+FPNGK++A
Sbjct  384   ERIQGKNGSVRRVKSPITATSYTVAALQTSTNSFSQENLIGEGSLGRVYRAEFPNGKIMA  443

Query  1513  IKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDM  1692
             IKK+DSAALSLQEEDNFLEA+SNMSRLRH NIV L+GYCAEHGQRLLVYD++ NGSLHDM
Sbjct  444   IKKIDSAALSLQEEDNFLEAVSNMSRLRHQNIVALIGYCAEHGQRLLVYDHVANGSLHDM  503

Query  1693  LHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSD  1872
             LHFADERS LLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSD
Sbjct  504   LHFADERSTLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSD  563

Query  1873  CGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLD  2052
             CGLAAL PNTER +SST +VGSFGYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKPLD
Sbjct  564   CGLAALNPNTERPVSSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLD  623

Query  2053  SSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRP  2232
             SSR RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRP
Sbjct  624   SSRMRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRP  683

Query  2233  PMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             PMSEVVQALVRL+QRASVV RR SDES F YKTPDH+
Sbjct  684   PMSEVVQALVRLMQRASVVKRRSSDESAFTYKTPDHE  720



>ref|XP_004232684.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Solanum lycopersicum]
Length=724

 Score =  1044 bits (2699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/706 (77%), Positives = 604/706 (86%), Gaps = 9/706 (1%)
 Frame = +1

Query  244   VLVIAALISRLGFVGAA-TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             ++VI A+     FV    TDPNDLQAL+VLY SLN+PSQLS WK++GGDPCGESWKG+TC
Sbjct  17    LVVIVAVGFYSSFVAEGNTDPNDLQALQVLYASLNNPSQLSNWKSNGGDPCGESWKGITC  76

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
             Q S+VVSI+IP LGLNGT+GYMLNG TSLK LDLS N IHD IPYQLPPNLTSLNLANNN
Sbjct  77    QASSVVSIQIPDLGLNGTLGYMLNGLTSLKNLDLSGNNIHDSIPYQLPPNLTSLNLANNN  136

Query  601   ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
             I+G+IPYS + M +L+YLN S NSL+Q IG++F+N SDL TLDLS NNFSGDLP+S   L
Sbjct  137   ISGNIPYSFAGMVTLSYLNLSHNSLSQTIGELFSNHSDLGTLDLSSNNFSGDLPSSFSSL  196

Query  781   SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSp  960
             +NLS L ++NNQL+G LN+L+DLPLT+LNVA N F+GWIPNEL+SIP F Y GNSF+N P
Sbjct  197   TNLSTLHLENNQLSGPLNILIDLPLTNLNVAKNHFNGWIPNELLSIPNFIYDGNSFANGP  256

Query  961   apppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivl  1140
             APPPPP+T PPPGR     +HS P S   PGSD   S        G   +  GAIVGI L
Sbjct  257   APPPPPYTAPPPGRSRHNRSHSPPSSRTRPGSDGPPSPENGDKKKG---LTTGAIVGIAL  313

Query  1141  gssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATVVDLK  1311
             GSS  +L A+V +V+C RR K KE A R STGSLP+ TDK   EV +QRAK    V DLK
Sbjct  314   GSSLAILFALVALVFCFRRGKGKEIATRPSTGSLPVGTDKVNMEVQEQRAKPVVAVADLK  373

Query  1312  PPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRA  1485
             PPP+EKVT+E +QGKNGS+RR  SPITA+ YTVA LQTATNSFSQENL+GEGSLGRVYRA
Sbjct  374   PPPTEKVTVEMIQGKNGSVRRVKSPITASAYTVAALQTATNSFSQENLIGEGSLGRVYRA  433

Query  1486  DFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDY  1665
             +FPNGK++ IKK+DSAALSLQEEDNFLEA+SNMSRLRHPNIV L+GYCAEHGQRLLVYD+
Sbjct  434   EFPNGKIMVIKKIDSAALSLQEEDNFLEAVSNMSRLRHPNIVQLIGYCAEHGQRLLVYDH  493

Query  1666  IGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLD  1845
             + NGSLHDMLHFADERS+LLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLD
Sbjct  494   VANGSLHDMLHFADERSELLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLD  553

Query  1846  EELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLE  2025
             EELNPHLSDCGLAALTPNTERQ+SST ++GSFGYSAPEFALSG+YTVKSDVYSFGVVMLE
Sbjct  554   EELNPHLSDCGLAALTPNTERQVSSTQMIGSFGYSAPEFALSGIYTVKSDVYSFGVVMLE  613

Query  2026  LLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALC  2205
             LLTGRKPLDSSR RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALC
Sbjct  614   LLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALC  673

Query  2206  VQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             VQPEPEFRPPMSEVVQALVRL+QRASVV RR SDES F YKTPDH+
Sbjct  674   VQPEPEFRPPMSEVVQALVRLMQRASVVKRRSSDESAFTYKTPDHE  719



>ref|XP_009777766.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Nicotiana sylvestris]
Length=723

 Score =  1043 bits (2696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/712 (77%), Positives = 610/712 (86%), Gaps = 16/712 (2%)
 Frame = +1

Query  235   TEVVLVIAALI---SRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESW  405
             T +++VI A+    S +  V A TDPNDLQAL+VLY SLNSPSQL+ WK++GGDPC ESW
Sbjct  14    TLLLVVIVAVFFNSSLVVVVEANTDPNDLQALQVLYSSLNSPSQLTNWKSNGGDPCNESW  73

Query  406   KGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLN  585
             KG+TCQG++VVSI+IP LGLNGT+GYMLNG TSLK LD+S N IHD IPYQLPPNLTSLN
Sbjct  74    KGITCQGTSVVSIQIPDLGLNGTLGYMLNGLTSLKNLDMSGNNIHDTIPYQLPPNLTSLN  133

Query  586   LANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPA  765
              A NNI+G+IPYSI+ M +LNYLN S NSL+Q IGD+FTN SDL TLDLS NNFSGDLP 
Sbjct  134   FAKNNISGNIPYSIAGMVTLNYLNLSRNSLSQTIGDVFTNHSDLATLDLSSNNFSGDLPP  193

Query  766   SLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNS  945
             S  LL+NLS L +QNNQL+G+LN+LV LPLT+LNVA N+F+GWIPNEL+SIP F Y GNS
Sbjct  194   SFSLLTNLSTLHLQNNQLSGTLNILVGLPLTNLNVAKNQFNGWIPNELLSIPNFVYDGNS  253

Query  946   FSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAi  1125
             F+NSPAPPPPP+TPPPPGR     N S P S   PGS+  + D + G       +  GAI
Sbjct  254   FANSPAPPPPPYTPPPPGRSRNNRNRSPPRSRTRPGSNPENGDKKKG-------LTTGAI  306

Query  1126  vgivlgssavvlsaivvivYCLRRCKKKEFAARTST--GSLPLS--TDKEVLDQRAKSTA  1293
             +GIV+GSS  VL A+V +V+C RR K KE AAR S   GSLP++   + EV +QRAK  A
Sbjct  307   IGIVIGSSLAVLFALVALVFCFRRGKGKEIAARPSPSPGSLPVTDIVNMEVQEQRAKPAA  366

Query  1294  TVVDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSL  1467
              V DLKPPP+EKVT+ER+QGKNGS+RR  SPITAT YTVA LQT+TNSFSQENL+GEGSL
Sbjct  367   AVADLKPPPTEKVTVERIQGKNGSVRRVKSPITATSYTVAALQTSTNSFSQENLIGEGSL  426

Query  1468  GRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQR  1647
             GRVYRA+FPNGK++AIKK+DSAALSLQEEDNFLEA+SNMSRLRH NIV L+GYCAEHGQR
Sbjct  427   GRVYRAEFPNGKIMAIKKIDSAALSLQEEDNFLEAVSNMSRLRHQNIVALIGYCAEHGQR  486

Query  1648  LLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKS  1827
             LLVYD++ NGSLHDMLHFADERS LLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKS
Sbjct  487   LLVYDHVANGSLHDMLHFADERSTLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKS  546

Query  1828  ANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSF  2007
             ANILLDEELNPHLSDCGLAAL PNTER +SST +VGSFGYSAPEFALSG+YTVKSDVYSF
Sbjct  547   ANILLDEELNPHLSDCGLAALNPNTERPVSSTQMVGSFGYSAPEFALSGIYTVKSDVYSF  606

Query  2008  GVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFA  2187
             GVVMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFA
Sbjct  607   GVVMLELLTGRKPLDSSRMRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFA  666

Query  2188  DIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             DIIALCVQPEPEFRPPMSEVVQALVRL+QRASVV RR SDES F YKTPDH+
Sbjct  667   DIIALCVQPEPEFRPPMSEVVQALVRLMQRASVVKRRSSDESAFTYKTPDHE  718



>ref|XP_006348158.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Solanum 
tuberosum]
Length=724

 Score =  1041 bits (2693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/688 (78%), Positives = 595/688 (86%), Gaps = 8/688 (1%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGT  474
             TDPNDLQAL+VLY SLNSPSQLS WK++GGDPCGESWKG+TCQ S++VSI+IP LGLNGT
Sbjct  35    TDPNDLQALQVLYASLNSPSQLSNWKSNGGDPCGESWKGITCQASSIVSIQIPDLGLNGT  94

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             +GYMLNG TSLK LD+S N IHD IPYQLPPNLTSLNLANNNI+G+IPYS + M +L+YL
Sbjct  95    LGYMLNGLTSLKNLDMSGNNIHDSIPYQLPPNLTSLNLANNNISGNIPYSFAGMVTLSYL  154

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S NSL+Q IG++FTN SDL  LDLS NNFSGDLP+S   L+NLS+L ++NNQL+G LN
Sbjct  155   NLSHNSLSQTIGELFTNHSDLGALDLSSNNFSGDLPSSFSSLTNLSILHLENNQLSGPLN  214

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR  1014
             +LV LPLT+LNVA N F+GWIPNEL+SIP F Y GNSF+N PAPPPPP+T PPPGR    
Sbjct  215   ILVGLPLTNLNVAKNHFNGWIPNELLSIPNFIYDGNSFANGPAPPPPPYTAPPPGRSRNN  274

Query  1015  TNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLR  1194
              +HS P S   PGSD   S        G   +  GAI+GI LGSS  +L A+V +V+C R
Sbjct  275   RSHSPPSSRTRPGSDGQPSPENGDKKKG---LTTGAIIGIALGSSLAILFALVALVFCFR  331

Query  1195  RCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGS  1365
             R K KE A R STGSLP+ TDK   EV +QRA   A V DLKPPP+EKVT+E +QGKNGS
Sbjct  332   RGKGKEIATRPSTGSLPVGTDKVNMEVQEQRANPVAAVADLKPPPTEKVTVEMIQGKNGS  391

Query  1366  LRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAAL  1539
             +RR  SPITA+ YTVA LQTATNSFSQENL+GEGSLGRVYRA+FPNGK++ IKK+DSAAL
Sbjct  392   VRRVKSPITASAYTVAALQTATNSFSQENLIGEGSLGRVYRAEFPNGKIMVIKKIDSAAL  451

Query  1540  SLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQ  1719
             SLQEEDNFLEA+SNMSRLRHPNIV L+GYCAEHGQRLLVYD++ NGSLHDMLHFADERS+
Sbjct  452   SLQEEDNFLEAVSNMSRLRHPNIVQLIGYCAEHGQRLLVYDHVANGSLHDMLHFADERSE  511

Query  1720  LLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPN  1899
             LLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPN
Sbjct  512   LLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPN  571

Query  1900  TERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQS  2079
             TERQ+SST ++GSFGYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKPLDSSR RSEQS
Sbjct  572   TERQVSSTQMIGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRVRSEQS  631

Query  2080  LVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQAL  2259
             LVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQAL
Sbjct  632   LVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQAL  691

Query  2260  VRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             VRL+QRASVV RR SDES F YKTPDH+
Sbjct  692   VRLMQRASVVKRRSSDESAFTYKTPDHE  719



>gb|EYU33875.1| hypothetical protein MIMGU_mgv1a002066mg [Erythranthe guttata]
Length=720

 Score =  1016 bits (2628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/714 (74%), Positives = 601/714 (84%), Gaps = 10/714 (1%)
 Frame = +1

Query  223   AFLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGES  402
             +  FT++V++ AA+ S    V AATDP+D+Q L+VLY SLNSPSQL+GWK+SGGDPCGES
Sbjct  9     SLFFTQLVVIAAAIFSLRAVVDAATDPSDVQGLQVLYTSLNSPSQLTGWKSSGGDPCGES  68

Query  403   WKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSL  582
             WKG+TCQGS+VVSI+I GLG+ G+MGY+L+   SLK LD+S+N IHD IPYQLPPNLTSL
Sbjct  69    WKGITCQGSSVVSIQISGLGITGSMGYLLSNLASLKTLDMSNNNIHDSIPYQLPPNLTSL  128

Query  583   NLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLP  762
             NLA NN TG+IPYSI+ M SLNYLN S N L+Q IGDMF N S L TLDLS N+F+GDLP
Sbjct  129   NLAGNNFTGNIPYSIATMGSLNYLNISRNMLSQGIGDMFANHSALATLDLSSNSFTGDLP  188

Query  763   ASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGN  942
              S   LSNLS L+VQNNQLTGSLNVLV LPLT+LNVANN FSGWIP ELISIP F+  GN
Sbjct  189   PSFTSLSNLSTLQVQNNQLTGSLNVLVGLPLTNLNVANNHFSGWIPQELISIPNFKNDGN  248

Query  943   SFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGA  1122
             +F+N PAPPPPP+T PPPGR    +  + P  H TP S+ N + H          +  G 
Sbjct  249   TFANGPAPPPPPYTSPPPGRSRNSSRQAPPSGH-TPDSNVNRNSHSEDKNV----LTTGP  303

Query  1123  ivgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTA  1293
             IVGIV+G+  VV+  +  + +CLRR  KKE AAR STG LP+ T+K   E+ +QR K   
Sbjct  304   IVGIVIGALFVVILLLFALFFCLRRKNKKEVAARPSTGRLPVITEKVDLEMQEQRPKPAT  363

Query  1294  TVVDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSL  1467
             + +DLKPPP+E VT+ER+QGKNGS+RR  SPITAT YTVA LQTATNSFSQENLVGEGSL
Sbjct  364   SALDLKPPPAENVTVERLQGKNGSIRRMKSPITATSYTVASLQTATNSFSQENLVGEGSL  423

Query  1468  GRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQR  1647
             GRVYR++F NGK++AIKKVD+AA+SLQEEDNFLE ISNMSRLRHPNIV L GYCAEHGQR
Sbjct  424   GRVYRSEFSNGKIMAIKKVDNAAVSLQEEDNFLEVISNMSRLRHPNIVALAGYCAEHGQR  483

Query  1648  LLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKS  1827
             LLV+DYIGNGSLHDMLHFADERS++LTWNARVRVALGTARALEYLHEVCLPSVVHRN KS
Sbjct  484   LLVHDYIGNGSLHDMLHFADERSKMLTWNARVRVALGTARALEYLHEVCLPSVVHRNLKS  543

Query  1828  ANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSF  2007
             ANILLDE+LNPHLSD GLAAL PNTERQ+SST ++GSFGYSAPEFALSG+YTVKSDVYSF
Sbjct  544   ANILLDEDLNPHLSDSGLAALAPNTERQVSSTQMIGSFGYSAPEFALSGIYTVKSDVYSF  603

Query  2008  GVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFA  2187
             GVVMLELLTGRKPLDSSR RSEQSLVRWA+PQLHDIDAL+KMVDP L+GMYPAKSLSRFA
Sbjct  604   GVVMLELLTGRKPLDSSRARSEQSLVRWASPQLHDIDALAKMVDPTLDGMYPAKSLSRFA  663

Query  2188  DIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAA  2349
             DIIALCVQPEPEFRPPMSEVVQALVRL+QRASVV RR ++ESGFA+KT DH+A 
Sbjct  664   DIIALCVQPEPEFRPPMSEVVQALVRLMQRASVVKRRSNEESGFAFKTQDHEAG  717



>emb|CDP04441.1| unnamed protein product [Coffea canephora]
Length=721

 Score =  1013 bits (2618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/703 (76%), Positives = 603/703 (86%), Gaps = 8/703 (1%)
 Frame = +1

Query  244   VLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQ  423
             V+++ A++S L  V   TD NDL AL+VLY  LNSP QL+GWK++GGDPC ESWKG+TCQ
Sbjct  19    VVILVAILSGLLAVDGNTDQNDLTALQVLYNVLNSPPQLTGWKSNGGDPCAESWKGITCQ  78

Query  424   GSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNI  603
             GSAVVS+++ GLGLNGTMGY LN   SLK LDLS N I+D IPYQLPPNLTSLNLA NNI
Sbjct  79    GSAVVSLQLSGLGLNGTMGYSLNSLMSLKTLDLSGNMIYDPIPYQLPPNLTSLNLAYNNI  138

Query  604   TGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLS  783
             +G++PYS+S M +L+YLN S NSL+Q I D+F N SD+  LDLS NN +GDLP S   LS
Sbjct  139   SGNLPYSLSGMAALSYLNVSHNSLSQSIVDVFNNHSDMAVLDLSSNNLTGDLPQSFISLS  198

Query  784   NLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpa  963
             NLS L +QNNQLTGSL+ LV LPLTDLNVANN FSGWIP EL+SIPKF+Y+GN F+N PA
Sbjct  199   NLSTLYLQNNQLTGSLDSLVGLPLTDLNVANNNFSGWIPQELLSIPKFKYNGNLFANGPA  258

Query  964   pppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlg  1143
             PPPPP+TPPPPGR   R++ + PG+   P    NH  H N     K  +KAG IVGIVLG
Sbjct  259   PPPPPYTPPPPGRFRNRSSPA-PGA---PKDSKNHPTHPNTGNGDKG-LKAGPIVGIVLG  313

Query  1144  ssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLST-DKEVLDQRAKSTATVVDLKPPP  1320
             SS V   A++ +V+C R+ KKKE AAR S+GSL  ST +KE+ +QRAKSTAT VDLKPPP
Sbjct  314   SSVVAFLALIALVFCRRKGKKKEIAARPSSGSLSASTVNKEMQEQRAKSTATAVDLKPPP  373

Query  1321  SEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFP  1494
             +EKV +E++ G+NGS++R  SPITAT YTVA LQTATNSF+QENL+GEGSLGRVYRA+FP
Sbjct  374   AEKVMVEKIPGRNGSMKRAKSPITATSYTVATLQTATNSFTQENLIGEGSLGRVYRAEFP  433

Query  1495  NGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGN  1674
             N K++AIKK+D+AALSLQEEDNFLEAISNMSRLRHPNIV L GYCAEHGQRLLVYDYIGN
Sbjct  434   NAKIMAIKKIDNAALSLQEEDNFLEAISNMSRLRHPNIVQLAGYCAEHGQRLLVYDYIGN  493

Query  1675  GSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEEL  1854
             GSLHDMLHFADERS++LTWNARV+VALGTARALEYLHEVCLPSVVHRN KSANILLDEEL
Sbjct  494   GSLHDMLHFADERSKMLTWNARVKVALGTARALEYLHEVCLPSVVHRNLKSANILLDEEL  553

Query  1855  NPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLT  2034
              PHLSDCGLAALTPNTERQ+SST +VGSFGYSAPEFALSG+YT+KSDVYSFGVVMLELLT
Sbjct  554   TPHLSDCGLAALTPNTERQVSSTQMVGSFGYSAPEFALSGIYTIKSDVYSFGVVMLELLT  613

Query  2035  GRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQP  2214
             GRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQP
Sbjct  614   GRKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQP  673

Query  2215  EPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             EPEFRPPMSEVVQALVRL+QRASVV RR SDES FAY+TPDH+
Sbjct  674   EPEFRPPMSEVVQALVRLMQRASVVKRRSSDESSFAYRTPDHE  716



>ref|XP_010099162.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
 gb|EXB77034.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
Length=728

 Score =   993 bits (2567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/723 (73%), Positives = 590/723 (82%), Gaps = 27/723 (4%)
 Frame = +1

Query  232   FTEVVLVI--AALISRLGFVGAATDPND-----------LQALEVLYGSLNSPSQLSGWK  372
              TE +L++  AA+ +    VGA TD +D           +QAL+V+Y SLNSPSQL+GW 
Sbjct  10    LTESLLLVFLAAIFAFPPLVGAFTDASDEIFATAYPDNFVQALQVMYTSLNSPSQLTGWT  69

Query  373   ASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIP  552
             ++GGDPCGESWKG+TC+GSAVVSIEI GLGL+GTMGYML    SL++ DLS N IHD IP
Sbjct  70    SNGGDPCGESWKGITCEGSAVVSIEISGLGLSGTMGYMLANLVSLRKFDLSDNNIHDTIP  129

Query  553   YQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDL  732
             YQLPPNLTSLNLA NN++G++PYS S M+SLNYLN S NSLAQ IGD+F N S L TLDL
Sbjct  130   YQLPPNLTSLNLAKNNLSGNLPYSFSTMSSLNYLNVSRNSLAQSIGDVFVNLSSLGTLDL  189

Query  733   SFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELI  912
             SFNNFSGDLP +LG L NLS L +QNNQLTGSLNVL  LPLT LNVANN F+GWIP EL 
Sbjct  190   SFNNFSGDLPNTLGSLFNLSSLYMQNNQLTGSLNVLTGLPLTTLNVANNHFTGWIPQELS  249

Query  913   SIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngng  1092
             SI  F Y GNSF N PAPP PP TPPPPGR H   NHS  G+H T  SD + S  ENG  
Sbjct  250   SIHSFIYDGNSFDNGPAPPSPPHTPPPPGRSHNNRNHSGSGTH-TEDSDHDASHSENG--  306

Query  1093  ngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPL---STDKE  1263
                  +  GAIVGI+LGS +      + I  C+RR K+K   AR S  SL +   S   E
Sbjct  307   -----LAVGAIVGIILGSISAAAIVFLAIFICIRRNKRKVTGARPSGASLSIGSNSVSTE  361

Query  1264  VLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFS  1437
             + +QR K  A V DLKPPP+EKV ++ + GKNGS++R  SPITAT YTVA LQTATNSFS
Sbjct  362   MQEQRVKPMAVVTDLKPPPAEKVMVDSLHGKNGSVKRIKSPITATSYTVASLQTATNSFS  421

Query  1438  QENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPL  1617
             QE L+GEGSLGRVY+ADFPNGKV+AIKK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV L
Sbjct  422   QEFLIGEGSLGRVYKADFPNGKVMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTL  481

Query  1618  VGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCL  1797
             VGYCAEHGQRLLVY+++GNGSLHDMLHF+++  + LTWN RVRVALGTARALEYLHEVCL
Sbjct  482   VGYCAEHGQRLLVYEFVGNGSLHDMLHFSEDGGKTLTWNVRVRVALGTARALEYLHEVCL  541

Query  1798  PSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGV  1977
             PSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQ+ ST +VG FGYSAPEFALSGV
Sbjct  542   PSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQV-STQMVGQFGYSAPEFALSGV  600

Query  1978  YTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGM  2157
             YTVKSDVYSFGVVMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGM
Sbjct  601   YTVKSDVYSFGVVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGM  660

Query  2158  YPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPD  2337
             YPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASV+ RR SDESGF+YKTPD
Sbjct  661   YPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVIKRRSSDESGFSYKTPD  720

Query  2338  HDA  2346
             H+A
Sbjct  721   HEA  723



>ref|XP_007213628.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
 gb|EMJ14827.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
Length=718

 Score =   991 bits (2563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/709 (73%), Positives = 587/709 (83%), Gaps = 13/709 (2%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L T  VL IA+  + L  V   TD +D+QAL+VLY S+NSPSQL+GWK SGGDPCGESWK
Sbjct  15    LLTGFVL-IASTFAVLPLVSGTTDASDVQALQVLYTSVNSPSQLTGWKISGGDPCGESWK  73

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GVTC+GSAVVSIE+ GLGL+GTMGY+L+   SL++ DLS N  HD +PYQLPPNLTSLNL
Sbjct  74    GVTCEGSAVVSIEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDTLPYQLPPNLTSLNL  133

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A NN TG++PYSI+ M SL YLN S NSL+Q +GDMF N   L TLDLS NNFSGD+P S
Sbjct  134   ARNNFTGNLPYSIANMVSLGYLNVSHNSLSQSVGDMFANLVGLATLDLSLNNFSGDIPNS  193

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                L+NLS L VQNNQLTGSLNVL  LPLT LNVANN FSGWIP+EL SI  F Y GN+F
Sbjct  194   FTSLTNLSSLYVQNNQLTGSLNVLTGLPLTTLNVANNHFSGWIPHELSSIHTFIYDGNAF  253

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N PAPPPPP+ PPPPGR  K  NHS  G+H       +H   +         +  GA+V
Sbjct  254   KNGPAPPPPPYNPPPPGRSDKNHNHSGSGTHPERSDGKSHDSKKG--------LTVGALV  305

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLST-DKEVLDQRAKSTATVVD  1305
             GI+LGS  V L  ++ + +C+ + K+++  AR S GSL + T + E+ +QR KS AT+ D
Sbjct  306   GIILGSVVVALIILLALAFCIGKNKREDHVARASGGSLTVPTINTEMQEQRVKSVATITD  365

Query  1306  LKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVY  1479
             LKPPP+E + ++R+  KNGS++R  SPITATPYTVA LQTATNSFSQE LVGEGSLGRVY
Sbjct  366   LKPPPAEILVVDRLHNKNGSIKRIKSPITATPYTVATLQTATNSFSQEFLVGEGSLGRVY  425

Query  1480  RADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVY  1659
             RA+FPNGK++AIKK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLLVY
Sbjct  426   RAEFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVY  485

Query  1660  DYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  1839
             ++IGNGSLHD+LHFA++ S  LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL
Sbjct  486   EHIGNGSLHDILHFAEDGSNTLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  545

Query  1840  LDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVM  2019
             LDEELNPHLSDCGLAALTPNTERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVYSFGVVM
Sbjct  546   LDEELNPHLSDCGLAALTPNTERQV-STQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVM  604

Query  2020  LELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIA  2199
             LELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIA
Sbjct  605   LELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIA  664

Query  2200  LCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             LCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDESGF+YKTPDH+A
Sbjct  665   LCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRSSDESGFSYKTPDHEA  713



>ref|XP_008224758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Prunus mume]
Length=721

 Score =   984 bits (2545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/711 (72%), Positives = 579/711 (81%), Gaps = 14/711 (2%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L T  VL IA+  + L  V   TD +D+QAL+VLY S+NSPSQL+GWK SGGDPCGESWK
Sbjct  15    LLTGFVL-IASTFAVLPLVSGTTDASDVQALQVLYTSVNSPSQLTGWKISGGDPCGESWK  73

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GVTC+GSAVVSIE+ GLGL+GTMGY+L+   SL++ DLS N  HD +PYQLPPNLTSLN+
Sbjct  74    GVTCEGSAVVSIEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDTLPYQLPPNLTSLNI  133

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A NN TG++PYSI+ M SL YLN S NSL+Q +GD+F N   L TLDLS NNFSGD+P S
Sbjct  134   ARNNFTGNLPYSIANMVSLGYLNVSHNSLSQSVGDIFANLVGLATLDLSLNNFSGDIPNS  193

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                L+NLS L VQNNQLTGSLNVL  LPLT LNVANN F+GWIP+EL SI  F Y GN+F
Sbjct  194   FTSLTNLSSLYVQNNQLTGSLNVLTGLPLTTLNVANNHFNGWIPHELSSIHTFIYDGNAF  253

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N PAPPPPP+ PPPPGR  K  NHS  G+H       +    +        G+  G++V
Sbjct  254   KNGPAPPPPPYNPPPPGRSDKNHNHSGSGTHPERSDGKSRDSKKGLTVGALVGIILGSVV  313

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLST---DKEVLDQRAKSTATV  1299
                L     +        +C+R+ K+++  AR S GSL + T   + E+ +QR KS AT+
Sbjct  314   VAALIILLALA-------FCIRKNKREDRVARASGGSLTVPTSNVNTEMQEQRVKSVATI  366

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DLKPPP+E + ++R+  KNGS++R  SPITATPYTVA LQTATNSFSQE LVGEGSLGR
Sbjct  367   TDLKPPPAEILVVDRLHNKNGSIKRIKSPITATPYTVATLQTATNSFSQEFLVGEGSLGR  426

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRADFPNGK++AIKK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLL
Sbjct  427   VYRADFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLL  486

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY++IGNGSLHD+LHFA++ S  LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN
Sbjct  487   VYEHIGNGSLHDILHFAEDGSNTLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  546

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLDEELNPHLSDCGLAALTPNTERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVYSFGV
Sbjct  547   ILLDEELNPHLSDCGLAALTPNTERQV-STQMVGSFGYSAPEFALSGVYTVKSDVYSFGV  605

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADI
Sbjct  606   VMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADI  665

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             IALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDESGF+YKTPDH+A
Sbjct  666   IALCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRSSDESGFSYKTPDHEA  716



>ref|XP_002267170.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Vitis vinifera]
 emb|CBI32991.3| unnamed protein product [Vitis vinifera]
Length=729

 Score =   981 bits (2537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/714 (73%), Positives = 588/714 (82%), Gaps = 14/714 (2%)
 Frame = +1

Query  226   FLFTEVVLV-IAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGES  402
             F F  +VL   +A++  L   GA TDP+D+Q L+V+Y SLN PSQL+GW  S GDPCGES
Sbjct  18    FFFALLVLFSFSAILPPLSVYGA-TDPSDVQGLQVIYNSLNGPSQLTGWTNSSGDPCGES  76

Query  403   WKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSL  582
             WKGVTC+GSAVVSI+I GLGLNGTMGY+L+ F SL+ LD+S N IHD IPYQLPPNLT+L
Sbjct  77    WKGVTCEGSAVVSIQISGLGLNGTMGYLLSNFLSLRTLDMSDNNIHDTIPYQLPPNLTNL  136

Query  583   NLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLP  762
             NLA+NN+TGS PYSIS M SLNYLN S NS++Q IGD+F   + LT LDLS NNF+GDLP
Sbjct  137   NLASNNLTGSFPYSISTMVSLNYLNVSHNSISQSIGDIFAKLAGLTILDLSVNNFTGDLP  196

Query  763   ASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGN  942
              S   LSNLS L +QNNQLTG L+VL  LPLTDLNVANN FSGWIP+EL SI KF Y GN
Sbjct  197   NSFTSLSNLSTLYLQNNQLTGPLSVLTGLPLTDLNVANNNFSGWIPSELRSIRKFIYDGN  256

Query  943   SFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGA  1122
             SF N PAPPPPP+TPPPP R      HS P + +TP S D  S + +    G     A  
Sbjct  257   SFDNGPAPPPPPYTPPPPSRSRSNRTHSPPEA-RTPSSSDGQSSNSDNGNKGL----AIG  311

Query  1123  ivgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK----EVLDQRAKST  1290
              +  ++  S +VL A++ +V+C+R+ KKK   AR S GS+P+ T+K     + +QR K T
Sbjct  312   PIIGIVLGSLLVLVALIALVFCVRKAKKKGTGARPSVGSVPVVTEKVNTETMQEQRTKFT  371

Query  1291  ATVVDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGS  1464
             ATV DLKPPP+E + +ER+QGKNGS +R  SPITAT YTVA LQTATNSFSQE L+GEGS
Sbjct  372   ATVTDLKPPPAENLMVERVQGKNGSGKRVKSPITATSYTVASLQTATNSFSQEFLIGEGS  431

Query  1465  LGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQ  1644
             LGRVYRADFPNGK +AIKK+D+AALSLQEEDNFLEA+SNMSRLRH NIV LVGYCAEHGQ
Sbjct  432   LGRVYRADFPNGKTMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHQNIVTLVGYCAEHGQ  491

Query  1645  RLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFK  1824
             RLLVY+YIGNGSLHDMLHF D+  + LTWNARVRVALGTARALEYLHEVCLPS VHRNFK
Sbjct  492   RLLVYEYIGNGSLHDMLHFTDDSGKTLTWNARVRVALGTARALEYLHEVCLPSTVHRNFK  551

Query  1825  SANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYS  2004
             SANILLDEELNPHLSDCGLAALTPNTERQ+ ST +VGSFGYSAPEFALSG+YTVKSDVYS
Sbjct  552   SANILLDEELNPHLSDCGLAALTPNTERQV-STQMVGSFGYSAPEFALSGIYTVKSDVYS  610

Query  2005  FGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRF  2184
             FGVVMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDP+LNGMYPAKSLSRF
Sbjct  611   FGVVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPSLNGMYPAKSLSRF  670

Query  2185  ADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             ADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDESGF YKTP+H+A
Sbjct  671   ADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRSSDESGFVYKTPEHEA  724



>ref|XP_010244139.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=729

 Score =   973 bits (2516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/715 (72%), Positives = 593/715 (83%), Gaps = 13/715 (2%)
 Frame = +1

Query  226   FLFTEVVLVIA-ALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGES  402
             F+ T  + V+A  +I  L  V +ATD +D+QAL+VLY SLNS   L+GWK++ GDPCGES
Sbjct  15    FVVTYAIAVVALTVIFTLPLVRSATDSSDVQALQVLYSSLNSSPLLTGWKSNAGDPCGES  74

Query  403   WKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSL  582
             WKGVTCQGS+VV+I+I GLGL+GT+GYML+   SLK LDLS N IHD IPYQLPPNLTSL
Sbjct  75    WKGVTCQGSSVVAIQISGLGLSGTLGYMLSSLFSLKALDLSGNNIHDSIPYQLPPNLTSL  134

Query  583   NLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLP  762
             NLANNN++G++PYSIS M SLNYLN   NS++Q IGD+F N   L+ LDLSFNNFSG+LP
Sbjct  135   NLANNNLSGNLPYSISTMVSLNYLNLGHNSISQSIGDIFANLQSLSVLDLSFNNFSGNLP  194

Query  763   ASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGN  942
              S G LSNLS L +QNNQLTGS+N+L DLPL +LNVANN F+GWIP E  SIP F Y GN
Sbjct  195   NSFGSLSNLSTLYLQNNQLTGSINLLADLPLDNLNVANNHFTGWIPREFTSIPSFIYDGN  254

Query  943   SFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGA  1122
             SF N PAPPPPP+T PPPGR H   NHS  G+H   GS    S        G   + AG 
Sbjct  255   SFENGPAPPPPPYTSPPPGRSHNHHNHSGSGTHSPRGSGRRASSDNQNGKKG---LAAGP  311

Query  1123  ivgivlgssavvlsaivvivYCLRRCK-KKEFAARTSTGSLPLSTDK----EVLDQRAKS  1287
             ++GI+LGS  V L A++ +++CL++ K +K  +AR STG+ P+ TD     E+ +++ +S
Sbjct  312   LIGIILGSILVALCALLALIFCLQKGKNEKGSSARASTGT-PVGTDTVINTELQEEKFRS  370

Query  1288  TATVVDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEG  1461
              A+V DLKPPP+EK+  +R+ G+NGS++R  SPITATPYTVA LQTATNSFSQE L+GEG
Sbjct  371   MASVTDLKPPPAEKMVADRVYGQNGSIKRVKSPITATPYTVASLQTATNSFSQEYLIGEG  430

Query  1462  SLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHG  1641
             SLGRVYR +FPNGKVLAIKK+DSAALSLQEEDNFLEA+SNMSRLRH NI  LVGYC EHG
Sbjct  431   SLGRVYRGEFPNGKVLAIKKIDSAALSLQEEDNFLEAVSNMSRLRHQNITTLVGYCTEHG  490

Query  1642  QRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNF  1821
             QRLLVY+YI NG+LHDMLHF+D+ S+ LTWNARVRVALGTARALEYLHEVCLPSVVHRNF
Sbjct  491   QRLLVYEYISNGTLHDMLHFSDDGSKRLTWNARVRVALGTARALEYLHEVCLPSVVHRNF  550

Query  1822  KSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVY  2001
             KSANILLDEELNPHLSDCGLAALTPNTERQ+ ST +VGSFGYSAPEFA+SG+YTVKSDV+
Sbjct  551   KSANILLDEELNPHLSDCGLAALTPNTERQV-STQMVGSFGYSAPEFAMSGIYTVKSDVH  609

Query  2002  SFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSR  2181
             SFGVVMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSR
Sbjct  610   SFGVVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSR  669

Query  2182  FADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             FADIIALCVQPEPEFRPPMSEVVQALVRL+QRASVV RR SD+SGF +K PD++A
Sbjct  670   FADIIALCVQPEPEFRPPMSEVVQALVRLMQRASVVKRRLSDDSGFIHKMPDYEA  724



>ref|XP_010252506.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=730

 Score =   973 bits (2516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/700 (73%), Positives = 580/700 (83%), Gaps = 20/700 (3%)
 Frame = +1

Query  280   FVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGL  459
              V A TDP D+Q+L+VLY SLNSP +L+GWK+ GGDPCGESWKGV CQGSAVV+I++PGL
Sbjct  35    LVRATTDPLDVQSLQVLYVSLNSPPRLTGWKSGGGDPCGESWKGVICQGSAVVAIQLPGL  94

Query  460   GLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMT  639
             GL+GT+GYML+   SL+ LDLS N IHD IPYQLPPNLTSLNLA+NN++G++PYSIS M 
Sbjct  95    GLSGTLGYMLSSLFSLRTLDLSDNNIHDSIPYQLPPNLTSLNLASNNLSGNLPYSISSMV  154

Query  640   SLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQL  819
             SLNYLN S NS+ Q IGD+F N   L+ LDLSFNNFSGDLP S G LSNLS L +Q+NQL
Sbjct  155   SLNYLNLSHNSIFQSIGDIFANLQGLSILDLSFNNFSGDLPNSFGSLSNLSTLYLQSNQL  214

Query  820   TGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppg  999
             TGS+N+L DLPL +LN+ANN F+GW+P E  SIP F Y GNSF N PAPPPPP+TPPPPG
Sbjct  215   TGSVNILADLPLDNLNIANNHFTGWVPREFSSIPNFIYDGNSFENGPAPPPPPYTPPPPG  274

Query  1000  rpHKRTNHSTPGSHKTPGSD-----DNHSDHEngngngkngVKAGAivgivlgssavvls  1164
             R H   NHS PG+H   GSD     DN +D +         +  GA+VGIVLGS+ V L 
Sbjct  275   RSHNNRNHSGPGTHTPQGSDGQASHDNENDKKG--------LATGALVGIVLGSTLVALC  326

Query  1165  aivvivYCLRRCKKKEFAARTSTGSLPLSTD----KEVLDQRAKSTATVVDLKPPPSEKV  1332
              ++V + CL+R KK+  ++   +   P+ TD     E+ +Q+ +S A   DLKPPP+EKV
Sbjct  327   VVIVFILCLKRGKKERGSSAAPSSGTPVGTDGVISTELQEQKFRSMAVATDLKPPPAEKV  386

Query  1333  TIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKV  1506
               ER  GKNGS+ R  SPITAT YTVA LQ ATNSFSQE L+GEGSLGRVYRA+FPNGKV
Sbjct  387   MAERAYGKNGSISRAKSPITATSYTVASLQMATNSFSQEYLIGEGSLGRVYRAEFPNGKV  446

Query  1507  LAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLH  1686
             LA+KK+DSAALSLQEEDNFLEA+SNMSRLRH NI  LVGYC EHGQRLLVY+YIGNG+LH
Sbjct  447   LAVKKIDSAALSLQEEDNFLEAVSNMSRLRHQNITSLVGYCTEHGQRLLVYEYIGNGTLH  506

Query  1687  DMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHL  1866
             DMLHF+D+ S+ LTWNARV++ALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHL
Sbjct  507   DMLHFSDDGSKRLTWNARVKIALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHL  566

Query  1867  SDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKP  2046
             SDCGLAALTPNTERQ+ ST +VGSFGYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKP
Sbjct  567   SDCGLAALTPNTERQV-STQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKP  625

Query  2047  LDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEF  2226
             LDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEF
Sbjct  626   LDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEF  685

Query  2227  RPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             RPPMSEVVQALVRL+QRASVV RR SD+S F +K PD++A
Sbjct  686   RPPMSEVVQALVRLMQRASVVKRRSSDDSSFIHKLPDYEA  725



>ref|XP_006586762.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine 
max]
 gb|KHN40858.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Glycine soja]
Length=711

 Score =   972 bits (2514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/692 (73%), Positives = 579/692 (84%), Gaps = 15/692 (2%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TDP+D+QALEV+Y  LNSP+QL+GWK  GGDPCGESWKGVTC+GSAVVSI++ GLGL+
Sbjct  24    ATTDPSDVQALEVMYNVLNSPTQLTGWKIGGGDPCGESWKGVTCEGSAVVSIKLSGLGLD  83

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             GT+GY+L+   SL++LDLS N+IHD IPYQLPPNLTSLN A NN++G++PYSIS M SLN
Sbjct  84    GTLGYLLSDLMSLRDLDLSDNKIHDTIPYQLPPNLTSLNFARNNLSGNLPYSISAMGSLN  143

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YLN S N+L+  +GD+F +  DL TLDLSFNNFSGDLP S+G L+NLS L +Q NQLTGS
Sbjct  144   YLNLSNNALSMTVGDIFASLQDLGTLDLSFNNFSGDLPPSVGALANLSSLFLQKNQLTGS  203

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             L+ LV LPL  LNVANN FSGWIP+EL SI  F Y GNSF N PAP PP  T PPP   H
Sbjct  204   LSALVGLPLDTLNVANNNFSGWIPHELSSIHNFIYDGNSFENRPAPLPPTVTSPPPSGSH  263

Query  1009  KRTNHSTPGSH-KTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivY  1185
             +R +HS  GSH KT  SD+  S+   G       +  GA++GIVLGS  V     + +V+
Sbjct  264   RR-HHSGSGSHNKTQASDNEKSNGHKG-------LTVGAVIGIVLGSVLVAAIVFLALVF  315

Query  1186  CLRRCKKKEFAARTSTGSLP---LSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGK  1356
             C+R+ K K+  AR  +GSLP   ++   ++ +QR KS A V DLKP P+E VT+ER+  K
Sbjct  316   CIRKQKGKKKGARNFSGSLPRGVINVTPQMQEQRVKSAAVVTDLKPRPAENVTVERVAVK  375

Query  1357  NGSLR--RSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDS  1530
             +GS++  +SPIT+T YTVA LQ+ATNSFSQE ++GEGSLGRVYRADFPNGKV+AIKK+D+
Sbjct  376   SGSVKQMKSPITSTSYTVASLQSATNSFSQEFIIGEGSLGRVYRADFPNGKVMAIKKIDN  435

Query  1531  AALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADE  1710
             +ALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLLVY+YI NG+LHDMLHFA++
Sbjct  436   SALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYIANGNLHDMLHFAED  495

Query  1711  RSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAAL  1890
              S+ L+WNARVR+ALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAAL
Sbjct  496   SSKDLSWNARVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAAL  555

Query  1891  TPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERS  2070
             TPNTERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR RS
Sbjct  556   TPNTERQV-STQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRVRS  614

Query  2071  EQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVV  2250
             EQSLVRWATPQLHDIDAL+KMVDP LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVV
Sbjct  615   EQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVV  674

Query  2251  QALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             QALVRLVQRASVV RR S+ESGF +KTPDHDA
Sbjct  675   QALVRLVQRASVVKRRPSEESGFGHKTPDHDA  706



>gb|KDP20703.1| hypothetical protein JCGZ_21174 [Jatropha curcas]
Length=721

 Score =   971 bits (2511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/705 (74%), Positives = 592/705 (84%), Gaps = 13/705 (2%)
 Frame = +1

Query  247   LVIAALISRLGF-VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQ  423
             LV  A I  L F V   TD +D+QAL+V+Y SLNSPSQL+ WK+ GGDPC ESWKGVTC+
Sbjct  20    LVFLASIFLLPFLVQCNTDASDVQALQVMYTSLNSPSQLTNWKSDGGDPCAESWKGVTCE  79

Query  424   GSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNI  603
             GSAVVS++I GLGLNGTMGY+L+   SL+  DLS N +HD IPYQLPPNLTSLNLA NN+
Sbjct  80    GSAVVSLQISGLGLNGTMGYLLSNLMSLRTFDLSDNNLHDSIPYQLPPNLTSLNLAGNNL  139

Query  604   TGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLS  783
             +G++PYS+S M SL YLN S NSLAQ IGD+F+N S +TTLDLSFNNFSGDLP+S   LS
Sbjct  140   SGNLPYSLSTMFSLTYLNVSHNSLAQSIGDVFSNLSLITTLDLSFNNFSGDLPSSFSSLS  199

Query  784   NLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpa  963
             NLS L VQ NQLTGSL+ LV LPLT LNVA+NRFSGWIP EL SIP F Y GNSF N PA
Sbjct  200   NLSTLYVQTNQLTGSLDALVGLPLTALNVAHNRFSGWIPQELRSIPDFIYDGNSFDNGPA  259

Query  964   pppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlg  1143
             PPPPPFTPPPPGR H   NHS  G+H  P SD   S+ + G       +  GA+VGI+LG
Sbjct  260   PPPPPFTPPPPGRSHNNRNHSGSGAHSPPSSDGQSSESDKG-------MSVGAVVGIILG  312

Query  1144  ssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK--EVLDQRAKSTATVVDLKPP  1317
             S  ++L A++ +V+ +R+ K+KE  A  S GS   ST+   E+ +QR K+ A V DLKPP
Sbjct  313   SVLLLLIALLAVVFFIRKSKRKEVGAIVSQGSRSASTNNITEMHEQRVKNIAAVTDLKPP  372

Query  1318  PSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADF  1491
             P+EK  +ER+QG +GS++R  SPITAT YTVA LQ ATNSFSQE L+GEGSLGRVY+ +F
Sbjct  373   PAEKSVVERLQGNSGSIKRMKSPITATSYTVASLQVATNSFSQEFLIGEGSLGRVYKGEF  432

Query  1492  PNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIG  1671
             PNGK +AIKK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV LVGYCAEHGQRLLVY+++G
Sbjct  433   PNGKTMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVSLVGYCAEHGQRLLVYEHVG  492

Query  1672  NGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE  1851
             NGSLHDMLHFA++ S+ L+WNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE
Sbjct  493   NGSLHDMLHFAEDGSKTLSWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE  552

Query  1852  LNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELL  2031
             LNPHLSDCGLAALTPNTERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELL
Sbjct  553   LNPHLSDCGLAALTPNTERQV-STQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELL  611

Query  2032  TGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQ  2211
             TGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQ
Sbjct  612   TGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQ  671

Query  2212  PEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             PEPEFRPPMSEVVQALVRLVQRASVV RR SDESGFAYKTPDH+A
Sbjct  672   PEPEFRPPMSEVVQALVRLVQRASVVKRRSSDESGFAYKTPDHEA  716



>ref|XP_007026173.1| STRUBBELIG-receptor family 8 isoform 1 [Theobroma cacao]
 gb|EOY28795.1| STRUBBELIG-receptor family 8 isoform 1 [Theobroma cacao]
Length=719

 Score =   969 bits (2504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/693 (74%), Positives = 586/693 (85%), Gaps = 15/693 (2%)
 Frame = +1

Query  283   VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLG  462
             V   TD  D+QAL+V+Y +LNSP++L+ WK +GGDPCGESWKGVTC+GSAVVS++I GLG
Sbjct  32    VQCTTDSTDVQALQVMYTALNSPAKLTNWKTNGGDPCGESWKGVTCEGSAVVSVDISGLG  91

Query  463   LNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTS  642
             L+G MGY+L+   SL+ LDLS+N IHD IPYQLPPNLTSLNLA NN++G++PYSIS M +
Sbjct  92    LSGAMGYLLSDLMSLRTLDLSNNNIHDTIPYQLPPNLTSLNLAGNNLSGNLPYSISTMVT  151

Query  643   LNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLT  822
             L YLN S NSL+  +GD+F N +DL TLDLSFNNFSGDLP S   LSNLSML +QNNQLT
Sbjct  152   LTYLNLSHNSLSLSVGDIFANLADLGTLDLSFNNFSGDLPNSFSSLSNLSMLYMQNNQLT  211

Query  823   GSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgr  1002
             GSLNVL  L LT LNVA N FSGWIP EL S+P F Y GNSF+N PAPPPPP++PPPP R
Sbjct  212   GSLNVLSGLSLTILNVAKNHFSGWIPQELFSLPTFIYDGNSFANGPAPPPPPYSPPPPRR  271

Query  1003  pHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivviv  1182
              H + N S  G+  +P SD   SD +NG         A  IVGIVLGS  +V+ A++ +V
Sbjct  272   SHNKHN-SGSGARTSPASDGQSSDSDNGP-------SAQLIVGIVLGSLLLVVLALLALV  323

Query  1183  YCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATVVDLKPPPSEKVTIERMQG  1353
             +C+ + KKK   AR S GSL + ++    E+ +QR K+ A V+DLKPPP+EK+T+++M  
Sbjct  324   FCIHKNKKKVSGARASRGSLSVGSNDGHTEMQEQRVKNVAAVIDLKPPPAEKLTVDKMS-  382

Query  1354  KNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVD  1527
             KNGSL+R  SPITAT YTVA LQTATNSFSQE L+GEGSLGRVYRA+FPNGK +AIKK+D
Sbjct  383   KNGSLKRMKSPITATSYTVASLQTATNSFSQEYLIGEGSLGRVYRAEFPNGKTMAIKKID  442

Query  1528  SAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFAD  1707
             +AALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLLVY+Y+GNGSLHDMLHF+D
Sbjct  443   NAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGSLHDMLHFSD  502

Query  1708  ERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAA  1887
             + S+ L+WNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAA
Sbjct  503   DGSKTLSWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAA  562

Query  1888  LTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRER  2067
             LTPNTERQ+ ST +VGSFGYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKPLDSSR R
Sbjct  563   LTPNTERQV-STQMVGSFGYSAPEFALSGLYTVKSDVYSFGVVMLELLTGRKPLDSSRTR  621

Query  2068  SEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV  2247
             SEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV
Sbjct  622   SEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV  681

Query  2248  VQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             VQALVRLVQRASVV RR SDESGFAYKTPDHDA
Sbjct  682   VQALVRLVQRASVVKRRSSDESGFAYKTPDHDA  714



>ref|XP_006467380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Citrus sinensis]
Length=720

 Score =   967 bits (2499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/718 (72%), Positives = 592/718 (82%), Gaps = 20/718 (3%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L    VL+++  ++ L  V   TD +D+QAL+VLY SLNSPS L+ WK + GDPCGESWK
Sbjct  18    LIDAFVLILSIFLT-LSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWK  76

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV C+GSAVVSI+I GLGL+GTMGY+L+   SL++ DLS N IHD IPYQLPPNLTSLNL
Sbjct  77    GVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNL  136

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A+NN +G++PYSI+ M SL+YLN S NSL Q IGD+F N + L TLDLSFNNFSGDLP S
Sbjct  137   ASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNS  196

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                LSN+S L +QNNQLTGSLNV   LPLT LNVANN FSGWIP ELISI  F Y GNSF
Sbjct  197   FISLSNISSLYLQNNQLTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSF  256

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N PAPPPPP T PP GR H   +H   GSH   GS  + SD E         + AGAIV
Sbjct  257   DNGPAPPPPPSTAPPSGRSHNNRSHRQ-GSHSPSGSQSSSSDKE---------LPAGAIV  306

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATV  1299
             GIVLG+  +V  A++ + +C+R+ ++K   AR+S GSLP+ST+    E+ +QR KS A V
Sbjct  307   GIVLGAVFLVALALLALYFCIRKNRRKVSGARSSAGSLPVSTNNMNTEMHEQRVKSVAAV  366

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DL PPP+EK+ IER+  K+GSL++  SPITAT YTVA LQTATNSFSQE L+GEGSLGR
Sbjct  367   TDLTPPPAEKLVIERV-AKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGR  425

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+F NGK++A+KK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLL
Sbjct  426   VYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLL  485

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY+Y+GNG+LHDMLHFAD+ S+ LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN
Sbjct  486   VYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  545

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLD+ELNPHLSDCGLAALTPNTERQ+ ST +VG+FGYSAPEFALSG+YTVKSDVYSFGV
Sbjct  546   ILLDDELNPHLSDCGLAALTPNTERQV-STQMVGAFGYSAPEFALSGIYTVKSDVYSFGV  604

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADI
Sbjct  605   VMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADI  664

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGDPPY  2367
             IALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDESGF+Y+TPDH+A   D P+
Sbjct  665   IALCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRSSDESGFSYRTPDHEAI--DTPF  720



>gb|KDO78347.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=720

 Score =   964 bits (2491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/718 (72%), Positives = 591/718 (82%), Gaps = 20/718 (3%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L    VL+++  ++ L  V   TD +D+QAL+VLY SLNSPS L+ WK + GDPCGESWK
Sbjct  18    LIDAFVLILSIFLT-LSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWK  76

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV C+GSAVVSI+I GLGL+GTMGY+L+   SL++ DLS N IHD IPYQLPPNLTSLNL
Sbjct  77    GVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNL  136

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A+NN +G++PYSI+ M SL+YLN S NSL Q IGD+F N + L TLDLSFNNFSGDLP S
Sbjct  137   ASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNS  196

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                LSN+S L +QNNQ+TGSLNV   LPLT LNVANN FSGWIP ELISI  F Y GNSF
Sbjct  197   FISLSNISSLYLQNNQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSF  256

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N PAPPPPP T PP GR H   +H   GSH   GS  + SD E         + AGAIV
Sbjct  257   DNGPAPPPPPSTAPPSGRSHNNRSHRQ-GSHSPSGSQSSSSDKE---------LPAGAIV  306

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATV  1299
             GIVLG+  +V  A++ + +C+R+ ++K   AR+S GS P+ST+    E+ +QR KS A V
Sbjct  307   GIVLGAVFLVALALLALYFCIRKNRRKVSGARSSAGSFPVSTNNMNTEMHEQRVKSVAAV  366

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DL PPP+EK+ IER+  K+GSL++  SPITAT YTVA LQTATNSFSQE L+GEGSLGR
Sbjct  367   TDLTPPPAEKLVIERV-AKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGR  425

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+F NGK++A+KK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLL
Sbjct  426   VYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLL  485

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY+Y+GNG+LHDMLHFAD+ S+ LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN
Sbjct  486   VYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  545

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLD+ELNPHLSDCGLAALTPNTERQ+ ST +VG+FGYSAPEFALSG+YTVKSDVYSFGV
Sbjct  546   ILLDDELNPHLSDCGLAALTPNTERQV-STQMVGAFGYSAPEFALSGIYTVKSDVYSFGV  604

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADI
Sbjct  605   VMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADI  664

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGDPPY  2367
             IALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDESGF+Y+TPDH+A   D P+
Sbjct  665   IALCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRSSDESGFSYRTPDHEAI--DTPF  720



>ref|XP_011002569.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Populus euphratica]
Length=715

 Score =   962 bits (2487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/709 (72%), Positives = 587/709 (83%), Gaps = 18/709 (3%)
 Frame = +1

Query  244   VLVIAALISRLGF---VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGV  414
             V V+  LIS  GF   V   TDPND+QAL+ +Y SLNSPSQL+ WK+ GGDPCGESWKG+
Sbjct  12    VFVVKVLIS--GFPVLVQCTTDPNDVQALQAMYSSLNSPSQLTSWKSIGGDPCGESWKGI  69

Query  415   TCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLAN  594
             TC+GSAVVS++I GLGL+GTMGYML+   SL+  DLS N IHD +PYQLPPNLTSLNLA 
Sbjct  70    TCEGSAVVSVQISGLGLDGTMGYMLSNLMSLRTFDLSDNNIHDPLPYQLPPNLTSLNLAI  129

Query  595   NNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLG  774
             NN++G++PYSIS M SL+YLN S NSL+Q IGD+F N S L+T+D+SFNNFSGD+P+S  
Sbjct  130   NNLSGNLPYSISTMVSLSYLNVSRNSLSQSIGDVFHNLSLLSTMDVSFNNFSGDIPSSFS  189

Query  775   LLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN  954
              LSNLS L VQNNQLTGSLNVL  LPLT LNVANN  SGWIP EL SIP F Y+GNSF N
Sbjct  190   SLSNLSTLNVQNNQLTGSLNVLTGLPLTTLNVANNNLSGWIPQELSSIPNFIYNGNSFDN  249

Query  955   SpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgi  1134
              PAPPPPP+T PPPG+ H+   H   G+ +TP SD   S+ + G          GAI G+
Sbjct  250   GPAPPPPPYTSPPPGKSHRNRTHPGSGAPRTPSSDGQPSESDKGK-------SVGAIAGV  302

Query  1135  vlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLS---TDKEVLDQRAKSTATVVD  1305
              LGS  +VL A++ +V+CL++ + KE     S GS P     T  E+ + R K+ A V D
Sbjct  303   ALGSVVLVLIALLALVFCLKKHQGKEIDPLASRGSRPADTYYTGAEMQEPRVKNMAAVTD  362

Query  1306  LKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVY  1479
             LKPPP+EK+ +ER+ G +GS++R  SPITAT Y+VA LQTATNSFSQE ++GEGSLGRVY
Sbjct  363   LKPPPAEKLVVERLLGNSGSIKRMKSPITATSYSVASLQTATNSFSQEFIIGEGSLGRVY  422

Query  1480  RADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVY  1659
             R DFP+GK++A+KK+D+AALSLQEEDNFLEA+SNMS LRHPNIV LVGYC EHGQRLLVY
Sbjct  423   RGDFPHGKIMAVKKIDNAALSLQEEDNFLEAVSNMSHLRHPNIVSLVGYCVEHGQRLLVY  482

Query  1660  DYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  1839
             ++I NGSLHD+LHFAD+ S+ L+WNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL
Sbjct  483   EFIANGSLHDILHFADDGSKTLSWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  542

Query  1840  LDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVM  2019
             LDEELNPHLSDCGLAALTPNTERQ+ ST +VGSFGYSAPEFALSG+YTVKSDVYSFGVVM
Sbjct  543   LDEELNPHLSDCGLAALTPNTERQV-STQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVM  601

Query  2020  LELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIA  2199
             LELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIA
Sbjct  602   LELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIA  661

Query  2200  LCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             LCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SD+SGFAYKTPDH+A
Sbjct  662   LCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRPSDDSGFAYKTPDHEA  710



>ref|XP_011046989.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Populus 
euphratica]
Length=711

 Score =   961 bits (2483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/712 (71%), Positives = 584/712 (82%), Gaps = 19/712 (3%)
 Frame = +1

Query  226   FLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESW  405
             FLF  V+ V+  L+         TD ND+QAL+V+Y SLNSPSQL+ WK++GGDPC ESW
Sbjct  9     FLFVSVIKVLILLVQ------CTTDANDVQALQVMYTSLNSPSQLTNWKSNGGDPCAESW  62

Query  406   KGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLN  585
             KG+TC+GSAVVSI+I GLGL+GTMGY+L    SL+ LDLS N + D  PYQLPPNLTSLN
Sbjct  63    KGITCEGSAVVSIQISGLGLDGTMGYLLANLMSLRTLDLSDNHLRDSFPYQLPPNLTSLN  122

Query  586   LANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPA  765
             LA NN++G+IPYS+S M SLNYLN S NSLAQ IGD+F N S L T+DLSFN+FSGDLP+
Sbjct  123   LAKNNLSGNIPYSMSSMVSLNYLNISRNSLAQSIGDVFLNLSLLATMDLSFNSFSGDLPS  182

Query  766   SLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNS  945
             S   LSNLS L VQNNQLTGSLNVL  LPLT LNVANN FSGWIP EL  IP F Y GNS
Sbjct  183   SFNSLSNLSTLNVQNNQLTGSLNVLTGLPLTTLNVANNNFSGWIPQELSLIPNFIYDGNS  242

Query  946   FSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAi  1125
             F N P+PPPPP+TPPPPG+ H+   H   G+  TP SD      +        G+  GAI
Sbjct  243   FDNGPSPPPPPYTPPPPGKSHRNRTHPGSGAPVTPSSDGQPEQSD-------KGISVGAI  295

Query  1126  vgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLST---DKEVLDQRAKSTAT  1296
             VG+ LGS  +VL A++ +V+C+++ K KE     + GS P  T   D+++ + R K+ A 
Sbjct  296   VGVALGSVVLVLIALLALVFCIKKHKSKEIGPLATRGSRPADTDDIDRDMQESRVKNMAA  355

Query  1297  VVDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLG  1470
             V DLKPPP+EK+ +ER+QG +GS++R  SPITAT Y+VA LQTAT+SFSQE L+GEGSLG
Sbjct  356   VTDLKPPPAEKLVVERLQGNSGSIKRMKSPITATSYSVASLQTATSSFSQEFLIGEGSLG  415

Query  1471  RVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRL  1650
             RVYR +FPNGK++A+KK+D+AALSLQEEDNFLEA+SNMS LRHPNIV LVGYC EHGQRL
Sbjct  416   RVYRGEFPNGKMMAVKKIDNAALSLQEEDNFLEAVSNMSHLRHPNIVSLVGYCVEHGQRL  475

Query  1651  LVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSA  1830
             LVY+YI NGS+HD+LHFAD+ S+ L+WNARVRVALGTARALEYLHEVCLPSVVHRN KSA
Sbjct  476   LVYEYIANGSVHDILHFADDGSKTLSWNARVRVALGTARALEYLHEVCLPSVVHRNLKSA  535

Query  1831  NILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFG  2010
             NILLDEELNPHLSDCGLAALTPNTERQ+ ST +VGSFGYSAPEFALSG+YTVKSDVYSFG
Sbjct  536   NILLDEELNPHLSDCGLAALTPNTERQV-STQMVGSFGYSAPEFALSGIYTVKSDVYSFG  594

Query  2011  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFAD  2190
             VVMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDP LNG+YPAKSLSRFAD
Sbjct  595   VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGIYPAKSLSRFAD  654

Query  2191  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             IIALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDESGFAY+TPDH+A
Sbjct  655   IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRSSDESGFAYRTPDHEA  706



>ref|XP_006597598.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine 
max]
 gb|KHN32995.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Glycine soja]
Length=710

 Score =   960 bits (2482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/699 (73%), Positives = 583/699 (83%), Gaps = 18/699 (3%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TDP+D+QALEV+Y +LNSP+QL+GWK  GGDPCGESWKGVTC+GSAVVSI++ GLGL+
Sbjct  24    ANTDPSDVQALEVMYNALNSPTQLTGWKIGGGDPCGESWKGVTCEGSAVVSIKLSGLGLD  83

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             GT+GY+L+   SL+ELDLS N+IHD IPYQLPPNLTSLN A NN++G++PYSIS M SLN
Sbjct  84    GTLGYLLSDLMSLRELDLSDNKIHDTIPYQLPPNLTSLNFARNNLSGNLPYSISAMVSLN  143

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YLN S N+L+  +GD+F +  DL TLDLSFNNFSGDLP S   L+NLS L +Q NQLTGS
Sbjct  144   YLNLSNNALSMTVGDIFASLQDLGTLDLSFNNFSGDLPPSFVALANLSSLFLQKNQLTGS  203

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             L VLV LPL  LNVANN FSGWIP+EL SI  F Y GNSF NSPAP PP FT PPP  PH
Sbjct  204   LGVLVGLPLDTLNVANNNFSGWIPHELSSIRNFIYDGNSFENSPAPLPPAFTSPPPNGPH  263

Query  1009  KRTNHSTPGSH-KTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivY  1185
              R +HS  GSH KT  SD+  SD   G       +  GA+VGIVLGS  V    ++ +V+
Sbjct  264   GR-HHSGSGSHNKTQVSDNEKSDGHKG-------LTVGAVVGIVLGSVLVAAIVLLALVF  315

Query  1186  CLRRCKKKEFAARTSTGSLP---LSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGK  1356
             C+R+ K K+  AR  +GSLP   ++   ++ +QR KS A V DLKP P+E VT+ER+  K
Sbjct  316   CIRKQKGKK-GARNFSGSLPRGVINVTPQMQEQRVKSAAVVTDLKPRPAENVTVERVAVK  374

Query  1357  NGSLR--RSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDS  1530
             +GS++  +SPIT+T YTVA LQ+ATNSFSQE ++GEGSLGRVY+ADFPNGKV+AIKK+D+
Sbjct  375   SGSVKQMKSPITSTLYTVASLQSATNSFSQEFIIGEGSLGRVYKADFPNGKVMAIKKIDN  434

Query  1531  AALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADE  1710
             +ALSLQEEDNFLEA+SNMSRLRHP+IV L GYCAEHGQRLLVY+YI NG+LHDMLHFA++
Sbjct  435   SALSLQEEDNFLEAVSNMSRLRHPSIVTLAGYCAEHGQRLLVYEYIANGNLHDMLHFAED  494

Query  1711  RSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAAL  1890
              S+ L+WNARVR+ALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAAL
Sbjct  495   SSKALSWNARVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAAL  554

Query  1891  TPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERS  2070
             TPNTERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDS R RS
Sbjct  555   TPNTERQV-STQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSLRVRS  613

Query  2071  EQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVV  2250
             EQSLVRWATPQLHDIDAL+KMVDP LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVV
Sbjct  614   EQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVV  673

Query  2251  QALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGDPPY  2367
             QALVRLVQRASVV RR S+ESGF +KTPDH+A   D P+
Sbjct  674   QALVRLVQRASVVKRRPSEESGFGHKTPDHEAM--DMPF  710



>ref|XP_010052883.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Eucalyptus 
grandis]
 gb|KCW77013.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=721

 Score =   959 bits (2479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/705 (71%), Positives = 575/705 (82%), Gaps = 12/705 (2%)
 Frame = +1

Query  247   LVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQG  426
              ++ A+IS L      TDP+D+QAL+ LY SLNSPSQL+ WK+SGGDPC ESWKG+TC+G
Sbjct  19    FLVLAVISALRGARGTTDPSDVQALQTLYTSLNSPSQLTNWKSSGGDPCAESWKGITCEG  78

Query  427   SAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNIT  606
             SAVVSIE+ GLGLNGTMGY+L    SLK+ DLS+N IHD IPYQLPPNLT+LNLA NN+T
Sbjct  79    SAVVSIEVSGLGLNGTMGYLLTNLVSLKKFDLSNNNIHDGIPYQLPPNLTNLNLAGNNLT  138

Query  607   GSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSN  786
             G++PYSIS M +LNY+N S NSL+  +GD+F N S+LTT D S+NNFSGDLPAS   L+N
Sbjct  139   GNLPYSISNMVNLNYMNVSRNSLSLSLGDIFANVSNLTTADFSYNNFSGDLPASFSALAN  198

Query  787   LSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpap  966
             LS L +QNNQLTGSLNVLV LPLT LNVANN FSGWIP E  S+  F Y GNSF+NSPAP
Sbjct  199   LSSLYMQNNQLTGSLNVLVGLPLTTLNVANNHFSGWIPKEFSSLQTFIYDGNSFANSPAP  258

Query  967   ppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgs  1146
             PPP FT PPP +      HS  G+    GS    S           G+   AIVGI+ GS
Sbjct  259   PPPLFTAPPPAKSRNNRTHSGSGTSTLDGSAGQTSG-------SSKGLSTAAIVGIIAGS  311

Query  1147  savvlsaivvivYCLRRCKKKEFAARTST---GSLPLSTDKEVLDQRAKSTATVVDLKPP  1317
               ++L  ++ I  C R+C KK+  AR ST    S+  + + E+ +QR  +TA+V+DLKPP
Sbjct  312   VLLLLVLLLAIYCCCRKCNKKKRGARASTRGIQSVKSNVNPEMQEQRVITTASVIDLKPP  371

Query  1318  PSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADF  1491
             P++ +  ER+  KNGS+RR  SPITAT YTVA LQTA NSF QENL+GEGSLGRVYRADF
Sbjct  372   PADVLLAERVPSKNGSVRRIKSPITATSYTVASLQTAANSFGQENLIGEGSLGRVYRADF  431

Query  1492  PNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIG  1671
             PNGK++A+KK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV LVGYCAEHGQRLLVY+Y+G
Sbjct  432   PNGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLVGYCAEHGQRLLVYEYVG  491

Query  1672  NGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE  1851
             NG+LHD+LHFA++RS+ L WNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE
Sbjct  492   NGNLHDLLHFAEDRSKTLNWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE  551

Query  1852  LNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELL  2031
             LNPHLSDCGLAALTPNTERQ  S  +VG FGYSAPEFALSGVYTVKSDVYSFGVVMLELL
Sbjct  552   LNPHLSDCGLAALTPNTERQQVSAQMVGQFGYSAPEFALSGVYTVKSDVYSFGVVMLELL  611

Query  2032  TGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQ  2211
             TGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQ
Sbjct  612   TGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQ  671

Query  2212  PEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             PEPEFRPPMSEVVQ LVRLVQRA +  RR SDE GF+Y+TPDH+A
Sbjct  672   PEPEFRPPMSEVVQQLVRLVQRAGISKRRSSDEMGFSYRTPDHEA  716



>ref|XP_006449794.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
 gb|ESR63034.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
Length=720

 Score =   959 bits (2478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/718 (72%), Positives = 587/718 (82%), Gaps = 20/718 (3%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L    VL+++  ++ L  V   TD +D+ AL+VLY SLNSPS L+ WK +GGDPCGESWK
Sbjct  18    LLAAFVLILSIFLT-LSLVQCTTDSSDVLALQVLYTSLNSPSVLTNWKGNGGDPCGESWK  76

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV C+GSAVVSI++ GLGLNGTMGY+L+   SL++ DLS N IHD IPYQLPPNLTSLNL
Sbjct  77    GVACEGSAVVSIDVSGLGLNGTMGYLLSDLLSLRKFDLSGNGIHDTIPYQLPPNLTSLNL  136

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A+NN +G++PYSI+ M SL+YLN S N L Q IGD+F   + L TLDLSFNNFSGDLP S
Sbjct  137   ASNNFSGNLPYSIASMVSLSYLNVSRNWLTQSIGDIFGTLACLATLDLSFNNFSGDLPNS  196

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                LSN+S L +QNNQLTGSLNV   LPLT LNVANN  SGWIP ELISI  F Y GNSF
Sbjct  197   FISLSNISSLYLQNNQLTGSLNVFSGLPLTTLNVANNHLSGWIPRELISIRTFIYDGNSF  256

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N PAPPPPP T PP GR H   +H   GSH   GS  + SD E         + AGAIV
Sbjct  257   DNGPAPPPPPSTAPPSGRSHNNRSHRQ-GSHSPSGSQSSSSDKE---------LSAGAIV  306

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATV  1299
             GIVLG+  +V  A++ + +C+ + + K   AR+S GSLP+ST+    E+ +QR KS A V
Sbjct  307   GIVLGAVFLVALALLALYFCIWKNRTKVSGARSSAGSLPVSTNNMNTEMHEQRVKSVAAV  366

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DL PPP+EK+ IER+  K+GSL++  SPITAT YTVA LQTATNSFSQE L+GEGSLGR
Sbjct  367   TDLTPPPAEKLVIERV-AKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGR  425

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+F NGK++A+KK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLL
Sbjct  426   VYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLL  485

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY+Y+GNGSLHDMLHFAD+ S+ LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN
Sbjct  486   VYEYVGNGSLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  545

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLD+ELNPHLSDCGLAALTPNTERQ+ ST +VG+FGYSAPEFALSG+YTVKSDVYSFGV
Sbjct  546   ILLDDELNPHLSDCGLAALTPNTERQV-STQMVGAFGYSAPEFALSGIYTVKSDVYSFGV  604

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADI
Sbjct  605   VMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADI  664

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGDPPY  2367
             IALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDESGF+Y+TPDH+A   D P+
Sbjct  665   IALCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRSSDESGFSYRTPDHEAI--DTPF  720



>ref|XP_010052884.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Eucalyptus 
grandis]
 gb|KCW77014.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=720

 Score =   957 bits (2474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/705 (71%), Positives = 577/705 (82%), Gaps = 13/705 (2%)
 Frame = +1

Query  247   LVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQG  426
              ++ A+IS L      TDP+D+QAL+ LY SLNSPSQL+ WK+SGGDPC ESWKG+TC+G
Sbjct  19    FLVLAVISALRGARGTTDPSDVQALQTLYTSLNSPSQLTNWKSSGGDPCAESWKGITCEG  78

Query  427   SAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNIT  606
             SAVVSIE+ GLGLNGTMGY+L    SLK+ DLS+N IHD IPYQLPPNLT+LNLA NN+T
Sbjct  79    SAVVSIEVSGLGLNGTMGYLLTNLVSLKKFDLSNNNIHDGIPYQLPPNLTNLNLAGNNLT  138

Query  607   GSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSN  786
             G++PYSIS M +LNY+N S NSL+  +GD+F N S+LTT D S+NNFSGDLPAS   L+N
Sbjct  139   GNLPYSISNMVNLNYMNVSRNSLSLSLGDIFANVSNLTTADFSYNNFSGDLPASFSALAN  198

Query  787   LSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpap  966
             LS L +QNNQLTGSLNVLV LPLT LNVANN FSGWIP E  S+  F Y GNSF+NSPAP
Sbjct  199   LSSLYMQNNQLTGSLNVLVGLPLTTLNVANNHFSGWIPKEFSSLQTFIYDGNSFANSPAP  258

Query  967   ppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgs  1146
             PPP FT PPP +      HS  G+    GS    S           G+   AIVGI+ GS
Sbjct  259   PPPLFTAPPPAKSRNNRTHSGSGTSTLDGSAGQTSG-------SSKGLSTAAIVGIIAGS  311

Query  1147  savvlsaivvivYCLRRCKKKEFAARTST---GSLPLSTDKEVLDQRAKSTATVVDLKPP  1317
               ++L  ++ I  C R+C KK+  AR ST    S+  + + E+ +QR  +TA+V+DLKPP
Sbjct  312   VLLLLVLLLAIYCCCRKCNKKKRGARASTRGIQSVKSNVNPEMQEQRVITTASVIDLKPP  371

Query  1318  PSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADF  1491
             P++ +  ER+  KNGS+RR  SPITAT YTVA LQTA NSF QENL+GEGSLGRVYRADF
Sbjct  372   PADVLLAERVPSKNGSVRRIKSPITATSYTVASLQTAANSFGQENLIGEGSLGRVYRADF  431

Query  1492  PNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIG  1671
             PNGK++A+KK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV LVGYCAEHGQRLLVY+Y+G
Sbjct  432   PNGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLVGYCAEHGQRLLVYEYVG  491

Query  1672  NGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE  1851
             NG+LHD+LHFA++RS+ L WNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE
Sbjct  492   NGNLHDLLHFAEDRSKTLNWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE  551

Query  1852  LNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELL  2031
             LNPHLSDCGLAALTPNTERQ+S+  +VG FGYSAPEFALSGVYTVKSDVYSFGVVMLELL
Sbjct  552   LNPHLSDCGLAALTPNTERQVSA-QMVGQFGYSAPEFALSGVYTVKSDVYSFGVVMLELL  610

Query  2032  TGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQ  2211
             TGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQ
Sbjct  611   TGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQ  670

Query  2212  PEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             PEPEFRPPMSEVVQ LVRLVQRA +  RR SDE GF+Y+TPDH+A
Sbjct  671   PEPEFRPPMSEVVQQLVRLVQRAGISKRRSSDEMGFSYRTPDHEA  715



>ref|XP_008355924.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Malus domestica]
Length=719

 Score =   957 bits (2473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/710 (73%), Positives = 584/710 (82%), Gaps = 20/710 (3%)
 Frame = +1

Query  238   EVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVT  417
             E VL+ +AL + L  V   TD +D+QAL+VLY S+NSPSQL GW +SGGDPCGESWKGVT
Sbjct  18    EFVLIASALAA-LPLVSGTTDASDVQALQVLYTSVNSPSQLXGWTSSGGDPCGESWKGVT  76

Query  418   CQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANN  597
             C+GSAVV++E+ GLGL+GTMGY+L+   SL++ DLS N  HD IPYQLPPNLTSLNLA N
Sbjct  77    CEGSAVVAVEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDTIPYQLPPNLTSLNLARN  136

Query  598   NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
             N TG++PYSI+ M SL+YLN S NSL+Q IGD+F +   L TLDLS NNF+ D+P+SL  
Sbjct  137   NFTGNLPYSIANMVSLSYLNVSRNSLSQSIGDIFAHLVSLATLDLSLNNFTSDIPSSLSS  196

Query  778   LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNS  957
             LSNLS L VQNNQLTGSLNVL  LPLT LNVANN FSGWIP EL SI  F Y GN F N 
Sbjct  197   LSNLSSLYVQNNQLTGSLNVLTGLPLTTLNVANNHFSGWIPRELSSIRTFIYDGNGFDNG  256

Query  958   papppppftppppgrpHKRTNHSTPGSHKTP--GSDDNHSDHEngngngkngVKAGAivg  1131
             PAPPPPP+ PPPPGR  K  +HS  G   TP  GSD    D + G       +  GA+VG
Sbjct  257   PAPPPPPYIPPPPGRTTKNRSHSGSG---TPPRGSDGQSHDSKKG-------LAVGALVG  306

Query  1132  ivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATVV  1302
             I+LGS  V L  ++ + +C+R+ K+++   R S G +   T+    E+ +QR KSTA V 
Sbjct  307   IILGSVVVALIVLLALAFCIRKNKREDRTPRASGGXVSARTNNVNTEMQEQRVKSTAAVT  366

Query  1303  DLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRV  1476
             D+KPPP+E + ++R+  KNGS +R  SPITATPYTVA LQTATNSFSQE L+GEGSLGRV
Sbjct  367   DIKPPPAEILVVDRLHSKNGSTKRIKSPITATPYTVASLQTATNSFSQEFLIGEGSLGRV  426

Query  1477  YRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLV  1656
             YRA+FPNGKV+AIKK+D+AALSLQEEDNFLEAISNMSRLRHPNIV L GYCAEHGQRLLV
Sbjct  427   YRAEFPNGKVMAIKKIDNAALSLQEEDNFLEAISNMSRLRHPNIVTLAGYCAEHGQRLLV  486

Query  1657  YDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANI  1836
             Y+Y+GNGSLHD+LHFA++ S  LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANI
Sbjct  487   YEYVGNGSLHDILHFAEDGSXTLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANI  546

Query  1837  LLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVV  2016
             LLDEELNPHLSDCGLAALTPNTERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVYSFGVV
Sbjct  547   LLDEELNPHLSDCGLAALTPNTERQV-STQMVGSFGYSAPEFALSGVYTVKSDVYSFGVV  605

Query  2017  MLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADII  2196
             MLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADII
Sbjct  606   MLELLTGRKPLDSSRSRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADII  665

Query  2197  ALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             ALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDES F +KTPDH+A
Sbjct  666   ALCVQPEPEFRPPMSEVVQALVRLVQRASVV-RRSSDESSFGFKTPDHEA  714



>ref|XP_008458998.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Cucumis 
melo]
Length=711

 Score =   956 bits (2472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/691 (72%), Positives = 569/691 (82%), Gaps = 16/691 (2%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGT  474
             TD +D+QAL+V+Y SL+SP QL+GW  SGGDPC ESWKGVTC+GSAVVSIEI GLGLNGT
Sbjct  25    TDASDVQALQVMYTSLDSPPQLTGWTVSGGDPCAESWKGVTCEGSAVVSIEISGLGLNGT  84

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             MGY L+ F SLK+LD+S N IHD IPYQLPPNLTSLN+A N++ G++PYS S M SLNYL
Sbjct  85    MGYALSSFLSLKKLDMSDNNIHDAIPYQLPPNLTSLNMAKNSLIGNLPYSFSTMASLNYL  144

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S N L+Q IGD+FTN + L TLDLSFNNF+GDLP SLG LSN+S L +QNN LTGSLN
Sbjct  145   NMSHNLLSQVIGDVFTNLTTLETLDLSFNNFTGDLPKSLGTLSNVSSLFLQNNGLTGSLN  204

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR  1014
             +L+DLPLT LNVANN FSGWIP EL S+  F Y GN+F NSPAPPPPPFTPPPPGR    
Sbjct  205   ILIDLPLTTLNVANNNFSGWIPQELKSVENFIYDGNTFDNSPAPPPPPFTPPPPGRSRNS  264

Query  1015  TNH--STPGSHKTPGSDDNHSD-HEngngngkngVKAGAivgivlgssavvlsaivvivY  1185
               H  S+ G+H  P S+ + S  ++        G+  GAI+ +++   A           
Sbjct  265   PKHPGSSGGTHTAPSSEGSSSHSNKGLPVLAIVGIVLGAIIFVLIVLVAFA--------V  316

Query  1186  CLRRCKKKEFAARTSTGSLPLST--DKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKN  1359
             C ++ K+K    R S+G L + T  + EV + R KS A V D+KP P+EK+  ER+Q KN
Sbjct  317   CFQKRKRKNIGLRASSGRLSIGTSVNAEVQEHRVKSVAAVADIKPLPAEKMNPERLQAKN  376

Query  1360  GSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSA  1533
             GS++R  +PITAT YTVA LQTATNSFSQE +VGEGSLGRVYRA+FPNGK +AIKK+D++
Sbjct  377   GSVKRIKAPITATSYTVASLQTATNSFSQECIVGEGSLGRVYRAEFPNGKTMAIKKIDNS  436

Query  1534  ALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADER  1713
             ALSLQEEDNFLEA+SNMSRLRH NIV L GYCAEHGQRLLVY++IG+GSLHDMLHFA+E 
Sbjct  437   ALSLQEEDNFLEAVSNMSRLRHTNIVTLNGYCAEHGQRLLVYEFIGHGSLHDMLHFAEES  496

Query  1714  SQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALT  1893
             S+ LTWNARVRVALGTARALEYLHEVCLPSVVHRN K+ANILLDE+LNPHLSDCGLAALT
Sbjct  497   SKTLTWNARVRVALGTARALEYLHEVCLPSVVHRNLKTANILLDEDLNPHLSDCGLAALT  556

Query  1894  PNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSE  2073
             PNTERQI ST +VGSFGYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKPLDSSR RSE
Sbjct  557   PNTERQI-STQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRVRSE  615

Query  2074  QSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ  2253
             QSLVRWATPQLHDIDAL+KMVDP LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ
Sbjct  616   QSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ  675

Query  2254  ALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             ALVRLVQRASVV R  SDESGF+YKTP+HDA
Sbjct  676   ALVRLVQRASVVKRHSSDESGFSYKTPEHDA  706



>ref|XP_004145432.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis 
sativus]
 gb|KGN66852.1| hypothetical protein Csa_1G701280 [Cucumis sativus]
Length=711

 Score =   956 bits (2472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/696 (72%), Positives = 572/696 (82%), Gaps = 16/696 (2%)
 Frame = +1

Query  280   FVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGL  459
             F+ A TD +D+QAL+V+Y SL+SP QL+GW  SGGDPC ESWKGVTC+GSAVVSIEI GL
Sbjct  20    FLRAHTDASDVQALQVMYTSLDSPPQLTGWIVSGGDPCAESWKGVTCEGSAVVSIEISGL  79

Query  460   GLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMT  639
             GLNGTMGY L+ F SLK+LD+S N IHD +PYQLPPNLTSLN+A N++ G++PYS+S M 
Sbjct  80    GLNGTMGYALSSFLSLKKLDMSDNSIHDAVPYQLPPNLTSLNMAKNSLIGNLPYSLSTMA  139

Query  640   SLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQL  819
             SLNYLN S N L+Q IGD+FTN + L TLDLSFNNF+GDLP SLG LSN+S L  QNN+L
Sbjct  140   SLNYLNMSHNLLSQVIGDVFTNLTTLETLDLSFNNFTGDLPKSLGTLSNVSSLFFQNNRL  199

Query  820   TGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppg  999
             TGSLN+L+DLPLT LNVANN FSGWIP EL S+  F Y GNSF NSPAPPPPPFTPPPPG
Sbjct  200   TGSLNILIDLPLTTLNVANNNFSGWIPQELKSVESFIYDGNSFDNSPAPPPPPFTPPPPG  259

Query  1000  rpHKRTNH--STPGSHKTPGSDDNHSD-HEngngngkngVKAGAivgivlgssavvlsai  1170
             R      H  S+ G+H  P S+ + S  ++        G+  GAI+ +++   A      
Sbjct  260   RSRNSPKHPGSSGGTHTAPSSEGSSSHSNKGLPVLAIVGIVLGAIIFVLIVLVAFA----  315

Query  1171  vvivYCLRRCKKKEFAARTSTGSLPLST--DKEVLDQRAKSTATVVDLKPPPSEKVTIER  1344
                  C ++ K+K    R S+G L + T  + EV + R KS A V D+KP P+EK+  ER
Sbjct  316   ----VCFQKRKRKNIGLRASSGRLSIGTSVNAEVQEHRVKSVAAVADIKPLPAEKMNPER  371

Query  1345  MQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIK  1518
             +Q KNGS++R  +PITAT YTVA LQ ATNSFSQE +VGEGSLGRVY+A+FPNGK +AIK
Sbjct  372   LQAKNGSVKRIKAPITATSYTVASLQAATNSFSQECIVGEGSLGRVYKAEFPNGKTMAIK  431

Query  1519  KVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLH  1698
             K+D++ALSLQEEDNFLEA+SNMSRLRH NIV L GYCAEHGQRLLVY++IG+GSLHDMLH
Sbjct  432   KIDNSALSLQEEDNFLEAVSNMSRLRHTNIVTLNGYCAEHGQRLLVYEFIGHGSLHDMLH  491

Query  1699  FADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCG  1878
             FA+E S+ LTWNARVRVALGTARALEYLHEVCLPSVVHRN K+ANILLDE+LNPHLSDCG
Sbjct  492   FAEESSKTLTWNARVRVALGTARALEYLHEVCLPSVVHRNLKTANILLDEDLNPHLSDCG  551

Query  1879  LAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  2058
             LAALTPNTERQI ST +VGSFGYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKPLDSS
Sbjct  552   LAALTPNTERQI-STQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  610

Query  2059  RERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  2238
             R RSEQSLVRWATPQLHDIDAL+KMVDP LNGMYPAKSLSRFADIIALCVQPEPEFRPPM
Sbjct  611   RVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPEPEFRPPM  670

Query  2239  SEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             SEVVQALVRLVQRASVV R  SDESGF+YKTP+HDA
Sbjct  671   SEVVQALVRLVQRASVVKRHSSDESGFSYKTPEHDA  706



>ref|XP_009357210.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Pyrus x 
bretschneideri]
Length=719

 Score =   954 bits (2467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/710 (73%), Positives = 587/710 (83%), Gaps = 20/710 (3%)
 Frame = +1

Query  238   EVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVT  417
             E VL+ +AL + L  V   TD +D+QAL+VLY S+NSPSQL+GWK+SGGDPCGESWKGVT
Sbjct  18    EFVLIASALAA-LPLVSGTTDASDVQALQVLYTSVNSPSQLTGWKSSGGDPCGESWKGVT  76

Query  418   CQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANN  597
             C+GSAVV++E+ GLGL+GTMGY+L+   SL++ DLS N  HD IPYQLPPNLTSLNLA N
Sbjct  77    CEGSAVVAVEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDTIPYQLPPNLTSLNLARN  136

Query  598   NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
             N TG+IPYSI+ M SLNYLN S NSL+Q IGD+F +  +L TLDLS NNF+ D+P+S   
Sbjct  137   NFTGNIPYSIANMVSLNYLNVSRNSLSQSIGDIFAHLVNLATLDLSLNNFTSDIPSSFSS  196

Query  778   LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNS  957
             LSNLS L +QNNQLTGSLNVL+ LPLT LNVANN FSGWIP EL SI  F Y GN F N 
Sbjct  197   LSNLSSLYMQNNQLTGSLNVLMGLPLTTLNVANNHFSGWIPRELSSIRTFIYDGNGFDNG  256

Query  958   papppppftppppgrpHKRTNHSTPGSHKTP--GSDDNHSDHEngngngkngVKAGAivg  1131
             PAPPPPP+ PPPPGR  K  +HS  G   TP  GSD    D + G       +  GA+VG
Sbjct  257   PAPPPPPYIPPPPGRTTKNRSHSGSG---TPPQGSDGQSRDSKKG-------LAGGALVG  306

Query  1132  ivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATVV  1302
             I+LGS  V L  ++ +  C+R+ K+++   RTS G++   T+    E+ +QR KSTA V 
Sbjct  307   IILGSVFVALIVLLALALCIRKNKREDRTPRTSGGNVSARTNNVNTEMQEQRVKSTAAVT  366

Query  1303  DLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRV  1476
             D+KPPP+E + ++R+  KNGS +R  +PITATPYTVA LQTATNSFSQE L+GEGSLGRV
Sbjct  367   DIKPPPAEILVVDRLHSKNGSTKRIKAPITATPYTVASLQTATNSFSQEFLIGEGSLGRV  426

Query  1477  YRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLV  1656
             YRA+F  GKV+AIKK+D+AALSLQEEDNFLEAISNMSRLRHPNIV L GYCAEHGQRLLV
Sbjct  427   YRAEFSVGKVMAIKKIDNAALSLQEEDNFLEAISNMSRLRHPNIVTLAGYCAEHGQRLLV  486

Query  1657  YDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANI  1836
             Y+++GNGSLHD+LHFA++ S+ LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANI
Sbjct  487   YEHVGNGSLHDILHFAEDGSKTLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANI  546

Query  1837  LLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVV  2016
             LLDEELNPHLSDCGLAALTPNTERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVYSFGVV
Sbjct  547   LLDEELNPHLSDCGLAALTPNTERQV-STQMVGSFGYSAPEFALSGVYTVKSDVYSFGVV  605

Query  2017  MLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADII  2196
             MLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADII
Sbjct  606   MLELLTGRKPLDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADII  665

Query  2197  ALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             ALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDES F YKTPDH+A
Sbjct  666   ALCVQPEPEFRPPMSEVVQALVRLVQRASVV-RRSSDESSFGYKTPDHEA  714



>ref|XP_010686780.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Beta vulgaris 
subsp. vulgaris]
Length=712

 Score =   954 bits (2466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/695 (70%), Positives = 564/695 (81%), Gaps = 11/695 (2%)
 Frame = +1

Query  274   LGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIP  453
             L  V A TD ND QAL VLYG+LN+PSQL+GWKA GGDPCGESWKGV C GSAVVS++I 
Sbjct  18    LVLVRANTDANDAQALHVLYGALNNPSQLTGWKADGGDPCGESWKGVKCDGSAVVSLDIS  77

Query  454   GLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISL  633
             GLG++GTMGY+L    SLK LD+S N IHD IP+QLPPNLTSLNLA+NN++G +PYSI  
Sbjct  78    GLGVSGTMGYLLTNLASLKTLDMSDNNIHDAIPFQLPPNLTSLNLAHNNLSGGLPYSIVS  137

Query  634   MTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNN  813
             M SL YLN S NSL+QPI D+F+N + L T+DLS NNFSG++P +   L+N+S L +QNN
Sbjct  138   MVSLAYLNVSSNSLSQPIADVFSNHTALATIDLSHNNFSGEIPPTFRNLTNISTLEIQNN  197

Query  814   QLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppp  993
             QLTGSL++L  LPL  LNVANN F+GW+P EL SI  F Y GNSF N PAPPPPP+TPPP
Sbjct  198   QLTGSLDILTSLPLDTLNVANNHFTGWVPQELKSISNFIYDGNSFDNGPAPPPPPYTPPP  257

Query  994   pgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaiv  1173
             PG P KR + S+ GS ++  S D+   H     +    +       ++     ++   ++
Sbjct  258   PGTPTKRRHRSSGGSAQSSESPDSQPSHGKKKSSIGTIIGV-----VLGVVFLLMFGILL  312

Query  1174  vivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATVVDLKPPPSEKVTIER  1344
              +++C RR + K+   R S   +   +DK   E+ +QR  S A VVDLKPPP+E + +E+
Sbjct  313   ALLFCKRRWRTKDNGGRMSGRGVSNGSDKVNVEIQEQRITSAAAVVDLKPPPTESLLVEK  372

Query  1345  MQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIK  1518
             M GKNGSLRR  SPITAT YTVA LQTATNSFSQEN+VGEGSLGRVYRA+F NGKVLAIK
Sbjct  373   MNGKNGSLRRVKSPITATSYTVASLQTATNSFSQENIVGEGSLGRVYRAEFSNGKVLAIK  432

Query  1519  KVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLH  1698
             K+D++ALSLQEEDNFLEA+SNMSRLRHPNIV LVGYC EHGQRLLV +YIG+GSLHDMLH
Sbjct  433   KIDNSALSLQEEDNFLEAVSNMSRLRHPNIVSLVGYCTEHGQRLLVNEYIGSGSLHDMLH  492

Query  1699  FADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCG  1878
             F+D+ S+ LTWN+RVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE NPHLSDCG
Sbjct  493   FSDDGSKRLTWNSRVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEEFNPHLSDCG  552

Query  1879  LAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  2058
             LAALTPNTERQ+ ST +VGSFGYSAPEFALSG+YT KSDVYSFGVVMLELLTGRKPLDSS
Sbjct  553   LAALTPNTERQV-STQMVGSFGYSAPEFALSGIYTTKSDVYSFGVVMLELLTGRKPLDSS  611

Query  2059  RERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  2238
             R RSEQSLVRWA+PQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM
Sbjct  612   RPRSEQSLVRWASPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  671

Query  2239  SEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             SEVVQALVRLVQRA V  RR SD+SGF YKTPDH+
Sbjct  672   SEVVQALVRLVQRAGVAKRRSSDDSGFGYKTPDHE  706



>gb|KEH36931.1| strubbelig-receptor family protein [Medicago truncatula]
Length=729

 Score =   950 bits (2455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/693 (72%), Positives = 572/693 (83%), Gaps = 14/693 (2%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TDP D+QALEV+Y ++N+P++L+GW   GGDPCG+SWKG+TC+GS+VVSI++ GLGL+
Sbjct  39    ANTDPTDVQALEVMYNAVNNPTELTGWTIGGGDPCGDSWKGITCEGSSVVSIDLSGLGLH  98

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             GT+GY+L+   SL++LDLS N+IHD IPYQLPPNLTSLNLA NN+TG++PYS S M SL 
Sbjct  99    GTLGYLLSDLMSLRKLDLSDNKIHDQIPYQLPPNLTSLNLARNNLTGNLPYSFSAMVSLT  158

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YLN S N+L+ PIG++F N S L TLDLSFNNFSGDLP S   LS+LS L +Q NQLTGS
Sbjct  159   YLNVSNNALSLPIGEVFANHSHLDTLDLSFNNFSGDLPPSFATLSSLSSLFLQKNQLTGS  218

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             L VLV LPL  LNVA N FSG IP EL SI  F Y GNS  + PAPP    T PPP  P 
Sbjct  219   LGVLVGLPLDTLNVAKNNFSGSIPPELKSIKNFIYDGNSIDDGPAPPSTESTSPPPREPD  278

Query  1009  KRTNHSTPGSH-KTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivY  1185
             K   HS  GSH K  GSDD  SD   G          GAIVGIVLGS  V    +V IV+
Sbjct  279   KSNPHSGSGSHPKRHGSDDKKSDDHKG-------TSPGAIVGIVLGSVLVSSVVLVAIVF  331

Query  1186  CLRRCKKKEFAARTSTGSLP---LSTDKEVLDQRAKSTATVVDLKP-PPSEKVTIERMQG  1353
             C+R+ K KE  ARTS GSLP   ++   ++ +QR KS A + DLKP PP+E VT++RM  
Sbjct  332   CIRKLKGKEKGARTSNGSLPPGIINVTPQMQEQRVKSAAVITDLKPRPPAENVTMDRMPM  391

Query  1354  KNGSLR--RSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVD  1527
             K+GS++  RSPIT+T YTVA LQ+ATNSFSQE ++GEGSLGRVY+A+FPNGK++A+KK+D
Sbjct  392   KSGSVKQMRSPITSTSYTVASLQSATNSFSQEFIIGEGSLGRVYKAEFPNGKIMAVKKID  451

Query  1528  SAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFAD  1707
             +AALSLQEEDNFLEAISNMSRLRHPN+V L GYCAEHGQRLL+Y+YIGNG+LHDMLHFA+
Sbjct  452   NAALSLQEEDNFLEAISNMSRLRHPNVVTLAGYCAEHGQRLLIYEYIGNGNLHDMLHFAE  511

Query  1708  ERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAA  1887
             E S+ L WNARVR+ALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAA
Sbjct  512   ESSKALPWNARVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAA  571

Query  1888  LTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRER  2067
             LTPNTERQ+SST +VGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR R
Sbjct  572   LTPNTERQVSSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRVR  631

Query  2068  SEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV  2247
             +EQSLVRWATPQLHDIDALSKMVDP LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV
Sbjct  632   AEQSLVRWATPQLHDIDALSKMVDPCLNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV  691

Query  2248  VQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             VQALVRLVQRASVV RR SDESGF +KTPDH+A
Sbjct  692   VQALVRLVQRASVVKRRPSDESGFGHKTPDHEA  724



>ref|XP_011002570.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Populus euphratica]
Length=692

 Score =   947 bits (2448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/686 (73%), Positives = 575/686 (84%), Gaps = 13/686 (2%)
 Frame = +1

Query  304   NDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGY  483
             +++QAL+ +Y SLNSPSQL+ WK+ GGDPCGESWKG+TC+GSAVVS++I GLGL+GTMGY
Sbjct  10    HEIQALQAMYSSLNSPSQLTSWKSIGGDPCGESWKGITCEGSAVVSVQISGLGLDGTMGY  69

Query  484   MLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFS  663
             ML+   SL+  DLS N IHD +PYQLPPNLTSLNLA NN++G++PYSIS M SL+YLN S
Sbjct  70    MLSNLMSLRTFDLSDNNIHDPLPYQLPPNLTSLNLAINNLSGNLPYSISTMVSLSYLNVS  129

Query  664   GNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLV  843
              NSL+Q IGD+F N S L+T+D+SFNNFSGD+P+S   LSNLS L VQNNQLTGSLNVL 
Sbjct  130   RNSLSQSIGDVFHNLSLLSTMDVSFNNFSGDIPSSFSSLSNLSTLNVQNNQLTGSLNVLT  189

Query  844   DLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNH  1023
              LPLT LNVANN  SGWIP EL SIP F Y+GNSF N PAPPPPP+T PPPG+ H+   H
Sbjct  190   GLPLTTLNVANNNLSGWIPQELSSIPNFIYNGNSFDNGPAPPPPPYTSPPPGKSHRNRTH  249

Query  1024  STPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCK  1203
                G+ +TP SD   S+ + G          GAI G+ LGS  +VL A++ +V+CL++ +
Sbjct  250   PGSGAPRTPSSDGQPSESDKGK-------SVGAIAGVALGSVVLVLIALLALVFCLKKHQ  302

Query  1204  KKEFAARTSTGSLPLST---DKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRR  1374
              KE     S GS P  T     E+ + R K+ A V DLKPPP+EK+ +ER+ G +GS++R
Sbjct  303   GKEIDPLASRGSRPADTYYTGAEMQEPRVKNMAAVTDLKPPPAEKLVVERLLGNSGSIKR  362

Query  1375  --SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQ  1548
               SPITAT Y+VA LQTATNSFSQE ++GEGSLGRVYR DFP+GK++A+KK+D+AALSLQ
Sbjct  363   MKSPITATSYSVASLQTATNSFSQEFIIGEGSLGRVYRGDFPHGKIMAVKKIDNAALSLQ  422

Query  1549  EEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLT  1728
             EEDNFLEA+SNMS LRHPNIV LVGYC EHGQRLLVY++I NGSLHD+LHFAD+ S+ L+
Sbjct  423   EEDNFLEAVSNMSHLRHPNIVSLVGYCVEHGQRLLVYEFIANGSLHDILHFADDGSKTLS  482

Query  1729  WNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTER  1908
             WNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTER
Sbjct  483   WNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTER  542

Query  1909  QISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVR  2088
             Q+ ST +VGSFGYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKPLDSSR RSEQSLVR
Sbjct  543   QV-STQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRVRSEQSLVR  601

Query  2089  WATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRL  2268
             WATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRL
Sbjct  602   WATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRL  661

Query  2269  VQRASVVIRRYSDESGFAYKTPDHDA  2346
             VQRASVV RR SD+SGFAYKTPDH+A
Sbjct  662   VQRASVVKRRPSDDSGFAYKTPDHEA  687



>gb|KHG11352.1| protein strubbelig-receptor family 8 [Gossypium arboreum]
Length=726

 Score =   945 bits (2443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/713 (70%), Positives = 573/713 (80%), Gaps = 16/713 (2%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             LF   ++++  +IS        TD  D+QAL+VLY SLNSP++L+ W + G DPC ESWK
Sbjct  20    LFLTELILVGLVISVFIPAQCFTDSTDVQALQVLYTSLNSPTELTNWNSDGNDPCEESWK  79

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV C+GSAVVSI++ GLGL+GTMGY+LN   SLK LDLS+N IHD+IPYQLPP LTSLN+
Sbjct  80    GVACEGSAVVSIDVSGLGLSGTMGYLLNDLMSLKTLDLSNNNIHDMIPYQLPPILTSLNV  139

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A NN++GS+PYSIS M +L YLN S NSL+  +GD+F N +DL TLD+SFNNFSGDLP S
Sbjct  140   AGNNLSGSLPYSISTMVTLTYLNVSHNSLSPSVGDVFANLTDLGTLDISFNNFSGDLPVS  199

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                L+ LS L +QNNQ +GSLNVL  LPL  LNVANN  SGWIP EL S+P F Y GNSF
Sbjct  200   FSSLTTLSALYMQNNQFSGSLNVLSGLPLNTLNVANNNLSGWIPQELFSLPTFIYDGNSF  259

Query  949   SNSpapppppftppppgrpHKRTNHST-PGSHKTPGSDDNHSDHEngngngkngVKAGAi  1125
             +N PAP P P++PPPPG    R  H T PG+HK+        D +  + +   G  AG I
Sbjct  260   ANGPAPLPLPYSPPPPG--RSRHKHKTRPGTHKS-------LDSDAQSSDSDKGPSAGQI  310

Query  1126  vgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTAT  1296
             VGIVLGS  +++  ++ +V+C+ + K+K   AR S GS     +    E+ +QR KS A 
Sbjct  311   VGIVLGSLLLLVLVLLAVVFCIHKNKRKVSGARASKGSFSAGFNDGHTEMQEQRVKSVAA  370

Query  1297  VVDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLG  1470
             V+DLKPPP+EKVT      KNGSL R  SPITAT YTVA LQTATNSFSQE L+GEGSLG
Sbjct  371   VIDLKPPPAEKVTTVDRISKNGSLNRMKSPITATSYTVAALQTATNSFSQEYLIGEGSLG  430

Query  1471  RVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRL  1650
             RVY+A+FPNGK +AIKK+D+AALSLQEEDNFLEAISNMSRLRHPNIV L GYCAEHGQRL
Sbjct  431   RVYKAEFPNGKTMAIKKIDNAALSLQEEDNFLEAISNMSRLRHPNIVTLAGYCAEHGQRL  490

Query  1651  LVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSA  1830
             LVY+Y+GNGSLHDMLHF+D+  + L+WNARVRVALGTARALEYLHEVCLPSVVHRNFKSA
Sbjct  491   LVYEYVGNGSLHDMLHFSDDGGKTLSWNARVRVALGTARALEYLHEVCLPSVVHRNFKSA  550

Query  1831  NILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFG  2010
             NILLD+ELNPHLSDCGLAAL PNTERQ+ ST VVGSFGYSAPEFALSG+YTVKSDVYSFG
Sbjct  551   NILLDDELNPHLSDCGLAALNPNTERQV-STQVVGSFGYSAPEFALSGIYTVKSDVYSFG  609

Query  2011  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFAD  2190
             VVMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDP LNGMYPAKSLSRFAD
Sbjct  610   VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFAD  669

Query  2191  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAA  2349
             IIALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDESGF YKTPDH+A 
Sbjct  670   IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRPSDESGFGYKTPDHEAG  722



>ref|XP_007147687.1| hypothetical protein PHAVU_006G146100g [Phaseolus vulgaris]
 gb|ESW19681.1| hypothetical protein PHAVU_006G146100g [Phaseolus vulgaris]
Length=713

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/693 (71%), Positives = 574/693 (83%), Gaps = 16/693 (2%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TD +D+QALEV+Y +LNS +QL+GW+  GGDPCGESWKGVTC+GSAVVSIE+ GLGL+
Sbjct  25    ANTDSSDVQALEVMYNALNSSTQLTGWRIGGGDPCGESWKGVTCEGSAVVSIELSGLGLD  84

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             GT+GY+L+   SL++LDLS N+IHD IPYQLPPNLTSLNLA NN++G++PYS S M SLN
Sbjct  85    GTLGYLLSNLMSLRKLDLSDNKIHDTIPYQLPPNLTSLNLARNNLSGNLPYSFSAMVSLN  144

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YLN S N+L+  +GD+F + SDL  LDLSFNNFSGDLP S G L+NLS L +Q NQ+TGS
Sbjct  145   YLNLSSNALSMTVGDVFASLSDLGILDLSFNNFSGDLPPSFGALTNLSSLFLQKNQMTGS  204

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             L+VLV LPL  LNVANN FSGWIP E+ SI  F Y GNSF N+PAP PP  T PPP   H
Sbjct  205   LSVLVGLPLDTLNVANNNFSGWIPREISSIHHFIYDGNSFENTPAPLPPGLTSPPPNGSH  264

Query  1009  KRTNHSTPGSHK-TPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivY  1185
                +HS  GSH  T  SD+ +SD          G+  GA+VGIVLGS  V    ++ + +
Sbjct  265   NH-HHSGSGSHNTTEASDNENSDGH-------TGLTVGAVVGIVLGSVVVAAIVLLALFF  316

Query  1186  CLRRCKKKEFAARTSTGSLP---LSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGK  1356
              +++ K K+  AR  +GSLP   ++   ++ +QR KS A V DLKP P+E V++ER+  K
Sbjct  317   FIQKRKGKKTGARNFSGSLPHGVINVTPQMQEQRVKSAAVVTDLKPRPAENVSVERLPAK  376

Query  1357  NGSLR--RSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDS  1530
             +GS+R  +SPIT+T YTVA LQ+ATNSFSQE ++GEGSLGRVY+ADFPNGK +AIKK+D+
Sbjct  377   SGSVRHMKSPITSTSYTVASLQSATNSFSQEFIIGEGSLGRVYKADFPNGKEMAIKKIDN  436

Query  1531  AALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADE  1710
             +ALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLLVY+YIGNG+LHDMLHF+++
Sbjct  437   SALSLQEEDNFLEAVSNMSRLRHPNIVTLTGYCAEHGQRLLVYEYIGNGNLHDMLHFSED  496

Query  1711  RS-QLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAA  1887
              S + L+WNARVR+ALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAA
Sbjct  497   SSGKDLSWNARVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAA  556

Query  1888  LTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRER  2067
             LTPNTERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR R
Sbjct  557   LTPNTERQV-STQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRIR  615

Query  2068  SEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV  2247
             SEQSLVRWATPQLHDIDAL+KMVDP LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV
Sbjct  616   SEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV  675

Query  2248  VQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             VQALVRLVQRASVV RR SD+SG  +KTP+H+A
Sbjct  676   VQALVRLVQRASVVKRRPSDDSGTGHKTPEHEA  708



>ref|XP_004293321.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Fragaria 
vesca subsp. vesca]
Length=685

 Score =   941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/692 (72%), Positives = 569/692 (82%), Gaps = 31/692 (4%)
 Frame = +1

Query  328   LYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSL  507
             +Y S+NSP QL+ WK+SGGDPCGESWKGVTC+G+AVV+IE+ GLGL+GTMGY+L+   SL
Sbjct  1     MYTSVNSPPQLTNWKSSGGDPCGESWKGVTCEGTAVVAIEVSGLGLSGTMGYLLSDLLSL  60

Query  508   KELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPI  687
             ++ DLS N  HD+IPYQLPPNLTSLNLA NN +G++PYSIS M SLNYLN S NSL+Q I
Sbjct  61    RKFDLSDNNFHDIIPYQLPPNLTSLNLARNNFSGNLPYSISAMGSLNYLNVSHNSLSQSI  120

Query  688   GDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLN  867
              D+F N S L TLDLS NNFSGD+P S   LSNLS L VQNNQLTGSLN L  LPLT LN
Sbjct  121   QDIFANLS-LATLDLSLNNFSGDIPVSFSSLSNLSALYVQNNQLTGSLNALTGLPLTTLN  179

Query  868   VANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKT  1047
             VANN FSGWIP EL S+  F Y GNSF N PAPPPPP+ P PPGRP    NHS PG+ + 
Sbjct  180   VANNHFSGWIPRELSSLQTFIYDGNSFDNGPAPPPPPYMPSPPGRPSSNRNHSGPGT-RP  238

Query  1048  PGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAART  1227
             P ++ + S           G+ AGA+VGI++GS  V L  ++ I +C+R+ K++   AR 
Sbjct  239   PRTESSESKK---------GLTAGALVGIIVGSVFVALILLLAIFFCIRKYKREGSVARP  289

Query  1228  STGSLPLSTDK---------------EVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNG  1362
             S G+L + T+                E+ +QR K+ + V DLKPPP+E + ++R+ GKNG
Sbjct  290   SRGNLSVGTNNVVCILSILFHLAVTTEIREQRVKNVSAVTDLKPPPAEILVVDRIHGKNG  349

Query  1363  S--LRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDS  1530
             S  ++R  SPITATPY+VA LQTATNSFSQE L+GEGSLGRVYRA+FPNGK++AIKK+D+
Sbjct  350   SGSIKRIKSPITATPYSVATLQTATNSFSQEFLIGEGSLGRVYRAEFPNGKIMAIKKIDN  409

Query  1531  AALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADE  1710
             AALSLQEEDNFLEA+SNMSRLRHPNIV LVGYCAEHGQRLLVY++IGNGSLHD+LHFA++
Sbjct  410   AALSLQEEDNFLEAVSNMSRLRHPNIVTLVGYCAEHGQRLLVYEHIGNGSLHDILHFAED  469

Query  1711  RSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAAL  1890
              S  L+WNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELN HLSDCGLAAL
Sbjct  470   GSNTLSWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNSHLSDCGLAAL  529

Query  1891  TPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERS  2070
             TPNTERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR RS
Sbjct  530   TPNTERQV-STQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRARS  588

Query  2071  EQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVV  2250
             EQSLVRWATPQLHDIDAL+KMVDP+LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVV
Sbjct  589   EQSLVRWATPQLHDIDALAKMVDPSLNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVV  648

Query  2251  QALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             QALVRLVQRASV  RR SD+SGFAY+TPDH+A
Sbjct  649   QALVRLVQRASVAKRRSSDDSGFAYRTPDHEA  680



>ref|XP_004486188.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cicer arietinum]
Length=680

 Score =   939 bits (2427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/682 (74%), Positives = 571/682 (84%), Gaps = 16/682 (2%)
 Frame = +1

Query  325   VLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTS  504
             V+Y +LNSP++L+GWK   GDPCGESWKG+ C+GSAVVSI++ GLGL+GT+GY+L+   S
Sbjct  2     VMYNALNSPTKLTGWKIVDGDPCGESWKGINCEGSAVVSIDLSGLGLDGTLGYLLSDLMS  61

Query  505   LKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQP  684
             L+ LDLS N+IHD IPYQLPPNLTSLNLA NN+TG++PYS S M SLNYLN S N+L+  
Sbjct  62    LRNLDLSDNKIHDTIPYQLPPNLTSLNLARNNLTGNLPYSFSAMVSLNYLNVSNNALSLS  121

Query  685   IGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDL  864
             IGD+F N S L+TLDLSFNNFSGDLP S G LSNLS L +Q NQLTGSL+VLV LPL  L
Sbjct  122   IGDVFANHSHLSTLDLSFNNFSGDLPPSFGSLSNLSSLFLQKNQLTGSLSVLVGLPLDTL  181

Query  865   NVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrp-HKRTNHSTPGSH  1041
             NVANN FSGWIP+EL SI  F Y GNSF N P+PPPPP +  PP    HK  +HS  GSH
Sbjct  182   NVANNNFSGWIPHELSSIHNFIYDGNSFDNGPSPPPPPASSLPPPSGSHKSNHHSGSGSH  241

Query  1042  -KTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFA  1218
              KT GSD  +SD       G  G   GAIVGIVLGS+ VV   +V +V+C+R+ K KE  
Sbjct  242   TKTQGSDGQNSD-------GSKGTSTGAIVGIVLGSALVVSIILVALVFCIRKLKAKEKG  294

Query  1219  ARTSTGSLP---LSTDKEVLDQRAKSTATVVDLKP-PPSEKVTIERMQGKNGSLR--RSP  1380
             ARTS+GSLP   ++   ++ +QR KS A V DLKP PP E VT++RM  K+GS++  RSP
Sbjct  295   ARTSSGSLPPGIINVTPQMQEQRVKSVAAVTDLKPRPPVENVTMDRMSVKSGSVKQMRSP  354

Query  1381  ITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDN  1560
             IT+T YTVA LQ+ATNSFSQE ++GEGSLGRVY+A+F NGK++A+KK+D+AALSLQEEDN
Sbjct  355   ITSTSYTVASLQSATNSFSQEFIIGEGSLGRVYKAEFSNGKIMAVKKIDNAALSLQEEDN  414

Query  1561  FLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNAR  1740
             FLEAISNMSRLRHPN+V L GYCAEHGQRLL+Y+YIGNG+LHDMLHFA++ S+ L WNAR
Sbjct  415   FLEAISNMSRLRHPNVVTLAGYCAEHGQRLLIYEYIGNGNLHDMLHFAEDSSKALPWNAR  474

Query  1741  VRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISS  1920
             VR+ALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQ+ S
Sbjct  475   VRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQV-S  533

Query  1921  THVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATP  2100
             T +VGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR RSEQSLVRWATP
Sbjct  534   TQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRVRSEQSLVRWATP  593

Query  2101  QLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRA  2280
             QLHDIDALSKMVDP LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRA
Sbjct  594   QLHDIDALSKMVDPCLNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRA  653

Query  2281  SVVIRRYSDESGFAYKTPDHDA  2346
             SVV RR SDE GF YKTPDH+A
Sbjct  654   SVVKRRPSDEYGFGYKTPDHEA  675



>ref|XP_002869840.1| kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46099.1| kinase [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   935 bits (2416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/710 (68%), Positives = 564/710 (79%), Gaps = 25/710 (4%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             +FT V+L+  ALIS    V   TDP+D+QAL+VLY SLNSPSQL+ WK  GGDPCGESWK
Sbjct  8     MFT-VLLLFIALISGFSIVSCVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWK  66

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             G+TC+GSAVVSI+I  LG++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTSLNL
Sbjct  67    GITCEGSAVVSIDISDLGVSGTLGYLLSDLMSLRKLDVSGNSIHDTLPYQLPPNLTSLNL  126

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A NN++G++PYSIS M SL+YLN SGNSL   IGD+F +   L+TLDLS NNFSGDLP+S
Sbjct  127   ARNNLSGNLPYSISAMGSLSYLNVSGNSLTMSIGDIFADHKSLSTLDLSHNNFSGDLPSS  186

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
             L  +S LS+L VQNNQLTGS++VL  LPLT LNVANN F+G IP EL SI    Y GNSF
Sbjct  187   LSTVSALSVLYVQNNQLTGSIDVLSGLPLTTLNVANNHFNGSIPKELSSIQTLIYDGNSF  246

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTP--GSDDNHSDHEngngngkngVKAGA  1122
              N           P   +P +      P   K P  GS+   SD          G+  G 
Sbjct  247   DN----------VPATPQPERPGKKGEPSGSKKPKIGSEKKSSD-------SGKGLSGGV  289

Query  1123  ivgivlgssavvlsaivvivYCLRRCKKKEFAA-RTSTGSLPLSTDKEVLDQRAKSTATV  1299
             + GIV GS  V     +V+  CL + K+K   + R S  SLPLS   E+ +QR KS A+V
Sbjct  290   VTGIVFGSLFVAGIIALVLYLCLHKKKRKVGGSTRASQRSLPLSGTPEMQEQRVKSVASV  349

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DLK  P+EKVT++R+  KNGS+ R  SPITA+ YTV+ LQ ATNSFSQEN++GEGSLGR
Sbjct  350   ADLKSSPAEKVTVDRVM-KNGSISRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLGR  408

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+FPNGK++AIKK+D+AALSLQEEDNFLEA+SNMSRLRHPNIVPL GYC EHGQRLL
Sbjct  409   VYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLL  468

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY+Y+GNG+L DMLH  D+RS  LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSAN
Sbjct  469   VYEYVGNGNLDDMLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSAN  528

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLDEELNPHLSD GLAALTPNTERQ+ ST VVGSFGYSAPEFALSG+YTVKSDVY+FGV
Sbjct  529   ILLDEELNPHLSDSGLAALTPNTERQV-STQVVGSFGYSAPEFALSGIYTVKSDVYTFGV  587

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKPLDS+R R EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADI
Sbjct  588   VMLELLTGRKPLDSTRTRVEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADI  647

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             IALC+QPEPEFRPPMSEVVQ LVRLVQRASV+ RR SD++GF+Y+TP+H+
Sbjct  648   IALCIQPEPEFRPPMSEVVQQLVRLVQRASVIKRRSSDDTGFSYRTPEHE  697



>ref|XP_009357487.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Pyrus x 
bretschneideri]
Length=719

 Score =   932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/711 (72%), Positives = 587/711 (83%), Gaps = 18/711 (3%)
 Frame = +1

Query  232   FTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKG  411
              TE VL IA+ ++ L  V   TD +D++AL+VLY S+NSPSQL+GWK+SGGDPCGESWKG
Sbjct  16    LTEFVL-IASTLAALPLVSGTTDASDVRALQVLYTSVNSPSQLTGWKSSGGDPCGESWKG  74

Query  412   VTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLA  591
             VTC+GSAVVS+E+ GLGL+GTMGY+L+   SL +LDLS N  HD IPYQLPPNLTSLNLA
Sbjct  75    VTCEGSAVVSVEVSGLGLSGTMGYLLSDLLSLLKLDLSDNNFHDTIPYQLPPNLTSLNLA  134

Query  592   NNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASL  771
              NN TG++PYS++ M SL+YLN S NSL+Q IGD+F   + L TLDLS NNF+ D+P S 
Sbjct  135   RNNFTGNLPYSMANMVSLSYLNVSRNSLSQSIGDIFAQLTGLATLDLSLNNFTSDIPDSF  194

Query  772   GLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
               LSNLS L +QNNQLTG+LNVL  LPLT LNVANN FSGWIP EL SI  F Y GN F 
Sbjct  195   SSLSNLSSLYMQNNQLTGTLNVLTGLPLTTLNVANNHFSGWIPQELSSIRTFIYDGNGFD  254

Query  952   NSpapppppftppppgrpHKRTNHSTPGSHKTP-GSDDNHSDHEngngngkngVKAGAiv  1128
             N PAPPPPPF PPPPGR  K  N S  GS   P GSD    D +NG       +  GA+V
Sbjct  255   NGPAPPPPPFIPPPPGRSTK--NRSRSGSGTPPQGSDGQSHDSKNG-------LAVGALV  305

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATV  1299
             GI+LGS  V L  ++ + +C+R+ K+++   R S G++   T+    E+ +QR KS ATV
Sbjct  306   GIILGSVFVALIVLLALAFCIRKNKREDKIPRASGGNVSARTNNVNTEMQEQRVKSAATV  365

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DL PPP+E + ++R+  KNGS++R  SPITATPYTVA LQ+ATNSFSQE L+GEGSLGR
Sbjct  366   TDLMPPPAEILVVDRLHSKNGSIKRIKSPITATPYTVASLQSATNSFSQEFLIGEGSLGR  425

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+FPNGK++AIKK+D+AALSLQEEDNFLEAISN+SRLRHPNIV L GYCAEHGQRLL
Sbjct  426   VYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAISNISRLRHPNIVTLAGYCAEHGQRLL  485

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY+++GNGSLHD+LHFA++ S+ L WNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN
Sbjct  486   VYEHVGNGSLHDILHFAEDGSKNLNWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  545

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLDEELNPHLSDCGLAALTPNTERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVYSFGV
Sbjct  546   ILLDEELNPHLSDCGLAALTPNTERQV-STQMVGSFGYSAPEFALSGVYTVKSDVYSFGV  604

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKPLD SR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADI
Sbjct  605   VMLELLTGRKPLDCSRSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADI  664

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             IALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDESGFAY+TPDH+A
Sbjct  665   IALCVQPEPEFRPPMSEVVQALVRLVQRASVV-RRSSDESGFAYRTPDHEA  714



>ref|XP_010448928.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Camelina 
sativa]
Length=704

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/711 (67%), Positives = 565/711 (79%), Gaps = 26/711 (4%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             +FT V+L+  A IS    V   TDP+D+QAL+VLY SLNSPSQL+ WK  GGDPCGESWK
Sbjct  8     MFT-VLLLFFASISGFSLVLCVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWK  66

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             G+TC+GSAVV+I+I  LG++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTS+NL
Sbjct  67    GITCEGSAVVTIDISDLGVSGTLGYLLSDLMSLRKLDVSGNSIHDTLPYQLPPNLTSINL  126

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             + NN++G++PYSIS M SL+Y+N SGNSL+  IGD+F N   L+TLDLS NNFSGDLP+S
Sbjct  127   SRNNLSGNLPYSISAMGSLSYMNVSGNSLSMSIGDIFANHKSLSTLDLSHNNFSGDLPSS  186

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
             L  +S LS L VQNNQLTGS+ VL  LPL  LNVANNRF+G IP EL SI    Y GNSF
Sbjct  187   LSTVSKLSALYVQNNQLTGSIVVLSGLPLKTLNVANNRFNGSIPKELSSIQTIIYDGNSF  246

Query  949   SNSpapppppftppppgrpHKRTNHSTP-GSHKTP--GSDDNHSDHEngngngkngVKAG  1119
              N           P   +P +      P GS K P  G+++  S+ + G       +  G
Sbjct  247   DN----------VPASSQPDRPGKKGKPSGSSKKPKIGTEEKSSESDKG-------LSGG  289

Query  1120  AivgivlgssavvlsaivvivYCLRRCKKKEFAA-RTSTGSLPLSTDKEVLDQRAKSTAT  1296
              + GIV GS  V     +++  CL + K+K   + R +  SLPLS   E  +QR KS ++
Sbjct  290   VVTGIVFGSLFVAGIVALILYLCLHKRKRKVGGSTRAAQRSLPLSGTTETQEQRVKSVSS  349

Query  1297  VVDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLG  1470
             V DLK  P+EKVT++R+  KNGS+ R  SPITA+ YTV+ LQ ATNSFSQEN++GEGSLG
Sbjct  350   VADLKSSPAEKVTVDRVM-KNGSISRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLG  408

Query  1471  RVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRL  1650
             RVYRA+FPNGK++AIKK+D+AALSLQEEDNFLEA+SNMSRLRHPNIVPL GYC EHGQRL
Sbjct  409   RVYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRL  468

Query  1651  LVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSA  1830
             LVY+Y+GNG+L D LH  D+RS  LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSA
Sbjct  469   LVYEYVGNGNLDDTLHMNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSA  528

Query  1831  NILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFG  2010
             NILLDEELNPHLSD GLAALTPNTERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVY+FG
Sbjct  529   NILLDEELNPHLSDSGLAALTPNTERQV-STQIVGSFGYSAPEFALSGVYTVKSDVYTFG  587

Query  2011  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFAD  2190
             VVMLELLTGRKPLDSSR R+EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFAD
Sbjct  588   VVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFAD  647

Query  2191  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             IIALC+QPEPEFRPPMSEVVQ LVRLVQRASVV RR SD++GF+Y+TP+H+
Sbjct  648   IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDTGFSYRTPEHE  698



>ref|XP_011086205.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Sesamum indicum]
Length=634

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/635 (76%), Positives = 548/635 (86%), Gaps = 18/635 (3%)
 Frame = +1

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             MGY+LN   SLK LDLS+N IHD IPYQLPPNLTSLNLA+NN++G++PYSIS M SLNYL
Sbjct  1     MGYLLNNLGSLKTLDLSNNNIHDSIPYQLPPNLTSLNLASNNLSGNLPYSISNMGSLNYL  60

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S N L+Q +GDMF N S L TLD+SFNNF+GDLP+S   L+NLS L+VQNNQLTGSLN
Sbjct  61    NISRNMLSQTVGDMFANHSALDTLDVSFNNFTGDLPSSFASLTNLSTLQVQNNQLTGSLN  120

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR  1014
             +LV LPLT+LNVANN+F+GWIP EL SIP F Y GN+F+N PAPPPPP+T PPPGR    
Sbjct  121   ILVGLPLTNLNVANNQFTGWIPQELNSIPNFVYDGNAFANGPAPPPPPYTSPPPGRSRNH  180

Query  1015  TNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLR  1194
             +  + PG HK P S+ ++S +EN NG     + AG IVGIVLGS    +  ++ +V+CLR
Sbjct  181   SRQTPPGGHK-PDSNRSNSQNENKNG-----LTAGPIVGIVLGSLFAAVLLLLALVFCLR  234

Query  1195  RCKKKEFAARTSTGSLPLSTDK----------EVLDQRAKSTATVVDLKPPPSEKVTIER  1344
             R  KKE AAR STGSLP+S++K          E+ +QR+K TA+V DLKPPP++ +T ER
Sbjct  235   RGNKKEVAARPSTGSLPVSSEKCSATKSSLNMEMQEQRSKPTASVSDLKPPPADNLTAER  294

Query  1345  MQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIK  1518
             +QGKNGS++R  SPITAT YTVA LQTATNSFSQENL+GEGSLGRVYRA+FPNGK++AIK
Sbjct  295   LQGKNGSVKRVKSPITATSYTVAALQTATNSFSQENLIGEGSLGRVYRAEFPNGKIMAIK  354

Query  1519  KVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLH  1698
             KVDSAALSLQEEDNFLEAISNMSRLRHPNIV L GYC EHGQRLLV+DYIGNGSLHDMLH
Sbjct  355   KVDSAALSLQEEDNFLEAISNMSRLRHPNIVALAGYCVEHGQRLLVHDYIGNGSLHDMLH  414

Query  1699  FADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCG  1878
             FADERS++LTWNARVRVALGTARALEYLHEVCLPSVVHRN KSANILLDEELNPHLSDCG
Sbjct  415   FADERSKMLTWNARVRVALGTARALEYLHEVCLPSVVHRNLKSANILLDEELNPHLSDCG  474

Query  1879  LAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  2058
             LAAL PNTERQ+SST ++GSFGYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKPLDSS
Sbjct  475   LAALGPNTERQVSSTQMIGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSS  534

Query  2059  RERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  2238
             R RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFAD+IALCVQPEPEFRPPM
Sbjct  535   RARSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADVIALCVQPEPEFRPPM  594

Query  2239  SEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             SEVVQALVRL+QRAS+V RR S+ESGFA+KTPDH+
Sbjct  595   SEVVQALVRLMQRASIVKRRSSEESGFAFKTPDHE  629



>ref|XP_008384096.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Malus domestica]
Length=719

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/718 (71%), Positives = 590/718 (82%), Gaps = 20/718 (3%)
 Frame = +1

Query  232   FTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKG  411
              TE VL IA+ ++ L  V   TD +D++AL+VLY S+NSPSQL+GWK+SGGDPCGESWKG
Sbjct  16    LTEFVL-IASTLAALPLVSGTTDASDVRALQVLYTSVNSPSQLTGWKSSGGDPCGESWKG  74

Query  412   VTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLA  591
             VTC+GSAVVS+E+ GLGL+GT+GY+L+   SL +LDLS N  HD IPYQLPPNLTSLNLA
Sbjct  75    VTCEGSAVVSVEVSGLGLSGTIGYLLSDLLSLLKLDLSDNNFHDTIPYQLPPNLTSLNLA  134

Query  592   NNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASL  771
              NN TG++PYSI+ M SL+YLN S NSL+Q IGD+F + + L+TLDLS NNF+ D+P SL
Sbjct  135   RNNFTGNLPYSIANMVSLSYLNVSRNSLSQSIGDIFAHLAGLSTLDLSLNNFTSDIPNSL  194

Query  772   GLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
               LSNLS L +QNNQLTG+LNVL  LPLT LNVANN FSGWIP EL SI  F Y GN F 
Sbjct  195   SSLSNLSSLYMQNNQLTGTLNVLTGLPLTTLNVANNHFSGWIPQELSSIRTFIYDGNGFD  254

Query  952   NSpapppppftppppgrpHKRTNHSTPGSHKTP-GSDDNHSDHEngngngkngVKAGAiv  1128
             N PAPPPPP+ PPPPGR  K  N S  GS   P GSD    D +NG       +  GA+V
Sbjct  255   NGPAPPPPPYNPPPPGRSTK--NRSRSGSGTPPQGSDGQSHDSKNG-------LAVGALV  305

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATV  1299
             GI+LGS  V L  ++ + +C+R+ K+++   R S G++   T+    E+ +QR KS A V
Sbjct  306   GIILGSVFVALIVLLALAFCIRKNKREDRIPRASGGNVSARTNNVNTEMQEQRVKSAAAV  365

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DL PPP+E + ++R+  KNGS++R  SPITATPYTVA LQ+ATNSFSQE L+GEGSLGR
Sbjct  366   TDLMPPPAEILVVDRLHSKNGSIKRIKSPITATPYTVASLQSATNSFSQEFLIGEGSLGR  425

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+FPNGK++AIKK+D+AALSLQEEDNFLEAISNMSRLRH NIV L GYCAEHGQ LL
Sbjct  426   VYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAISNMSRLRHQNIVTLAGYCAEHGQCLL  485

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY++IGNGSLHD+LHFA++ S+ L WNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN
Sbjct  486   VYEHIGNGSLHDILHFAEDGSKTLNWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  545

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLDEELNPHLSDCGLAALTPNTERQ+S   +VGSFGYSAPEFALSGVYTVKSDVYSFGV
Sbjct  546   ILLDEELNPHLSDCGLAALTPNTERQVSP-QMVGSFGYSAPEFALSGVYTVKSDVYSFGV  604

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFAD+
Sbjct  605   VMLELLTGRKPLDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADV  664

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGDPPY  2367
             IALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDESGFAY+TPDH+A   D P+
Sbjct  665   IALCVQPEPEFRPPMSEVVQALVRLVQRASVV-RRSSDESGFAYRTPDHEAI--DMPF  719



>ref|XP_006467381.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Citrus sinensis]
Length=696

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/718 (69%), Positives = 573/718 (80%), Gaps = 44/718 (6%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L    VL+++  ++ L  V   TD +D+QAL+VLY SLNSPS L+ WK + GDPCGESWK
Sbjct  18    LIDAFVLILSIFLT-LSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWK  76

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV C+GSAVVSI+I GLGL+GTMGY+L+   SL++ DLS N IHD IPYQLPPNLTSLNL
Sbjct  77    GVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNL  136

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A+NN +G++PYSI+ M SL+YLN S NSL Q IGD+F N                     
Sbjct  137   ASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGN---------------------  175

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                L+ L+   +QNNQLTGSLNV   LPLT LNVANN FSGWIP ELISI  F Y GNSF
Sbjct  176   ---LAGLATFYLQNNQLTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSF  232

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N PAPPPPP T PP GR H   +H   GSH   GS  + SD E         + AGAIV
Sbjct  233   DNGPAPPPPPSTAPPSGRSHNNRSHRQ-GSHSPSGSQSSSSDKE---------LPAGAIV  282

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATV  1299
             GIVLG+  +V  A++ + +C+R+ ++K   AR+S GSLP+ST+    E+ +QR KS A V
Sbjct  283   GIVLGAVFLVALALLALYFCIRKNRRKVSGARSSAGSLPVSTNNMNTEMHEQRVKSVAAV  342

Query  1300  VDLKPPPSEKVTIERMQGKNGSLR--RSPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DL PPP+EK+ IER+  K+GSL+  +SPITAT YTVA LQTATNSFSQE L+GEGSLGR
Sbjct  343   TDLTPPPAEKLVIERV-AKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGR  401

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+F NGK++A+KK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLL
Sbjct  402   VYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLL  461

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY+Y+GNG+LHDMLHFAD+ S+ LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN
Sbjct  462   VYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  521

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLD+ELNPHLSDCGLAALTPNTERQ+ ST +VG+FGYSAPEFALSG+YTVKSDVYSFGV
Sbjct  522   ILLDDELNPHLSDCGLAALTPNTERQV-STQMVGAFGYSAPEFALSGIYTVKSDVYSFGV  580

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADI
Sbjct  581   VMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADI  640

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGDPPY  2367
             IALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDESGF+Y+TPDH+A   D P+
Sbjct  641   IALCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRSSDESGFSYRTPDHEAI--DTPF  696



>ref|XP_006413689.1| hypothetical protein EUTSA_v10024563mg [Eutrema salsugineum]
 gb|ESQ55142.1| hypothetical protein EUTSA_v10024563mg [Eutrema salsugineum]
Length=700

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/714 (66%), Positives = 558/714 (78%), Gaps = 38/714 (5%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             V+L+   LIS    V   TDP+D+QAL+VLY SLNSPSQL+ WK  GGDPCGESWKG+TC
Sbjct  6     VLLLFFVLISGFSLVRCVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWKGITC  65

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
             +GSAVV+I+I  LG++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTSLNLA NN
Sbjct  66    EGSAVVTIDISDLGVSGTLGYLLSDLMSLRKLDVSGNNIHDTLPYQLPPNLTSLNLARNN  125

Query  601   ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
             ++G++PYSIS M SL+Y+N SGNSL+  IGD+F +   L+TLDLS NNFSGDLP+SL  +
Sbjct  126   LSGNLPYSISAMGSLSYMNVSGNSLSMSIGDIFADHKSLSTLDLSHNNFSGDLPSSLSTV  185

Query  781   SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSp  960
             S LS+L +QNN+LTG+++VL  LPLT LNVANN+F+G IP EL SI    Y GNSF N+ 
Sbjct  186   SKLSVLYLQNNKLTGTIDVLSGLPLTTLNVANNQFNGSIPKELSSIETLIYDGNSFDNA-  244

Query  961   apppppftppppgrpHKRTNHSTPGSHKTPGSDD-----------NHSDHEngngngkng  1107
                                    PGS +    D            N  D E  +     G
Sbjct  245   -----------------------PGSPQPERPDKKGKPSGSKKPKNSPDAEGKSSESDKG  281

Query  1108  VKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAA-RTSTGSLPLSTDKEVLDQRAK  1284
             +  G + GIV GS  V     + +  CL + KKK   + R S  SLPLS   EV +QR K
Sbjct  282   LSGGVVTGIVFGSLFVAGIVALGLYLCLHKKKKKVGGSTRASQRSLPLSGIPEVQEQRVK  341

Query  1285  STATVVDLKPPPSEKVTIER-MQGKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEG  1461
             S A+V DLK  P+EKVT++R M+ ++ S  RSPITA+ YTV+ LQ ATNSFSQEN++GEG
Sbjct  342   SVASVADLKSSPAEKVTVDRVMKNESISRIRSPITASQYTVSSLQVATNSFSQENIIGEG  401

Query  1462  SLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHG  1641
             SLGRVYRA+FP+GK++AIKK+D+AALSLQEED+FLEA+SNMSRLRHPNIVPL GYC EHG
Sbjct  402   SLGRVYRAEFPHGKIMAIKKIDNAALSLQEEDSFLEAVSNMSRLRHPNIVPLAGYCTEHG  461

Query  1642  QRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNF  1821
             QRLLVY+Y+GNG+L DMLH  D+RS  LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNF
Sbjct  462   QRLLVYEYVGNGNLDDMLHLNDDRSMTLTWNARVKVALGTAKALEYLHEVCLPSIVHRNF  521

Query  1822  KSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVY  2001
             KSANILLDEELNPHLSD GLAAL PNTERQ+ ST VVGSFGYSAPEFALSG+YTVKSDVY
Sbjct  522   KSANILLDEELNPHLSDSGLAALNPNTERQV-STQVVGSFGYSAPEFALSGIYTVKSDVY  580

Query  2002  SFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSR  2181
             +FGVVMLELLTGRKPLDSSR R+EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSR
Sbjct  581   TFGVVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSR  640

Query  2182  FADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             FADIIALC+QPEPEFRPPMSEVVQ LVRLVQRASVV RR SD++GF+Y+TP+H+
Sbjct  641   FADIIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDTGFSYRTPEHE  694



>ref|NP_193944.2| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
 sp|Q6R2J8.1|SRF8_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 8; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAR99876.1| strubbelig receptor family 8 [Arabidopsis thaliana]
 gb|ACN59345.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE84560.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
Length=703

 Score =   919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/710 (68%), Positives = 564/710 (79%), Gaps = 25/710 (4%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             +FT ++L IA+ IS    V   TDP+D+QAL+VLY SLNSPSQL+ WK  GGDPCGESWK
Sbjct  8     MFTVLLLFIAS-ISGFSVVRCVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWK  66

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             G+TC+GSAVV+I+I  LG++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTSLNL
Sbjct  67    GITCEGSAVVTIDISDLGVSGTLGYLLSDLKSLRKLDVSGNSIHDTLPYQLPPNLTSLNL  126

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A NN++G++PYSIS M SL+Y+N SGNSL   IGD+F +   L TLDLS NNFSGDLP+S
Sbjct  127   ARNNLSGNLPYSISAMGSLSYMNVSGNSLTMSIGDIFADHKSLATLDLSHNNFSGDLPSS  186

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
             L  +S LS+L VQNNQLTGS++VL  LPL  LNVANN F+G IP EL SI    Y GNSF
Sbjct  187   LSTVSTLSVLYVQNNQLTGSIDVLSGLPLKTLNVANNHFNGSIPKELSSIQTLIYDGNSF  246

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTP--GSDDNHSDHEngngngkngVKAGA  1122
              N           P   +P +     TP   K P  GS++  SD          G+  G 
Sbjct  247   DN----------VPASPQPERPGKKETPSGSKKPKIGSEEKSSD-------SGKGLSGGV  289

Query  1123  ivgivlgssavvlsaivvivYCLRRCKKK-EFAARTSTGSLPLSTDKEVLDQRAKSTATV  1299
             + GIV GS  V     +V+  CL + K+K   + R S  SLPLS   EV +QR KS A+V
Sbjct  290   VTGIVFGSLFVAGIIALVLYLCLHKKKRKVRGSTRASQRSLPLSGTPEVQEQRVKSVASV  349

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DLK  P+EKVT++R+  KNGS+ R  SPITA+ YTV+ LQ ATNSFSQEN++GEGSLGR
Sbjct  350   ADLKSSPAEKVTVDRVM-KNGSISRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLGR  408

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+FPNGK++AIKK+D+AALSLQEEDNFLEA+SNMSRLRHPNIVPL GYC EHGQRLL
Sbjct  409   VYRAEFPNGKIMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLL  468

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY+Y+GNG+L D LH  D+RS  LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSAN
Sbjct  469   VYEYVGNGNLDDTLHTNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSAN  528

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLDEELNPHLSD GLAALTPNTERQ+ ST VVGSFGYSAPEFALSG+YTVKSDVY+FGV
Sbjct  529   ILLDEELNPHLSDSGLAALTPNTERQV-STQVVGSFGYSAPEFALSGIYTVKSDVYTFGV  587

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKPLDSSR R+EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADI
Sbjct  588   VMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADI  647

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             IALC+QPEPEFRPPMSEVVQ LVRLVQRASVV RR SD++GF+Y+TP+H+
Sbjct  648   IALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDTGFSYRTPEHE  697



>emb|CDX76385.1| BnaA08g10150D [Brassica napus]
Length=698

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/710 (67%), Positives = 561/710 (79%), Gaps = 30/710 (4%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             +F  +VL+ +A IS    V   TDP+D+QAL+VLY SLNSPSQL+ WK  GGDPCGESWK
Sbjct  8     MFPVLVLIFSA-ISGFSVVHCVTDPSDVQALQVLYTSLNSPSQLTSWKNGGGDPCGESWK  66

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             G+TC+ SAVVSI+I   G++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTSLNL
Sbjct  67    GITCERSAVVSIDISDSGVSGTLGYLLSDLMSLRKLDVSGNSIHDTLPYQLPPNLTSLNL  126

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A NN++G++PYSIS M SL Y+N SGNSL+  IGD+F +   L+TLDLS NNFSG LP+S
Sbjct  127   ARNNLSGNLPYSISAMASLTYMNVSGNSLSMSIGDIFADHKSLSTLDLSHNNFSGALPSS  186

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
             L  +S LS L VQNN+LTG+++VL  LPLT LNVANN F+G IP EL SI    Y GNSF
Sbjct  187   LSTVSQLSALYVQNNELTGTIDVLSGLPLTTLNVANNHFNGSIPKELTSINTLIYDGNSF  246

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHK-TPGSDDNHSDHEngngngkngVKAGAi  1125
              N+PA P P           K+   S    HK +P ++   SD          G+  G +
Sbjct  247   DNAPASPQPKRP-------DKKRKPSGSKKHKNSPKAEGKSSDK---------GLSGGVV  290

Query  1126  vgivlgssavvlsaivvivYCLRRCKKKEFAA--RTSTGSLPLSTDKEVLDQRAKSTATV  1299
              GIV GS  V     +V+  CL + +KK   +  R S  SLPLS   EV +QR K     
Sbjct  291   TGIVFGSLFVAGIIALVLYLCLHKKRKKVGGSTKRASQRSLPLSGTTEVQEQRVK-----  345

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DLK  P+EKVT++R+  KNGS+ R  SPITA+PYTV+ LQ ATNSFSQEN++GEGSLGR
Sbjct  346   -DLKSSPAEKVTVDRVM-KNGSISRMRSPITASPYTVSSLQVATNSFSQENIIGEGSLGR  403

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+FPNGK++AIKK+D+AALSLQEEDNFLEA+SNMSRLRHPNIVPL GYC EHGQRLL
Sbjct  404   VYRAEFPNGKLMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLL  463

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY+Y+GNG+L DMLH  DERS  LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSAN
Sbjct  464   VYEYVGNGNLDDMLHLNDERSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSAN  523

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLDEELNPHLSDCGLAAL PNTER++ ST +VGSFGYSAPEFALSG+YTVKSDVY+FGV
Sbjct  524   ILLDEELNPHLSDCGLAALNPNTERRV-STQMVGSFGYSAPEFALSGIYTVKSDVYTFGV  582

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKPLDSSR R+EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADI
Sbjct  583   VMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADI  642

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             IALC+QPEPEFRPPMSEVVQ LVRLVQRASVV RR SD++GF+Y+TP+HD
Sbjct  643   IALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDNGFSYRTPEHD  692



>ref|XP_009108553.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Brassica rapa]
Length=702

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/706 (68%), Positives = 557/706 (79%), Gaps = 29/706 (4%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             V+L+  A ISR   V   TDP+D+QAL+VLY SLNSPSQL+ WK  GGDPCGESWKG+TC
Sbjct  15    VLLLTFAAISRFSVVHCVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWKGITC  74

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
             + SAVVSI+I   G++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTSLNLA NN
Sbjct  75    ERSAVVSIDISDSGVSGTLGYLLSDLMSLRKLDVSGNSIHDTLPYQLPPNLTSLNLARNN  134

Query  601   ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
             ++G++PYSIS M SL Y+N SGNSL+  IGD+F +   L+TLDLS NNFSGDLP SL  +
Sbjct  135   LSGNLPYSISAMASLTYMNVSGNSLSMSIGDIFADHISLSTLDLSHNNFSGDLPTSLSTV  194

Query  781   SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSp  960
             S LS L VQNN+LTGS++VL  LPLT LNVANN F+G IP EL SI    Y GNSF N+P
Sbjct  195   SQLSALYVQNNELTGSIDVLSGLPLTTLNVANNHFNGSIPKELTSINTLIYDGNSFDNAP  254

Query  961   apppppftppppgrpHKRTNHSTPGSHK-TPGSDDNHSDHEngngngkngVKAGAivgiv  1137
             A P P           K+   S    HK +P ++   SD          G+  G + GIV
Sbjct  255   ASPQPQRP-------DKKRKPSGSKKHKNSPKAEGKSSDK---------GLSGGVVTGIV  298

Query  1138  lgssavvlsaivvivYCLRRCKKKEFAA--RTSTGSLPLSTDKEVLDQRAKSTATVVDLK  1311
              GS  V     +V+  CL + +KK   +  R S  SLPLS   EV +QR K      DLK
Sbjct  299   FGSLFVAGIIALVLYLCLHKKRKKVGGSTKRASQRSLPLSGTTEVQEQRVK------DLK  352

Query  1312  PPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRA  1485
               P+EKV ++R+  KNGS+ R  SPITA+PYTV+ LQ ATNSFSQEN++GEGSLGRVYRA
Sbjct  353   SSPAEKVAVDRVM-KNGSISRMRSPITASPYTVSSLQVATNSFSQENIIGEGSLGRVYRA  411

Query  1486  DFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDY  1665
              FPNGK++AIKK+D+AALSLQEEDNFLEA+SNMSRLRHPNIVPL GYC EHGQRLLVY+Y
Sbjct  412   KFPNGKLMAIKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEY  471

Query  1666  IGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLD  1845
             +GNG+L DMLH  DERS  LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSANILLD
Sbjct  472   VGNGNLDDMLHLNDERSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLD  531

Query  1846  EELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLE  2025
             EELNPHLSDCGLAAL PNTER++ ST +VGSFGYSAPEFALSG+YTVKSDVY+FGVVMLE
Sbjct  532   EELNPHLSDCGLAALNPNTERRV-STQMVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLE  590

Query  2026  LLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALC  2205
             LLTGRKPLDSSR R+EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADIIALC
Sbjct  591   LLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALC  650

Query  2206  VQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             +QPEPEFRPPMSEVVQ LVRLVQRASVV RR SD++GF+Y+TP+H+
Sbjct  651   IQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDNGFSYRTPEHE  696



>ref|XP_010539262.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Tarenaya 
hassleriana]
Length=699

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/694 (69%), Positives = 553/694 (80%), Gaps = 24/694 (3%)
 Frame = +1

Query  274   LGF--VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIE  447
             LGF  V  ATDP+D+QAL+VLY SLNSPSQL+ WK+ GGDPCGESWKGVTC+GSAVVSI+
Sbjct  20    LGFSSVHCATDPSDVQALQVLYTSLNSPSQLTNWKSGGGDPCGESWKGVTCEGSAVVSID  79

Query  448   IPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSI  627
             I  LG++GT+GY+L+   SL+ LD++ N IHD+IPYQLPPNLTSLNLA NN++G++PYSI
Sbjct  80    ISELGVSGTLGYLLSDLMSLRNLDVNGNNIHDIIPYQLPPNLTSLNLARNNLSGNLPYSI  139

Query  628   SLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQ  807
             S M SL+Y+N S NSL+  IGD+F     L+TLDLS NN +GDLP+S   L+ LS+L VQ
Sbjct  140   STMVSLSYMNVSHNSLSMSIGDIFGTHDSLSTLDLSHNNLTGDLPSSFSTLTKLSVLYVQ  199

Query  808   NNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftp  987
             NNQLTGS++VL  LPLT LNVANN F+G +P +L SI  F Y GNSF N           
Sbjct  200   NNQLTGSIDVLSGLPLTTLNVANNHFNGSVPEKLSSIQTFIYDGNSFDN-------VPAS  252

Query  988   pppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsa  1167
             P P + HKR + S  GS K   S    SD + G       +  GAI GIV G   V    
Sbjct  253   PQPEKSHKRRSRS--GSKKPGVSSGESSDTDTG-------LSGGAIAGIVFGCLFVAGIL  303

Query  1168  ivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERM  1347
              +V +  +++ K+K    R S G+LPL    E+ +QR KS A V D+K PP   V ++R+
Sbjct  304   ALVFILFIQKNKRKVRVTRPSQGNLPLGGSIEMQEQRLKSVAAVADVKAPP--PVMVDRV  361

Query  1348  QGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKK  1521
               KNGS+ R  SPITA+ YTVA LQ ATNSFSQEN++GEGSLGRVYRA+F NGK +AIKK
Sbjct  362   L-KNGSVNRTRSPITASQYTVASLQVATNSFSQENIIGEGSLGRVYRAEFSNGKTMAIKK  420

Query  1522  VDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHF  1701
             +D+AALSLQEEDNFLEA+S+MSRLRHPNIVPL GYC EHGQRLLVY+YI NG+L DMLH 
Sbjct  421   IDNAALSLQEEDNFLEAVSSMSRLRHPNIVPLAGYCTEHGQRLLVYEYISNGNLDDMLHL  480

Query  1702  ADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGL  1881
              D+RS+ LTWN+RVRVALGTARALEYLHEVCLP VVHRNFKSANILLDEELNPHLSDCGL
Sbjct  481   NDDRSKSLTWNSRVRVALGTARALEYLHEVCLPFVVHRNFKSANILLDEELNPHLSDCGL  540

Query  1882  AALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR  2061
             AALTPNTERQ+ ST VVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR
Sbjct  541   AALTPNTERQV-STQVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR  599

Query  2062  ERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMS  2241
              RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALC+QPEPEFRPPMS
Sbjct  600   PRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCIQPEPEFRPPMS  659

Query  2242  EVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             EVVQ LVRLVQRASV+ RR SD++GF+Y+TP+H+
Sbjct  660   EVVQQLVRLVQRASVIKRRSSDDAGFSYRTPEHE  693



>emb|CDY27444.1| BnaC03g64840D [Brassica napus]
Length=698

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/705 (67%), Positives = 555/705 (79%), Gaps = 27/705 (4%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             V+L+I + IS    V   TDP+D+QAL+VLY SLNSPSQL+ WK  GGDPCGESWKG+TC
Sbjct  11    VLLLIFSSISGFSVVNCVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWKGITC  70

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
             + SAVVSI+I   G++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTSLNLA NN
Sbjct  71    ERSAVVSIDISDSGVSGTLGYLLSDLMSLRKLDVSGNSIHDTLPYQLPPNLTSLNLARNN  130

Query  601   ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
             ++GS+PYSIS M SL Y+N SGNSL+  IGD+F + + L+T DLS NNFSGDLP+S+  +
Sbjct  131   LSGSLPYSISAMASLTYMNVSGNSLSMSIGDIFADHNSLSTFDLSHNNFSGDLPSSVSTV  190

Query  781   SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSp  960
             S LS+L VQNN+LTG+++VL  LPLT LNVANN F+G IP EL SI    Y GNSF N+P
Sbjct  191   SKLSVLYVQNNELTGTIDVLSGLPLTTLNVANNHFNGSIPKELTSIKTLIYDGNSFDNAP  250

Query  961   apppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivl  1140
             A P P            +   ++P   K  G                  +  G + GIV 
Sbjct  251   ASPQPERPDKKGKPSGSKKPKTSP---KAKGKSSEKG------------LSGGVVSGIVF  295

Query  1141  gssavvlsaivvivYCLRRCKKKEFAA--RTSTGSLPLSTDKEVLDQRAKSTATVVDLKP  1314
             GS  V     +V+  CL + +KK   +  R S  SLPLS   +V +QR K      DLK 
Sbjct  296   GSLFVAGIIALVLYLCLHKKRKKVGGSTKRASQRSLPLSGTTQVQEQRVK------DLKS  349

Query  1315  PPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRAD  1488
              P+EKVT++R+  KNGS+RR  SPITA+PYTV+ LQ ATNSFSQEN++GEGSLGRVYRA+
Sbjct  350   SPAEKVTVDRVM-KNGSIRRMRSPITASPYTVSSLQVATNSFSQENIIGEGSLGRVYRAE  408

Query  1489  FPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYI  1668
             FPNGKV+AIKK+D+A+LSLQEEDNFLEA+SNMSRLRHPNIVPL GYC EH QRLLVY+Y+
Sbjct  409   FPNGKVMAIKKIDNASLSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHDQRLLVYEYV  468

Query  1669  GNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDE  1848
             GNG+L DMLH  D+RS  LTWNARV+VALGTA+ALEYLHEVCLPSVVHRNFKSANILLDE
Sbjct  469   GNGNLDDMLHLNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSVVHRNFKSANILLDE  528

Query  1849  ELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLEL  2028
             ELNPHLSDCGLAAL PNTER++ ST +VGSFGYSAPEFALSG+YTVKSDVY+FGVVMLEL
Sbjct  529   ELNPHLSDCGLAALNPNTERRV-STQMVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLEL  587

Query  2029  LTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCV  2208
             LTGRKPLDSSR R+EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADIIALC+
Sbjct  588   LTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCI  647

Query  2209  QPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             QPEPEFRPPMSEVVQ LVRLVQRASVV RR SD++GF+Y+TP+H+
Sbjct  648   QPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDNGFSYRTPEHE  692



>ref|XP_006449793.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
 gb|ESR63033.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
Length=698

 Score =   910 bits (2351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/718 (69%), Positives = 569/718 (79%), Gaps = 42/718 (6%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L    VL+++  ++ L  V   TD +D+ AL+VLY SLNSPS L+ WK +GGDPCGESWK
Sbjct  18    LLAAFVLILSIFLT-LSLVQCTTDSSDVLALQVLYTSLNSPSVLTNWKGNGGDPCGESWK  76

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV C+GSAVVSI++ GLGLNGTMGY+L+   SL++L                      NL
Sbjct  77    GVACEGSAVVSIDVSGLGLNGTMGYLLSDLLSLRKL----------------------NL  114

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A+NN +G++PYSI+ M SL+YLN S N L Q IGD+F   + L TLDLSFNNFSGDLP S
Sbjct  115   ASNNFSGNLPYSIASMVSLSYLNVSRNWLTQSIGDIFGTLACLATLDLSFNNFSGDLPNS  174

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                LSN+S L +QNNQLTGSLNV   LPLT LNVANN  SGWIP ELISI  F Y GNSF
Sbjct  175   FISLSNISSLYLQNNQLTGSLNVFSGLPLTTLNVANNHLSGWIPRELISIRTFIYDGNSF  234

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N PAPPPPP T PP GR H   +H   GSH   GS  + SD E         + AGAIV
Sbjct  235   DNGPAPPPPPSTAPPSGRSHNNRSHRQ-GSHSPSGSQSSSSDKE---------LSAGAIV  284

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATV  1299
             GIVLG+  +V  A++ + +C+ + + K   AR+S GSLP+ST+    E+ +QR KS A V
Sbjct  285   GIVLGAVFLVALALLALYFCIWKNRTKVSGARSSAGSLPVSTNNMNTEMHEQRVKSVAAV  344

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DL PPP+EK+ IER+  K+GSL++  SPITAT YTVA LQTATNSFSQE L+GEGSLGR
Sbjct  345   TDLTPPPAEKLVIERV-AKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGR  403

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+F NGK++A+KK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLL
Sbjct  404   VYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLL  463

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY+Y+GNGSLHDMLHFAD+ S+ LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN
Sbjct  464   VYEYVGNGSLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  523

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLD+ELNPHLSDCGLAALTPNTERQ+ ST +VG+FGYSAPEFALSG+YTVKSDVYSFGV
Sbjct  524   ILLDDELNPHLSDCGLAALTPNTERQV-STQMVGAFGYSAPEFALSGIYTVKSDVYSFGV  582

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADI
Sbjct  583   VMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADI  642

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGDPPY  2367
             IALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SDESGF+Y+TPDH+A   D P+
Sbjct  643   IALCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRSSDESGFSYRTPDHEAI--DTPF  698



>ref|XP_010539255.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Tarenaya 
hassleriana]
Length=702

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/697 (69%), Positives = 553/697 (79%), Gaps = 27/697 (4%)
 Frame = +1

Query  274   LGF--VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIE  447
             LGF  V  ATDP+D+QAL+VLY SLNSPSQL+ WK+ GGDPCGESWKGVTC+GSAVVSI+
Sbjct  20    LGFSSVHCATDPSDVQALQVLYTSLNSPSQLTNWKSGGGDPCGESWKGVTCEGSAVVSID  79

Query  448   IPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSI  627
             I  LG++GT+GY+L+   SL+ LD++ N IHD+IPYQLPPNLTSLNLA NN++G++PYSI
Sbjct  80    ISELGVSGTLGYLLSDLMSLRNLDVNGNNIHDIIPYQLPPNLTSLNLARNNLSGNLPYSI  139

Query  628   SLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQ  807
             S M SL+Y+N S NSL+  IGD+F     L+TLDLS NN +GDLP+S   L+ LS+L VQ
Sbjct  140   STMVSLSYMNVSHNSLSMSIGDIFGTHDSLSTLDLSHNNLTGDLPSSFSTLTKLSVLYVQ  199

Query  808   NNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftp  987
             NNQLTGS++VL  LPLT LNVANN F+G +P +L SI  F Y GNSF N           
Sbjct  200   NNQLTGSIDVLSGLPLTTLNVANNHFNGSVPEKLSSIQTFIYDGNSFDN-------VPAS  252

Query  988   pppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsa  1167
             P P + HKR + S  GS K   S    SD + G       +  GAI GIV G   V    
Sbjct  253   PQPEKSHKRRSRS--GSKKPGVSSGESSDTDTG-------LSGGAIAGIVFGCLFVAGIL  303

Query  1168  ivvivYCLRRCKKKEFAARTSTGSLPLS---TDKEVLDQRAKSTATVVDLKPPPSEKVTI  1338
              +V +  +++ K+K    R S G+LPL       E+ +QR KS A V D+K PP   V +
Sbjct  304   ALVFILFIQKNKRKVRVTRPSQGNLPLGGSIVTTEMQEQRLKSVAAVADVKAPP--PVMV  361

Query  1339  ERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLA  1512
             +R+  KNGS+ R  SPITA+ YTVA LQ ATNSFSQEN++GEGSLGRVYRA+F NGK +A
Sbjct  362   DRVL-KNGSVNRTRSPITASQYTVASLQVATNSFSQENIIGEGSLGRVYRAEFSNGKTMA  420

Query  1513  IKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDM  1692
             IKK+D+AALSLQEEDNFLEA+S+MSRLRHPNIVPL GYC EHGQRLLVY+YI NG+L DM
Sbjct  421   IKKIDNAALSLQEEDNFLEAVSSMSRLRHPNIVPLAGYCTEHGQRLLVYEYISNGNLDDM  480

Query  1693  LHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSD  1872
             LH  D+RS+ LTWN+RVRVALGTARALEYLHEVCLP VVHRNFKSANILLDEELNPHLSD
Sbjct  481   LHLNDDRSKSLTWNSRVRVALGTARALEYLHEVCLPFVVHRNFKSANILLDEELNPHLSD  540

Query  1873  CGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLD  2052
             CGLAALTPNTERQ+ ST VVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLD
Sbjct  541   CGLAALTPNTERQV-STQVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLD  599

Query  2053  SSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRP  2232
             SSR RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALC+QPEPEFRP
Sbjct  600   SSRPRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCIQPEPEFRP  659

Query  2233  PMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             PMSEVVQ LVRLVQRASV+ RR SD++GF+Y+TP+H+
Sbjct  660   PMSEVVQQLVRLVQRASVIKRRSSDDAGFSYRTPEHE  696



>ref|XP_010538738.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Tarenaya 
hassleriana]
Length=701

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/708 (66%), Positives = 560/708 (79%), Gaps = 25/708 (4%)
 Frame = +1

Query  226   FLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESW  405
             FLF  +V + A        V  ATDP+D+QAL+VLY SLN+P QL+ WK++GGDPCGESW
Sbjct  11    FLFLFMVSIFA-----FSAVRCATDPSDVQALQVLYASLNNPPQLTNWKSNGGDPCGESW  65

Query  406   KGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLN  585
             KGVTC+GSAVVSI++  LG++GT+GY+L+   SL++LD+S N IHD I YQLPPNLTSLN
Sbjct  66    KGVTCEGSAVVSIDMSELGVSGTLGYLLSDLMSLRKLDVSGNNIHDTIAYQLPPNLTSLN  125

Query  586   LANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPA  765
             LA NN++GS+PYS+S M SL+Y+N S NSL+  IG++F++   L+TLDLS+NN SGDLP+
Sbjct  126   LARNNLSGSLPYSLSTMVSLSYMNASHNSLSMSIGNIFSSHGSLSTLDLSYNNLSGDLPS  185

Query  766   SLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNS  945
             S   L+ LS+L +QNNQLTGS+ VL  L LT LNVANN F+G +P  L SI  F+Y GNS
Sbjct  186   SFSTLTKLSVLYIQNNQLTGSIGVLSGLNLTTLNVANNHFNGSVPANLSSIQTFKYDGNS  245

Query  946   FSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAi  1125
             F N           P P + HK+ N S  GS K   S+   SD + G       +  GAI
Sbjct  246   FDN-------VPASPQPEKSHKKGNRS--GSKKPDVSNGKSSDTDAG-------LSGGAI  289

Query  1126  vgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVD  1305
              GIV G  +V  +  +V++ C+++ K+K    R S G+LP     E+ +QR KS A + D
Sbjct  290   TGIVFGCLSVAGTLAIVLILCIQKNKRKVRGTRASQGNLPHGGASEMHEQRVKSVAAMAD  349

Query  1306  LKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVY  1479
             LK  P+EKV ++R+  KNGS++R  SPITA+ YTVA LQ ATNSFSQEN++ EGSLGRVY
Sbjct  350   LKAQPAEKVIVDRVM-KNGSVKRMRSPITASQYTVASLQVATNSFSQENIISEGSLGRVY  408

Query  1480  RADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVY  1659
             +A+FP GK +AIKK+D+AALSLQEE+NFLEAISNMSRLRHPNI+PL GYC EHGQRLLVY
Sbjct  409   KAEFPGGKTMAIKKIDNAALSLQEEENFLEAISNMSRLRHPNIIPLAGYCTEHGQRLLVY  468

Query  1660  DYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  1839
             +Y+ NG+L DMLH  D+RS+ LTWN RVRVALGTARALEYLHEVCLPS VHRNFKSANIL
Sbjct  469   EYVSNGNLDDMLHLNDDRSKTLTWNGRVRVALGTARALEYLHEVCLPSGVHRNFKSANIL  528

Query  1840  LDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVM  2019
             LD+ELNPHLSDCGLAALTPNTERQ+ ST +VGSFGYS PEFALSGVYT+KSDVYSFGVVM
Sbjct  529   LDDELNPHLSDCGLAALTPNTERQV-STQMVGSFGYSPPEFALSGVYTIKSDVYSFGVVM  587

Query  2020  LELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIA  2199
             LELLTGRKPLDSSR R EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADIIA
Sbjct  588   LELLTGRKPLDSSRPRPEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIA  647

Query  2200  LCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             LC+QPEPEFRPPMSEVVQ LVRLVQRASV+ RR SD++GF+Y+TP+H+
Sbjct  648   LCIQPEPEFRPPMSEVVQQLVRLVQRASVMKRRTSDDTGFSYRTPEHE  695



>ref|XP_010434074.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Camelina 
sativa]
Length=703

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/709 (65%), Positives = 550/709 (78%), Gaps = 23/709 (3%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             +FT ++L  A+ IS    V   TDP+D+QAL+VLY SLNSPSQL+ WK  GGDPCGESW+
Sbjct  8     MFTFLLLFFAS-ISGFSLVRCVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWR  66

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             G+TC+GSAVV+I+I  LG++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTS+NL
Sbjct  67    GITCEGSAVVTIDISDLGVSGTLGYLLSDLMSLRKLDVSGNSIHDTLPYQLPPNLTSINL  126

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             + NN++G++PYSIS M SL+Y+N SGNSL+ PIGD+F N   L+TLDLS NNFSGDLP+S
Sbjct  127   SRNNLSGNLPYSISAMGSLSYMNVSGNSLSMPIGDIFANHKSLSTLDLSHNNFSGDLPSS  186

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
             L  +S LS L VQNNQ TGS+ VL  LPL  LNVANN F+G IP EL SI    Y GNSF
Sbjct  187   LSTVSKLSALYVQNNQFTGSIVVLSGLPLKTLNVANNHFNGSIPKELSSIQTIIYDGNSF  246

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N            P      +    +       G+++  S+ E G         +G +V
Sbjct  247   DN--------VPASPQPDRPGKKGKPSGSKKPKIGTEEKSSESEKGL--------SGGVV  290

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAA--RTSTGSLPLSTDKEVLDQRAKSTATVV  1302
               ++  S  V   I + +Y     +K++     R    SLPLS   E  +QR +  A+V 
Sbjct  291   TGIVFGSLFVAGIIALFLYLYLHKRKRKVGGSTRADQRSLPLSGITETQEQRVRIVASVA  350

Query  1303  DLKPPPSEKVTIERMQGKNGSLR--RSPITATPYTVAVLQTATNSFSQENLVGEGSLGRV  1476
             D K  P+EKVT++R+  KNGS+   RSPITA+ YTV  LQ ATNSFSQEN++GEGSLGRV
Sbjct  351   DFKSSPAEKVTVDRVM-KNGSISRIRSPITASQYTVCSLQVATNSFSQENIIGEGSLGRV  409

Query  1477  YRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLV  1656
             YRA+FPNGK++AIKK+D+ ALSLQEEDNFLEA+SNMSRLRHPNIVPL GYC EHGQRLLV
Sbjct  410   YRAEFPNGKIMAIKKIDNVALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLV  469

Query  1657  YDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANI  1836
             Y+Y+GNG+L D LH  D+RS  LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSANI
Sbjct  470   YEYVGNGNLDDTLHMNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANI  529

Query  1837  LLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVV  2016
             LLDEELNPHLSD GLAALTPNTERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVY+FGVV
Sbjct  530   LLDEELNPHLSDSGLAALTPNTERQV-STQIVGSFGYSAPEFALSGVYTVKSDVYTFGVV  588

Query  2017  MLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADII  2196
             MLELLTGRKPLDSSR R+EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADII
Sbjct  589   MLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADII  648

Query  2197  ALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             ALC+QPEPEFRPPMSEVVQ LVRLVQRASVV RR SD++GF+Y+TP+H+
Sbjct  649   ALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDTGFSYRTPEHE  697



>gb|KFK28787.1| hypothetical protein AALP_AA7G048200 [Arabis alpina]
Length=694

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/704 (67%), Positives = 552/704 (78%), Gaps = 21/704 (3%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             +  V+  LIS   FV   TD +D+QAL+VLY SLNSPSQL+ W   GGDPCGESWKG+TC
Sbjct  3     MFFVLLTLISGFSFVRCVTDQSDVQALQVLYTSLNSPSQLTNWNNGGGDPCGESWKGITC  62

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
             +GSAVVSI+I  LG++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTS++L+ NN
Sbjct  63    EGSAVVSIDISDLGVSGTLGYLLSDLMSLRKLDVSGNNIHDTLPYQLPPNLTSIDLSRNN  122

Query  601   ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
             ++G++PYSIS M+SL+Y+N SGNSL+  IGD+F     LTTLDLS NNFSGDLP+SL   
Sbjct  123   LSGNLPYSISAMSSLSYMNVSGNSLSMSIGDIFAGHESLTTLDLSHNNFSGDLPSSLSTA  182

Query  781   SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSp  960
             S LS+L VQNNQLTGS+++L  LPLT LNVANN F G IP ELISI    Y GNSF N  
Sbjct  183   SKLSVLYVQNNQLTGSIDLLSSLPLTTLNVANNHFKGSIPKELISIKTLIYDGNSFDN--  240

Query  961   apppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivl  1140
                      P    P +      P   K P  D      E  +     G+  G + GIV 
Sbjct  241   --------VPASPEPERPDKKEKPPGSKKPNKDKGP---EEKSSESNKGLSGGVVSGIVF  289

Query  1141  gssavvlsaivvivYCLRRCKKKEFAA-RTSTGSLPLSTDKEVLDQRAKSTATVVDLKPP  1317
             GS  V     +V+  C+ + KKK   + R S  SLPLS   E+ +QR KS A+V D    
Sbjct  290   GSLFVAGIIALVLYLCIHKKKKKVGGSTRASQRSLPLSATSEMQEQRVKSVASVAD---S  346

Query  1318  PSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADF  1491
             P+EKVT++R+  KNGSL R  SPITA+ YTV+ LQ ATNSFSQEN++GEGSLGRVYRA+F
Sbjct  347   PAEKVTVDRVL-KNGSLNRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEF  405

Query  1492  PNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIG  1671
             PNGK++AIKK+D+AALSLQEED FLEAISNMSRLRHPNIVPLVGYC EH QRLLVY+Y+G
Sbjct  406   PNGKIMAIKKIDNAALSLQEEDTFLEAISNMSRLRHPNIVPLVGYCTEHAQRLLVYEYVG  465

Query  1672  NGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE  1851
             NG+L D LH  D+RS  LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSANILLDEE
Sbjct  466   NGNLDDTLHLNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEE  525

Query  1852  LNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELL  2031
             LNPHLSD GLAALTPNTERQ+ ST VVGSFGYSAPEFALSGVYTVKSDVY+FGVVMLELL
Sbjct  526   LNPHLSDSGLAALTPNTERQV-STQVVGSFGYSAPEFALSGVYTVKSDVYTFGVVMLELL  584

Query  2032  TGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQ  2211
             TGRKPLDSSR R+EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADIIALC+Q
Sbjct  585   TGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQ  644

Query  2212  PEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             PEPEFRPPMSEVVQ LVRLVQRASVV RR SD++GF+Y+TP+H+
Sbjct  645   PEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDTGFSYRTPEHE  688



>ref|XP_010928422.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010928423.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
Length=720

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/706 (68%), Positives = 573/706 (81%), Gaps = 23/706 (3%)
 Frame = +1

Query  283   VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLG  462
             V +ATDP+D+QAL VLY SLNSP QLSGW +SGGDPC +SWKG+TC GSAV +I++ G+G
Sbjct  21    VESATDPSDVQALGVLYSSLNSPPQLSGWTSSGGDPCRDSWKGITCSGSAVTAIQVSGMG  80

Query  463   LNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTS  642
             LNGT+GY+L+   SLK LD+S+N + + IPYQLPPNLT LNLA  N++GS+P+SIS M S
Sbjct  81    LNGTLGYLLSDLLSLKTLDISNNNLREGIPYQLPPNLTYLNLAKANLSGSLPFSISTMVS  140

Query  643   LNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLT  822
             LNY N S NSL+Q IGD+F N  DL+ LD+SFNN +GDLP SL  LSNLS L +Q+NQLT
Sbjct  141   LNYFNLSHNSLSQQIGDIFANLQDLSELDISFNNLTGDLPNSLSSLSNLSSLYLQDNQLT  200

Query  823   GSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgr  1002
             G +N+L  L LT LN+ANN FSGWIP E  SIP     GNSF+N PAPPPPP+ PPPP R
Sbjct  201   GPVNLLASLDLTTLNIANNNFSGWIPQEFSSIPNLIIGGNSFANGPAPPPPPYVPPPPSR  260

Query  1003  pHKRTNHS-----TPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsa  1167
             PHK  NH+     TP S   P S   H D++N   +    + AG+I+GI + S+   L  
Sbjct  261   PHKNRNHTEAPTDTPDS---PESKPFHPDNKNKKKS----LTAGSIIGITISSAFGALCV  313

Query  1168  ivvivYCLRRCKKKEFAARTSTG---SLPL----STDKEVLDQRAKSTATVVDLKPPPSE  1326
             I+ +++CL   +K++   RT+     S+ +    +TDKE+ +QR +S A+V  LKPPP E
Sbjct  314   ILAVIFCLWNVQKEKDDTRTNASHSRSVSIGADRATDKEMREQRLES-ASVTSLKPPPVE  372

Query  1327  KVTIERMQGKNGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNG  1500
             K+ +E++ GKNGS ++   PITAT YTVA LQ ATNSFSQ++L+GEGSLGRVYRA+F NG
Sbjct  373   KMMVEKVYGKNGSGKKPKVPITATSYTVASLQIATNSFSQDSLLGEGSLGRVYRAEFSNG  432

Query  1501  KVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGS  1680
             KVLA+KK+DSAALSLQEEDN+LEA+S+MSRL+HPNIV LVGYC EHGQRLLVY+YIGN +
Sbjct  433   KVLAVKKIDSAALSLQEEDNYLEAVSSMSRLKHPNIVTLVGYCVEHGQRLLVYEYIGNAT  492

Query  1681  LHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNP  1860
             LHDMLHFAD+ S  +TWNARVR+ALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNP
Sbjct  493   LHDMLHFADDSSTKVTWNARVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNP  552

Query  1861  HLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGR  2040
             HLSDCGLAALTPNTERQ+ ST VVGSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLTGR
Sbjct  553   HLSDCGLAALTPNTERQV-STEVVGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGR  611

Query  2041  KPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEP  2220
             KPLDSSRERSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEP
Sbjct  612   KPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEP  671

Query  2221  EFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             EFRPPMSEVVQ LVRL+QRAS+V R   DE G++Y+  +H+A++ D
Sbjct  672   EFRPPMSEVVQQLVRLMQRASIVRRSSGDELGYSYRISEHEASTTD  717



>ref|XP_010943263.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
Length=742

 Score =   894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/704 (69%), Positives = 568/704 (81%), Gaps = 18/704 (3%)
 Frame = +1

Query  283   VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLG  462
             V +ATDP D+QAL VLY SLNSP QLSGW  SGGDPCG+SWKG+TC GSAV ++++ G+G
Sbjct  42    VESATDPFDVQALGVLYSSLNSPPQLSGWTWSGGDPCGDSWKGITCSGSAVTAMQVSGMG  101

Query  463   LNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTS  642
             LNGT+GY+L+   SLK LD+S+N IHD IPYQLPPNLT LNLANNN++G++PYSI  M S
Sbjct  102   LNGTLGYLLSDLLSLKTLDMSNNSIHDGIPYQLPPNLTYLNLANNNLSGNLPYSIYTMVS  161

Query  643   LNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLT  822
             LNYLN S NSL+Q IGD+F N  DL+ LDLSFNN +GDLP SL  LS+LS L +Q NQLT
Sbjct  162   LNYLNLSHNSLSQQIGDIFANLQDLSELDLSFNNLTGDLPNSLSSLSHLSSLYLQENQLT  221

Query  823   GSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgr  1002
             G +N+L +L LT LN+A+N FSGW+P E  SIP     GN+F+N PAPPPPP+ PPPP R
Sbjct  222   GPVNLLANLDLTTLNIADNNFSGWMPQEFSSIPNLITGGNTFANGPAPPPPPYVPPPPSR  281

Query  1003  pHKRTNHSTPGSH--KTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivv  1176
             PHK  NH+   +   + P S   H D+EN   +    + AG++ GIV+GS+   L  +V 
Sbjct  282   PHKNRNHTKAPTDTPQGPESKPFHPDNENNKKS----LTAGSVTGIVIGSTLGALCIVVA  337

Query  1177  ivYCLRRCKKKEFAARTSTGSLPLS--------TDKEVLDQRAKSTATVVDLKPPPSEKV  1332
             +++ L    KK+   R ST     S        TDKE+ +QR K TA+V  LKP P+EK+
Sbjct  338   VIFYLWNVPKKKDDTRNSTSPYLASATLGEDRATDKEMREQRLK-TASVTSLKPLPAEKM  396

Query  1333  TIERMQGKNGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKV  1506
              +E++ GKNGS +R   PITAT +T+A LQ ATNSFSQ++LVGEGSLGRVYRA+  NGKV
Sbjct  397   MVEKVYGKNGSGKRPKVPITATSHTIASLQIATNSFSQDSLVGEGSLGRVYRAEISNGKV  456

Query  1507  LAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLH  1686
             LA+KK+DSAALSLQEEDNFLEA+SNMSRLRHPNIV LVGYC EHGQRLLVY+YIGN +LH
Sbjct  457   LAVKKIDSAALSLQEEDNFLEAVSNMSRLRHPNIVSLVGYCVEHGQRLLVYEYIGNRTLH  516

Query  1687  DMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHL  1866
             DMLH+AD+ S  LTWNARVRVALGTARALEYLHEVCLPS+VHRNFKSANILLDEELNPHL
Sbjct  517   DMLHYADDSSNKLTWNARVRVALGTARALEYLHEVCLPSLVHRNFKSANILLDEELNPHL  576

Query  1867  SDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKP  2046
             SDCGLAALTPNTERQ+ ST +VGSFGYSAPEFA+SGVYTVKSDVYSFG+VMLELLTGRKP
Sbjct  577   SDCGLAALTPNTERQV-STEMVGSFGYSAPEFAMSGVYTVKSDVYSFGIVMLELLTGRKP  635

Query  2047  LDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEF  2226
             LDSSRERSEQSLVRWATPQLHDIDAL+KMVDPALNG+YPAKSLSRFAD+IALCVQPEPEF
Sbjct  636   LDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGIYPAKSLSRFADVIALCVQPEPEF  695

Query  2227  RPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             RPPMSEVVQ LVRL+QRAS+V R   DE G++Y+ P+H+ +  D
Sbjct  696   RPPMSEVVQQLVRLMQRASIVRRSSGDELGYSYRVPEHEVSMTD  739



>ref|XP_010539270.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X3 [Tarenaya 
hassleriana]
Length=685

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/694 (68%), Positives = 545/694 (79%), Gaps = 38/694 (5%)
 Frame = +1

Query  274   LGF--VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIE  447
             LGF  V  ATDP+D+QAL+VLY SLNSPSQL+ WK+ GGDPCGESWKGVTC+GSAVVSI+
Sbjct  20    LGFSSVHCATDPSDVQALQVLYTSLNSPSQLTNWKSGGGDPCGESWKGVTCEGSAVVSID  79

Query  448   IPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSI  627
             I  LG++GT+GY+L+   SL+ LD++ N IHD+IPYQLPPNLTSLNLA NN++G++PYSI
Sbjct  80    ISELGVSGTLGYLLSDLMSLRNLDVNGNNIHDIIPYQLPPNLTSLNLARNNLSGNLPYSI  139

Query  628   SLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQ  807
             S M SL+Y+N S NSL+  IGD+F     L+TLDLS NN +GDLP+S   L+ LS+L VQ
Sbjct  140   STMVSLSYMNVSHNSLSMSIGDIFGTHDSLSTLDLSHNNLTGDLPSSFSTLTKLSVLYVQ  199

Query  808   NNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftp  987
             NNQLTGS++VL  LPLT LNVANN F+G +P +L SI  F Y GNSF N           
Sbjct  200   NNQLTGSIDVLSGLPLTTLNVANNHFNGSVPEKLSSIQTFIYDGNSFDN-------VPAS  252

Query  988   pppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsa  1167
             P P + HKR + S  GS K   S    SD + G       +  GAI GIV G   V    
Sbjct  253   PQPEKSHKRRSRS--GSKKPGVSSGESSDTDTG-------LSGGAIAGIVFGCLFVAGIL  303

Query  1168  ivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERM  1347
              +V +  +++ K+K    R S G+LPL                 +D+K PP   V ++R+
Sbjct  304   ALVFILFIQKNKRKVRVTRPSQGNLPLGGS--------------IDVKAPP--PVMVDRV  347

Query  1348  QGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKK  1521
               KNGS+ R  SPITA+ YTVA LQ ATNSFSQEN++GEGSLGRVYRA+F NGK +AIKK
Sbjct  348   L-KNGSVNRTRSPITASQYTVASLQVATNSFSQENIIGEGSLGRVYRAEFSNGKTMAIKK  406

Query  1522  VDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHF  1701
             +D+AALSLQEEDNFLEA+S+MSRLRHPNIVPL GYC EHGQRLLVY+YI NG+L DMLH 
Sbjct  407   IDNAALSLQEEDNFLEAVSSMSRLRHPNIVPLAGYCTEHGQRLLVYEYISNGNLDDMLHL  466

Query  1702  ADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGL  1881
              D+RS+ LTWN+RVRVALGTARALEYLHEVCLP VVHRNFKSANILLDEELNPHLSDCGL
Sbjct  467   NDDRSKSLTWNSRVRVALGTARALEYLHEVCLPFVVHRNFKSANILLDEELNPHLSDCGL  526

Query  1882  AALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR  2061
             AALTPNTERQ+ ST VVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR
Sbjct  527   AALTPNTERQV-STQVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR  585

Query  2062  ERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMS  2241
              RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALC+QPEPEFRPPMS
Sbjct  586   PRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCIQPEPEFRPPMS  645

Query  2242  EVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             EVVQ LVRLVQRASV+ RR SD++GF+Y+TP+H+
Sbjct  646   EVVQQLVRLVQRASVIKRRSSDDAGFSYRTPEHE  679



>ref|XP_002316561.2| hypothetical protein POPTR_0011s01540g [Populus trichocarpa]
 gb|EEE97173.2| hypothetical protein POPTR_0011s01540g [Populus trichocarpa]
Length=689

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/709 (68%), Positives = 556/709 (78%), Gaps = 44/709 (6%)
 Frame = +1

Query  244   VLVIAALISRLGF---VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGV  414
             V V+  LI   GF   V   TD ND+QAL+ +Y SLNSPSQL+ WK+ GGDPCGESWKG+
Sbjct  12    VFVVKVLI--FGFPVLVQCTTDANDVQALQSMYSSLNSPSQLTSWKSIGGDPCGESWKGI  69

Query  415   TCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLAN  594
             TC+GSAVVS++I GLGL+GTMGYML+   SL+  DLS N IHD +PYQLPPNLTSLNLA 
Sbjct  70    TCEGSAVVSVQISGLGLDGTMGYMLSNLMSLRTFDLSDNNIHDPLPYQLPPNLTSLNLAI  129

Query  595   NNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLG  774
             NN++G++PYSIS M SL+YLN S NSL+Q IGD+F N S L+T+D+SFNN SGD+P+S  
Sbjct  130   NNLSGNLPYSISTMVSLSYLNVSRNSLSQSIGDVFHNLSLLSTMDVSFNNLSGDIPSSFS  189

Query  775   LLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN  954
              LSNLS L VQNNQLTGSLNVL  LPLT LNVANN  SGWIP EL SIP F Y+GNSF N
Sbjct  190   SLSNLSTLNVQNNQLTGSLNVLTGLPLTTLNVANNNLSGWIPQELSSIPNFIYNGNSFDN  249

Query  955   SpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgi  1134
              PAPPPPP+T PP G+ H+   H   G+ +T  SD   S+ +        G+  GAIVG+
Sbjct  250   GPAPPPPPYTSPPSGKSHRNRTHPGSGAPRTSSSDGQPSESD-------KGISVGAIVGV  302

Query  1135  vlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLS---TDKEVLDQRAKSTATVVD  1305
              LGS  +VL A++ +V+C+++ + KE     S GS P     T  E+ + R K+ A V D
Sbjct  303   ALGSVVLVLIALLALVFCIKKHQGKEIDPLASRGSRPADTYYTGAEMQEPRVKNMAAVTD  362

Query  1306  LKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVY  1479
             LKPPP+EK+  ER+ G +GS++R  SPITAT Y+VA LQTATNSFSQE ++GEGSLGRVY
Sbjct  363   LKPPPAEKLVAERLLGNSGSIKRMKSPITATSYSVASLQTATNSFSQEFIIGEGSLGRVY  422

Query  1480  RADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVY  1659
             R DFP+GK++A+KK+D+AALSLQEEDNFLEA+SNMS LRHPNIV LVGYC EHGQRLLVY
Sbjct  423   RGDFPHGKIMAVKKIDNAALSLQEEDNFLEAVSNMSHLRHPNIVSLVGYCVEHGQRLLVY  482

Query  1660  DYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  1839
             +YI NGSLHD+LHFAD+ S+ L+WNARVRVALGTARALEYLHEVCLPSVVHRNFKSA   
Sbjct  483   EYIANGSLHDILHFADDGSKTLSWNARVRVALGTARALEYLHEVCLPSVVHRNFKSA---  539

Query  1840  LDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVM  2019
                                     I ST +VGSFGYSAPEFALSG+YTVKSDVYSFGVVM
Sbjct  540   ------------------------IVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVM  575

Query  2020  LELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIA  2199
             LELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIA
Sbjct  576   LELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIA  635

Query  2200  LCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             LCVQPEPEFRPPMSEVVQALVRLVQRASVV RR SD+SGFAYKTPDH+A
Sbjct  636   LCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRPSDDSGFAYKTPDHEA  684



>ref|XP_009135627.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Brassica rapa]
Length=706

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/706 (67%), Positives = 556/706 (79%), Gaps = 18/706 (3%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             ++LV+  L + +  V   TDP+D+QAL+VLY SLNSPSQL+ W   GGDPCGESWKG+TC
Sbjct  8     MLLVLLVLFTAISVVRCVTDPSDVQALQVLYTSLNSPSQLTNWNNGGGDPCGESWKGITC  67

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
             +GSAVVSI+I  LG++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTSLNLA NN
Sbjct  68    EGSAVVSIDISDLGVSGTLGYLLSDLMSLRKLDVSGNSIHDTLPYQLPPNLTSLNLARNN  127

Query  601   ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
             ++G++PYSIS M SL+Y+N SGNSL+  +GD+F     L+TLDLS NNFSGDLP+SL  L
Sbjct  128   LSGNLPYSISAMGSLSYMNVSGNSLSMSVGDIFAGLKSLSTLDLSHNNFSGDLPSSLSTL  187

Query  781   SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSp  960
             S LS+L VQNNQLTG+++VL  LPLT LNVANN F+G IP EL SI    Y GNSF N+P
Sbjct  188   SQLSVLYVQNNQLTGTIDVLSGLPLTTLNVANNHFNGSIPKELSSIKTLIYDGNSFDNAP  247

Query  961   apppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivl  1140
             A P P                       TP + D  S+      + K G+  G + GIV 
Sbjct  248   ASPQPERPDKKSKPSSGSKKPK-----NTPDAKDKSSE-----SSDKGGLSGGVVTGIVF  297

Query  1141  gssavvlsaivvivYCLRRCKKK--EFAARTS-TGSLPLSTDKEVLDQRAKSTATVVDLK  1311
             GS  V     +V+  CL + K+K  E   R S   SLPLS   EV +QR K+ A +    
Sbjct  298   GSLFVAGIIALVLYLCLHKKKRKVGESTTRASHRTSLPLSVIPEVQEQRVKTVADMKSSS  357

Query  1312  PPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRA  1485
              PP +KVT++ +  KNGSL R  SPITA+ YTV+ LQ ATNSFSQEN++GEGSLGRVYRA
Sbjct  358   SPP-DKVTVDNVM-KNGSLTRMRSPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRA  415

Query  1486  DFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDY  1665
             +FPNGKV+A+KK+D+AALSLQEED FLEA+SNMSRLRHPNIVPL GYC EHGQRLLVY+Y
Sbjct  416   EFPNGKVMAVKKIDNAALSLQEEDCFLEAVSNMSRLRHPNIVPLGGYCTEHGQRLLVYEY  475

Query  1666  IGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLD  1845
             +GNG+L DMLH  D+RS  LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSANILLD
Sbjct  476   VGNGNLDDMLHLNDDRSMALTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLD  535

Query  1846  EELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLE  2025
             EELNPHLSDCGLAAL PNTERQ+ ST VVGSFGYSAPEFALSG+YTVKSDVY+FGVVMLE
Sbjct  536   EELNPHLSDCGLAALNPNTERQV-STQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLE  594

Query  2026  LLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALC  2205
             LLTGRKPLDSSR R+EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADIIALC
Sbjct  595   LLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALC  654

Query  2206  VQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             +QPEPEFRPPMSEVVQ LVRLVQRASVV RR SD++GF+Y+TP+H+
Sbjct  655   IQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDTGFSYRTPEHE  700



>ref|XP_008799289.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Phoenix dactylifera]
Length=737

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/704 (68%), Positives = 565/704 (80%), Gaps = 18/704 (3%)
 Frame = +1

Query  283   VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLG  462
             V +AT P+D++AL VLYG LNSP QL+GW +SGGDPC +SWKG+TC GSAV +IE+ G+G
Sbjct  37    VESATKPSDVRALGVLYGFLNSPPQLAGWTSSGGDPCRDSWKGITCSGSAVTAIEVSGMG  96

Query  463   LNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTS  642
             LNGT+GY+L+   SLK LD+S+N +H+ IPYQLPPNLT LNLA NN++G++P+SIS M S
Sbjct  97    LNGTLGYLLSDLLSLKTLDISNNNVHEGIPYQLPPNLTYLNLAKNNLSGNLPFSISTMVS  156

Query  643   LNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLT  822
             LNYLN S NSL+Q IGD+F N  DL+ LDLSFNN +GDLP SL  LSNLS L +Q+NQLT
Sbjct  157   LNYLNVSHNSLSQQIGDIFANLQDLSELDLSFNNLTGDLPNSLSSLSNLSSLYLQDNQLT  216

Query  823   GSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgr  1002
             G +N+L  L LT LN+AN+ FSGWIP E  SIP     GNSF + PAPPPPP+  PPP R
Sbjct  217   GPVNLLASLDLTTLNIANDNFSGWIPQEFSSIPNLITGGNSFIDGPAPPPPPYVAPPPSR  276

Query  1003  pHKRTNHSTP--GSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivv  1176
             PHK  NH+     +   P S   H D+     N K  + AG+I+GI++ S    L  I+ 
Sbjct  277   PHKNRNHTKAPIDTPDRPESKPFHPDN----TNEKKSLTAGSIIGIIISSIFGALCVILA  332

Query  1177  ivYCLRRCKKKEFAARTSTG--------SLPLSTDKEVLDQRAKSTATVVDLKPPPSEKV  1332
             + +CL    KK+   R +T         +   +TDKE+ +QR K TA+V  LKPPP EK+
Sbjct  333   VSFCLWNVPKKKDDTRMNTSHSLGFVTIAADRATDKEMREQRLK-TASVTSLKPPPVEKM  391

Query  1333  TIERMQGKNGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKV  1506
              +E++ G NGS +R   PITAT YTVA LQ ATNSFSQ++L+GEGSLGRVYRA+F +G V
Sbjct  392   MVEKVYGNNGSGKRPKVPITATSYTVASLQIATNSFSQDSLLGEGSLGRVYRAEFSDGTV  451

Query  1507  LAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLH  1686
             LA+KK+DSAALSLQEEDNFLEA+SNMSRLRHPNIV L+GYC EHGQRLLV++YIGNG+LH
Sbjct  452   LAVKKIDSAALSLQEEDNFLEAVSNMSRLRHPNIVTLLGYCVEHGQRLLVFEYIGNGTLH  511

Query  1687  DMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHL  1866
             DMLHFAD+ S+ LTWNARVRVALGTARALEYLHEVCLPS+VHRNFKSANILLDEELNP L
Sbjct  512   DMLHFADDSSKKLTWNARVRVALGTARALEYLHEVCLPSIVHRNFKSANILLDEELNPRL  571

Query  1867  SDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKP  2046
             SDCGLAALTPNTERQ+ ST VVGSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLTGRKP
Sbjct  572   SDCGLAALTPNTERQV-STEVVGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKP  630

Query  2047  LDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEF  2226
             LDSSRERSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEF
Sbjct  631   LDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEF  690

Query  2227  RPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             RPPMSEVVQ LVRL+QRAS+V R   DE G++Y+  +H+A++ D
Sbjct  691   RPPMSEVVQQLVRLMQRASIVRRSSGDELGYSYRVLEHEASTTD  734



>gb|KCW77015.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=696

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/676 (70%), Positives = 544/676 (80%), Gaps = 15/676 (2%)
 Frame = +1

Query  247   LVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQG  426
              ++ A+IS L      TDP+D+QAL+ LY SLNSPSQL+ WK+SGGDPC ESWKG+TC+G
Sbjct  19    FLVLAVISALRGARGTTDPSDVQALQTLYTSLNSPSQLTNWKSSGGDPCAESWKGITCEG  78

Query  427   SAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNIT  606
             SAVVSIE+ GLGLNGTMGY+L    SLK+ DLS+N IHD IPYQLPPNLT+LNLA NN+T
Sbjct  79    SAVVSIEVSGLGLNGTMGYLLTNLVSLKKFDLSNNNIHDGIPYQLPPNLTNLNLAGNNLT  138

Query  607   GSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSN  786
             G++PYSIS M +LNY+N S NSL+  +GD+F N S+LTT D S+NNFSGDLPAS   L+N
Sbjct  139   GNLPYSISNMVNLNYMNVSRNSLSLSLGDIFANVSNLTTADFSYNNFSGDLPASFSALAN  198

Query  787   LSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpap  966
             LS L +QNNQLTGSLNVLV LPLT LNVANN FSGWIP E  S+  F Y GNSF+NSPAP
Sbjct  199   LSSLYMQNNQLTGSLNVLVGLPLTTLNVANNHFSGWIPKEFSSLQTFIYDGNSFANSPAP  258

Query  967   ppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgs  1146
             PPP FT PPP +      HS  G+    GS    S           G+   AIVGI+ GS
Sbjct  259   PPPLFTAPPPAKSRNNRTHSGSGTSTLDGSAGQTSG-------SSKGLSTAAIVGIIAGS  311

Query  1147  savvlsaivvivYCLRRCKKKEFAARTST---GSLPLSTDKEVLDQRAKSTATVVDLKPP  1317
               ++L  ++ I  C R+C KK+  AR ST    S+  + + E+ +QR  +TA+V+DLKPP
Sbjct  312   VLLLLVLLLAIYCCCRKCNKKKRGARASTRGIQSVKSNVNPEMQEQRVITTASVIDLKPP  371

Query  1318  PSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADF  1491
             P++ +  ER+  KNGS+RR  SPITAT YTVA LQTA NSF QENL+GEGSLGRVYRADF
Sbjct  372   PADVLLAERVPSKNGSVRRIKSPITATSYTVASLQTAANSFGQENLIGEGSLGRVYRADF  431

Query  1492  PNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIG  1671
             PNGK++A+KK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV LVGYCAEHGQRLLVY+Y+G
Sbjct  432   PNGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLVGYCAEHGQRLLVYEYVG  491

Query  1672  NGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE  1851
             NG+LHD+LHFA++RS+ L WNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE
Sbjct  492   NGNLHDLLHFAEDRSKTLNWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE  551

Query  1852  LNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELL  2031
             LNPHLSDCGLAALTPNTERQ+S+  +VG FGYSAPEFALSGVYTVKSDVYSFGVVMLELL
Sbjct  552   LNPHLSDCGLAALTPNTERQVSA-QMVGQFGYSAPEFALSGVYTVKSDVYSFGVVMLELL  610

Query  2032  TGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQ  2211
             TGRKPLDSSR RSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQ
Sbjct  611   TGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQ  670

Query  2212  PEPEFRPPMSEVVQAL  2259
                 F PP++     L
Sbjct  671   --VNFIPPVTHANMCL  684



>ref|XP_010943264.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Elaeis guineensis]
Length=690

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/696 (68%), Positives = 545/696 (78%), Gaps = 54/696 (8%)
 Frame = +1

Query  283   VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLG  462
             V +ATDP D+QAL VLY SLNSP QLSGW  SGGDPCG+SWKG+TC GSAV ++++ G+G
Sbjct  42    VESATDPFDVQALGVLYSSLNSPPQLSGWTWSGGDPCGDSWKGITCSGSAVTAMQVSGMG  101

Query  463   LNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTS  642
             LNGT+GY+L+   SLK LD+S+N IHD IPYQLPPNLT LNLANNN++G++PYSI  M S
Sbjct  102   LNGTLGYLLSDLLSLKTLDMSNNSIHDGIPYQLPPNLTYLNLANNNLSGNLPYSIYTMVS  161

Query  643   LNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLT  822
             LNYLN S NSL+Q IGD+F N  DL+ LDLSFNN +GDLP SL  LS+LS L +Q NQLT
Sbjct  162   LNYLNLSHNSLSQQIGDIFANLQDLSELDLSFNNLTGDLPNSLSSLSHLSSLYLQENQLT  221

Query  823   GSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgr  1002
             G +N+L +L LT LN+A+N FSGW+P E  SIP     GN+F+N PAPPPPP+ PPPP R
Sbjct  222   GPVNLLANLDLTTLNIADNNFSGWMPQEFSSIPNLITGGNTFANGPAPPPPPYVPPPPSR  281

Query  1003  pHKRTNHSTPGSH--KTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivv  1176
             PHK  NH+   +   + P S   H D+EN                               
Sbjct  282   PHKNRNHTKAPTDTPQGPESKPFHPDNEN-------------------------------  310

Query  1177  ivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGK  1356
                      KK   A         +TDKE+ +QR K TA+V  LKP P+EK+ +E++ GK
Sbjct  311   --------NKKSLTA---------ATDKEMREQRLK-TASVTSLKPLPAEKMMVEKVYGK  352

Query  1357  NGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDS  1530
             NGS +R   PITAT +T+A LQ ATNSFSQ++LVGEGSLGRVYRA+  NGKVLA+KK+DS
Sbjct  353   NGSGKRPKVPITATSHTIASLQIATNSFSQDSLVGEGSLGRVYRAEISNGKVLAVKKIDS  412

Query  1531  AALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADE  1710
             AALSLQEEDNFLEA+SNMSRLRHPNIV LVGYC EHGQRLLVY+YIGN +LHDMLH+AD+
Sbjct  413   AALSLQEEDNFLEAVSNMSRLRHPNIVSLVGYCVEHGQRLLVYEYIGNRTLHDMLHYADD  472

Query  1711  RSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAAL  1890
              S  LTWNARVRVALGTARALEYLHEVCLPS+VHRNFKSANILLDEELNPHLSDCGLAAL
Sbjct  473   SSNKLTWNARVRVALGTARALEYLHEVCLPSLVHRNFKSANILLDEELNPHLSDCGLAAL  532

Query  1891  TPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERS  2070
             TPNTERQ+ ST +VGSFGYSAPEFA+SGVYTVKSDVYSFG+VMLELLTGRKPLDSSRERS
Sbjct  533   TPNTERQV-STEMVGSFGYSAPEFAMSGVYTVKSDVYSFGIVMLELLTGRKPLDSSRERS  591

Query  2071  EQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVV  2250
             EQSLVRWATPQLHDIDAL+KMVDPALNG+YPAKSLSRFAD+IALCVQPEPEFRPPMSEVV
Sbjct  592   EQSLVRWATPQLHDIDALAKMVDPALNGIYPAKSLSRFADVIALCVQPEPEFRPPMSEVV  651

Query  2251  QALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             Q LVRL+QRAS+V R   DE G++Y+ P+H+ +  D
Sbjct  652   QQLVRLMQRASIVRRSSGDELGYSYRVPEHEVSMTD  687



>emb|CDX79126.1| BnaA01g11930D [Brassica napus]
Length=706

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/698 (67%), Positives = 551/698 (79%), Gaps = 18/698 (3%)
 Frame = +1

Query  265   ISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSI  444
              + +  V   TDP+D+QAL+VLY SLNSPSQL+ WK  GGDPCGESWKG+TC+GSAVVSI
Sbjct  16    FTTISVVRCVTDPSDVQALQVLYSSLNSPSQLTNWKNGGGDPCGESWKGITCEGSAVVSI  75

Query  445   EIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYS  624
             +I  LG++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTSLNLA NN++G++PYS
Sbjct  76    DISDLGVSGTLGYLLSDLMSLRKLDVSGNSIHDTLPYQLPPNLTSLNLARNNLSGNLPYS  135

Query  625   ISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRV  804
             IS M SL+Y+N SGNSL+  +GD+F     L+TLDLS NNFSGDLP+SL  LS LS+L V
Sbjct  136   ISAMGSLSYMNVSGNSLSMSVGDIFAGLKSLSTLDLSHNNFSGDLPSSLSTLSQLSVLYV  195

Query  805   QNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppft  984
             QNNQLTG+++VL  LPLT LNVANN F+G IP EL SI    Y GNSF N+PA P P   
Sbjct  196   QNNQLTGTIDVLSGLPLTTLNVANNHFNGSIPKELSSIKTLIYDGNSFDNAPASPQPETP  255

Query  985   ppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvls  1164
                                 TP + D  S+      + K G+  G + GIV GS  V   
Sbjct  256   DKKSKPSSGSKKPK-----NTPDAKDKSSE-----SSDKGGLSGGVVTGIVFGSLFVAGI  305

Query  1165  aivvivYCLRRCKKK--EFAARTS-TGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVT  1335
               +V+  CL + K+K  E   R S   SLPLS   EV +QR K+ A +     PP +KVT
Sbjct  306   IALVLYLCLHKKKRKVGESTTRASHRTSLPLSVIPEVQEQRVKTVADMKSSSSPP-DKVT  364

Query  1336  IERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVL  1509
             ++ +  KNGSL R  SPITA+ YTV+ LQ ATNSFSQEN++GEGSLGRVYRA+FPNGKV+
Sbjct  365   VDNVM-KNGSLTRMRSPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEFPNGKVM  423

Query  1510  AIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHD  1689
             A+KK+D+AALSLQEED FLEA+SNMSRLRHPNIVPL GYC EHGQRLLVY+Y+GNG+L D
Sbjct  424   AVKKIDNAALSLQEEDCFLEAVSNMSRLRHPNIVPLGGYCTEHGQRLLVYEYVGNGNLDD  483

Query  1690  MLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLS  1869
             MLH  D+RS  LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSANILLDEELNPHLS
Sbjct  484   MLHLNDDRSMALTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLS  543

Query  1870  DCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPL  2049
             DCGLAAL PNTERQ+ ST VVGSFGYSAPEFALSG+YTVKSDVY+FGVVMLELLTGRKPL
Sbjct  544   DCGLAALNPNTERQV-STQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPL  602

Query  2050  DSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFR  2229
             DSSR R+EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADIIALC+QPEPEFR
Sbjct  603   DSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFR  662

Query  2230  PPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             PPMSEVVQ LVRLVQRASVV RR SD++GF+Y+TP+H+
Sbjct  663   PPMSEVVQQLVRLVQRASVVKRRSSDDTGFSYRTPEHE  700



>ref|XP_007026174.1| STRUBBELIG-receptor family 8 isoform 2 [Theobroma cacao]
 gb|EOY28796.1| STRUBBELIG-receptor family 8 isoform 2 [Theobroma cacao]
Length=624

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/629 (75%), Positives = 532/629 (85%), Gaps = 15/629 (2%)
 Frame = +1

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             MGY+L+   SL+ LDLS+N IHD IPYQLPPNLTSLNLA NN++G++PYSIS M +L YL
Sbjct  1     MGYLLSDLMSLRTLDLSNNNIHDTIPYQLPPNLTSLNLAGNNLSGNLPYSISTMVTLTYL  60

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S NSL+  +GD+F N +DL TLDLSFNNFSGDLP S   LSNLSML +QNNQLTGSLN
Sbjct  61    NLSHNSLSLSVGDIFANLADLGTLDLSFNNFSGDLPNSFSSLSNLSMLYMQNNQLTGSLN  120

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR  1014
             VL  L LT LNVA N FSGWIP EL S+P F Y GNSF+N PAPPPPP++PPPP R H +
Sbjct  121   VLSGLSLTILNVAKNHFSGWIPQELFSLPTFIYDGNSFANGPAPPPPPYSPPPPRRSHNK  180

Query  1015  TNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLR  1194
              N S  G+  +P SD   SD +NG         A  IVGIVLGS  +V+ A++ +V+C+ 
Sbjct  181   HN-SGSGARTSPASDGQSSDSDNGP-------SAQLIVGIVLGSLLLVVLALLALVFCIH  232

Query  1195  RCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGS  1365
             + KKK   AR S GSL + ++    E+ +QR K+ A V+DLKPPP+EK+T+++M  KNGS
Sbjct  233   KNKKKVSGARASRGSLSVGSNDGHTEMQEQRVKNVAAVIDLKPPPAEKLTVDKMS-KNGS  291

Query  1366  LRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAAL  1539
             L+R  SPITAT YTVA LQTATNSFSQE L+GEGSLGRVYRA+FPNGK +AIKK+D+AAL
Sbjct  292   LKRMKSPITATSYTVASLQTATNSFSQEYLIGEGSLGRVYRAEFPNGKTMAIKKIDNAAL  351

Query  1540  SLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQ  1719
             SLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLLVY+Y+GNGSLHDMLHF+D+ S+
Sbjct  352   SLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLLVYEYVGNGSLHDMLHFSDDGSK  411

Query  1720  LLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPN  1899
              L+WNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPN
Sbjct  412   TLSWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPN  471

Query  1900  TERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQS  2079
             TERQ+ ST +VGSFGYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKPLDSSR RSEQS
Sbjct  472   TERQV-STQMVGSFGYSAPEFALSGLYTVKSDVYSFGVVMLELLTGRKPLDSSRTRSEQS  530

Query  2080  LVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQAL  2259
             LVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQAL
Sbjct  531   LVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQAL  590

Query  2260  VRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             VRLVQRASVV RR SDESGFAYKTPDHDA
Sbjct  591   VRLVQRASVVKRRSSDESGFAYKTPDHDA  619



>ref|XP_009386651.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Musa acuminata 
subsp. malaccensis]
Length=735

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/705 (67%), Positives = 554/705 (79%), Gaps = 18/705 (3%)
 Frame = +1

Query  283   VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLG  462
             V +ATD  D+ AL VLY SLNSP QLSGW  SGGDPCG SW GV+C GSAVV+I + GLG
Sbjct  39    VESATDSLDVPALGVLYASLNSPRQLSGWTRSGGDPCGTSWLGVSCSGSAVVAIHLSGLG  98

Query  463   LNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTS  642
             LNG++GY+L+   SLK LDLS+N IH+ IPYQLPPNLT LNLA N+++G++PYSIS M S
Sbjct  99    LNGSLGYLLSDLLSLKTLDLSNNNIHETIPYQLPPNLTYLNLAGNDLSGNLPYSISSMVS  158

Query  643   LNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLT  822
             LNYLN S N L+Q +GD+F++  DL+ LDLSFN+F+GDLP S G LSNLS L +Q+NQ  
Sbjct  159   LNYLNLSHNLLSQTVGDIFSDLQDLSELDLSFNSFTGDLPNSFGSLSNLSNLYLQDNQFM  218

Query  823   GSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgr  1002
             G +N+LV+L LT LN+ANN+F+GWIP E  SI   E  GNSFS+ PAPPPPP+ PPPPGR
Sbjct  219   GPVNILVNLDLTTLNIANNQFNGWIPQEFKSITNLEIGGNSFSHGPAPPPPPYMPPPPGR  278

Query  1003  pHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivviv  1182
              H R++++T    +  G   +  DH       K  + AG ++GIV+GS+   L  I+ I+
Sbjct  279   LH-RSHNNTRNPSQGSGGKSSAPDH----VRNKKSLTAGLLIGIVIGSAFGALCIILAII  333

Query  1183  YCL---RRCKKKEFAARTSTGSLPLS-----TDKEVLDQRAKSTATVVDLKPPPSEKVTI  1338
              CL   ++CK      R  +G+         T KE+ +QR KS++  +    PP++ V +
Sbjct  334   LCLHNIQKCKNGNVNNRNDSGTSAAVGTNKVTKKEMQEQRLKSSS--ITSPKPPTDTVMV  391

Query  1339  ERMQGKNGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLA  1512
             E++ GKN + + S  PITAT YTVA LQ ATNSFSQ+ LVGEGS GRVYRA+FPNGK+LA
Sbjct  392   EKLHGKNMAAKPSKVPITATSYTVASLQIATNSFSQDCLVGEGSFGRVYRAEFPNGKILA  451

Query  1513  IKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDM  1692
             +KK+DSAA+SLQEED+FLEAISNMSR RHPNIV L GYC EHGQRLLVY+YIGNG+LHDM
Sbjct  452   VKKIDSAAVSLQEEDSFLEAISNMSRFRHPNIVTLSGYCVEHGQRLLVYEYIGNGTLHDM  511

Query  1693  LHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSD  1872
             LHFA++ S  L+WNARVRVALG ARALEYLHEVCLPSVVHRN KSANILLDEELNP LSD
Sbjct  512   LHFANDSSNTLSWNARVRVALGVARALEYLHEVCLPSVVHRNLKSANILLDEELNPRLSD  571

Query  1873  CGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLD  2052
             CGLAALTP+TER++ ST VVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG+KPLD
Sbjct  572   CGLAALTPSTERKV-STEVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGQKPLD  630

Query  2053  SSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRP  2232
             SSR RSEQSLVRWATPQLHDIDALSKMVD ALNGMYPAKSLSRFADIIALCVQPEPEFRP
Sbjct  631   SSRVRSEQSLVRWATPQLHDIDALSKMVDAALNGMYPAKSLSRFADIIALCVQPEPEFRP  690

Query  2233  PMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGDPPY  2367
             PMSEVVQ LVRLVQRAS V RR  +E GF+Y+  + DA+  D  +
Sbjct  691   PMSEVVQELVRLVQRASAVRRRSGEEIGFSYRVMEQDASMTDISF  735



>ref|XP_009385265.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=725

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/698 (67%), Positives = 551/698 (79%), Gaps = 11/698 (2%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             +ATD  D+QAL VLY SLNSPSQLSGW  SGGDPCG+SWKGV+C GS+V ++++ GLGLN
Sbjct  28    SATDSLDVQALGVLYASLNSPSQLSGWTPSGGDPCGDSWKGVSCSGSSVTAVQLSGLGLN  87

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             G++GY+L+   SLK LDLS+N+I + IPYQLPPNLT LNLA NN++G++PYSIS M SLN
Sbjct  88    GSLGYLLSDLLSLKTLDLSNNDIRETIPYQLPPNLTYLNLAGNNLSGNLPYSISAMASLN  147

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YLN S N L+Q +GD+F N  DL+ LDLSFNNF+GDLP S G LSNL  L +QNNQLTG 
Sbjct  148   YLNLSHNLLSQAVGDIFRNLQDLSELDLSFNNFTGDLPNSFGSLSNLLSLYLQNNQLTGP  207

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             +NVL +L L++LN+ANN+F+GWIP E  SI   E  GN FSNS AP PPP+ PPPP R H
Sbjct  208   VNVLSNLSLSNLNIANNQFNGWIPQEFSSISDLEIGGNFFSNSLAPHPPPYMPPPPSRQH  267

Query  1009  KRTNHS-----TP-GSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsai  1170
                N++     TP GS     S DN S+ +        G+  G+ +G +  + AV+L   
Sbjct  268   STHNNTQESPNTPQGSEGKSISPDNASNKKKLTTGPLIGIVLGSTLGALCITLAVILLLR  327

Query  1171  vvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQ  1350
              V          +    R++ G    + +KE+ + R KS++    +  PPS+ V IE++ 
Sbjct  328   NVPKGKDHSINSRNDTGRSAVGGADKANEKEMQELRVKSSSATTPV--PPSDTVIIEKLH  385

Query  1351  GKNGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKV  1524
             GKN  ++R   PITAT YTVA LQ ATNSFSQ+ LVGEGSLGRVYRA+FPNGKVLA+KK+
Sbjct  386   GKNVPVKRPKIPITATSYTVASLQVATNSFSQDCLVGEGSLGRVYRAEFPNGKVLAVKKI  445

Query  1525  DSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFA  1704
             DSAA+SLQEEDNFLEA+SNMSRLRHPNIVPL GYC EHGQR+LV++YIGNG+LHDMLHFA
Sbjct  446   DSAAISLQEEDNFLEAVSNMSRLRHPNIVPLSGYCVEHGQRILVHEYIGNGTLHDMLHFA  505

Query  1705  DERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLA  1884
             D  S+ L+WNARVRVALGTARALEYLHEVCLPSVVH+NFKS NILLDEELNPHLSDCGLA
Sbjct  506   DYSSKRLSWNARVRVALGTARALEYLHEVCLPSVVHKNFKSTNILLDEELNPHLSDCGLA  565

Query  1885  ALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRE  2064
             ALTPNTERQ+ ST VVGSFGYSAPEFA+SGVYT+KSDVYSFGVVMLELLTGRKPLDSSR 
Sbjct  566   ALTPNTERQV-STEVVGSFGYSAPEFAMSGVYTIKSDVYSFGVVMLELLTGRKPLDSSRV  624

Query  2065  RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSE  2244
             RSEQSLVRWATPQLHDIDALSKMVD +LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSE
Sbjct  625   RSEQSLVRWATPQLHDIDALSKMVDTSLNGMYPAKSLSRFADIIALCVQPEPEFRPPMSE  684

Query  2245  VVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             VVQ LVRLVQRAS V RR  DE GF+Y+ P+ D++  D
Sbjct  685   VVQQLVRLVQRASAVKRRSGDELGFSYRVPEQDSSMTD  722



>ref|XP_004164349.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis 
sativus]
Length=647

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/680 (69%), Positives = 531/680 (78%), Gaps = 45/680 (7%)
 Frame = +1

Query  328   LYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSL  507
             +Y SL+SP QL+GW  SGGDPC ESWKGVTC+GSAVVSIEI GLGLNGTMGY L+ F SL
Sbjct  1     MYTSLDSPPQLTGWIVSGGDPCAESWKGVTCEGSAVVSIEISGLGLNGTMGYALSSFLSL  60

Query  508   KELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPI  687
             K+LD+S N IHD +PYQLPPNLTSLN+A N++ G++PYS+S M SLNYLN S N L+Q I
Sbjct  61    KKLDMSDNSIHDAVPYQLPPNLTSLNMAKNSLIGNLPYSLSTMASLNYLNMSHNLLSQVI  120

Query  688   GDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLN  867
             GD+FTN + L TLDLSFNNF+GDLP SLG LSN+S L  QNN+LTGSLN+L+DLPLT LN
Sbjct  121   GDVFTNLTTLETLDLSFNNFTGDLPKSLGTLSNVSSLFFQNNRLTGSLNILIDLPLTTLN  180

Query  868   VANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNH--STPGSH  1041
             VANN FSGWIP EL S+  F Y GNSF NSPAPPPPPFTPPPPGR      H  S+ G+H
Sbjct  181   VANNNFSGWIPQELKSVESFIYDGNSFDNSPAPPPPPFTPPPPGRSRNSPKHPGSSGGTH  240

Query  1042  KTPGSDDNHSD-HEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFA  1218
               P S+ + S  ++        G+  GAI+ +++   A           C ++ K+K   
Sbjct  241   TAPSSEGSSSHSNKGLPVLAIVGIVLGAIIFVLIVLVAFA--------VCFQKRKRKNIG  292

Query  1219  ARTSTGSLPLST--DKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRR--SPIT  1386
              R S+G L + T  + EV + R KS A V D+KP P+EK+  ER+Q KNGS++R  +PIT
Sbjct  293   LRASSGRLSIGTSVNAEVQEHRVKSVAAVADIKPLPAEKMNPERLQAKNGSVKRIKAPIT  352

Query  1387  ATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFL  1566
             AT YTVA LQ ATNSFSQE +VGEGSLGRVY+A+FPNGK +AIKK+D++ALSLQEEDNFL
Sbjct  353   ATSYTVASLQAATNSFSQECIVGEGSLGRVYKAEFPNGKTMAIKKIDNSALSLQEEDNFL  412

Query  1567  EAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVR  1746
             EA+SNMSRLRH NIV L                             +E S+ LTWNARVR
Sbjct  413   EAVSNMSRLRHTNIVTL-----------------------------NESSKTLTWNARVR  443

Query  1747  VALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTH  1926
             VALGTARALEYLHEVCLPSVVHRN K+ANILLDE+LNPHLSDCGLAALTPNTERQIS T 
Sbjct  444   VALGTARALEYLHEVCLPSVVHRNLKTANILLDEDLNPHLSDCGLAALTPNTERQIS-TQ  502

Query  1927  VVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQL  2106
             +VGSFGYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKPLDSSR RSEQSLVRWATPQL
Sbjct  503   MVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRVRSEQSLVRWATPQL  562

Query  2107  HDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASV  2286
             HDIDAL+KMVDP LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASV
Sbjct  563   HDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASV  622

Query  2287  VIRRYSDESGFAYKTPDHDA  2346
             V R  SDESGF+YKTP+HDA
Sbjct  623   VKRHSSDESGFSYKTPEHDA  642



>ref|XP_008803525.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Phoenix 
dactylifera]
 ref|XP_008803526.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Phoenix 
dactylifera]
Length=739

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/716 (67%), Positives = 569/716 (79%), Gaps = 17/716 (2%)
 Frame = +1

Query  244   VLVIAALI-SRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             + V+A L  S    V +ATDP+D+QAL VLY +LNSP  L GW +SGGDPC +SWKG+TC
Sbjct  27    IAVLAVLFGSPAAVVESATDPSDVQALGVLYSALNSPPHLFGWTSSGGDPCRDSWKGITC  86

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
              GSAV +I++ GLGLNGT+GY+L+   SLK LD+S+N IH+ IPYQLPPNLT LNLANNN
Sbjct  87    SGSAVTAIQVSGLGLNGTLGYLLSYLLSLKTLDMSNNNIHEGIPYQLPPNLTYLNLANNN  146

Query  601   ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
             ++G++PYSI  M SLNYLN S NSL+Q IGD+F N  DL+ LDLSFNN +GDLP SL  L
Sbjct  147   LSGNLPYSIYTMVSLNYLNLSHNSLSQQIGDIFENLQDLSELDLSFNNLTGDLPNSLSSL  206

Query  781   SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSp  960
             SNLS L +Q NQLTG LN+L +L LT LN+A+N FSGWIP E  SIP     GNSF+N P
Sbjct  207   SNLSSLYLQENQLTGPLNLLANLDLTTLNIADNNFSGWIPQEFSSIPNLIAGGNSFANGP  266

Query  961   apppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivl  1140
             APPPPP+ PPP    ++    +   + + P S   H D++N   +    + AG++ GIV+
Sbjct  267   APPPPPYVPPPSRPHNRNHTEAPTDTPQGPESKPFHPDNKNNKKS----LTAGSVTGIVI  322

Query  1141  gssavvlsaivvivYCLRRCKKKEFAAR--------TSTGSLPLSTDKEVLDQRAKSTAT  1296
             GS+   L  ++ +++C+    KK+   R        ++T     +TDKE+ +QR K TA+
Sbjct  323   GSTLGALCIVLAVIFCIWNLPKKKDDTRKNASPSLASATIGADRATDKEMQEQRLK-TAS  381

Query  1297  VVDLKPPPSEKVTIERMQGKNGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLG  1470
             V  LKP P EK+ +E++ GKNGS +R   PITA+ +TVA LQ ATNSFSQ++LVGEGSLG
Sbjct  382   VTSLKPLPPEKMMVEKVYGKNGSGKRPKVPITASSHTVASLQLATNSFSQDSLVGEGSLG  441

Query  1471  RVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRL  1650
             RVYRA+F NGKV AIKK+DSAALSLQEEDNFLEA+SNMSRLRHPNIV LVGYC EHGQRL
Sbjct  442   RVYRAEFSNGKVFAIKKIDSAALSLQEEDNFLEAVSNMSRLRHPNIVSLVGYCVEHGQRL  501

Query  1651  LVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSA  1830
             LVY+YIGNG+LHDMLH+AD+    LTWNAR+RVALGTARALEYLHEVCLPS+VHRNFKSA
Sbjct  502   LVYEYIGNGTLHDMLHYADDSGNKLTWNARMRVALGTARALEYLHEVCLPSLVHRNFKSA  561

Query  1831  NILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFG  2010
             NILLDEELNPHLSDCGLAALTPNTERQ+ ST VVGSFGYSAPEFA+SGVYTVKSDVYSFG
Sbjct  562   NILLDEELNPHLSDCGLAALTPNTERQV-STEVVGSFGYSAPEFAMSGVYTVKSDVYSFG  620

Query  2011  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFAD  2190
             +VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFAD
Sbjct  621   IVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  680

Query  2191  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             IIALCVQPEPEFRPP+SEVVQ LVRL+QRAS+V R   DE G++Y+ P+H+ +  D
Sbjct  681   IIALCVQPEPEFRPPISEVVQQLVRLMQRASMVRRSSGDELGYSYRVPEHEVSMTD  736



>ref|XP_006648399.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Oryza brachyantha]
Length=720

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/691 (68%), Positives = 553/691 (80%), Gaps = 18/691 (3%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGG-DPCGESWKGVTCQGSAVVSIEIPGLGLNG  471
             TD +D  AL  LY S NSPSQL+GW A+GG DPCG  W+GVTC G+ V  I + GLGL+G
Sbjct  25    TDSSDASALGNLYSSWNSPSQLAGWSAAGGGDPCGAGWQGVTCSGAGVTEIRLAGLGLDG  84

Query  472   TMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNY  651
             T+GY L+   SLK LDLS+N +H  IPYQLPPNLT LNLANNN++G++PYSIS M SL Y
Sbjct  85    TLGYELSSLFSLKTLDLSNNHLHGSIPYQLPPNLTYLNLANNNLSGNLPYSISNMVSLEY  144

Query  652   LNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSL  831
             LN S NSL+Q IGD+F + + L+ LD+SFN  +GDLP SLG +SNLS L +QNNQLTGS+
Sbjct  145   LNISHNSLSQQIGDLFGSLNSLSELDVSFNKLTGDLPNSLGSMSNLSSLYMQNNQLTGSV  204

Query  832   NVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHK  1011
             NVL  L LT LN+ANN FSGWIP E  SIP     GNSFSN PAPPPPPF PPPP RP  
Sbjct  205   NVLSGLSLTTLNIANNNFSGWIPQEFSSIPDLTLGGNSFSNGPAPPPPPFMPPPPRRPRS  264

Query  1012  RTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCL  1191
             R +H   GS   P      S    G G+ K G+  G +VGI+ GS+   L A++++V+C+
Sbjct  265   RPSHPR-GSGDAP----EGSVSPAGQGDKKQGLHTGTLVGIIAGSTVAALCALLLLVFCI  319

Query  1192  RRCKKKEFAARTSTGSL--PLSTD------KEVLDQRAKSTATVVDLKPPPSEKVTIERM  1347
                +K++    +++     PLS +      +E+ +Q  ++T +V  +K  P+EK+T ER+
Sbjct  320   CNARKRKDDTSSNSKDFVGPLSVNIERASSREIPEQSPENT-SVATMKISPAEKMTPERI  378

Query  1348  QGKNGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKK  1521
              GK GS+R++  PITATPYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKVLA+KK
Sbjct  379   YGKTGSMRKTKVPITATPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVLAVKK  438

Query  1522  VDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHF  1701
             +DS+ALSLQEEDNFLEA+S+MSRLRHPNIVPL GYC EHGQRLLVY+YIGNG+LHD+LH+
Sbjct  439   IDSSALSLQEEDNFLEAVSSMSRLRHPNIVPLSGYCVEHGQRLLVYEYIGNGTLHDVLHY  498

Query  1702  ADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGL  1881
             +DE S+ LTWN RVR+ALGTARALEYLHEVCLPSVVHRNFKS+NILLDEE NPHLSDCGL
Sbjct  499   SDEMSRRLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSSNILLDEEHNPHLSDCGL  558

Query  1882  AALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR  2061
             AALTPNTERQ+ ST V GSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLTGRKPLDSSR
Sbjct  559   AALTPNTERQV-STEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSR  617

Query  2062  ERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMS  2241
             ERSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMS
Sbjct  618   ERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMS  677

Query  2242  EVVQALVRLVQRASVVIRRYSDESGFAYKTP  2334
             EVVQ LVRL+QRAS+V R+  +E GF+Y+ P
Sbjct  678   EVVQQLVRLMQRASIVRRQSGEELGFSYRAP  708



>ref|XP_008645353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Zea mays]
 gb|AFW70555.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=717

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/690 (65%), Positives = 536/690 (78%), Gaps = 10/690 (1%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGT  474
             TDP+D  AL  LY S NSPSQL+GW ASGGDPCG +W+GV C G+ V  I++PG GL+G+
Sbjct  25    TDPDDAAALANLYTSWNSPSQLAGWSASGGDPCGAAWQGVACSGAGVTEIKLPGTGLDGS  84

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             +GY L+   SLK LDLS+N +H  IPYQLPPNLT+LNL +NN  G++PYSIS M S+ YL
Sbjct  85    LGYELSNLFSLKTLDLSNNNLHGSIPYQLPPNLTNLNLGSNNFNGNLPYSISNMASIEYL  144

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S NS++Q +GD+F + + L+ LD+SFN  +GDLP S+G LSNLS L +QNNQLTGS+N
Sbjct  145   NLSHNSISQQLGDIFGSLNSLSDLDVSFNKLTGDLPNSIGSLSNLSSLYMQNNQLTGSVN  204

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR  1014
             VL  L LT LN+ANN FSGWIP E  SIP     GNSF+N PAPPPPPF PPPP RP  R
Sbjct  205   VLRGLSLTTLNIANNNFSGWIPKEFSSIPDVTLEGNSFANGPAPPPPPFMPPPPQRPRNR  264

Query  1015  TNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLR  1194
               H   G    P   ++H+   N       G   G I G ++    V L  +  +    +
Sbjct  265   PKHPQ-GPGDAPKGSESHTVQSNKKQGLGTGPLVGIIAGSIVAVLCVFLLLLCCMCNAQK  323

Query  1195  RCKKKEFAARTSTGSLPL----STDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNG  1362
             R       ++   G L +    ++ +E+ +Q   ++   V L  PP+EK+T ER+ GKNG
Sbjct  324   RTDDASSESKDFGGPLTVNIERASSREIPEQMDDTSIATVKL--PPAEKMTPERVYGKNG  381

Query  1363  SLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAA  1536
             S+R++  PITATPYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKVLA+KK+DSAA
Sbjct  382   SVRKTKVPITATPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVLAVKKIDSAA  441

Query  1537  LSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERS  1716
             LSLQEEDNFLEA+S+MSRLRHPNIVPL GYC EHGQRLLVY+YI NG+LHDMLHF+ E S
Sbjct  442   LSLQEEDNFLEAVSSMSRLRHPNIVPLTGYCVEHGQRLLVYEYIVNGTLHDMLHFSVEIS  501

Query  1717  QLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTP  1896
             + LTWN RVR+ALGTARALEYLHEVC+PS+VHRN KS+NILLDEE NPHLSDCGLAALTP
Sbjct  502   RKLTWNIRVRIALGTARALEYLHEVCMPSLVHRNLKSSNILLDEEHNPHLSDCGLAALTP  561

Query  1897  NTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ  2076
             NTERQ+ ST V GSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ
Sbjct  562   NTERQV-STEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ  620

Query  2077  SLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQA  2256
             SLVRWATPQLHDIDAL++MVDPALNGMYPAKSLSRFAD+IALCVQPEPEFRPPMSEVVQ 
Sbjct  621   SLVRWATPQLHDIDALARMVDPALNGMYPAKSLSRFADVIALCVQPEPEFRPPMSEVVQQ  680

Query  2257  LVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             LVRL+QRAS+V R+  +E GF+Y+ P+ + 
Sbjct  681   LVRLMQRASIVRRQSGEELGFSYRVPEREG  710



>ref|XP_004951618.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Setaria 
italica]
Length=720

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/695 (66%), Positives = 543/695 (78%), Gaps = 17/695 (2%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGT  474
             TD  D  AL  LY S N PSQL+GW A GGDPCG +W+GVTC G+ V  I++PG+GLNG+
Sbjct  25    TDSADAAALGNLYASWNGPSQLAGWSAGGGDPCGAAWQGVTCSGAGVTEIKLPGIGLNGS  84

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             +GY L+   SLK LDLS+N +H  IPYQLPPNLT LNLA+N+ +G++PYSI+ + S+ YL
Sbjct  85    LGYELSNLFSLKTLDLSNNNLHGSIPYQLPPNLTYLNLASNDFSGNLPYSITNLASIEYL  144

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S NSL   +G++F N S L+ LD+SFN  +GDLP S+G LSNLS L +QNNQ TGS+N
Sbjct  145   NLSHNSLLNQMGELFGNLSSLSELDVSFNKLTGDLPNSIGSLSNLSSLYMQNNQFTGSVN  204

Query  835   VLVDL--PLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             VL  L   LT LN+ANN FSGWIP E  SIP  +  GNSF+N PAPPPPPF PPPP RP 
Sbjct  205   VLRGLSSALTTLNIANNNFSGWIPKEFSSIPDLKLGGNSFANGPAPPPPPFMPPPPQRPR  264

Query  1009  KRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYC  1188
              R  H      +  G     S+      + K G+  G +VGI+ GS   VL  ++++V C
Sbjct  265   NRPKHP-----QGQGDAPKGSESPTIQSDKKQGLGTGPLVGIIAGSIVAVLCVLLLLVCC  319

Query  1189  LRRCKKKEFAARTSTGSL--PLSTDKEVLDQRAK-----STATVVDLKPPPSEKVTIERM  1347
             +R  +K++  A + +     PL+ + E    R          ++  +K PP EK+T ER+
Sbjct  320   MRNARKRKDDASSESKDFVGPLTVNIERASSRETPEPNLEDTSIATVKLPPPEKMTPERV  379

Query  1348  QGKNGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKK  1521
              GKNGS+R++  PITATPYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKVLA+KK
Sbjct  380   YGKNGSMRKTKVPITATPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVLAVKK  439

Query  1522  VDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHF  1701
             +DSAALSLQEEDNFLEA+S+MSRLRHPNIVPL GYC EHGQRLLVY+YIGNG+LHD+LHF
Sbjct  440   IDSAALSLQEEDNFLEAVSSMSRLRHPNIVPLTGYCVEHGQRLLVYEYIGNGTLHDILHF  499

Query  1702  ADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGL  1881
             +DE S+ LTWN RVR+ALGTARALEYLHEVCLPSVVHRNFKS+NILLDEE NPHLSDCGL
Sbjct  500   SDEMSRKLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSSNILLDEEHNPHLSDCGL  559

Query  1882  AALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR  2061
             AALTPNTERQ+ ST V GSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLTGRKPLDSSR
Sbjct  560   AALTPNTERQV-STEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSR  618

Query  2062  ERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMS  2241
             ERSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMS
Sbjct  619   ERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMS  678

Query  2242  EVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             EVVQ LVRL+QRAS+V R+  +E GF+Y+ P+ + 
Sbjct  679   EVVQQLVRLMQRASIVRRQSGEELGFSYRAPEREG  713



>ref|XP_003571057.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Brachypodium 
distachyon]
Length=715

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/693 (66%), Positives = 549/693 (79%), Gaps = 17/693 (2%)
 Frame = +1

Query  298   DPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTM  477
             + +D  AL  LY S NSPSQL+GW ASGGDPCG  W+GV+C GS V  I++ G GLNG++
Sbjct  23    ESSDAAALGNLYTSWNSPSQLAGWSASGGDPCGAGWQGVSCNGSGVTEIKLAGTGLNGSL  82

Query  478   GYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLN  657
             GY L+   SLK LDLS+N IH  IPYQLPPNLT LNLA NN +G++PYSIS M S+ YLN
Sbjct  83    GYELSNLYSLKTLDLSNNNIHGSIPYQLPPNLTYLNLATNNFSGNLPYSISNMASIEYLN  142

Query  658   FSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNV  837
              S NSL+Q IGD+F N + L+ LD+SFN  +GDLP S+G LSN+S L +QNNQLTG +NV
Sbjct  143   ISHNSLSQQIGDLFRNLNSLSELDISFNKLTGDLPNSIGSLSNISSLYMQNNQLTGPVNV  202

Query  838   LVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRT  1017
             L  L LT LN+ANN FSGWIP E  SIP     GNSF+N PAPPPPPF PPPP RP  R 
Sbjct  203   LSGLGLTTLNIANNNFSGWIPKEFSSIPDVILGGNSFANGPAPPPPPFMPPPPRRPRNRP  262

Query  1018  NHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRR  1197
             N+S    +   GS+ +    +   G     ++ GA+VGI++GS    L  ++V+V C+R 
Sbjct  263   NNSGGSGNAPKGSESSTGQGDKKQG-----LQTGALVGIIVGSILAALCVLLVLVLCIRN  317

Query  1198  CKKKEFAARTSTGSL--PLS------TDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQG  1353
              +K++  + + +     PLS      +D+E+ +   ++T +V  +K  P+EK+T ER+ G
Sbjct  318   ARKRKDDSSSESKDFVGPLSVNIQEASDREIAEHGHENT-SVAAMKVLPAEKMTPERVYG  376

Query  1354  KNGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVD  1527
              NGS+R++  PITATPYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKVLA+KK+D
Sbjct  377   INGSMRKAKVPITATPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVLAVKKID  436

Query  1528  SAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFAD  1707
             SAALSLQEEDNFLE +S+MSRLRHPNIVPL GYC EH QRLLVY+YIGNG+LHDMLHF+D
Sbjct  437   SAALSLQEEDNFLEVVSSMSRLRHPNIVPLTGYCVEHAQRLLVYEYIGNGTLHDMLHFSD  496

Query  1708  ERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAA  1887
             E S+ LTWN RVR+ALGTARALEYLHEVCLPSVVHRNFKS+NILLDEE N HLSDCGLAA
Sbjct  497   EMSRKLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSSNILLDEEHNAHLSDCGLAA  556

Query  1888  LTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRER  2067
             LTPNTERQ+ ST VVGSFGYSAPE+++SG+YTVKSDVYSFGVVMLELLTGRKPLDSSRER
Sbjct  557   LTPNTERQV-STEVVGSFGYSAPEYSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRER  615

Query  2068  SEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV  2247
             SEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV
Sbjct  616   SEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV  675

Query  2248  VQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             VQ LVRL+QRAS+V R+  +E GF+Y+ P+ + 
Sbjct  676   VQQLVRLMQRASIVRRQSGEELGFSYRAPEREG  708



>dbj|BAK07184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=713

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/698 (66%), Positives = 550/698 (79%), Gaps = 21/698 (3%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGT  474
             T+ +D  AL  LY S NSP QL+GW ASGGDPCG  W+GV+C GS V  I++ G GLNG+
Sbjct  24    TESSDSAALGNLYTSWNSPPQLAGWSASGGDPCGAGWQGVSCTGSGVTEIKLAGTGLNGS  83

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             +GY L+   SLK LDLS+N I   IPYQLPPNLT LNLA NN +G++PYSIS M S+ YL
Sbjct  84    LGYELSNLFSLKTLDLSNNHIQGSIPYQLPPNLTYLNLATNNFSGNLPYSISNMASIEYL  143

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S N+LAQ IGD+F N + L+ LD+SFN  +GDLP S+G LSN+S L +QNNQLTGS+N
Sbjct  144   NLSHNALAQQIGDLFGNLTSLSELDVSFNKLTGDLPTSIGSLSNISSLYMQNNQLTGSVN  203

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR  1014
             VL  L LT LN+ANN FSGWIP E  SIP    SGNSF N PAPPPPPF PPPP RP  R
Sbjct  204   VLSGLGLTTLNIANNNFSGWIPKEFSSIPDVILSGNSFLNGPAPPPPPFMPPPPRRPRNR  263

Query  1015  TNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLR  1194
              N S  GS   P   ++ +        G NG++  ++VGI++GS    L  ++++V C+R
Sbjct  264   PNRSG-GSGNAPKGSESSTGQ-----GGNNGLQTASLVGIIVGSVLAALCVLLLLVLCIR  317

Query  1195  RCKKKEFAARTSTGSL--PLS------TDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQ  1350
             + +K++  + T +     PLS      +++E+ +Q  ++TA    +K  P+EK+T ER+ 
Sbjct  318   KSRKRKDDSSTGSKDFVGPLSVNIEEASNREIPEQGLENTA----MKVLPAEKMTPERVY  373

Query  1351  GKNGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKV  1524
             GK GS+R++  PITATPYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKV+A+KKV
Sbjct  374   GKTGSMRKTKVPITATPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVMAVKKV  433

Query  1525  DSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFA  1704
             DSAA+SLQEED+FLE +S+MSRLRHPNIVPL GYC EH QRLLVY+YIGN +LHDMLHF+
Sbjct  434   DSAAISLQEEDDFLEVVSSMSRLRHPNIVPLTGYCVEHAQRLLVYEYIGNATLHDMLHFS  493

Query  1705  DERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLA  1884
             DE  + LTWN RVR+ALGTARALEYLHEVCLPSVVHRNFKSANILLDEE N HLSDCGLA
Sbjct  494   DEMGRRLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEEHNAHLSDCGLA  553

Query  1885  ALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRE  2064
             ALTPNTERQ+ ST VVGSFGYSAPEF++SG+YTVKSDVYSFGVVMLELLTGRKPLDSSRE
Sbjct  554   ALTPNTERQV-STEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRE  612

Query  2065  RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSE  2244
             RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSE
Sbjct  613   RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSE  672

Query  2245  VVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             VVQ LVRL+QRAS+V R+  +E GF+Y+ P+ +  + D
Sbjct  673   VVQQLVRLMQRASIVRRQSGEELGFSYRAPEREGDARD  710



>ref|XP_010052885.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X3 [Eucalyptus 
grandis]
Length=627

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/629 (72%), Positives = 513/629 (82%), Gaps = 12/629 (2%)
 Frame = +1

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             MGY+L    SLK+ DLS+N IHD IPYQLPPNLT+LNLA NN+TG++PYSIS M +LNY+
Sbjct  1     MGYLLTNLVSLKKFDLSNNNIHDGIPYQLPPNLTNLNLAGNNLTGNLPYSISNMVNLNYM  60

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S NSL+  +GD+F N S+LTT D S+NNFSGDLPAS   L+NLS L +QNNQLTGSLN
Sbjct  61    NVSRNSLSLSLGDIFANVSNLTTADFSYNNFSGDLPASFSALANLSSLYMQNNQLTGSLN  120

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR  1014
             VLV LPLT LNVANN FSGWIP E  S+  F Y GNSF+NSPAPPPP FT PPP +    
Sbjct  121   VLVGLPLTTLNVANNHFSGWIPKEFSSLQTFIYDGNSFANSPAPPPPLFTAPPPAKSRNN  180

Query  1015  TNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLR  1194
               HS  G+    GS    S           G+   AIVGI+ GS  ++L  ++ I  C R
Sbjct  181   RTHSGSGTSTLDGSAGQTSG-------SSKGLSTAAIVGIIAGSVLLLLVLLLAIYCCCR  233

Query  1195  RCKKKEFAARTST---GSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGS  1365
             +C KK+  AR ST    S+  + + E+ +QR  +TA+V+DLKPPP++ +  ER+  KNGS
Sbjct  234   KCNKKKRGARASTRGIQSVKSNVNPEMQEQRVITTASVIDLKPPPADVLLAERVPSKNGS  293

Query  1366  LRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAAL  1539
             +RR  SPITAT YTVA LQTA NSF QENL+GEGSLGRVYRADFPNGK++A+KK+D+AAL
Sbjct  294   VRRIKSPITATSYTVASLQTAANSFGQENLIGEGSLGRVYRADFPNGKIMAVKKIDNAAL  353

Query  1540  SLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQ  1719
             SLQEEDNFLEA+SNMSRLRHPNIV LVGYCAEHGQRLLVY+Y+GNG+LHD+LHFA++RS+
Sbjct  354   SLQEEDNFLEAVSNMSRLRHPNIVTLVGYCAEHGQRLLVYEYVGNGNLHDLLHFAEDRSK  413

Query  1720  LLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPN  1899
              L WNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPN
Sbjct  414   TLNWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPN  473

Query  1900  TERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQS  2079
             TERQ  S  +VG FGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR RSEQS
Sbjct  474   TERQQVSAQMVGQFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRVRSEQS  533

Query  2080  LVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQAL  2259
             LVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ L
Sbjct  534   LVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQL  593

Query  2260  VRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             VRLVQRA +  RR SDE GF+Y+TPDH+A
Sbjct  594   VRLVQRAGISKRRSSDEMGFSYRTPDHEA  622



>gb|EPS69681.1| hypothetical protein M569_05081 [Genlisea aurea]
Length=695

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/699 (65%), Positives = 537/699 (77%), Gaps = 20/699 (3%)
 Frame = +1

Query  214   KNGAFLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPC  393
             ++    F E  +++A ++        +TD +D+QAL+VLY SLNSPSQLSGW +SGGDPC
Sbjct  8     RSSLMFFVEATVIVAVVLRFFHTAHCSTDLSDVQALQVLYSSLNSPSQLSGWNSSGGDPC  67

Query  394   GESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNL  573
             G+SW GVTC GS+VVS+ + GLGLNGTMGY+LN   SL  LDLS+N ++D IPYQLPP L
Sbjct  68    GDSWTGVTCLGSSVVSLNLSGLGLNGTMGYLLNNLASLTTLDLSNNSMNDRIPYQLPPKL  127

Query  574   TSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSG  753
             TSLNLA NN+TG +PYSIS M+ L YLN SGN L+Q IGD+FTN   L TLD SFNNF+G
Sbjct  128   TSLNLARNNLTGGLPYSISAMSQLGYLNLSGNKLSQNIGDLFTNHPLLATLDASFNNFTG  187

Query  754   DLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEY  933
             DLP S   L+NLS L++Q+NQ +GSLNVLV LPLT+LNVA+N FSGWIPN L+SIP F Y
Sbjct  188   DLPPSFSSLTNLSALQLQDNQFSGSLNVLVGLPLTNLNVADNNFSGWIPNTLLSIPNFIY  247

Query  934   SGNSFSNSpapppppftppppgrpHKRTNHST-PGSHKTPGSDDNHSDHEngngngkngV  1110
              GNSF N PAPPPPP+T PPPGRPH        P S   P +     +H          +
Sbjct  248   QGNSFFNGPAPPPPPYTAPPPGRPHPYHGQPVLPKSTVAPNASQTRGNH----------L  297

Query  1111  KAGAivgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLS---TDKEVLDQRA  1281
             KAGAIVGI++GS  +V+  ++V+ +  R+   K    + ST    ++    +  + +Q  
Sbjct  298   KAGAIVGIIIGSLFLVVLLLLVLAFATRKGSIKGIDDQPSTADFHINHHHVNAVMQEQGP  357

Query  1282  KSTATVVDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVG  1455
             KSTA V D+K   SE    + +  K  S+RR  S +TAT YTVA LQTATN+FSQENLVG
Sbjct  358   KSTAVVSDVKSIVSENGAADSLHEKTSSMRRIKSQVTATSYTVAALQTATNNFSQENLVG  417

Query  1456  EGSLGRVYRADFPNGKVLAIKKVDS-AALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCA  1632
             EGSLGRVYRA F NGKV+A+KK+DS AA SLQEED FLEAISN+SRLRHPNI  LVGYCA
Sbjct  418   EGSLGRVYRATFSNGKVMAVKKIDSVAAASLQEEDAFLEAISNLSRLRHPNIASLVGYCA  477

Query  1633  EHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVH  1812
             EHGQRLLV+D+IGNG+LHDMLHF  ER + L WNARVR+ALGTARALEYLHEVCLP VVH
Sbjct  478   EHGQRLLVHDFIGNGNLHDMLHFDHERRKSLMWNARVRIALGTARALEYLHEVCLPPVVH  537

Query  1813  RNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKS  1992
             RN KSANILLD+EL PHLSDCG A L+PN ERQ+SS  +   FGYSAPEF+LSG+YTVK+
Sbjct  538   RNLKSANILLDDELTPHLSDCGFAVLSPNAERQVSSAQI---FGYSAPEFSLSGIYTVKT  594

Query  1993  DVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKS  2172
             DVYSFGV MLELLTGRKPLDSSR R+EQSLVRWATPQLHDIDAL+ MVDP+L+GMYPAKS
Sbjct  595   DVYSFGVAMLELLTGRKPLDSSRVRTEQSLVRWATPQLHDIDALAGMVDPSLDGMYPAKS  654

Query  2173  LSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVV  2289
             LSR ADIIALCVQPEPEFRPPMSEVVQALVRL+QRAS V
Sbjct  655   LSRLADIIALCVQPEPEFRPPMSEVVQALVRLMQRASAV  693



>ref|XP_006383864.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
 gb|ERP61661.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
Length=625

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/675 (68%), Positives = 525/675 (78%), Gaps = 57/675 (8%)
 Frame = +1

Query  328   LYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSL  507
             +Y SLNSPSQL+ WK++GGDPC ESWKG+TC+GSAVVSI+I GLGL+GTMGY+L    SL
Sbjct  1     MYTSLNSPSQLTTWKSNGGDPCAESWKGITCEGSAVVSIQISGLGLDGTMGYLLANLMSL  60

Query  508   KELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPI  687
             + LDLS N +HD  PYQLPPNLTSLNLA NN++G+IPYS+S M SL+YLN S NSLAQ I
Sbjct  61    RTLDLSDNHLHDSFPYQLPPNLTSLNLAKNNLSGNIPYSMSSMVSLSYLNISRNSLAQSI  120

Query  688   GDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLN  867
             GD+F N S L T+DLSFN+FSGDLP+S   LSNLS L VQNNQLTGSLNVL  LPLT LN
Sbjct  121   GDVFLNLSLLATMDLSFNSFSGDLPSSFNSLSNLSTLNVQNNQLTGSLNVLTGLPLTTLN  180

Query  868   VANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKT  1047
             VANN FSGWIP EL SIP F Y GNSF N P+PPPPP+TPPPPG+ H+   H   G+  T
Sbjct  181   VANNNFSGWIPQELSSIPNFIYDGNSFDNGPSPPPPPYTPPPPGKSHRNRTHPGSGAPVT  240

Query  1048  PGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAART  1227
             P SD   S  + G       +  GAIVG+ LGS  +VL  ++ +V+C+++ K KE     
Sbjct  241   PSSDGQPSQSDKG-------ISVGAIVGVALGSLVLVLIVLLALVFCIKKHKSKEI----  289

Query  1228  STGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYT  1401
                      D+++ + R K+ A V DLKPPP+E  +     G +GS++R  SPITAT Y+
Sbjct  290   --------VDRDMQESRVKNMAAVTDLKPPPAEIASYNE-HGNSGSIKRMKSPITATSYS  340

Query  1402  VAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISN  1581
             +                                  +A+KK+D+AALSLQEEDNFLEA+SN
Sbjct  341   M----------------------------------MAVKKIDNAALSLQEEDNFLEAVSN  366

Query  1582  MSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGT  1761
             MS LRHPNIV LVGYC EHGQRLLVY+YI NGS+HD+LHFAD+ S+ L+WNARVRVALGT
Sbjct  367   MSHLRHPNIVSLVGYCVEHGQRLLVYEYIANGSVHDILHFADDGSKTLSWNARVRVALGT  426

Query  1762  ARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSF  1941
             ARALEYLHEVCLPSVVHRN KSANILLDEELNPHLSDCGLAALTPNTERQ+S T +VGSF
Sbjct  427   ARALEYLHEVCLPSVVHRNLKSANILLDEELNPHLSDCGLAALTPNTERQVS-TQMVGSF  485

Query  1942  GYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDA  2121
             GYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDA
Sbjct  486   GYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDA  545

Query  2122  LSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRY  2301
             L+KMVDP LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVV RR 
Sbjct  546   LAKMVDPILNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRS  605

Query  2302  SDESGFAYKTPDHDA  2346
             SDESGFAY+TPDH+A
Sbjct  606   SDESGFAYRTPDHEA  620



>ref|XP_002451696.1| hypothetical protein SORBIDRAFT_04g006110 [Sorghum bicolor]
 gb|EES04672.1| hypothetical protein SORBIDRAFT_04g006110 [Sorghum bicolor]
Length=716

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/692 (67%), Positives = 542/692 (78%), Gaps = 15/692 (2%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGT  474
             TD  D  AL  LY S NSPSQL+GW ASGGDPCG +W+GVTC G+ V  I++PG+GL+G+
Sbjct  25    TDSADAAALGNLYTSWNSPSQLAGWSASGGDPCGAAWQGVTCSGAGVTEIKLPGVGLDGS  84

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             +GY L+   SLK LDLS+N +H  IPYQLPPNLT+LNL  NN  G++PYSIS M S+ YL
Sbjct  85    LGYQLSNLFSLKTLDLSNNNLHGSIPYQLPPNLTNLNLGGNNFNGNLPYSISNMASIQYL  144

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S NSL+Q +GD+F + + L+ LD+SFN  +G+LP S+G LSNLS L +QNNQLTGS+N
Sbjct  145   NLSHNSLSQQLGDLFGSLNSLSELDVSFNKLTGNLPNSIGSLSNLSSLYIQNNQLTGSVN  204

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR  1014
             VL  L LT LN+ANN FSGWIP E  SIP     GNSF+N PAPPPPPF PPPP RP  R
Sbjct  205   VLRGLSLTTLNIANNNFSGWIPKEFSSIPDLTLDGNSFANGPAPPPPPFMPPPPQRPRNR  264

Query  1015  TNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLR  1194
                      + PG     S+      N K G+  G +VGI+ GS   VL   +++V C+ 
Sbjct  265   PKQP-----QGPGDAPKASESPTIQSNKKQGLGTGPLVGIIAGSIVAVLCVFLLLVCCMC  319

Query  1195  RCKKKEFAARTSTGSL--PLSTDKEVLDQR----AKSTATVVDLKPPPSEKVTIERMQGK  1356
               +K+   A + +     PL+ + E    R         ++   K PP EK+T ER+ GK
Sbjct  320   NARKRTDDASSESKDFVGPLTVNIERASSREIPEQIEDTSIATAKFPP-EKMTPERVYGK  378

Query  1357  NGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDS  1530
             NGS+R++  PITATPYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKVLA+KK+DS
Sbjct  379   NGSMRKTKVPITATPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVLAVKKIDS  438

Query  1531  AALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADE  1710
             AALSLQEEDNFLEA+S+MSRLRHPNIVPL GYCAEHGQRLLVY+YIGNG+LHDMLHF+DE
Sbjct  439   AALSLQEEDNFLEAVSSMSRLRHPNIVPLTGYCAEHGQRLLVYEYIGNGTLHDMLHFSDE  498

Query  1711  RSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAAL  1890
              S+ LTWN RVR+ALGTARALEYLHEVCLPSVVHRNFKS+NILLDEE NPHLSDCGLAAL
Sbjct  499   MSRKLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSSNILLDEEHNPHLSDCGLAAL  558

Query  1891  TPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERS  2070
             TPNTERQ+ ST V GSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLTGRKPLDSSRERS
Sbjct  559   TPNTERQV-STEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERS  617

Query  2071  EQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVV  2250
             EQSLVRWATPQLHDIDAL++MVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVV
Sbjct  618   EQSLVRWATPQLHDIDALARMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVV  677

Query  2251  QALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             Q LVRL+QRAS+V R+  +E GF+Y+ P+ + 
Sbjct  678   QQLVRLMQRASIVRRQSGEELGFSYRAPEREG  709



>ref|XP_008458999.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Cucumis 
melo]
Length=612

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/616 (72%), Positives = 504/616 (82%), Gaps = 16/616 (3%)
 Frame = +1

Query  520   LSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMF  699
             +S N IHD IPYQLPPNLTSLN+A N++ G++PYS S M SLNYLN S N L+Q IGD+F
Sbjct  1     MSDNNIHDAIPYQLPPNLTSLNMAKNSLIGNLPYSFSTMASLNYLNMSHNLLSQVIGDVF  60

Query  700   TNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANN  879
             TN + L TLDLSFNNF+GDLP SLG LSN+S L +QNN LTGSLN+L+DLPLT LNVANN
Sbjct  61    TNLTTLETLDLSFNNFTGDLPKSLGTLSNVSSLFLQNNGLTGSLNILIDLPLTTLNVANN  120

Query  880   RFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNH--STPGSHKTPG  1053
              FSGWIP EL S+  F Y GN+F NSPAPPPPPFTPPPPGR      H  S+ G+H  P 
Sbjct  121   NFSGWIPQELKSVENFIYDGNTFDNSPAPPPPPFTPPPPGRSRNSPKHPGSSGGTHTAPS  180

Query  1054  SDDNHSD-HEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAARTS  1230
             S+ + S  ++        G+  GAI+ +++   A           C ++ K+K    R S
Sbjct  181   SEGSSSHSNKGLPVLAIVGIVLGAIIFVLIVLVAFA--------VCFQKRKRKNIGLRAS  232

Query  1231  TGSLPLST--DKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRR--SPITATPY  1398
             +G L + T  + EV + R KS A V D+KP P+EK+  ER+Q KNGS++R  +PITAT Y
Sbjct  233   SGRLSIGTSVNAEVQEHRVKSVAAVADIKPLPAEKMNPERLQAKNGSVKRIKAPITATSY  292

Query  1399  TVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAIS  1578
             TVA LQTATNSFSQE +VGEGSLGRVYRA+FPNGK +AIKK+D++ALSLQEEDNFLEA+S
Sbjct  293   TVASLQTATNSFSQECIVGEGSLGRVYRAEFPNGKTMAIKKIDNSALSLQEEDNFLEAVS  352

Query  1579  NMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALG  1758
             NMSRLRH NIV L GYCAEHGQRLLVY++IG+GSLHDMLHFA+E S+ LTWNARVRVALG
Sbjct  353   NMSRLRHTNIVTLNGYCAEHGQRLLVYEFIGHGSLHDMLHFAEESSKTLTWNARVRVALG  412

Query  1759  TARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGS  1938
             TARALEYLHEVCLPSVVHRN K+ANILLDE+LNPHLSDCGLAALTPNTERQI ST +VGS
Sbjct  413   TARALEYLHEVCLPSVVHRNLKTANILLDEDLNPHLSDCGLAALTPNTERQI-STQMVGS  471

Query  1939  FGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDID  2118
             FGYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKPLDSSR RSEQSLVRWATPQLHDID
Sbjct  472   FGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDID  531

Query  2119  ALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRR  2298
             AL+KMVDP LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVV R 
Sbjct  532   ALAKMVDPTLNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKRH  591

Query  2299  YSDESGFAYKTPDHDA  2346
              SDESGF+YKTP+HDA
Sbjct  592   SSDESGFSYKTPEHDA  607



>ref|XP_002518426.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF43813.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=640

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/628 (72%), Positives = 516/628 (82%), Gaps = 22/628 (4%)
 Frame = +1

Query  505   LKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQP  684
              K +DLS N IHD IPYQLPPNLTSLNLA NN++G++PYSIS M SL YLN S NS++Q 
Sbjct  16    FKGIDLSDNNIHDTIPYQLPPNLTSLNLARNNLSGNLPYSISTMVSLTYLNMSHNSISQS  75

Query  685   IGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDL  864
             +GD+F N + LTTLDLSFNNFSG+LP+S   LSNLS   +QNNQLTGSL+VL  LPLT L
Sbjct  76    VGDVFANLALLTTLDLSFNNFSGNLPSSFSSLSNLSTFYIQNNQLTGSLDVLAGLPLTTL  135

Query  865   NVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHK  1044
             NVANN  +GWIP EL S+P F Y GNSF N PAPPPPP+TPPPPGR     +HS  G+  
Sbjct  136   NVANNHLTGWIPRELNSVPNFIYDGNSFDNGPAPPPPPYTPPPPGRSRNNHSHSGSGTRT  195

Query  1045  TPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAAR  1224
              P S       ++ +     G+  GAIVGIVLGS  ++  A++ +++C R+ K+K+  A 
Sbjct  196   PPSS-------DDQSSESDKGMSVGAIVGIVLGSVLLIFIALLAVLFCTRKKKQKDGGAI  248

Query  1225  TSTGSLPLST------------DKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSL  1368
              S GS    T            D E+ +QR KS A V DLKPPP+EK+ ++++QG +GS+
Sbjct  249   VSQGSRSAGTTDSAKFSSVIAGDTEMQEQRVKSIAAVADLKPPPAEKLVVDKLQGHSGSV  308

Query  1369  RR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALS  1542
             +R  SPITAT YTVA LQTATNSFSQE ++GEGSLGRVYR +F NGK++AIKK+D+AALS
Sbjct  309   KRMKSPITATSYTVASLQTATNSFSQEFIIGEGSLGRVYRGEFSNGKIMAIKKIDNAALS  368

Query  1543  LQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQL  1722
             LQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLLVY++IGNGSLHDMLHFA++ S+ 
Sbjct  369   LQEEDNFLEAVSNMSRLRHPNIVSLAGYCAEHGQRLLVYEHIGNGSLHDMLHFAEDGSKT  428

Query  1723  LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNT  1902
             L+WNARVRVALGTARALEYLHEVCLPS+VHRNFKSANILLDEELNPHLSDCGLAALTPNT
Sbjct  429   LSWNARVRVALGTARALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDCGLAALTPNT  488

Query  1903  ERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSL  2082
             ERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSR RSEQSL
Sbjct  489   ERQV-STQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRVRSEQSL  547

Query  2083  VRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALV  2262
             VRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALV
Sbjct  548   VRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALV  607

Query  2263  RLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             RLVQRASVV RR SDESGF YKTPDH+A
Sbjct  608   RLVQRASVVKRRSSDESGFGYKTPDHEA  635



>ref|XP_009385272.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=701

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/698 (66%), Positives = 535/698 (77%), Gaps = 35/698 (5%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             +ATD  D+QAL VLY SLNSPSQLSGW  SGGDPCG+SWKGV+C GS+V ++++ GLGLN
Sbjct  28    SATDSLDVQALGVLYASLNSPSQLSGWTPSGGDPCGDSWKGVSCSGSSVTAVQLSGLGLN  87

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             G++GY+L+   SLK LDLS+N+I + IPYQLPPNLT LNLA NN++G++PYSIS M SLN
Sbjct  88    GSLGYLLSDLLSLKTLDLSNNDIRETIPYQLPPNLTYLNLAGNNLSGNLPYSISAMASLN  147

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YL                        DLSFNNF+GDLP S G LSNL  L +QNNQLTG 
Sbjct  148   YL------------------------DLSFNNFTGDLPNSFGSLSNLLSLYLQNNQLTGP  183

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             +NVL +L L++LN+ANN+F+GWIP E  SI   E  GN FSNS AP PPP+ PPPP R H
Sbjct  184   VNVLSNLSLSNLNIANNQFNGWIPQEFSSISDLEIGGNFFSNSLAPHPPPYMPPPPSRQH  243

Query  1009  KRTNHS-----TP-GSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsai  1170
                N++     TP GS     S DN S+ +        G+  G+ +G +  + AV+L   
Sbjct  244   STHNNTQESPNTPQGSEGKSISPDNASNKKKLTTGPLIGIVLGSTLGALCITLAVILLLR  303

Query  1171  vvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQ  1350
              V          +    R++ G    + +KE+ + R KS++    +  PPS+ V IE++ 
Sbjct  304   NVPKGKDHSINSRNDTGRSAVGGADKANEKEMQELRVKSSSATTPV--PPSDTVIIEKLH  361

Query  1351  GKNGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKV  1524
             GKN  ++R   PITAT YTVA LQ ATNSFSQ+ LVGEGSLGRVYRA+FPNGKVLA+KK+
Sbjct  362   GKNVPVKRPKIPITATSYTVASLQVATNSFSQDCLVGEGSLGRVYRAEFPNGKVLAVKKI  421

Query  1525  DSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFA  1704
             DSAA+SLQEEDNFLEA+SNMSRLRHPNIVPL GYC EHGQR+LV++YIGNG+LHDMLHFA
Sbjct  422   DSAAISLQEEDNFLEAVSNMSRLRHPNIVPLSGYCVEHGQRILVHEYIGNGTLHDMLHFA  481

Query  1705  DERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLA  1884
             D  S+ L+WNARVRVALGTARALEYLHEVCLPSVVH+NFKS NILLDEELNPHLSDCGLA
Sbjct  482   DYSSKRLSWNARVRVALGTARALEYLHEVCLPSVVHKNFKSTNILLDEELNPHLSDCGLA  541

Query  1885  ALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRE  2064
             ALTPNTERQ+ ST VVGSFGYSAPEFA+SGVYT+KSDVYSFGVVMLELLTGRKPLDSSR 
Sbjct  542   ALTPNTERQV-STEVVGSFGYSAPEFAMSGVYTIKSDVYSFGVVMLELLTGRKPLDSSRV  600

Query  2065  RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSE  2244
             RSEQSLVRWATPQLHDIDALSKMVD +LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSE
Sbjct  601   RSEQSLVRWATPQLHDIDALSKMVDTSLNGMYPAKSLSRFADIIALCVQPEPEFRPPMSE  660

Query  2245  VVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             VVQ LVRLVQRAS V RR  DE GF+Y+ P+ D++  D
Sbjct  661   VVQQLVRLVQRASAVKRRSGDELGFSYRVPEQDSSMTD  698



>gb|EEC72655.1| hypothetical protein OsI_06182 [Oryza sativa Indica Group]
Length=718

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/690 (65%), Positives = 541/690 (78%), Gaps = 30/690 (4%)
 Frame = +1

Query  328   LYGSLNSPSQLSGWKASGGDPCGES-WKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTS  504
             LY S NSPSQL+GW A GG     + W+G++C G+ V  I + G+GL+G++GY L+   S
Sbjct  35    LYSSWNSPSQLAGWSAGGGGDPCGAGWQGISCSGAGVTEIRLAGVGLDGSLGYELSSLFS  94

Query  505   LKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQP  684
             LK LDLS+N +H  IPYQLPPNLT LNLA NN++G++PYSIS M SL YLN S NSL+Q 
Sbjct  95    LKTLDLSNNNLHGSIPYQLPPNLTYLNLATNNLSGNLPYSISNMVSLEYLNVSHNSLSQQ  154

Query  685   IGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDL  864
             IGD+F + + L+ LD+SFN  +GDLP SLG LSNLS L +QNNQLTGS+NVL  L LT L
Sbjct  155   IGDLFGSLNSLSELDVSFNKLTGDLPNSLGFLSNLSSLYMQNNQLTGSVNVLSGLSLTTL  214

Query  865   NVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR------TNHS  1026
             N+ANN F+GWIP E  SIP     GNSF+N PAPPPPPF PPPP RP  R      +  +
Sbjct  215   NIANNNFNGWIPQEFSSIPDLTLGGNSFTNGPAPPPPPFMPPPPRRPRNRPSHPRGSGDA  274

Query  1027  TPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKK  1206
               GS    G  D               ++ G +VGIV GS+   L A++++V+C+R  +K
Sbjct  275   PEGSVSPAGQGDKKQG-----------LQTGPLVGIVAGSTVGALCALLLLVFCIRNAQK  323

Query  1207  KEFAARTSTGSL--PLS------TDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNG  1362
             ++    +++     PLS      +++E+ +Q  ++T +V  +   P+EK+T ER+ GK G
Sbjct  324   RKDDTSSNSKDFVGPLSVNIERASNREIPEQSPENT-SVATMTISPAEKMTPERIYGKTG  382

Query  1363  SLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAA  1536
             S+R++  PITATPYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKVLA+KK+DS+A
Sbjct  383   SMRKTKVPITATPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVLAVKKIDSSA  442

Query  1537  LSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERS  1716
             LSLQEEDNFLEA+S+MSRLRHPNIVPL GYC EHGQRLLVY+YIGNG+LHD+LH++DE S
Sbjct  443   LSLQEEDNFLEAVSSMSRLRHPNIVPLTGYCVEHGQRLLVYEYIGNGTLHDVLHYSDELS  502

Query  1717  QLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTP  1896
             + LTWN RVRVALGTARALEYLHEVCLPSVVHRNFKS+N+LLDEE NPHLSDCGLAALTP
Sbjct  503   RKLTWNIRVRVALGTARALEYLHEVCLPSVVHRNFKSSNVLLDEEHNPHLSDCGLAALTP  562

Query  1897  NTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ  2076
             NTERQ+ ST V GSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ
Sbjct  563   NTERQV-STEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ  621

Query  2077  SLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQA  2256
             SLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ 
Sbjct  622   SLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQ  681

Query  2257  LVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             LVRL+QRAS+V R+  +E G++Y+ P+ + 
Sbjct  682   LVRLMQRASIVRRQSGEELGYSYRAPEREG  711



>ref|NP_001046150.1| Os02g0190500 [Oryza sativa Japonica Group]
 dbj|BAD16477.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 dbj|BAF08064.1| Os02g0190500 [Oryza sativa Japonica Group]
 gb|EEE56479.1| hypothetical protein OsJ_05699 [Oryza sativa Japonica Group]
Length=718

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/690 (65%), Positives = 542/690 (79%), Gaps = 30/690 (4%)
 Frame = +1

Query  328   LYGSLNSPSQLSGWKASGGDPCGES-WKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTS  504
             LY S NSPSQL+GW A GG     + W+G++C G+ V  I + G+GL+G++GY L+   S
Sbjct  35    LYSSWNSPSQLAGWSAGGGGDPCGAGWQGISCSGAGVTEIRLAGVGLDGSLGYELSSLFS  94

Query  505   LKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQP  684
             LK LDLS+N +H  IPYQLPPNLT LNLA NN++G++PYSIS M SL YLN S NSL+Q 
Sbjct  95    LKTLDLSNNNLHGSIPYQLPPNLTYLNLATNNLSGNLPYSISNMVSLEYLNVSHNSLSQQ  154

Query  685   IGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDL  864
             IGD+F + + L+ LD+SFN  +GDLP SLG LSNLS L +QNNQLTGS+NVL  L LT L
Sbjct  155   IGDLFGSLNSLSELDVSFNKLTGDLPNSLGSLSNLSSLYMQNNQLTGSVNVLSGLSLTTL  214

Query  865   NVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR------TNHS  1026
             N+ANN F+GWIP E  SIP     GNSF+N PAPPPPPF PPPP RP  R      +  +
Sbjct  215   NIANNNFNGWIPQEFSSIPDLTLGGNSFTNGPAPPPPPFMPPPPRRPRNRPSHPRGSGDA  274

Query  1027  TPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKK  1206
               GS    G  D               ++ G +VGIV GS+   L A++++V+C+R  +K
Sbjct  275   PEGSVSPAGQGDKKQG-----------LQTGPLVGIVAGSTVGALCALLLLVFCIRNAQK  323

Query  1207  KEFAARTSTGSL--PLS------TDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNG  1362
             ++    +++     PLS      +++E+ +Q  ++T +V  +K  P+EK+T ER+ GK G
Sbjct  324   RKDDTSSNSKDFVGPLSVNIERASNREIPEQSPENT-SVATMKISPAEKMTPERIYGKTG  382

Query  1363  SLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAA  1536
             S+R++  PITATPYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKVLA+KK+DS+A
Sbjct  383   SMRKTKVPITATPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVLAVKKIDSSA  442

Query  1537  LSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERS  1716
             LSLQEEDNFLEA+S+MSRLRHPNIVPL GYC EHGQRLLVY+YIGNG+LHD+LH++DE S
Sbjct  443   LSLQEEDNFLEAVSSMSRLRHPNIVPLTGYCVEHGQRLLVYEYIGNGTLHDVLHYSDELS  502

Query  1717  QLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTP  1896
             + LTWN RVRVALGTARALEYLHEVCLPSVVHRNFKS+NILLDEE NPHLSDCGLAALTP
Sbjct  503   RKLTWNIRVRVALGTARALEYLHEVCLPSVVHRNFKSSNILLDEEHNPHLSDCGLAALTP  562

Query  1897  NTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ  2076
             NTERQ+ ST V GSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ
Sbjct  563   NTERQV-STEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ  621

Query  2077  SLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQA  2256
             SLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ 
Sbjct  622   SLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQ  681

Query  2257  LVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             LVRL+QRAS+V R+  +E G++Y+ P+ + 
Sbjct  682   LVRLMQRASIVRRQSGEELGYSYRAPEREG  711



>ref|XP_004965804.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Setaria 
italica]
Length=716

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/705 (61%), Positives = 527/705 (75%), Gaps = 34/705 (5%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGT  474
             TD  D+ AL  LY S NSP+QL+GW A+GGDPCG +W GVTC G+AV SI++ G+ LNGT
Sbjct  27    TDAGDVAALGNLYSSWNSPAQLTGWSAAGGDPCGAAWAGVTCSGTAVTSIKLSGMELNGT  86

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             +GY L+   +LK +DLS+N +HD IPYQLP NLT LNLA NN++G++PYSIS M SL YL
Sbjct  87    LGYELSSLQALKTMDLSNNFLHDSIPYQLPSNLTYLNLAKNNLSGNLPYSISTMVSLEYL  146

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S NSL Q IG++F + + L+ LD+SFNN +G LP S+G LS +S L +QNNQL+G+++
Sbjct  147   NLSHNSLFQEIGELFGSLNSLSELDISFNNLTGSLPISMGSLSKVSSLYMQNNQLSGTVD  206

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR  1014
             VL +L L  LN+ANN FSG IP EL SIP     GNSF+N     PPP   PPP     +
Sbjct  207   VLSNLSLATLNIANNNFSGTIPQELSSIPNLIVGGNSFAN-MPASPPPTLTPPPKNTRDQ  265

Query  1015  TNH-----STPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvi  1179
              NH     S P   +TP   D+              ++ G +VGI +GS AV    +  +
Sbjct  266   PNHPQGPISAPIVPETPIDQDDKK------------LQTGPLVGIAVGSIAVGSCVLFAL  313

Query  1180  vYCLRRCKKKEFAARTS----TGSLPLSTDKEV-----LDQRAKSTATVVDLKPPPSEKV  1332
             V+CL + +K+   A +      GSL ++ ++       +   +   A V      PS K+
Sbjct  314   VFCLHKTRKRNDDASSEPKDIVGSLAVNIERASNRETPIPNNSHENAVVATSDLQPSGKM  373

Query  1333  TIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGK  1503
             T ER+ G NGS  ++   P+TAT YTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGK
Sbjct  374   TPERVYGTNGSTAKNAKVPVTATSYTVAALQVATNSFCQDSLLGEGSLGRVYKADFPNGK  433

Query  1504  VLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSL  1683
             VLA+KK+DSA+LSL EE+NFLE ISN+SRLRHPNIVPL GYC EHGQRLLVY+YIGNG+L
Sbjct  434   VLAVKKIDSASLSLYEEENFLEVISNISRLRHPNIVPLTGYCTEHGQRLLVYEYIGNGTL  493

Query  1684  HDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPH  1863
             HD+LHF+D  S+ LTWN RVR+ALGTARALEYLHEVC+P VVHR+FKS+NILLDEE +PH
Sbjct  494   HDILHFSDGMSRKLTWNTRVRIALGTARALEYLHEVCMPPVVHRSFKSSNILLDEEYSPH  553

Query  1864  LSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRK  2043
             LSDCGLAAL+PN ER++S+  VVGSFGYSAPEFA+SG YT KSDVYSFGVVMLELLTGRK
Sbjct  554   LSDCGLAALSPNPEREVSA-EVVGSFGYSAPEFAMSGTYTTKSDVYSFGVVMLELLTGRK  612

Query  2044  PLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPE  2223
             PLDSSRERSEQSLVRWATPQLHDID L+KMVDPA++G+YPAKSLSRFADIIA+CVQ EPE
Sbjct  613   PLDSSRERSEQSLVRWATPQLHDIDLLAKMVDPAMDGLYPAKSLSRFADIIAICVQSEPE  672

Query  2224  FRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             FRPPMSEVVQ LVRL+QRAS +IRR SD+ G++Y+ P  +  +GD
Sbjct  673   FRPPMSEVVQQLVRLMQRAS-IIRRQSDDLGYSYRVP--EGGTGD  714



>ref|XP_008799298.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008799306.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Phoenix dactylifera]
Length=643

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/646 (68%), Positives = 517/646 (80%), Gaps = 18/646 (3%)
 Frame = +1

Query  457   LGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLM  636
             +GLNGT+GY+L+   SLK LD+S+N +H+ IPYQLPPNLT LNLA NN++G++P+SIS M
Sbjct  1     MGLNGTLGYLLSDLLSLKTLDISNNNVHEGIPYQLPPNLTYLNLAKNNLSGNLPFSISTM  60

Query  637   TSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQ  816
              SLNYLN S NSL+Q IGD+F N  DL+ LDLSFNN +GDLP SL  LSNLS L +Q+NQ
Sbjct  61    VSLNYLNVSHNSLSQQIGDIFANLQDLSELDLSFNNLTGDLPNSLSSLSNLSSLYLQDNQ  120

Query  817   LTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftpppp  996
             LTG +N+L  L LT LN+AN+ FSGWIP E  SIP     GNSF + PAPPPPP+  PPP
Sbjct  121   LTGPVNLLASLDLTTLNIANDNFSGWIPQEFSSIPNLITGGNSFIDGPAPPPPPYVAPPP  180

Query  997   grpHKRTNHSTP--GSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsai  1170
              RPHK  NH+     +   P S   H D+     N K  + AG+I+GI++ S    L  I
Sbjct  181   SRPHKNRNHTKAPIDTPDRPESKPFHPDN----TNEKKSLTAGSIIGIIISSIFGALCVI  236

Query  1171  vvivYCLRRCKKKEFAARTSTG--------SLPLSTDKEVLDQRAKSTATVVDLKPPPSE  1326
             + + +CL    KK+   R +T         +   +TDKE+ +QR K TA+V  LKPPP E
Sbjct  237   LAVSFCLWNVPKKKDDTRMNTSHSLGFVTIAADRATDKEMREQRLK-TASVTSLKPPPVE  295

Query  1327  KVTIERMQGKNGSLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNG  1500
             K+ +E++ G NGS +R   PITAT YTVA LQ ATNSFSQ++L+GEGSLGRVYRA+F +G
Sbjct  296   KMMVEKVYGNNGSGKRPKVPITATSYTVASLQIATNSFSQDSLLGEGSLGRVYRAEFSDG  355

Query  1501  KVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGS  1680
              VLA+KK+DSAALSLQEEDNFLEA+SNMSRLRHPNIV L+GYC EHGQRLLV++YIGNG+
Sbjct  356   TVLAVKKIDSAALSLQEEDNFLEAVSNMSRLRHPNIVTLLGYCVEHGQRLLVFEYIGNGT  415

Query  1681  LHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNP  1860
             LHDMLHFAD+ S+ LTWNARVRVALGTARALEYLHEVCLPS+VHRNFKSANILLDEELNP
Sbjct  416   LHDMLHFADDSSKKLTWNARVRVALGTARALEYLHEVCLPSIVHRNFKSANILLDEELNP  475

Query  1861  HLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGR  2040
              LSDCGLAALTPNTERQ+ ST VVGSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLTGR
Sbjct  476   RLSDCGLAALTPNTERQV-STEVVGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGR  534

Query  2041  KPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEP  2220
             KPLDSSRERSEQSLVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEP
Sbjct  535   KPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEP  594

Query  2221  EFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             EFRPPMSEVVQ LVRL+QRAS+V R   DE G++Y+  +H+A++ D
Sbjct  595   EFRPPMSEVVQQLVRLMQRASIVRRSSGDELGYSYRVLEHEASTTD  640



>ref|XP_003563583.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Brachypodium 
distachyon]
Length=720

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/685 (62%), Positives = 518/685 (76%), Gaps = 18/685 (3%)
 Frame = +1

Query  328   LYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSL  507
             LY S NSP+QL+GW A GGDPCG +W GV+C GSA+ SI + G+GLNGT+GY L+   +L
Sbjct  36    LYTSWNSPAQLTGWSAGGGDPCGAAWMGVSCSGSAITSINLSGMGLNGTLGYQLSDLVAL  95

Query  508   KELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPI  687
             K +DLS+N +HD IPYQLPPNLT L+LA+NN +G++PYSIS M SL YLN S NSL Q I
Sbjct  96    KTMDLSNNNLHDAIPYQLPPNLTYLSLASNNFSGNLPYSISNMLSLVYLNLSHNSLFQEI  155

Query  688   GDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLN  867
             G++F N + L+ LD+SFNN SG+LP S   LSNLS L +QNNQL+G++NVL +L LT LN
Sbjct  156   GELFGNLNSLSELDVSFNNMSGNLPMSFISLSNLSSLYMQNNQLSGTVNVLSNLSLTTLN  215

Query  868   VANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKT  1047
             +ANN FSG IP EL SIP     GNSF N       P +PPP   P  ++    P   + 
Sbjct  216   IANNNFSGLIPGELSSIPNLTLGGNSFIN------MPASPPPTLMPPPQSPLDQPEYPQA  269

Query  1048  PGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCL----RRCKKKEF  1215
             P S  +     N  G  K G++ G ++G+V+GS A     + V+V+CL    RR      
Sbjct  270   PISFPDRPQIPNNQGRKKQGLQTGRLIGVVVGSIAAGSCILFVLVFCLHNVHRRKDGGSS  329

Query  1216  AARTSTGSLPLSTDK----EVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRRS--  1377
              ++   GSL ++ D+    E+LD+  +  +      P P+ K+T ER+ G NGS  +   
Sbjct  330   ESKDHVGSLAVNIDRGSNREILDKSHQDASVATSTLPQPTGKMTPERVYGTNGSPAKKIK  389

Query  1378  -PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEE  1554
              P  AT YTVA LQ ATNSF Q++L+GEGSLGRVYRADFPNGKVLA+KK+DSAALSL EE
Sbjct  390   VPSAATSYTVASLQVATNSFCQDSLLGEGSLGRVYRADFPNGKVLALKKIDSAALSLYEE  449

Query  1555  DNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWN  1734
             D+FLE +SN+SRLRHPNIV L GYC EHGQRLLVY YIGNG+LHD+LHF++E S+ LTWN
Sbjct  450   DHFLEVVSNISRLRHPNIVSLTGYCVEHGQRLLVYQYIGNGTLHDLLHFSEEASKNLTWN  509

Query  1735  ARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQI  1914
             ARVR+ LGTARALEYLHEVCLP VVHRN KS+NILLDEE +PHLSDCGLAAL+PN ER++
Sbjct  510   ARVRIVLGTARALEYLHEVCLPPVVHRNLKSSNILLDEEYSPHLSDCGLAALSPNPEREV  569

Query  1915  SSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWA  2094
              ST VVGSFGYSAPEFA+SG YTVKSDVYSFGVVMLELLTGRKPLD SRERSEQSLV WA
Sbjct  570   -STEVVGSFGYSAPEFAMSGTYTVKSDVYSFGVVMLELLTGRKPLDRSRERSEQSLVGWA  628

Query  2095  TPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQ  2274
             TPQLHDIDAL+KMVDPA++GMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ LVRL+Q
Sbjct  629   TPQLHDIDALAKMVDPAMDGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQLVRLLQ  688

Query  2275  RASVVIRRYSDESGFAYKTPDHDAA  2349
             RAS++ R+ +++ G +Y+ P+ +  
Sbjct  689   RASMLRRQSAEDLGSSYRAPEREGG  713



>gb|EEC81030.1| hypothetical protein OsI_23812 [Oryza sativa Indica Group]
Length=712

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/703 (61%), Positives = 526/703 (75%), Gaps = 29/703 (4%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGT  474
             TD  D  AL  LY S NSP+QL+GW A GGDPCG +W GV+C GSAV SI++ G+GLNGT
Sbjct  22    TDGGDAAALGNLYSSWNSPAQLTGWSAGGGDPCGAAWMGVSCVGSAVTSIKLSGMGLNGT  81

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             +GY L+   +LK +DLSSN +HD IPYQLPPNL  LNLA NN +G++PYSIS M SLNYL
Sbjct  82    LGYQLSNLLALKTMDLSSNNLHDSIPYQLPPNLAYLNLAGNNFSGNLPYSISNMVSLNYL  141

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S N L Q IG+MF N + L+ LD+SFNN +G+LP SL  LSN+S + +QNNQL+G++N
Sbjct  142   NLSHNLLFQEIGEMFGNLTALSELDVSFNNLNGNLPISLRSLSNISGIYLQNNQLSGTVN  201

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR  1014
             VL +L LT LN+ANN FSG IP +  SI      GNSF N P+ PP   T PP G+P   
Sbjct  202   VLSNLSLTTLNIANNNFSGSIPQDFSSISHLILGGNSFLNVPSSPPSTITSPPQGQPDFP  261

Query  1015  TNHST-PGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCL  1191
                +T P   + P   D  SD +         ++ G ++GIV+GS A     +  +V CL
Sbjct  262   QGPTTAPNIPEIP--IDQGSDKKQR-------LRTGLVIGIVIGSMAAACGVLFALVLCL  312

Query  1192  RRCKKKEFA--------ARTSTGSLPLSTDKEVLD---QRAKSTATVVDLKPPPSEKVTI  1338
                +K +          A T   ++  ++++E+ D   Q A  +++V+    PP  K+T 
Sbjct  313   HNVRKSKDGGISESKDVASTFAVNIDRASNREIWDHTQQDAPVSSSVL----PPMGKMTP  368

Query  1339  ERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVL  1509
             ER+   N S+ +     +TA PYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKVL
Sbjct  369   ERVYSTNSSMSKKMKVSVTANPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVL  428

Query  1510  AIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHD  1689
             A+KK+DSA+LSL EEDNFLE +S++SRLRHPNIVPL GYC EHGQRLLVY++IGNG+LHD
Sbjct  429   AVKKIDSASLSLYEEDNFLEVVSSISRLRHPNIVPLAGYCVEHGQRLLVYEHIGNGTLHD  488

Query  1690  MLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLS  1869
             +LHF D+ S++LTWN R+R+ALGTARALEYLHEVCLP VVHRN KSANILLD+E +PHLS
Sbjct  489   ILHFFDDTSKILTWNHRMRIALGTARALEYLHEVCLPPVVHRNLKSANILLDKEYSPHLS  548

Query  1870  DCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPL  2049
             DCGLAALTPN ER++ ST V GSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLT RKPL
Sbjct  549   DCGLAALTPNPEREV-STEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTARKPL  607

Query  2050  DSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFR  2229
             DSSRERSEQSLV WATPQLHDIDAL+KMVDPA++GMYPAKSLSRFADIIALCVQPEPEFR
Sbjct  608   DSSRERSEQSLVTWATPQLHDIDALAKMVDPAMDGMYPAKSLSRFADIIALCVQPEPEFR  667

Query  2230  PPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             PPMSEVVQ LVRLVQRAS+V R+  ++ G +Y+ PD +  + D
Sbjct  668   PPMSEVVQQLVRLVQRASMVRRQSGEDVGLSYRGPDREGGTAD  710



>gb|AFW70556.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=668

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/645 (65%), Positives = 499/645 (77%), Gaps = 10/645 (2%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGT  474
             TDP+D  AL  LY S NSPSQL+GW ASGGDPCG +W+GV C G+ V  I++PG GL+G+
Sbjct  25    TDPDDAAALANLYTSWNSPSQLAGWSASGGDPCGAAWQGVACSGAGVTEIKLPGTGLDGS  84

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             +GY L+   SLK LDLS+N +H  IPYQLPPNLT+LNL +NN  G++PYSIS M S+ YL
Sbjct  85    LGYELSNLFSLKTLDLSNNNLHGSIPYQLPPNLTNLNLGSNNFNGNLPYSISNMASIEYL  144

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S NS++Q +GD+F + + L+ LD+SFN  +GDLP S+G LSNLS L +QNNQLTGS+N
Sbjct  145   NLSHNSISQQLGDIFGSLNSLSDLDVSFNKLTGDLPNSIGSLSNLSSLYMQNNQLTGSVN  204

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR  1014
             VL  L LT LN+ANN FSGWIP E  SIP     GNSF+N PAPPPPPF PPPP RP  R
Sbjct  205   VLRGLSLTTLNIANNNFSGWIPKEFSSIPDVTLEGNSFANGPAPPPPPFMPPPPQRPRNR  264

Query  1015  TNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLR  1194
               H   G    P   ++H+   N       G   G I G ++    V L  +  +    +
Sbjct  265   PKHPQ-GPGDAPKGSESHTVQSNKKQGLGTGPLVGIIAGSIVAVLCVFLLLLCCMCNAQK  323

Query  1195  RCKKKEFAARTSTGSLPL----STDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNG  1362
             R       ++   G L +    ++ +E+ +Q   ++   V L  PP+EK+T ER+ GKNG
Sbjct  324   RTDDASSESKDFGGPLTVNIERASSREIPEQMDDTSIATVKL--PPAEKMTPERVYGKNG  381

Query  1363  SLRRS--PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAA  1536
             S+R++  PITATPYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKVLA+KK+DSAA
Sbjct  382   SVRKTKVPITATPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVLAVKKIDSAA  441

Query  1537  LSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERS  1716
             LSLQEEDNFLEA+S+MSRLRHPNIVPL GYC EHGQRLLVY+YI NG+LHDMLHF+ E S
Sbjct  442   LSLQEEDNFLEAVSSMSRLRHPNIVPLTGYCVEHGQRLLVYEYIVNGTLHDMLHFSVEIS  501

Query  1717  QLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTP  1896
             + LTWN RVR+ALGTARALEYLHEVC+PS+VHRN KS+NILLDEE NPHLSDCGLAALTP
Sbjct  502   RKLTWNIRVRIALGTARALEYLHEVCMPSLVHRNLKSSNILLDEEHNPHLSDCGLAALTP  561

Query  1897  NTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ  2076
             NTERQ+ ST V GSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ
Sbjct  562   NTERQV-STEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ  620

Query  2077  SLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQ  2211
             SLVRWATPQLHDIDAL++MVDPALNGMYPAKSLSRFAD+IALCVQ
Sbjct  621   SLVRWATPQLHDIDALARMVDPALNGMYPAKSLSRFADVIALCVQ  665



>ref|XP_006377174.1| hypothetical protein POPTR_0011s01540g [Populus trichocarpa]
 gb|ERP54971.1| hypothetical protein POPTR_0011s01540g [Populus trichocarpa]
Length=600

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/629 (69%), Positives = 494/629 (79%), Gaps = 39/629 (6%)
 Frame = +1

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             MGYML+   SL+  DLS N IHD +PYQLPPNLTSLNLA NN++G++PYSIS M SL+YL
Sbjct  1     MGYMLSNLMSLRTFDLSDNNIHDPLPYQLPPNLTSLNLAINNLSGNLPYSISTMVSLSYL  60

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S NSL+Q IGD+F N S L+T+D+SFNN SGD+P+S   LSNLS L VQNNQLTGSLN
Sbjct  61    NVSRNSLSQSIGDVFHNLSLLSTMDVSFNNLSGDIPSSFSSLSNLSTLNVQNNQLTGSLN  120

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR  1014
             VL  LPLT LNVANN  SGWIP EL SIP F Y+GNSF N PAPPPPP+T PP G+ H+ 
Sbjct  121   VLTGLPLTTLNVANNNLSGWIPQELSSIPNFIYNGNSFDNGPAPPPPPYTSPPSGKSHRN  180

Query  1015  TNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLR  1194
               H   G+ +T  SD   S+ + G       +  GAIVG+ LGS  +VL A++ +V+C++
Sbjct  181   RTHPGSGAPRTSSSDGQPSESDKG-------ISVGAIVGVALGSVVLVLIALLALVFCIK  233

Query  1195  RCKKKEFAARTSTGSLPLST---DKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGS  1365
             + + KE     S GS P  T     E+ + R K+ A V DLKPPP+EK+  ER+ G +GS
Sbjct  234   KHQGKEIDPLASRGSRPADTYYTGAEMQEPRVKNMAAVTDLKPPPAEKLVAERLLGNSGS  293

Query  1366  LRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAAL  1539
             ++R  SPITAT Y+VA LQTATNSFSQE ++GEGSLGRVYR DFP+GK++A+KK+D+AAL
Sbjct  294   IKRMKSPITATSYSVASLQTATNSFSQEFIIGEGSLGRVYRGDFPHGKIMAVKKIDNAAL  353

Query  1540  SLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQ  1719
             SLQEEDNFLEA+SNMS LRHPNIV LVGYC EHGQRLLVY+YI NGSLHD+LHFAD+ S+
Sbjct  354   SLQEEDNFLEAVSNMSHLRHPNIVSLVGYCVEHGQRLLVYEYIANGSLHDILHFADDGSK  413

Query  1720  LLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPN  1899
              L+WNARVRVALGTARALEYLHEVCLPSVVHRNFKSA                       
Sbjct  414   TLSWNARVRVALGTARALEYLHEVCLPSVVHRNFKSA-----------------------  450

Query  1900  TERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQS  2079
                 I ST +VGSFGYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKPLDSSR RSEQS
Sbjct  451   ----IVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRVRSEQS  506

Query  2080  LVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQAL  2259
             LVRWATPQLHDIDAL+KMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQAL
Sbjct  507   LVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQAL  566

Query  2260  VRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             VRLVQRASVV RR SD+SGFAYKTPDH+A
Sbjct  567   VRLVQRASVVKRRPSDDSGFAYKTPDHEA  595



>gb|KDO78348.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=621

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/614 (69%), Positives = 494/614 (80%), Gaps = 18/614 (3%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L    VL+++  ++ L  V   TD +D+QAL+VLY SLNSPS L+ WK + GDPCGESWK
Sbjct  18    LIDAFVLILSIFLT-LSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWK  76

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV C+GSAVVSI+I GLGL+GTMGY+L+   SL++ DLS N IHD IPYQLPPNLTSLNL
Sbjct  77    GVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNL  136

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A+NN +G++PYSI+ M SL+YLN S NSL Q IGD+F N + L TLDLSFNNFSGDLP S
Sbjct  137   ASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNS  196

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                LSN+S L +QNNQ+TGSLNV   LPLT LNVANN FSGWIP ELISI  F Y GNSF
Sbjct  197   FISLSNISSLYLQNNQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSF  256

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N PAPPPPP T PP GR H   +H   GSH   GS  + SD E         + AGAIV
Sbjct  257   DNGPAPPPPPSTAPPSGRSHNNRSHRQ-GSHSPSGSQSSSSDKE---------LPAGAIV  306

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATV  1299
             GIVLG+  +V  A++ + +C+R+ ++K   AR+S GS P+ST+    E+ +QR KS A V
Sbjct  307   GIVLGAVFLVALALLALYFCIRKNRRKVSGARSSAGSFPVSTNNMNTEMHEQRVKSVAAV  366

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DL PPP+EK+ IER+  K+GSL++  SPITAT YTVA LQTATNSFSQE L+GEGSLGR
Sbjct  367   TDLTPPPAEKLVIERV-AKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGR  425

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+F NGK++A+KK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLL
Sbjct  426   VYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLL  485

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY+Y+GNG+LHDMLHFAD+ S+ LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN
Sbjct  486   VYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  545

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLD+ELNPHLSDCGLAALTPNTERQ+ ST +VG+FGYSAPEFALSG+YTVKSDVYSFGV
Sbjct  546   ILLDDELNPHLSDCGLAALTPNTERQV-STQMVGAFGYSAPEFALSGIYTVKSDVYSFGV  604

Query  2014  VMLELLTGRKPLDS  2055
             VMLELLTGRKPLDS
Sbjct  605   VMLELLTGRKPLDS  618



>gb|KDO78349.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
 gb|KDO78350.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=618

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/613 (69%), Positives = 493/613 (80%), Gaps = 18/613 (3%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L    VL+++  ++ L  V   TD +D+QAL+VLY SLNSPS L+ WK + GDPCGESWK
Sbjct  18    LIDAFVLILSIFLT-LSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWK  76

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV C+GSAVVSI+I GLGL+GTMGY+L+   SL++ DLS N IHD IPYQLPPNLTSLNL
Sbjct  77    GVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNL  136

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A+NN +G++PYSI+ M SL+YLN S NSL Q IGD+F N + L TLDLSFNNFSGDLP S
Sbjct  137   ASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNS  196

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                LSN+S L +QNNQ+TGSLNV   LPLT LNVANN FSGWIP ELISI  F Y GNSF
Sbjct  197   FISLSNISSLYLQNNQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSF  256

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N PAPPPPP T PP GR H   +H   GSH   GS  + SD E         + AGAIV
Sbjct  257   DNGPAPPPPPSTAPPSGRSHNNRSHRQ-GSHSPSGSQSSSSDKE---------LPAGAIV  306

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATV  1299
             GIVLG+  +V  A++ + +C+R+ ++K   AR+S GS P+ST+    E+ +QR KS A V
Sbjct  307   GIVLGAVFLVALALLALYFCIRKNRRKVSGARSSAGSFPVSTNNMNTEMHEQRVKSVAAV  366

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DL PPP+EK+ IER+  K+GSL++  SPITAT YTVA LQTATNSFSQE L+GEGSLGR
Sbjct  367   TDLTPPPAEKLVIERV-AKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGR  425

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+F NGK++A+KK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLL
Sbjct  426   VYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLL  485

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY+Y+GNG+LHDMLHFAD+ S+ LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN
Sbjct  486   VYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  545

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLD+ELNPHLSDCGLAALTPNTERQ+ ST +VG+FGYSAPEFALSG+YTVKSDVYSFGV
Sbjct  546   ILLDDELNPHLSDCGLAALTPNTERQV-STQMVGAFGYSAPEFALSGIYTVKSDVYSFGV  604

Query  2014  VMLELLTGRKPLD  2052
             VMLELLTGRKPLD
Sbjct  605   VMLELLTGRKPLD  617



>dbj|BAK02781.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=715

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/702 (60%), Positives = 510/702 (73%), Gaps = 19/702 (3%)
 Frame = +1

Query  283   VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGG-DPCGESWKGVTCQGSAVVSIEIPGL  459
             VGA TD   + AL  LY S NSP+QL GW A+GG DPCG +W GV+C GSA+ SI + G+
Sbjct  21    VGADTDAAGVAALGNLYTSWNSPAQLVGWSAAGGGDPCGAAWTGVSCSGSAITSINLSGM  80

Query  460   GLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMT  639
             GLNGT+GY L    +L  +DLS+N +HD+IPYQLPPNL  LNLA NN +G +PYSIS + 
Sbjct  81    GLNGTLGYQLASLVALTTMDLSNNSLHDVIPYQLPPNLIHLNLARNNFSGDLPYSISNIL  140

Query  640   SLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQL  819
             SL YLN S NSL Q IG++F   + L+ LDLSFNN SG+LP S   LSNLS L +QNNQL
Sbjct  141   SLGYLNVSHNSLFQEIGELFGGLNSLSVLDLSFNNLSGNLPVSFVSLSNLSSLYMQNNQL  200

Query  820   TGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppg  999
             TG++NVL +L LT LN+ANN FSG IP EL S+P     GNSF N PA PPP   PP   
Sbjct  201   TGTVNVLSNLSLTTLNIANNNFSGSIPGELSSVPDLTAGGNSFINMPASPPPIIMPPSGS  260

Query  1000  rpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvi  1179
                +      P +      D+   D  +         + G +VG+ +GS A     +  +
Sbjct  261   PLAQPDRPRVPITFPNGPEDEIPIDEGDKKQGR----QTGLLVGLAVGSVAAASCILFAL  316

Query  1180  vYCLRRCKKKEFAARTS----TGSLPLSTDKEVLD--QRAKSTATVVDLKPPPSEKVTIE  1341
             V+CL    K++    +      G+L ++ D++  +   +    AT V  +P      T E
Sbjct  317   VFCLHNLHKRKDGGTSEPKDFVGALAVNIDRDSNNNIHQDSPVATSVLQRP----IGTPE  372

Query  1342  RMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLA  1512
             R  G N S  +    P  AT YTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKVLA
Sbjct  373   RAYGINSSPAKKIKVPGAATSYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVLA  432

Query  1513  IKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDM  1692
             +KK+DSAALSL EED+FLE +SN+SRLRHPNIV L GYCA+HGQRLLVY++IGNG+LHDM
Sbjct  433   VKKIDSAALSLYEEDHFLEVVSNISRLRHPNIVSLTGYCADHGQRLLVYEHIGNGTLHDM  492

Query  1693  LHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSD  1872
             LHF+DE S+ LTWNARVR+ALGTARALEYLHEVCLP VVHRN KS+NILLDEE +PHLSD
Sbjct  493   LHFSDEASKNLTWNARVRIALGTARALEYLHEVCLPPVVHRNLKSSNILLDEECSPHLSD  552

Query  1873  CGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLD  2052
             CGLAA +PN ER++ ST V+GS GYSAPEFA+SG YTVKSDVYSFGVVMLELLTGRKPLD
Sbjct  553   CGLAAFSPNPEREV-STEVLGSLGYSAPEFAMSGTYTVKSDVYSFGVVMLELLTGRKPLD  611

Query  2053  SSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRP  2232
              SRERSEQSLV WATPQLHDIDAL+KMVDPA++GMYPAKSLSRFADIIAL VQPEPEFRP
Sbjct  612   RSRERSEQSLVGWATPQLHDIDALAKMVDPAMDGMYPAKSLSRFADIIALSVQPEPEFRP  671

Query  2233  PMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             P+SEVVQ LVRL+QRAS++ R+  D+ G +Y+ P+ +  + D
Sbjct  672   PISEVVQQLVRLMQRASMLRRQSGDDLGSSYRAPEREGGASD  713



>ref|XP_006449792.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
 gb|ESR63032.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
Length=618

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/613 (69%), Positives = 489/613 (80%), Gaps = 18/613 (3%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L    VL+++  ++ L  V   TD +D+ AL+VLY SLNSPS L+ WK +GGDPCGESWK
Sbjct  18    LLAAFVLILSIFLT-LSLVQCTTDSSDVLALQVLYTSLNSPSVLTNWKGNGGDPCGESWK  76

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV C+GSAVVSI++ GLGLNGTMGY+L+   SL++ DLS N IHD IPYQLPPNLTSLNL
Sbjct  77    GVACEGSAVVSIDVSGLGLNGTMGYLLSDLLSLRKFDLSGNGIHDTIPYQLPPNLTSLNL  136

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A+NN +G++PYSI+ M SL+YLN S N L Q IGD+F   + L TLDLSFNNFSGDLP S
Sbjct  137   ASNNFSGNLPYSIASMVSLSYLNVSRNWLTQSIGDIFGTLACLATLDLSFNNFSGDLPNS  196

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                LSN+S L +QNNQLTGSLNV   LPLT LNVANN  SGWIP ELISI  F Y GNSF
Sbjct  197   FISLSNISSLYLQNNQLTGSLNVFSGLPLTTLNVANNHLSGWIPRELISIRTFIYDGNSF  256

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N PAPPPPP T PP GR H   +H   GSH   GS  + SD E         + AGAIV
Sbjct  257   DNGPAPPPPPSTAPPSGRSHNNRSHRQ-GSHSPSGSQSSSSDKE---------LSAGAIV  306

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATV  1299
             GIVLG+  +V  A++ + +C+ + + K   AR+S GSLP+ST+    E+ +QR KS A V
Sbjct  307   GIVLGAVFLVALALLALYFCIWKNRTKVSGARSSAGSLPVSTNNMNTEMHEQRVKSVAAV  366

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DL PPP+EK+ IER+  K+GSL++  SPITAT YTVA LQTATNSFSQE L+GEGSLGR
Sbjct  367   TDLTPPPAEKLVIERV-AKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGR  425

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+F NGK++A+KK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLL
Sbjct  426   VYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLL  485

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY+Y+GNGSLHDMLHFAD+ S+ LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN
Sbjct  486   VYEYVGNGSLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  545

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             ILLD+ELNPHLSDCGLAALTPNTERQ+ ST +VG+FGYSAPEFALSG+YTVKSDVYSFGV
Sbjct  546   ILLDDELNPHLSDCGLAALTPNTERQV-STQMVGAFGYSAPEFALSGIYTVKSDVYSFGV  604

Query  2014  VMLELLTGRKPLD  2052
             VMLELLTGRKPLD
Sbjct  605   VMLELLTGRKPLD  617



>gb|AFW87367.1| putative STRUBBELIG family receptor protein kinase, partial [Zea 
mays]
Length=743

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/712 (57%), Positives = 505/712 (71%), Gaps = 40/712 (6%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGT  474
             TD  D+ AL  LY S NSP++L+GW ASGGDPCG +W GV+C GSAV SI++ G+ LNGT
Sbjct  26    TDAGDVAALGNLYSSWNSPARLAGWSASGGDPCGAAWTGVSCSGSAVTSIKLSGMELNGT  85

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             +GY L+   +LK +DLS+N +HD IPYQLP NLT LNLA NN +G++PYSIS + SL YL
Sbjct  86    LGYQLSSLQALKTMDLSNNYLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEYL  145

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S NSL Q IG++F + S L+ LD+SFNN +G+LP S+G LS LS L +QNNQL+G+++
Sbjct  146   NLSHNSLFQEIGELFGSLSSLSELDISFNNLTGNLPFSMGSLSKLSSLYMQNNQLSGTVD  205

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN---Spapppppftppppgrp  1005
             V+ ++ L  L++A+N FSG IP E  SIP    +GNSF N   SP     P   P     
Sbjct  206   VISNISLATLDIASNNFSGMIPQEFSSIPNLIVAGNSFVNMPASPPQALTPPPNPRGRPD  265

Query  1006  HKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivY  1185
              +R   S P   +TP   D+              ++ G +VGI +GS A     +  +V 
Sbjct  266   DRRGPTSAPTVPETPIDPDDKK------------MQTGPLVGIAVGSIAAASCVLFALVL  313

Query  1186  CLRRCKKK----EFAARTSTGS--LPLSTDKEVLDQRAKSTATV---VDLKPPPSEKVTI  1338
             CL   +KK       A+   GS  +  ++ +EV+D    + A     + L  P  +    
Sbjct  314   CLHNARKKPDDGSSEAKGIAGSHLVVTTSSREVMDSSHDNAAVATSDLQLIQPAGKMTPD  373

Query  1339  ERMQGKNGSLRRSP------ITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNG  1500
             +R  G NG   + P       T + YTVA LQ ATNSF Q++L+GEGSLGRVY+A FPNG
Sbjct  374   DRAHGPNGCTAKRPKQQVTVTTVSSYTVAALQVATNSFCQDSLLGEGSLGRVYKAVFPNG  433

Query  1501  KVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGS  1680
             KVLA+KK+DSA+LSL EEDNFL  +SN+SRLRHPNIVPL GYC EHGQRLL Y+Y+GNG+
Sbjct  434   KVLAVKKIDSASLSLYEEDNFLAVVSNVSRLRHPNIVPLAGYCVEHGQRLLAYEYVGNGT  493

Query  1681  LHDMLHFADE-------RSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  1839
             LHDMLHF+D+       ++  L WN R R+ALGTARALEYLHEVCLP VVHR FKS+NIL
Sbjct  494   LHDMLHFSDDDGMTMPGKTTRLAWNTRARIALGTARALEYLHEVCLPPVVHRAFKSSNIL  553

Query  1840  LDEELNPHLSDCGLAALTPN--TERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             LD+E +P LSDCGLAAL+PN  TER+ +   VVGSFGYSAPEFA+SG YT KSDVYSFGV
Sbjct  554   LDDEYSPRLSDCGLAALSPNPETERE-AFAGVVGSFGYSAPEFAMSGTYTAKSDVYSFGV  612

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDID L+KMVDPAL+G+YPAKSLSRFADI
Sbjct  613   VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDLLAKMVDPALDGLYPAKSLSRFADI  672

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAA  2349
             IA+CVQ EPEFRPPMSEVVQ LVRL+QRAS+V R+  D+ G++Y+ P+ D  
Sbjct  673   IAICVQSEPEFRPPMSEVVQQLVRLMQRASIVRRQSDDQLGYSYRVPERDGG  724



>gb|AFW87368.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=734

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/709 (57%), Positives = 504/709 (71%), Gaps = 40/709 (6%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGT  474
             TD  D+ AL  LY S NSP++L+GW ASGGDPCG +W GV+C GSAV SI++ G+ LNGT
Sbjct  26    TDAGDVAALGNLYSSWNSPARLAGWSASGGDPCGAAWTGVSCSGSAVTSIKLSGMELNGT  85

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             +GY L+   +LK +DLS+N +HD IPYQLP NLT LNLA NN +G++PYSIS + SL YL
Sbjct  86    LGYQLSSLQALKTMDLSNNYLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEYL  145

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S NSL Q IG++F + S L+ LD+SFNN +G+LP S+G LS LS L +QNNQL+G+++
Sbjct  146   NLSHNSLFQEIGELFGSLSSLSELDISFNNLTGNLPFSMGSLSKLSSLYMQNNQLSGTVD  205

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN---Spapppppftppppgrp  1005
             V+ ++ L  L++A+N FSG IP E  SIP    +GNSF N   SP     P   P     
Sbjct  206   VISNISLATLDIASNNFSGMIPQEFSSIPNLIVAGNSFVNMPASPPQALTPPPNPRGRPD  265

Query  1006  HKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivY  1185
              +R   S P   +TP   D+              ++ G +VGI +GS A     +  +V 
Sbjct  266   DRRGPTSAPTVPETPIDPDDKK------------MQTGPLVGIAVGSIAAASCVLFALVL  313

Query  1186  CLRRCKKK----EFAARTSTGS--LPLSTDKEVLDQRAKSTATV---VDLKPPPSEKVTI  1338
             CL   +KK       A+   GS  +  ++ +EV+D    + A     + L  P  +    
Sbjct  314   CLHNARKKPDDGSSEAKGIAGSHLVVTTSSREVMDSSHDNAAVATSDLQLIQPAGKMTPD  373

Query  1339  ERMQGKNGSLRRSP------ITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNG  1500
             +R  G NG   + P       T + YTVA LQ ATNSF Q++L+GEGSLGRVY+A FPNG
Sbjct  374   DRAHGPNGCTAKRPKQQVTVTTVSSYTVAALQVATNSFCQDSLLGEGSLGRVYKAVFPNG  433

Query  1501  KVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGS  1680
             KVLA+KK+DSA+LSL EEDNFL  +SN+SRLRHPNIVPL GYC EHGQRLL Y+Y+GNG+
Sbjct  434   KVLAVKKIDSASLSLYEEDNFLAVVSNVSRLRHPNIVPLAGYCVEHGQRLLAYEYVGNGT  493

Query  1681  LHDMLHFADE-------RSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  1839
             LHDMLHF+D+       ++  L WN R R+ALGTARALEYLHEVCLP VVHR FKS+NIL
Sbjct  494   LHDMLHFSDDDGMTMPGKTTRLAWNTRARIALGTARALEYLHEVCLPPVVHRAFKSSNIL  553

Query  1840  LDEELNPHLSDCGLAALTPN--TERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             LD+E +P LSDCGLAAL+PN  TER+ +   VVGSFGYSAPEFA+SG YT KSDVYSFGV
Sbjct  554   LDDEYSPRLSDCGLAALSPNPETERE-AFAGVVGSFGYSAPEFAMSGTYTAKSDVYSFGV  612

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDID L+KMVDPAL+G+YPAKSLSRFADI
Sbjct  613   VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDLLAKMVDPALDGLYPAKSLSRFADI  672

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDH  2340
             IA+CVQ EPEFRPPMSEVVQ LVRL+QRAS+V R+  D+ G++Y+ P+ 
Sbjct  673   IAICVQSEPEFRPPMSEVVQQLVRLMQRASIVRRQSDDQLGYSYRVPER  721



>ref|XP_008659801.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Zea mays]
Length=724

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/703 (57%), Positives = 500/703 (71%), Gaps = 38/703 (5%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGT  474
             TD  D+ AL  LY S NSP++L+GW ASGGDPCG +W GV+C GSAV SI++ G+ LNGT
Sbjct  26    TDAGDVAALGNLYSSWNSPARLAGWSASGGDPCGAAWTGVSCSGSAVTSIKLSGMELNGT  85

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             +GY L+   +LK +DLS+N +HD IPYQLP NLT LNLA NN +G++PYSIS + SL YL
Sbjct  86    LGYQLSSLQALKTMDLSNNYLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEYL  145

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S NSL Q IG++F + S L+ LD+SFNN +G+LP S+G LS LS L +QNNQL+G+++
Sbjct  146   NLSHNSLFQEIGELFGSLSSLSELDISFNNLTGNLPFSMGSLSKLSSLYMQNNQLSGTVD  205

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN---Spapppppftppppgrp  1005
             V+ ++ L  L++A+N FSG IP E  SIP    +GNSF N   SP     P   P     
Sbjct  206   VISNISLATLDIASNNFSGMIPQEFSSIPNLIVAGNSFVNMPASPPQALTPPPNPRGRPD  265

Query  1006  HKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivY  1185
              +R   S P   +TP   D+              ++ G +VGI +GS A     +  +V 
Sbjct  266   DRRGPTSAPTVPETPIDPDDKK------------MQTGPLVGIAVGSIAAASCVLFALVL  313

Query  1186  CLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATV---VDLKPPPSEKVTIERMQGK  1356
             CL   +KK     +   +    + +EV+D    + A     + L  P  +    +R  G 
Sbjct  314   CLHNARKKPDDGSSEAKA----SSREVMDSSHDNAAVATSDLQLIQPAGKMTPDDRAHGP  369

Query  1357  NGSLRRSP------ITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIK  1518
             NG   + P       T + YTVA LQ ATNSF Q++L+GEGSLGRVY+A FPNGKVLA+K
Sbjct  370   NGCTAKRPKQQVTVTTVSSYTVAALQVATNSFCQDSLLGEGSLGRVYKAVFPNGKVLAVK  429

Query  1519  KVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLH  1698
             K+DSA+LSL EEDNFL  +SN+SRLRHPNIVPL GYC EHGQRLL Y+Y+GNG+LHDMLH
Sbjct  430   KIDSASLSLYEEDNFLAVVSNVSRLRHPNIVPLAGYCVEHGQRLLAYEYVGNGTLHDMLH  489

Query  1699  FADE-------RSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELN  1857
             F+D+       ++  L WN R R+ALGTARALEYLHEVCLP VVHR FKS+NILLD+E +
Sbjct  490   FSDDDGMTMPGKTTRLAWNTRARIALGTARALEYLHEVCLPPVVHRAFKSSNILLDDEYS  549

Query  1858  PHLSDCGLAALTPN--TERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELL  2031
             P LSDCGLAAL+PN  TER+ +   VVGSFGYSAPEFA+SG YT KSDVYSFGVVMLELL
Sbjct  550   PRLSDCGLAALSPNPETERE-AFAGVVGSFGYSAPEFAMSGTYTAKSDVYSFGVVMLELL  608

Query  2032  TGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQ  2211
             TGRKPLDSSRERSEQSLVRWATPQLHDID L+KMVDPAL+G+YPAKSLSRFADIIA+CVQ
Sbjct  609   TGRKPLDSSRERSEQSLVRWATPQLHDIDLLAKMVDPALDGLYPAKSLSRFADIIAICVQ  668

Query  2212  PEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDH  2340
              EPEFRPPMSEVVQ LVRL+QRAS+V R+  D+ G++Y+ P+ 
Sbjct  669   SEPEFRPPMSEVVQQLVRLMQRASIVRRQSDDQLGYSYRVPER  711



>gb|EEE66066.1| hypothetical protein OsJ_22073 [Oryza sativa Japonica Group]
Length=690

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/703 (59%), Positives = 509/703 (72%), Gaps = 51/703 (7%)
 Frame = +1

Query  295   TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGT  474
             TD  D  AL  LY S NSP+QL+GW A GGDPCG +W GV+C GSAV SI++ G+GLNGT
Sbjct  22    TDGGDAAALGNLYSSWNSPAQLTGWSAGGGDPCGAAWMGVSCVGSAVTSIKLSGMGLNGT  81

Query  475   MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
             +GY L+   +LK                      ++NLA NN +G++PYSIS M SLNYL
Sbjct  82    LGYQLSNLLALK----------------------TMNLAGNNFSGNLPYSISNMVSLNYL  119

Query  655   NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
             N S N L Q IG+MF N + L+ LD+SFNN +G+LP SL  LSN+S + +QNNQL+G++N
Sbjct  120   NLSHNLLFQEIGEMFGNLTALSELDVSFNNLNGNLPISLRSLSNISGIYLQNNQLSGTVN  179

Query  835   VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKR  1014
             VL +L LT LN+ANN FSG IP E  SI      GNSF N P+ PP   T PP G+P   
Sbjct  180   VLSNLSLTTLNIANNNFSGSIPQEFSSISHLILGGNSFLNVPSSPPSTITSPPQGQPDFP  239

Query  1015  TNHST-PGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCL  1191
                +T P   + P   D  SD +         ++ G ++GIV+GS A     +  +V CL
Sbjct  240   QGPTTAPNIPEIP--IDQGSDKKQR-------LRTGLVIGIVIGSMAAACGVLFALVLCL  290

Query  1192  RRCKKKEFA--------ARTSTGSLPLSTDKEVLD---QRAKSTATVVDLKPPPSEKVTI  1338
                +K +          A T   ++  ++++E+ D   Q A  +++V+    PP  K+T 
Sbjct  291   HNVRKSKDGGISESKDVASTFAVNIDRASNREIWDHTQQDAPVSSSVL----PPMGKMTP  346

Query  1339  ERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVL  1509
             ER+   N S+ +     +TA PYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKVL
Sbjct  347   ERVYSTNSSMSKKMKVSVTANPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVL  406

Query  1510  AIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHD  1689
             A+KK+DSA+LSL EEDNFLE +S++SRLRHPNIVPL GYC EHGQRLLVY++IGNG+LHD
Sbjct  407   AVKKIDSASLSLYEEDNFLEVVSSISRLRHPNIVPLAGYCVEHGQRLLVYEHIGNGTLHD  466

Query  1690  MLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLS  1869
             +LHF D+ S++LTWN R+R+ALGTARALEYLHEVCLP VVHRN KSANILLD+E +PHLS
Sbjct  467   ILHFFDDTSKILTWNHRMRIALGTARALEYLHEVCLPPVVHRNLKSANILLDKEYSPHLS  526

Query  1870  DCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPL  2049
             DCGLAALTPN ER++ ST V GSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLT RKPL
Sbjct  527   DCGLAALTPNPEREV-STEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTARKPL  585

Query  2050  DSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFR  2229
             DSSRERSEQSLV WATPQLHDIDAL+KMVDPA++GMYPAKSLSRFADIIALCVQPEPEFR
Sbjct  586   DSSRERSEQSLVTWATPQLHDIDALAKMVDPAMDGMYPAKSLSRFADIIALCVQPEPEFR  645

Query  2230  PPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             PPMSEVVQ LVRLVQRAS+V R+  ++ G +Y+ PD +  + D
Sbjct  646   PPMSEVVQQLVRLVQRASMVRRQSGEDVGLSYRGPDREGGTAD  688



>gb|EMS51823.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Triticum urartu]
Length=630

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/625 (66%), Positives = 495/625 (79%), Gaps = 25/625 (4%)
 Frame = +1

Query  514   LDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGD  693
             +DLS+N+I   IPYQLPPNLT LNLA NN +G++PYSIS M ++ YLN S NSLAQ IGD
Sbjct  18    MDLSNNQIQGSIPYQLPPNLTYLNLATNNFSGNLPYSISNMAAIEYLNLSHNSLAQQIGD  77

Query  694   MFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVA  873
             +F N S L+ LD+SFN  +GDLP S+G LSN+S L +QNNQLTGS+NVL  L LT LN+A
Sbjct  78    LFGNLSSLSELDVSFNKLTGDLPTSIGSLSNISSLYMQNNQLTGSVNVLSGLGLTTLNIA  137

Query  874   NNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPG  1053
             NN FSGWIP E  SIP    +GNSF N PAPPPPPF PPPP +P  R N S  GS   P 
Sbjct  138   NNNFSGWIPKEFSSIPDVILNGNSFLNGPAPPPPPFMPPPPRKPRSRPNRSG-GSGNAPK  196

Query  1054  SDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAARTST  1233
               ++ +        GKNG++  ++VGI++GS    L  ++++V C+R+ +K++  + T +
Sbjct  197   GSESSTGQ-----GGKNGLQTASLVGIIVGSVLAALCVLLLLVLCIRKSRKRKDDSSTES  251

Query  1234  GSL--PLS------TDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRRS--PI  1383
                  PLS      +++E+ +Q  ++TA    +K  P+EK+T ER+ GK GS+R++  PI
Sbjct  252   KDFVGPLSVNIEEVSNREIPEQGLENTA----MKVLPAEKMTPERVYGKTGSMRKTKVPI  307

Query  1384  TATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNF  1563
             TATPYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKV+A+KKVDSAA+SLQEED+F
Sbjct  308   TATPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVMAVKKVDSAAISLQEEDDF  367

Query  1564  LEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARV  1743
             LE +S+MSRLRHPNIVPL GYC EH QRLLVY+YIGN +LHDMLHF+DE S+ LTWN RV
Sbjct  368   LEVVSSMSRLRHPNIVPLTGYCVEHAQRLLVYEYIGNATLHDMLHFSDEMSRRLTWNIRV  427

Query  1744  RVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISST  1923
             R+ALGTARALEYLHEVCLPSVVHRNFKSANILLDEE N HLSDCGLAALTPNTERQ S T
Sbjct  428   RIALGTARALEYLHEVCLPSVVHRNFKSANILLDEEHNAHLSDCGLAALTPNTERQASIT  487

Query  1924  HVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQ  2103
             +       +APEF++SG+YTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQ
Sbjct  488   NT-----SNAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQ  542

Query  2104  LHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRAS  2283
             LHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ LVRL+QRAS
Sbjct  543   LHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQLVRLMQRAS  602

Query  2284  VVIRRYSDESGFAYKTPDHDAASGD  2358
             +V R+  +E GF+Y+ P+ +  + D
Sbjct  603   IVRRQSGEELGFSYRAPEREGDARD  627



>ref|NP_001119030.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
 gb|AEE84561.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
Length=562

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/575 (69%), Positives = 453/575 (79%), Gaps = 24/575 (4%)
 Frame = +1

Query  634   MTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNN  813
             M SL+Y+N SGNSL   IGD+F +   L TLDLS NNFSGDLP+SL  +S LS+L VQNN
Sbjct  1     MGSLSYMNVSGNSLTMSIGDIFADHKSLATLDLSHNNFSGDLPSSLSTVSTLSVLYVQNN  60

Query  814   QLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppp  993
             QLTGS++VL  LPL  LNVANN F+G IP EL SI    Y GNSF N           P 
Sbjct  61    QLTGSIDVLSGLPLKTLNVANNHFNGSIPKELSSIQTLIYDGNSFDN----------VPA  110

Query  994   pgrpHKRTNHSTPGSHKTP--GSDDNHSDHEngngngkngVKAGAivgivlgssavvlsa  1167
               +P +     TP   K P  GS++  SD          G+  G + GIV GS  V    
Sbjct  111   SPQPERPGKKETPSGSKKPKIGSEEKSSD-------SGKGLSGGVVTGIVFGSLFVAGII  163

Query  1168  ivvivYCLRRCKKK-EFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIER  1344
              +V+  CL + K+K   + R S  SLPLS   EV +QR KS A+V DLK  P+EKVT++R
Sbjct  164   ALVLYLCLHKKKRKVRGSTRASQRSLPLSGTPEVQEQRVKSVASVADLKSSPAEKVTVDR  223

Query  1345  MQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIK  1518
             +  KNGS+ R  SPITA+ YTV+ LQ ATNSFSQEN++GEGSLGRVYRA+FPNGK++AIK
Sbjct  224   VM-KNGSISRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEFPNGKIMAIK  282

Query  1519  KVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLH  1698
             K+D+AALSLQEEDNFLEA+SNMSRLRHPNIVPL GYC EHGQRLLVY+Y+GNG+L D LH
Sbjct  283   KIDNAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLH  342

Query  1699  FADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCG  1878
               D+RS  LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSANILLDEELNPHLSD G
Sbjct  343   TNDDRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSG  402

Query  1879  LAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSS  2058
             LAALTPNTERQ+ ST VVGSFGYSAPEFALSG+YTVKSDVY+FGVVMLELLTGRKPLDSS
Sbjct  403   LAALTPNTERQV-STQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSS  461

Query  2059  RERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPM  2238
             R R+EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADIIALC+QPEPEFRPPM
Sbjct  462   RTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPM  521

Query  2239  SEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             SEVVQ LVRLVQRASVV RR SD++GF+Y+TP+H+
Sbjct  522   SEVVQQLVRLVQRASVVKRRSSDDTGFSYRTPEHE  556



>ref|XP_008649054.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X4 [Zea mays]
Length=719

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/715 (58%), Positives = 510/715 (71%), Gaps = 46/715 (6%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TD  D+ AL  LY S NSP+QL+GW ASGGDPCG +W GV+C GSAV SI++ G+ LN
Sbjct  24    ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             GT+GY L+   +LK +DLS+N +HD IPYQLP NLT LNLA NN +G++PYSIS + SL 
Sbjct  84    GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YLN S NSL Q IG++F + + L+ LD+SFNN +G+LP S+G LS LS L +QNNQL+G+
Sbjct  144   YLNLSHNSLFQEIGELFGSLNSLSELDVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  203

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             ++VL ++ L  LN+A+N FSG IP E  SIP     GNSF N    P  P +   P    
Sbjct  204   VDVLSNISLATLNIADNNFSGMIPQEFSSIPNLIVGGNSFVN---MPASPPSTLKPPLEE  260

Query  1009  KRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYC  1188
              +   S P S  TP   D+              ++ G ++GI +GS A     + V+V+C
Sbjct  261   PQGPVSAPTSPDTPIDQDDRK------------IQTGPLIGIAVGSIAAASCVLFVLVFC  308

Query  1189  L---RRCKKKEFAA-RTSTGSLPLSTD----KEVLDQRAKSTATVV-DLKPPPSEKVTIE  1341
             L   RR    E +  +   GSL +S +    +EVL+   +++A    DL+      +T +
Sbjct  309   LHNARRRNDDEISEPKDLVGSLAVSIETASSREVLNNNHENSAVATSDLQHAGKMMMTPD  368

Query  1342  RM--QGKNGSLR----RSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGK  1503
             R+     NGS      + P+T T YTVA LQ ATNSF +++L+GEGSLGRVY+A FPNGK
Sbjct  369   RVLHDTTNGSSTAKRPKVPVTVTSYTVADLQVATNSFCEDSLLGEGSLGRVYKAGFPNGK  428

Query  1504  VLAIKKVD-SAALSLQE--EDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGN  1674
             VLA+KKVD SA LSL    ED FLE +SN+SRLRHPNIVPL GYC EHGQRLLVY+Y+GN
Sbjct  429   VLAVKKVDDSALLSLYGGGEDAFLELVSNVSRLRHPNIVPLTGYCVEHGQRLLVYEYVGN  488

Query  1675  GSLHDMLH--FADER--SQLLTWNARVRVALGTARALEYLHEVCLPSVVH-RNFKSANIL  1839
             G+L D+L    +D+   S+ LTWN RVR+ALGTARALEYLHEVC+P VVH R FK++NIL
Sbjct  489   GTLRDVLQHCLSDDEGASKKLTWNTRVRIALGTARALEYLHEVCIPPVVHSRTFKASNIL  548

Query  1840  LDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVM  2019
             LDEE +PHLSDCGLAALT      + S   VGSFGYSAPE A+SG YT KSDVYSFGVVM
Sbjct  549   LDEEYSPHLSDCGLAALT-----TVVSPEAVGSFGYSAPELAMSGTYTAKSDVYSFGVVM  603

Query  2020  LELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIA  2199
             LELLTGRKPLDSSRERSEQSLVRWA PQLHDID L++MVDPAL+G+YP+KSLSRFADIIA
Sbjct  604   LELLTGRKPLDSSRERSEQSLVRWAAPQLHDIDLLARMVDPALDGLYPSKSLSRFADIIA  663

Query  2200  LCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD--AASGD  2358
             +CVQPEPEFRPPMSEVVQ LVRL+QRA+ +IRR SD+ G++Y+ PD D  AA+GD
Sbjct  664   ICVQPEPEFRPPMSEVVQQLVRLMQRAA-IIRRQSDDLGYSYRVPDRDGGAAAGD  717



>ref|XP_008649053.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X3 [Zea mays]
Length=720

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/716 (58%), Positives = 510/716 (71%), Gaps = 47/716 (7%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TD  D+ AL  LY S NSP+QL+GW ASGGDPCG +W GV+C GSAV SI++ G+ LN
Sbjct  24    ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             GT+GY L+   +LK +DLS+N +HD IPYQLP NLT LNLA NN +G++PYSIS + SL 
Sbjct  84    GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YLN S NSL Q IG++F + + L+ LD+SFNN +G+LP S+G LS LS L +QNNQL+G+
Sbjct  144   YLNLSHNSLFQEIGELFGSLNSLSELDVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  203

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             ++VL ++ L  LN+A+N FSG IP E  SIP     GNSF N    P  P +   P    
Sbjct  204   VDVLSNISLATLNIADNNFSGMIPQEFSSIPNLIVGGNSFVN---MPASPPSTLKPPLEE  260

Query  1009  KRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYC  1188
              +   S P S  TP   D+              ++ G ++GI +GS A     + V+V+C
Sbjct  261   PQGPVSAPTSPDTPIDQDDRK------------IQTGPLIGIAVGSIAAASCVLFVLVFC  308

Query  1189  L---RRCKKKEFAA-RTSTGSLPLSTD-----KEVLDQRAKSTATVV-DLKPPPSEKVTI  1338
             L   RR    E +  +   GSL +S +     +EVL+   +++A    DL+      +T 
Sbjct  309   LHNARRRNDDEISEPKDLVGSLAVSIETAASSREVLNNNHENSAVATSDLQHAGKMMMTP  368

Query  1339  ERM--QGKNGSLR----RSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNG  1500
             +R+     NGS      + P+T T YTVA LQ ATNSF +++L+GEGSLGRVY+A FPNG
Sbjct  369   DRVLHDTTNGSSTAKRPKVPVTVTSYTVADLQVATNSFCEDSLLGEGSLGRVYKAGFPNG  428

Query  1501  KVLAIKKVD-SAALSLQE--EDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIG  1671
             KVLA+KKVD SA LSL    ED FLE +SN+SRLRHPNIVPL GYC EHGQRLLVY+Y+G
Sbjct  429   KVLAVKKVDDSALLSLYGGGEDAFLELVSNVSRLRHPNIVPLTGYCVEHGQRLLVYEYVG  488

Query  1672  NGSLHDMLH--FADER--SQLLTWNARVRVALGTARALEYLHEVCLPSVVH-RNFKSANI  1836
             NG+L D+L    +D+   S+ LTWN RVR+ALGTARALEYLHEVC+P VVH R FK++NI
Sbjct  489   NGTLRDVLQHCLSDDEGASKKLTWNTRVRIALGTARALEYLHEVCIPPVVHSRTFKASNI  548

Query  1837  LLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVV  2016
             LLDEE +PHLSDCGLAALT      + S   VGSFGYSAPE A+SG YT KSDVYSFGVV
Sbjct  549   LLDEEYSPHLSDCGLAALT-----TVVSPEAVGSFGYSAPELAMSGTYTAKSDVYSFGVV  603

Query  2017  MLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADII  2196
             MLELLTGRKPLDSSRERSEQSLVRWA PQLHDID L++MVDPAL+G+YP+KSLSRFADII
Sbjct  604   MLELLTGRKPLDSSRERSEQSLVRWAAPQLHDIDLLARMVDPALDGLYPSKSLSRFADII  663

Query  2197  ALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD--AASGD  2358
             A+CVQPEPEFRPPMSEVVQ LVRL+QRA+ +IRR SD+ G++Y+ PD D  AA+GD
Sbjct  664   AICVQPEPEFRPPMSEVVQQLVRLMQRAA-IIRRQSDDLGYSYRVPDRDGGAAAGD  718



>ref|XP_006657163.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Oryza brachyantha]
Length=638

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/646 (62%), Positives = 489/646 (76%), Gaps = 23/646 (4%)
 Frame = +1

Query  457   LGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLM  636
             +GLNG +GY L+   +LK LDLS+N +HD IPYQLPPNL  LNLA+NN +G++P+SI+ M
Sbjct  1     MGLNGNLGYQLSNLLALKTLDLSNNNLHDSIPYQLPPNLAYLNLASNNFSGNLPFSIANM  60

Query  637   TSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQ  816
              SLNYLN S N L Q +G+MF N S L+ LD+SFN+ +G+LP SL  LSN+S + +QNNQ
Sbjct  61    VSLNYLNLSHNLLFQEMGEMFGNLSSLSELDVSFNSLTGNLPISLSSLSNISSIYMQNNQ  120

Query  817   LTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftpppp  996
             L+GS+NVL +L LT LN+ANN FSG IP +L SIP     GNSF N P+ PP   TP P 
Sbjct  121   LSGSVNVLGNLSLTTLNIANNNFSGSIPQQLSSIPNLILGGNSFLNVPSSPPSIITPTPQ  180

Query  997   grpHKRTNHST-PGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaiv  1173
             G+P      +T P   + P   D  SD +         ++ G ++GIV+GS A     + 
Sbjct  181   GQPDFPQGPTTAPNIPEIP--IDQGSDKKQR-------LQTGLLIGIVVGSMAAACVVLF  231

Query  1174  vivYCLRRCKKKEFA----ARTSTGSLPLSTDK----EVLDQRAKSTATVVDLKPPPSEK  1329
              +V CL   +K +      ++  +GS  ++ D+    E+ D   +  A V     PP+ K
Sbjct  232   SLVVCLHNFRKSKDGGISESKDISGSFAVNIDRASNREIWDH-TRQDAPVASSVLPPTGK  290

Query  1330  VTIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNG  1500
             +T ER+ G NGS+ +    P+TA PYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNG
Sbjct  291   MTPERVHGTNGSIAKKIKVPVTANPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNG  350

Query  1501  KVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGS  1680
             KVLA+KK+DSA+LSL EEDNFLE +S++SRLRHPNIVPL GYC EHGQRLLVY++IGNG+
Sbjct  351   KVLAVKKIDSASLSLYEEDNFLEVVSSISRLRHPNIVPLTGYCVEHGQRLLVYEHIGNGT  410

Query  1681  LHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNP  1860
             LHD+LHF+DE S+ LTWN R+R+ALGTARALEYLHEVCLP VVHRN KSANILLD+E +P
Sbjct  411   LHDILHFSDEMSKNLTWNTRMRIALGTARALEYLHEVCLPPVVHRNLKSANILLDKEYSP  470

Query  1861  HLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGR  2040
             HLSDCGLAALTPN ER++ ST V GSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLT R
Sbjct  471   HLSDCGLAALTPNPEREV-STEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTAR  529

Query  2041  KPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEP  2220
             KPLDSSRE+SEQSLV WATPQLHDIDAL+KMVDPA++GMYPAKSLSRFADIIALCVQPEP
Sbjct  530   KPLDSSREKSEQSLVTWATPQLHDIDALAKMVDPAMDGMYPAKSLSRFADIIALCVQPEP  589

Query  2221  EFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             EFRPPMSEVVQ LVRLVQRA +V R+  ++ G +Y+ PD +  + D
Sbjct  590   EFRPPMSEVVQQLVRLVQRAGMVRRQSGEDVGLSYRGPDREGGTAD  635



>gb|EMT22844.1| hypothetical protein F775_52608 [Aegilops tauschii]
Length=606

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/609 (66%), Positives = 478/609 (78%), Gaps = 25/609 (4%)
 Frame = +1

Query  562   PPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFN  741
             PP     NLA NN +G++PYSIS M S+ YLN S NSLAQ IGD+F N S L+ LD+SFN
Sbjct  10    PPPSPRRNLATNNFSGNLPYSISNMASIEYLNLSHNSLAQQIGDLFGNLSSLSELDVSFN  69

Query  742   NFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIP  921
               +GDLP S+G LSN+S L +QNNQLTGS+NVL  L LT LN+ANN FSGWIP E  SIP
Sbjct  70    KLTGDLPTSIGSLSNISSLYMQNNQLTGSVNVLSGLGLTTLNIANNNFSGWIPKEFSSIP  129

Query  922   KFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngk  1101
                 +GNSF N PAPPPPPF PPPP RP  R N S    +   GS+ + S        GK
Sbjct  130   DVILNGNSFLNGPAPPPPPFMPPPPRRPRSRPNRSGGSGNAPKGSESSTSQ------GGK  183

Query  1102  ngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSL--PLS------TD  1257
             NG++  ++VGI++GS    L  ++++V C+R+ +K++  + T +     PLS      ++
Sbjct  184   NGLQTASLVGIIVGSILAALCVLLLLVLCIRKSRKRKDDSSTESKDFVGPLSVNIEEVSN  243

Query  1258  KEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRRS--PITATPYTVAVLQTATNS  1431
             +E+ +Q  ++TA    +K  P+EK+T ER+ GK GS+R++  PITATPYTVA LQ ATNS
Sbjct  244   REIPEQGLENTA----MKVLPAEKMTPERVYGKTGSMRKTKVPITATPYTVASLQVATNS  299

Query  1432  FSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIV  1611
             F Q++L+GEGSLGRVY+ADFPNGK++A+KKVDSAA+SLQEED+FLE +S+MSRLRHPNIV
Sbjct  300   FCQDSLLGEGSLGRVYKADFPNGKIMAVKKVDSAAISLQEEDDFLEVVSSMSRLRHPNIV  359

Query  1612  PLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEV  1791
             PL GYC EH QRLLVY+YIGN +LHDMLHF+DE S+ LTWN RVR+ALGTARALEYLHEV
Sbjct  360   PLTGYCVEHAQRLLVYEYIGNATLHDMLHFSDEMSRRLTWNIRVRIALGTARALEYLHEV  419

Query  1792  CLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALS  1971
             CLPSVVHRNFKSANILLDEE N HLSDCGLAALTPNTERQ S T+       +APEF++S
Sbjct  420   CLPSVVHRNFKSANILLDEEHNAHLSDCGLAALTPNTERQASITNT-----SNAPEFSMS  474

Query  1972  GVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALN  2151
             G+YTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALN
Sbjct  475   GIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALN  534

Query  2152  GMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKT  2331
             GMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ LVRL+QRAS+V R+  +E GF+Y+ 
Sbjct  535   GMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEELGFSYRA  594

Query  2332  PDHDAASGD  2358
             P+ +  + D
Sbjct  595   PEREGDTRD  603



>emb|CAN77920.1| hypothetical protein VITISV_027646 [Vitis vinifera]
Length=850

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/675 (61%), Positives = 471/675 (70%), Gaps = 108/675 (16%)
 Frame = +1

Query  283   VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLG  462
             V  ATDP+D+Q L+V+Y SLN PSQL+GW  S GDPCGESWKGVTC+GSAVVSI+I GLG
Sbjct  37    VYGATDPSDVQGLQVIYNSLNGPSQLTGWTNSSGDPCGESWKGVTCEGSAVVSIQISGLG  96

Query  463   LNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTS  642
             LNGTMGY+L+ F SL+     + E+  L+P                             +
Sbjct  97    LNGTMGYLLSNFLSLRTF--YNXEV--LLPDA--------------------------KT  126

Query  643   LNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLT  822
             L + N S NS++Q IGD+F   + LT LDLS NNF+GDLP S   LSNLS L +QNNQLT
Sbjct  127   LGFRNVSHNSISQSIGDIFAKLAGLTILDLSVNNFTGDLPNSFTSLSNLSTLYLQNNQLT  186

Query  823   GSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgr  1002
             G L+VL  LPLTDL                      Y GNSF N PAPPPPP+TPPPP R
Sbjct  187   GPLSVLTGLPLTDL----------------------YDGNSFDNGPAPPPPPYTPPPPSR  224

Query  1003  pHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivviv  1182
                   HS P + +TP S D  S + +    G     A   +  ++  S +VL A++ +V
Sbjct  225   SRSNRTHSPPEA-RTPSSSDGQSSNSDNGNKGL----AIGPIIGIVLGSLLVLVALIALV  279

Query  1183  YCLRRCKKKEFAARTSTGSLPLSTDK----EVLDQRAKSTATVVDLKPPPSEKVTIERMQ  1350
             +C+R+ KKK   AR S GS+P+ T+K     + +QR K TATV DLKPPP+E + +ER+Q
Sbjct  280   FCVRKAKKKGTGARPSVGSVPVVTEKVNTETMQEQRTKFTATVTDLKPPPAENLMVERVQ  339

Query  1351  GKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKV  1524
             GKNGS +R  SPITAT YTVA LQTATNSFSQE L+GEGSLGRVYRADFPNGK       
Sbjct  340   GKNGSGKRVKSPITATSYTVASLQTATNSFSQEFLIGEGSLGRVYRADFPNGK-------  392

Query  1525  DSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFA  1704
                                                  HGQRLLVY+YIGNGSLHDMLHF 
Sbjct  393   -------------------------------------HGQRLLVYEYIGNGSLHDMLHFT  415

Query  1705  DERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLA  1884
             D+  + LTWNARVRVALGTARALEYLHEVCLPS VHRNFKSANILLDEELNPHLSDCGLA
Sbjct  416   DDSGKTLTWNARVRVALGTARALEYLHEVCLPSTVHRNFKSANILLDEELNPHLSDCGLA  475

Query  1885  ALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRE  2064
             ALTPNTERQ+S T +VGSFGYSAPEFALSG+YTVKSDVYSFGVVMLELLTGRKPLDSSR 
Sbjct  476   ALTPNTERQVS-TQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRV  534

Query  2065  RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSE  2244
             RSEQSLVRWATPQLHDIDAL+KMVDP+LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSE
Sbjct  535   RSEQSLVRWATPQLHDIDALAKMVDPSLNGMYPAKSLSRFADIIALCVQPEPEFRPPMSE  594

Query  2245  VVQALVRLVQRASVV  2289
             VVQALVRLVQRASVV
Sbjct  595   VVQALVRLVQRASVV  609



>ref|XP_009383597.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=720

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/705 (54%), Positives = 482/705 (68%), Gaps = 38/705 (5%)
 Frame = +1

Query  244   VLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQ  423
             VL    L+   G VG ATD ND+  L VL+ SLNSPSQL+GW A+GGDPCG+SW GVTC 
Sbjct  14    VLFACILVGNPGGVGGATDQNDVSTLNVLFTSLNSPSQLTGWIANGGDPCGQSWLGVTCT  73

Query  424   GSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHD--LIPYQLPPNLTSLNLANN  597
             GSA+ +I++ GLGL+GT+GY L   TSL ELD+S+N I     +PY LPPNL SLNL  N
Sbjct  74    GSAITTIKLSGLGLSGTLGYNLQTMTSLAELDMSNNNIGSGGQLPYNLPPNLQSLNLGGN  133

Query  598   NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
               +G+IPYSISLM +L YLN + N L   + +MF   ++LTT+DLSFN  +GDLP S   
Sbjct  134   QFSGNIPYSISLMVTLKYLNLAHNQLQGNLTEMFGGLTNLTTMDLSFNQLTGDLPQSFSN  193

Query  778   LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNS  957
             LS+L+ L ++NNQ TG +++L +LPL DLNVANNRF+GWIP++L  I      G    NS
Sbjct  194   LSSLTTLYLENNQFTGHIDILANLPLQDLNVANNRFTGWIPDQLKKINNLRTDG----NS  249

Query  958   papppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgiv  1137
              +  P P  PP    P  R   S PG H       N S     N     GV AG ++ ++
Sbjct  250   WSSTPAPPPPPYRPPPPGR--KSNPGQHSG---GSNKSSGGGNNSGIGAGVIAGIVISVL  304

Query  1138  lgssavvlsaivvivYCLRRCKKKE-----FAARTSTGSLPLSTDKEVLDQRAKSTATV-  1299
             +    +         + +RR  +K      F        L  +  KE+   +A ST+   
Sbjct  305   VVGGILAF-------FLMRRKSQKHSKEEIFEKDPPFAPLASNDAKEMKTIQASSTSHTA  357

Query  1300  -------VDLKPPPSEK-VTIERMQGKNGSLRR----SPITATPYTVAVLQTATNSFSQE  1443
                    + LKPPP E+  + +     N  + +    +PI A  Y+VA LQ AT+SFS +
Sbjct  358   ILPPPAPISLKPPPIERHKSFDEDDFSNKPIVKKANTTPIKAAVYSVADLQIATDSFSID  417

Query  1444  NLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVG  1623
             NLVGEGS GRVY+A F +GK++A+KK++S+AL  Q  D F+E +SN+SRL HPN+  LVG
Sbjct  418   NLVGEGSFGRVYKAQFSDGKIMAVKKINSSALPNQLPDCFIELVSNISRLHHPNLCELVG  477

Query  1624  YCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPS  1803
             YC+EHGQ LLVY++  NGSLHD+LH +DE S+ L+WNARV++ALGTARALEYLHEVC PS
Sbjct  478   YCSEHGQHLLVYEFYKNGSLHDLLHLSDEYSKSLSWNARVKIALGTARALEYLHEVCSPS  537

Query  1804  VVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYT  1983
             +VH+NFKS+NILLD ELNPHLSDCG  +L P+ E Q S  ++    GYS PE A+SG YT
Sbjct  538   LVHKNFKSSNILLDMELNPHLSDCGFESLVPDAEFQASEQNMAS--GYSPPEVAMSGQYT  595

Query  1984  VKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYP  2163
             +KSDVY+FGVVMLELLTGRKP DSSR RSEQSLVRWATPQLHDIDAL +M+DP L G+YP
Sbjct  596   LKSDVYNFGVVMLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALDRMIDPDLKGLYP  655

Query  2164  AKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRR  2298
             AKSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  +R
Sbjct  656   AKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMSSKR  700



>gb|KDO78351.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
 gb|KDO78352.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=577

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/567 (67%), Positives = 449/567 (79%), Gaps = 17/567 (3%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L    VL+++  ++ L  V   TD +D+QAL+VLY SLNSPS L+ WK + GDPCGESWK
Sbjct  18    LIDAFVLILSIFLT-LSLVQCTTDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWK  76

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV C+GSAVVSI+I GLGL+GTMGY+L+   SL++ DLS N IHD IPYQLPPNLTSLNL
Sbjct  77    GVACEGSAVVSIDISGLGLSGTMGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNL  136

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A+NN +G++PYSI+ M SL+YLN S NSL Q IGD+F N + L TLDLSFNNFSGDLP S
Sbjct  137   ASNNFSGNLPYSIASMVSLSYLNVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNS  196

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                LSN+S L +QNNQ+TGSLNV   LPLT LNVANN FSGWIP ELISI  F Y GNSF
Sbjct  197   FISLSNISSLYLQNNQVTGSLNVFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSF  256

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N PAPPPPP T PP GR H   +H   GSH   GS  + SD E         + AGAIV
Sbjct  257   DNGPAPPPPPSTAPPSGRSHNNRSHRQ-GSHSPSGSQSSSSDKE---------LPAGAIV  306

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATV  1299
             GIVLG+  +V  A++ + +C+R+ ++K   AR+S GS P+ST+    E+ +QR KS A V
Sbjct  307   GIVLGAVFLVALALLALYFCIRKNRRKVSGARSSAGSFPVSTNNMNTEMHEQRVKSVAAV  366

Query  1300  VDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
              DL PPP+EK+ IER+  K+GSL++  SPITAT YTVA LQTATNSFSQE L+GEGSLGR
Sbjct  367   TDLTPPPAEKLVIERV-AKSGSLKKIKSPITATSYTVASLQTATNSFSQEFLIGEGSLGR  425

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VYRA+F NGK++A+KK+D+AALSLQEEDNFLEA+SNMSRLRHPNIV L GYCAEHGQRLL
Sbjct  426   VYRAEFANGKIMAVKKIDNAALSLQEEDNFLEAVSNMSRLRHPNIVTLAGYCAEHGQRLL  485

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
             VY+Y+GNG+LHDMLHFAD+ S+ LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN
Sbjct  486   VYEYVGNGNLHDMLHFADDSSKNLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  545

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQI  1914
             ILLD+ELNPHLSDCGLAALTPNTERQ+
Sbjct  546   ILLDDELNPHLSDCGLAALTPNTERQV  572



>ref|XP_004983096.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Setaria 
italica]
Length=719

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/726 (54%), Positives = 492/726 (68%), Gaps = 52/726 (7%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             V+L   A   R   V AATD ND+ AL  L+ S++SP QL GWKASGGDPC ESW+G+TC
Sbjct  12    VLLCFGAWTPRRILVSAATDANDVTALNTLFTSMSSPGQLQGWKASGGDPCSESWQGITC  71

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIH--DLIPYQLP-PNLTSLNLA  591
              GS+V +I++PGLGL+GT+ Y +N   SL ELDLS N +     IPY LP   L  LNLA
Sbjct  72    SGSSVTAIKLPGLGLSGTLAYNMNTMDSLVELDLSQNNLGGGQQIPYNLPNKKLERLNLA  131

Query  592   NNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASL  771
              N  +G++PYSIS M  L YLN + N L+  I D+F+N   LTT+DLS N+ +G+LP S 
Sbjct  132   GNQFSGAVPYSISTMPKLQYLNLNHNQLSGDITDIFSNLPSLTTVDLSSNSLTGNLPQSF  191

Query  772   GLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
               LS+L  L +QNNQLTGS+NVL +LPL DLNVANNRF+GWIPNEL  I   +  GNS+S
Sbjct  192   TSLSSLKTLYLQNNQLTGSINVLANLPLDDLNVANNRFTGWIPNELKKINSLQTDGNSWS  251

Query  952   NSpapppppftppppgrpHKRTNH-STPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
               P+PPPPPFT PP    H R+N   +PG H               N +   G       
Sbjct  252   TGPSPPPPPFTAPP----HSRSNRRKSPGQHSN-----------GSNNSSSGGSSGIGAG  296

Query  1129  givlgssavvlsaivvivYCLRRCKKK-----EFAARTSTGSLPLSTDKEVLDQRAKSTA  1293
              I     +V++   VV  + ++R ++K      +  R    S P +  KE+   +  +T 
Sbjct  297   AIAGIIISVLVIGAVVAFFLIKRKQRKGAMPEHYEQRQPFNSFPSNEVKEMKPIQEATTV  356

Query  1294  TV--------VDLKPPPSEKVTIERMQGKNGS-------LRRS---PITATPYTVAVLQT  1419
              V        V+LKPPP     IER Q  +          ++S   P+ AT Y+VA LQ 
Sbjct  357   EVESLPSPAAVNLKPPPK----IERNQSFDDDDIASKPVAKKSNAAPVKATVYSVADLQM  412

Query  1420  ATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRH  1599
             AT+SFS +NL+GEG+ GRVYRA F +GKVLA+KK++S AL  Q  D+F E +SN+S+L H
Sbjct  413   ATDSFSMDNLIGEGTFGRVYRAQFSDGKVLAVKKLNSTALPSQSSDDFYELVSNISKLHH  472

Query  1600  PNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEY  1779
             PN+  LVGYC EHGQ LLV+D+  NGSLHDM+H +DE ++ L+WN+RV++ALG+ARALEY
Sbjct  473   PNLSELVGYCMEHGQYLLVFDFHRNGSLHDMIHLSDEYNKPLSWNSRVKIALGSARALEY  532

Query  1780  LHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPE  1959
             LHE+C PS++H+NFKS+NILLD ELNPH+SD GL++  P+ E Q S     GS GY APE
Sbjct  533   LHEICSPSIIHKNFKSSNILLDTELNPHISDAGLSSFVPDAEFQASDQ---GS-GYGAPE  588

Query  1960  FALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVD  2139
               ++G YT+KSDVYSFGVVMLELLTGRKP DSSR RSEQSLVRWATPQLHDIDAL +MVD
Sbjct  589   VDMTGQYTLKSDVYSFGVVMLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALDRMVD  648

Query  2140  PALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGF  2319
             PAL G+YPAKSLSRFAD++ALCVQPEPEFRPPMSEVVQALVRLVQRA++  R    E   
Sbjct  649   PALKGLYPAKSLSRFADVVALCVQPEPEFRPPMSEVVQALVRLVQRANMTRRMLDGEE--  706

Query  2320  AYKTPD  2337
             A + PD
Sbjct  707   ASRRPD  712



>ref|XP_008659800.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Zea mays]
Length=675

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/652 (57%), Positives = 462/652 (71%), Gaps = 38/652 (6%)
 Frame = +1

Query  445   EIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYS  624
             ++ G+ LNGT+GY L+   +LK +DLS+N +HD IPYQLP NLT LNLA NN +G++PYS
Sbjct  27    KLSGMELNGTLGYQLSSLQALKTMDLSNNYLHDSIPYQLPSNLTYLNLAKNNFSGNLPYS  86

Query  625   ISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRV  804
             IS + SL YLN S NSL Q IG++F + S L+ LD+SFNN +G+LP S+G LS LS L +
Sbjct  87    ISNLVSLEYLNLSHNSLFQEIGELFGSLSSLSELDISFNNLTGNLPFSMGSLSKLSSLYM  146

Query  805   QNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN---Spapppp  975
             QNNQL+G+++V+ ++ L  L++A+N FSG IP E  SIP    +GNSF N   SP     
Sbjct  147   QNNQLSGTVDVISNISLATLDIASNNFSGMIPQEFSSIPNLIVAGNSFVNMPASPPQALT  206

Query  976   pftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssav  1155
             P   P      +R   S P   +TP   D+              ++ G +VGI +GS A 
Sbjct  207   PPPNPRGRPDDRRGPTSAPTVPETPIDPDDKK------------MQTGPLVGIAVGSIAA  254

Query  1156  vlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATV---VDLKPPPSE  1326
                 +  +V CL   +KK     +   +    + +EV+D    + A     + L  P  +
Sbjct  255   ASCVLFALVLCLHNARKKPDDGSSEAKA----SSREVMDSSHDNAAVATSDLQLIQPAGK  310

Query  1327  KVTIERMQGKNGSLRRSP------ITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRAD  1488
                 +R  G NG   + P       T + YTVA LQ ATNSF Q++L+GEGSLGRVY+A 
Sbjct  311   MTPDDRAHGPNGCTAKRPKQQVTVTTVSSYTVAALQVATNSFCQDSLLGEGSLGRVYKAV  370

Query  1489  FPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYI  1668
             FPNGKVLA+KK+DSA+LSL EEDNFL  +SN+SRLRHPNIVPL GYC EHGQRLL Y+Y+
Sbjct  371   FPNGKVLAVKKIDSASLSLYEEDNFLAVVSNVSRLRHPNIVPLAGYCVEHGQRLLAYEYV  430

Query  1669  GNGSLHDMLHFADE-------RSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKS  1827
             GNG+LHDMLHF+D+       ++  L WN R R+ALGTARALEYLHEVCLP VVHR FKS
Sbjct  431   GNGTLHDMLHFSDDDGMTMPGKTTRLAWNTRARIALGTARALEYLHEVCLPPVVHRAFKS  490

Query  1828  ANILLDEELNPHLSDCGLAALTPN--TERQISSTHVVGSFGYSAPEFALSGVYTVKSDVY  2001
             +NILLD+E +P LSDCGLAAL+PN  TER+ +   VVGSFGYSAPEFA+SG YT KSDVY
Sbjct  491   SNILLDDEYSPRLSDCGLAALSPNPETERE-AFAGVVGSFGYSAPEFAMSGTYTAKSDVY  549

Query  2002  SFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSR  2181
             SFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDID L+KMVDPAL+G+YPAKSLSR
Sbjct  550   SFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDLLAKMVDPALDGLYPAKSLSR  609

Query  2182  FADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPD  2337
             FADIIA+CVQ EPEFRPPMSEVVQ LVRL+QRAS+V R+  D+ G++Y+ P+
Sbjct  610   FADIIAICVQSEPEFRPPMSEVVQQLVRLMQRASIVRRQSDDQLGYSYRVPE  661



>gb|EMT21016.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Aegilops tauschii]
Length=669

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/685 (56%), Positives = 467/685 (68%), Gaps = 61/685 (9%)
 Frame = +1

Query  328   LYGSLNSPSQLSGWKASGG-DPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTS  504
             LY S NSP+QL GW A+GG DPCG +W GV+C GSA+                       
Sbjct  36    LYTSWNSPAQLVGWSAAGGGDPCGAAWMGVSCSGSAI-----------------------  72

Query  505   LKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQP  684
                                    TS+NLA NN +G+IPYSIS + SL YLN S NSL Q 
Sbjct  73    -----------------------TSMNLARNNFSGNIPYSISNILSLGYLNVSHNSLFQE  109

Query  685   IGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDL  864
             IG++F   + L+ LDLSFNN SG+LP S   LSNLS L +QNNQL+G++NVL +L LT L
Sbjct  110   IGELFGGLNSLSVLDLSFNNLSGNLPVSFVSLSNLSRLYMQNNQLSGTVNVLSNLSLTTL  169

Query  865   NVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHK  1044
             N+ANN FSG IP EL SIP     GNSF N PA PP    PP      +      P +  
Sbjct  170   NIANNNFSGLIPEELSSIPDLSAGGNSFINMPASPPRIIMPPSQSPVAQPDRPQVPTTFP  229

Query  1045  TPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFA--  1218
                 D+   D  +         + G +VG+ +GS A     +  +V+CL    K++    
Sbjct  230   NGPEDEMPIDEGDKKQGR----QTGLLVGLAVGSVAAASCILFALVFCLHSVHKRKDGDT  285

Query  1219  --ARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRRS---PI  1383
                +   G+L ++ D++  +   + +     + P P    T ER  G N S  +    P 
Sbjct  286   GEPKDFVGALAVNIDRDSNNNIHQDSPVAASVLPRPIG--TPERAYGVNSSPAKKIKVPG  343

Query  1384  TATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNF  1563
              AT YTVA LQ ATNSF Q+ L+GEGSLGRVYRADFPNGKVLA+KK+DSA+LSL EED+F
Sbjct  344   AATSYTVASLQVATNSFCQDTLLGEGSLGRVYRADFPNGKVLAVKKIDSASLSLYEEDHF  403

Query  1564  LEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARV  1743
             LE +SN+SRLRHPNIV L GYCA+HGQRLLVY++IGNG+LHDMLH++DE S+ LTWNARV
Sbjct  404   LEVVSNISRLRHPNIVSLTGYCADHGQRLLVYEHIGNGTLHDMLHYSDEASKNLTWNARV  463

Query  1744  RVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISST  1923
             R+ALGTARALEYLHEVCLPSVVHRN KS+NILLDEE +PHLSD GLAA +PN ER++ ST
Sbjct  464   RIALGTARALEYLHEVCLPSVVHRNLKSSNILLDEECSPHLSDAGLAAFSPNPEREV-ST  522

Query  1924  HVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQ  2103
              V+GS GYSAPEFA+SG YTVKSDVYSFGVVMLELLTGRKPLD SRERSEQSLV WATPQ
Sbjct  523   EVLGSLGYSAPEFAMSGTYTVKSDVYSFGVVMLELLTGRKPLDRSRERSEQSLVGWATPQ  582

Query  2104  LHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRAS  2283
             LHDIDAL+KMVDPA++GMYPAKSLSRFADIIAL VQPEPEFRPP+SEVVQ LVRL+QRAS
Sbjct  583   LHDIDALAKMVDPAMDGMYPAKSLSRFADIIALSVQPEPEFRPPISEVVQQLVRLMQRAS  642

Query  2284  VVIRRYSDESGFAYKTPDHDAASGD  2358
             ++ R+  D+ G +Y+ P+ +  + D
Sbjct  643   MLRRQSGDDLGSSYRAPEREGGAWD  667



>ref|XP_002962278.1| hypothetical protein SELMODRAFT_76873, partial [Selaginella moellendorffii]
 gb|EFJ37538.1| hypothetical protein SELMODRAFT_76873, partial [Selaginella moellendorffii]
Length=673

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/687 (55%), Positives = 483/687 (70%), Gaps = 22/687 (3%)
 Frame = +1

Query  310   LQALEVLYGSLNSPSQLSGWKAS-GGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYM  486
             +  L++LYGS NSP +LSGW +  GGDPCGESW+GV C G  V SI++PG  L G++GY 
Sbjct  1     VNGLKILYGSWNSP-RLSGWNSGPGGDPCGESWQGVLCTGPRVTSIKLPGQNLGGSLGYA  59

Query  487   LNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSG  666
             L+   +LK LDLS+N++   IPYQLPP L  + L+NN +TG +PYS+  + SL  ++ S 
Sbjct  60    LDQLRNLKILDLSNNQLSQAIPYQLPPQLQEMYLSNNQLTG-LPYSLKDLWSLTKIDVSH  118

Query  667   NSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVD  846
             N L   I D+F N S+L  LD+SFN  +G LP+S   L ++S++ VQNN+L+G +NVL D
Sbjct  119   NQLIGTIPDVFQNFSNLNLLDVSFNQLTGSLPSSFAGLISISVMHVQNNKLSGDINVLSD  178

Query  847   LPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHS  1026
             LPL DLNV NN+F+GW+P+ L SIP     GN+FS SPAPPPPPFTPPPP     +    
Sbjct  179   LPLADLNVENNQFNGWVPSSLRSIPNLRDGGNNFSTSPAPPPPPFTPPPPPP-RAQAGGK  237

Query  1027  TPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKK  1206
             +PG+  +P    +        G     + A           A V++ +V + Y  +R  K
Sbjct  238   SPGAKSSPRQSKDAESGGLSQGTMAGIIVA--------LVLAAVIAGLVAVCYMRKRKGK  289

Query  1207  KEFAARTSTGSL-----PLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLR  1371
              +   +  +  L     P    +  ++Q+ + +     LKPPP +    ER   K+ + +
Sbjct  290   PDLEKKMESSWLTPHNAPAKVKELKMEQKTRLSPPEKVLKPPPLKTPAAERSPIKHKNSK  349

Query  1372  RSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQE  1551
              S + AT Y+VA LQ ATNSF+QENL+GEGSLGRVYRA+  NG  LA+KK+D++  ++Q 
Sbjct  350   AS-VAATSYSVADLQAATNSFAQENLLGEGSLGRVYRAELQNGTPLAVKKLDASGSTVQT  408

Query  1552  EDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTW  1731
              + FL  +S ++RLRH N+  LVGYCAEHGQRLLVY+Y   G+LH+MLH  DE S+ L+W
Sbjct  409   NEEFLAFVSTIARLRHTNVTELVGYCAEHGQRLLVYEYFNRGTLHEMLHVLDETSKRLSW  468

Query  1732  NARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQ  1911
             N RV++ALG ARALEYLHEVC P+VVHRNFKSANILLD++++PHL+DCGLAAL  N +  
Sbjct  469   NQRVKIALGAARALEYLHEVCSPAVVHRNFKSANILLDDDMSPHLTDCGLAALRKNWQ--  526

Query  1912  ISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRW  2091
               +  ++GSFGYSAPEFA+SGVYTVKSDVYSFGVVMLELLTGRKPLDSSR RSEQSLVRW
Sbjct  527   -VAAQMLGSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRARSEQSLVRW  585

Query  2092  ATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLV  2271
             ATPQLHDIDALSKMVDPAL G+YPAKSLSRFAD+I+ CVQPEPEFRPPMSEVVQ+LVRL+
Sbjct  586   ATPQLHDIDALSKMVDPALKGIYPAKSLSRFADVISSCVQPEPEFRPPMSEVVQSLVRLM  645

Query  2272  QRASVVIRRYSDESGFAYKTPDHDAAS  2352
             QRAS+  R   DE G + ++  HD  S
Sbjct  646   QRASLSKRSSGDELGGSQRS-MHDPPS  671



>ref|NP_001167741.1| uncharacterized protein LOC100381429 precursor [Zea mays]
 gb|ACN25932.1| unknown [Zea mays]
Length=720

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/727 (53%), Positives = 482/727 (66%), Gaps = 53/727 (7%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             ++    A   R   V AATD ND+ AL  L+ S+NSP QL GWK SGGDPCGESW+G+TC
Sbjct  12    ILTCFGAWTPRQILVAAATDANDVTALNTLFTSMNSPGQLQGWKVSGGDPCGESWQGITC  71

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIH--DLIPYQLP-PNLTSLNLA  591
              GS+V +I++P LGL+G + Y +N   SL ELD+S N +     IPY LP   L  LNLA
Sbjct  72    SGSSVTAIKLPNLGLSGNLAYNMNTMDSLVELDMSHNNLGGGQQIPYNLPNKKLERLNLA  131

Query  592   NNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASL  771
              N  +GS+PYSIS M ++ YLN + N L+  I D+F+N   LTT+DLS N+ +G+LP S 
Sbjct  132   ENQFSGSVPYSISTMPNIKYLNLNHNQLSGDITDIFSNLPSLTTVDLSSNSLTGNLPQSF  191

Query  772   GLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
               LS+L  L +QNNQLTGS+NVL +LPL DLNVANNRF+GWIP EL  I   +  GNS+S
Sbjct  192   TSLSSLKTLYLQNNQLTGSINVLANLPLDDLNVANNRFTGWIPEELKKINSLQTDGNSWS  251

Query  952   NSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivg  1131
                APPPPPFT PP      R    +PG H               N +   G  +     
Sbjct  252   TGSAPPPPPFTAPP----RSRNRRKSPGQHSN-----------GSNNSSSGGSSSIGAGA  296

Query  1132  ivlgssavvlsaivvivYCLRRCKKK-----EFAARTSTGSLPLSTDKEVLDQRAKSTAT  1296
             I     +V++   +V  + ++R K+K      +  R    S P +  K +      +T  
Sbjct  297   IAGIIISVLVVGALVAFFLIKRNKRKSAMPEHYEQRQPFNSFPSNEVKNMKPIEEATTVE  356

Query  1297  V--------VDLKPPPSEKVTIERMQ------------GKNGSLRRSPITATPYTVAVLQ  1416
             V        V+LKPPP     IER Q                +   +P+ AT Y+VA LQ
Sbjct  357   VESLPSPAAVNLKPPPK----IERNQSFDDDDFANKPVAMKSNAAAAPVKATVYSVADLQ  412

Query  1417  TATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLR  1596
              AT+SF+ +NL+GEG+LGRVY+A F +GKVLA+KK++S  L  Q  D+F E +SN+S+L 
Sbjct  413   MATDSFNMDNLIGEGTLGRVYKAQFSDGKVLAVKKLNSTTLPRQSSDDFYELVSNISKLH  472

Query  1597  HPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALE  1776
             HPN+  LVGYC EHGQ LLVYD+  NGSLHDMLH +D+ ++ L+WN+RV++ALG+ARALE
Sbjct  473   HPNLSELVGYCMEHGQHLLVYDFHRNGSLHDMLHLSDDYNKPLSWNSRVKIALGSARALE  532

Query  1777  YLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAP  1956
             +LHE+C PS++H+NFKS+NILLD ELNPH+SD G ++  P+ E Q S     GS GYSAP
Sbjct  533   HLHEICSPSIIHKNFKSSNILLDTELNPHISDAGHSSFVPDAEFQASDQ---GS-GYSAP  588

Query  1957  EFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMV  2136
             E  +SG YT+KSDVYSFGVVMLELLTGRKP DSSR RSEQSLVRWATPQLHDIDAL +MV
Sbjct  589   EVEMSGQYTLKSDVYSFGVVMLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALDQMV  648

Query  2137  DPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             DPAL G+YPAKSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R    E  
Sbjct  649   DPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMTRRMLDGEE-  707

Query  2317  FAYKTPD  2337
              A + PD
Sbjct  708   -ASRRPD  713



>gb|EMS53763.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Triticum urartu]
Length=658

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/685 (56%), Positives = 466/685 (68%), Gaps = 61/685 (9%)
 Frame = +1

Query  328   LYGSLNSPSQLSGWKASGG-DPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTS  504
             LY S NSP+QL GW A+GG DPCG +W GV+C GSA+                       
Sbjct  25    LYTSWNSPAQLVGWSAAGGGDPCGAAWMGVSCSGSAI-----------------------  61

Query  505   LKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQP  684
                                    TS+NLA NN +G+IPYSIS + SL YLN S NSL Q 
Sbjct  62    -----------------------TSMNLARNNFSGNIPYSISNILSLGYLNVSHNSLFQE  98

Query  685   IGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDL  864
             IG++F   + L+ LDLSFNN SG+LP S   LSNLS L +QNNQL+G+++VL +L LT L
Sbjct  99    IGELFGGLNSLSVLDLSFNNLSGNLPVSFVSLSNLSSLYMQNNQLSGTVSVLSNLSLTTL  158

Query  865   NVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHK  1044
             N+ANN FSG IP EL SIP     GNSF N PA PP    PP      +      P +  
Sbjct  159   NIANNNFSGLIPGELSSIPDLSAGGNSFINMPASPPRIIMPPSQSPVAQPDRPQVPTTFP  218

Query  1045  TPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAAR  1224
               G +D+    E     G+   + G +VG+ +GS A     +  +V+CL    K++    
Sbjct  219   N-GPEDDIPIEEGDKKQGR---QTGLLVGLAVGSVAAASCILFALVFCLHSVHKRKDGGT  274

Query  1225  TS----TGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRRS---PI  1383
             +      G+L ++ D++      + +     + P P    T ER  G N S  +    P 
Sbjct  275   SEPKDFVGALAVNIDRDSNTNIHQDSPVAASVLPRPIG--TPERAYGVNSSPAKKIKVPG  332

Query  1384  TATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNF  1563
              AT YTVA LQ ATNSF Q+ L+GEGSLGRVYRADFPNGKVLA+KK+DSA+LSL EED+F
Sbjct  333   AATSYTVASLQVATNSFCQDTLLGEGSLGRVYRADFPNGKVLAVKKIDSASLSLYEEDHF  392

Query  1564  LEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARV  1743
             LE +SN+SRLRHPNIV L GYCA+HGQRLLVY++IGNG+LH+ LHF+DE ++ L+WN RV
Sbjct  393   LEVVSNISRLRHPNIVSLTGYCADHGQRLLVYEHIGNGTLHERLHFSDEANKSLSWNTRV  452

Query  1744  RVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISST  1923
             R+ALGTARALEYLHEVCLPSVVHRN KS+NILLDEE +PHLSD GLAA +PN ER++ ST
Sbjct  453   RIALGTARALEYLHEVCLPSVVHRNLKSSNILLDEECSPHLSDSGLAAFSPNPEREV-ST  511

Query  1924  HVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQ  2103
              V+GS GYSAPEFA+SG +TVKSDVYSFGVVMLELLTGRKPLD SRERSEQSLV WATPQ
Sbjct  512   EVLGSLGYSAPEFAMSGTHTVKSDVYSFGVVMLELLTGRKPLDRSRERSEQSLVGWATPQ  571

Query  2104  LHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRAS  2283
             LHDIDAL+KMVDPA+ GMYPAKSLSRFADIIAL VQPEPEFRPP+SEVVQ LVRL+QRAS
Sbjct  572   LHDIDALAKMVDPAMEGMYPAKSLSRFADIIALSVQPEPEFRPPISEVVQQLVRLMQRAS  631

Query  2284  VVIRRYSDESGFAYKTPDHDAASGD  2358
             ++ R+  D+ G +Y+ P+ +  + D
Sbjct  632   MLRRQSGDDLGSSYRAPEREGGAWD  656



>ref|XP_004303773.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Fragaria 
vesca subsp. vesca]
Length=717

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/708 (53%), Positives = 477/708 (67%), Gaps = 39/708 (6%)
 Frame = +1

Query  283   VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLG  462
             + A TDP+D+ AL V+Y SLNSPSQL+ W AS GDPCG+SWKGV C  S V  I++ GLG
Sbjct  24    INADTDPSDVSALTVMYSSLNSPSQLTQWSASSGDPCGQSWKGVKCTRSRVTEIDLSGLG  83

Query  463   LNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTS  642
             L+G+ GY L   T+L  LD+S+N +   IPY LPPNLT LNL  N  T  IPYS+S+MTS
Sbjct  84    LSGSFGYNLQSLTALTNLDMSNNNLAGGIPYNLPPNLTRLNLGGNQFTQGIPYSVSMMTS  143

Query  643   LNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLT  822
             L YLN S N L   + D+F   S LTTLDLSFN   G LP S   LS+L  L +QNNQLT
Sbjct  144   LKYLNISHNQLQNTLDDVFGKLSSLTTLDLSFNTMPGSLPESFSSLSSLKTLDLQNNQLT  203

Query  823   GSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgr  1002
             G+++VL +LPL +LN+ NN F+GW+P  L +I   +  GN++++ PAPPPPP TPP    
Sbjct  204   GTIDVLANLPLENLNIENNHFTGWVPEPLKNI-NLKKDGNTWNSGPAPPPPPGTPPA---  259

Query  1003  pHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivviv  1182
               K   + TPGS+ TP  +      +          K+G   G + G    +     +I 
Sbjct  260   --KNNGNRTPGSNGTPSKNGASEGGK----------KSGIGAGGIAGIVISIFVVTGIIA  307

Query  1183  YCL--RRCKKK----EFAARTSTGSLPLSTDKEV--------LDQRAKSTATVVDLKPPP  1320
             + L  RR KK     E         LP +  KE+        +D +       ++L+PPP
Sbjct  308   FFLIKRRSKKSSSDIEKIDIQPFAPLPSNEVKEMKSVEPSATVDLKTFDAPATINLRPPP  367

Query  1321  SEK---VTIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYR  1482
              ++      E    K   ++++   PI    Y++A LQ AT SFS +NL+GEGS GRVYR
Sbjct  368   VDRHKSFDDEEFSKKPIVVKKTVAAPINVISYSIADLQMATGSFSVDNLLGEGSFGRVYR  427

Query  1483  ADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYD  1662
             A F +GKVLA+KK+DS+ L  +  ++F E +SN+S L H N+  LVGYC+EHGQ LLVY+
Sbjct  428   AQFDDGKVLAVKKIDSSVLPSESSEDFTEIVSNISHLHHANVTELVGYCSEHGQHLLVYE  487

Query  1663  YIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILL  1842
             +  NGSLHD LH +DE ++ LTWN+RV++ALGTARALEYLHEVC PS++H+N KS+NILL
Sbjct  488   FHKNGSLHDFLHLSDEYTKPLTWNSRVKIALGTARALEYLHEVCSPSIIHKNIKSSNILL  547

Query  1843  DEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVML  2022
             D ELNPHLSD GLA+  PN ++ +   H  GS GYSAPE A+SG YT+KSDVYSFGVVML
Sbjct  548   DVELNPHLSDSGLASSIPNADQALD--HNAGS-GYSAPEVAMSGQYTLKSDVYSFGVVML  604

Query  2023  ELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIAL  2202
             EL++GRKP DSS+ RSEQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IAL
Sbjct  605   ELISGRKPFDSSKSRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIAL  664

Query  2203  CVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             CVQPEPEFRPPMSEVVQALVRLVQRA++  R   ++ G + +    DA
Sbjct  665   CVQPEPEFRPPMSEVVQALVRLVQRANMSRRTVGNDQGGSQRGDSTDA  712



>ref|XP_006836581.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
 gb|ERM99434.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
Length=721

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/731 (53%), Positives = 503/731 (69%), Gaps = 39/731 (5%)
 Frame = +1

Query  214   KNGAFLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPC  393
             + G FL      +    +  L  V  ATD  D+ AL V+Y SLNSP QLSGW ++GGDPC
Sbjct  3     RKGQFLI--FFSLFCNWVLNLSSVNGATDAADVSALNVMYNSLNSPGQLSGWTSNGGDPC  60

Query  394   GESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNL  573
             G++W+GVTC GS+V  +++ GLGL+G++GY L   TSL   D+S+N   + IPYQLPPNL
Sbjct  61    GQNWRGVTCSGSSVTELKLSGLGLSGSLGYQLTSLTSLTTFDVSNNNFGNDIPYQLPPNL  120

Query  574   TSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSG  753
             + LNLA N+ TG+I YSI+ M++L YLN   N L   + D+F   S LTTLDLS N  +G
Sbjct  121   SRLNLAENSFTGNIQYSIAQMSALQYLNIGHNQLQGQLSDIFGQLSSLTTLDLSSNRLNG  180

Query  754   DLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEY  933
             +LP S   L++L+ L +Q+NQ TG ++VL +LPL +LNVANN FSGWIP  L +I  F+ 
Sbjct  181   NLPESFSSLTSLTTLSLQDNQFTGPIDVLANLPLQNLNVANNHFSGWIPGSLNNIRNFQK  240

Query  934   SGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVK  1113
              GNS+++ PAPPPPP++ P           ++PG HK+ G +       + + +G    K
Sbjct  241   DGNSWTSGPAPPPPPYSTP------PPGRRASPG-HKSGGGN-------SPSNSGGGSNK  286

Query  1114  AGAivgivlgssavvlsaivvivYCL--RRCKKKEFAARTSTGS--LPLSTD-----KEV  1266
             +G   G + G    +L    ++ + L  +R KK     + S      PL ++     K +
Sbjct  287   SGLSGGGIAGIVITILVIGGILAFFLVRKRSKKGGLVEKQSHDQPFTPLVSNDIKEMKSI  346

Query  1267  LDQRAKSTATV----VDLKPPP--------SEKVTIERMQGKNGSLRRSPITATPYTVAV  1410
                 +  TA++    + LKPPP         E+    ++  K    +++PI+A PY++A 
Sbjct  347   QPSSSIDTASIQPASIALKPPPMERHKSFDEEEFAANKITVKPKREKKAPISANPYSIAD  406

Query  1411  LQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSR  1590
             LQ AT SF  +NL+GEGS+GRVYRA FP+GKVLA+KK+DS+AL  QE + F+EA+SN+S+
Sbjct  407   LQIATGSFGIDNLIGEGSIGRVYRAQFPDGKVLAVKKIDSSALPNQEPEEFMEAVSNISQ  466

Query  1591  LRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARA  1770
             L HPNI  LVGY +EHGQ LLVY+++ NGSLHD LH +DE S+ LTWN RV++ALGTARA
Sbjct  467   LHHPNITELVGYSSEHGQYLLVYEFLKNGSLHDYLHLSDEFSRPLTWNTRVKIALGTARA  526

Query  1771  LEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYS  1950
             LEYLHEVC PSVVH+NFKSANILLD E NPHLSDCGL     N + + S+ +  GS GYS
Sbjct  527   LEYLHEVCSPSVVHKNFKSANILLDNEFNPHLSDCGLGDFVANPDSEASNQN-QGS-GYS  584

Query  1951  APEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSK  2130
             APE A+SGVYT+KSDVYSFGV MLELLTGRKP DSS+ RSEQSLVRWATPQLHDIDALSK
Sbjct  585   APEVAMSGVYTMKSDVYSFGVAMLELLTGRKPFDSSKARSEQSLVRWATPQLHDIDALSK  644

Query  2131  MVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDE  2310
             MVDP L  +YP KSLSRFAD++ALCVQPEPEFRPPMSEVVQALVRLVQRAS+  R  S++
Sbjct  645   MVDPGLKELYPVKSLSRFADVVALCVQPEPEFRPPMSEVVQALVRLVQRASMSKRTNSED  704

Query  2311  SGFAYKTPDHD  2343
             SG + K  +HD
Sbjct  705   SGASRKAEEHD  715



>gb|KDP40614.1| hypothetical protein JCGZ_24613 [Jatropha curcas]
Length=714

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/722 (52%), Positives = 482/722 (67%), Gaps = 41/722 (6%)
 Frame = +1

Query  247   LVIAALISRLGFV-GAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQ  423
             L +  +I  LG++ G  TDPND  AL  ++ SL SP QL+ WKA+GGDPC ESWKGVTC 
Sbjct  9     LFVTVIICILGYINGDNTDPNDASALRGMFTSLGSPGQLTQWKANGGDPCEESWKGVTCS  68

Query  424   GSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNI  603
             G  V  I++ GL L+G MGY L   T+L  LD+S+N I   IPY LPPNLT LNLA+N  
Sbjct  69    GPRVTEIKLSGLALSGQMGYQLASLTALTNLDMSNNNIGGGIPYGLPPNLTQLNLASNQF  128

Query  604   TGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLS  783
             TG IPYSIS+MT L YLN + N L   + DMF   S L+TLD+SFN  SG+LP S   LS
Sbjct  129   TGDIPYSISMMTKLTYLNIAHNQLQNQLNDMFGKLSSLSTLDISFNQLSGNLPESFSNLS  188

Query  784   NLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpa  963
             +++   +QNNQ TG+++VL DLPL +L + NN F+GWIP +L  I   +  GN++++ PA
Sbjct  189   SMTSRYLQNNQFTGTIDVLADLPLKNLYIGNNHFTGWIPEQLKGI-NLQTDGNNWNSGPA  247

Query  964   pppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlg  1143
             PPPPP              H  PG HK+ G   N+S  +   G G      G      + 
Sbjct  248   PPPPPG---------TPPAHKNPG-HKSGG---NNSPSDGDAGGGSKKSGIGGGGIAGII  294

Query  1144  ssavvlsaivvivYCLRRCKK----------KEFA--ARTSTGSLPLSTDKEVLDQRAKS  1287
              S  V+  I+   +  RR K+          + FA  A +    +        ++ +   
Sbjct  295   ISIFVVGGIIAFFFVKRRSKRSSSDIEKLDNQPFAPLASSEVREMKSVQTSSTVNTKTFD  354

Query  1288  TATVVDLKPPPSEK---VTIERMQGKNGSLR---RSPITATPYTVAVLQTATNSFSQENL  1449
             T+  ++L+PPP ++      +    K   ++   R+P+  T Y+VA LQ AT SFS ++L
Sbjct  355   TSASINLRPPPIDRNKSFDEDDFSKKPIVVKKPVRAPVNVTSYSVADLQIATGSFSIDHL  414

Query  1450  VGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYC  1629
             +GEGS GRVYRA F +GKVLA+KK++S+AL+    D+F+E +S +S L HPN+  L+GYC
Sbjct  415   LGEGSFGRVYRAHFDDGKVLAVKKINSSALASDMSDDFIEMVSKISELHHPNVTELMGYC  474

Query  1630  AEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVV  1809
             +EHGQ LLVY++  NGSLHD LH +DE S+ L WN+RV++ALGTARALEYLHEVC PS++
Sbjct  475   SEHGQHLLVYEFHKNGSLHDFLHLSDEDSRPLIWNSRVKIALGTARALEYLHEVCSPSII  534

Query  1810  HRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVK  1989
             H+N KSANILLD ELNPHLSD GLA+  PN ++ +++     + GY APE A+SG YT+K
Sbjct  535   HKNMKSANILLDAELNPHLSDSGLASFLPNADQALNND---SASGYGAPEVAMSGQYTLK  591

Query  1990  SDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAK  2169
             SDVYSFGVVMLELLTGRKP DSSR RSEQSLVRWATPQLHDIDAL+KMVDPAL G+YP K
Sbjct  592   SDVYSFGVVMLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVK  651

Query  2170  SLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYK-----TP  2334
             SLSRFAD+IALCVQ EPEFRPPMSEVVQALVRLVQRA++  R   ++ G + +     TP
Sbjct  652   SLSRFADVIALCVQSEPEFRPPMSEVVQALVRLVQRANMSKRTVGNDQGASRQADNLDTP  711

Query  2335  DH  2340
             D+
Sbjct  712   DY  713



>ref|NP_001064502.1| Os10g0389800 [Oryza sativa Japonica Group]
 gb|AAO72637.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 gb|ABB47491.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26416.1| Os10g0389800 [Oryza sativa Japonica Group]
 gb|EEE50892.1| hypothetical protein OsJ_31383 [Oryza sativa Japonica Group]
Length=719

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/722 (53%), Positives = 481/722 (67%), Gaps = 43/722 (6%)
 Frame = +1

Query  223   AFLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGES  402
             A+    +V    +   R   V A TD ND+  L  L+ SLNSP QL GW+ +GGDPCG S
Sbjct  5     AWPLVFLVSCCCSWTQRRILVAATTDANDVTVLNALFTSLNSPGQLRGWQVNGGDPCGAS  64

Query  403   WKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIH--DLIPYQLP-PNL  573
             W+G+TC GS+V +I++P LGL+G + Y +N   SL ELD+S N +     I Y LP   L
Sbjct  65    WQGITCSGSSVTAIKLPSLGLSGNLAYNMNTMESLVELDMSQNNLGGGQNIQYNLPNKKL  124

Query  574   TSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSG  753
               LNLA N   G++PYSIS M  L YLN + N L   + D+F+N   L+TLDLS N+ +G
Sbjct  125   ERLNLAGNQFAGNVPYSISTMPKLKYLNLNHNQLQGNMTDVFSNLPSLSTLDLSLNSLTG  184

Query  754   DLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEY  933
             DLP S   LS+L  L +QNNQ TGS+NVL +LPL +LNV NNRF+GWIPNEL  I   + 
Sbjct  185   DLPQSFTSLSSLKTLYLQNNQFTGSINVLANLPLDNLNVGNNRFTGWIPNELKKINSLQT  244

Query  934   SGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVK  1113
              GNS+S  PAPPPPPFT PPP R  K++    PG H             + +  G +G++
Sbjct  245   DGNSWSTGPAPPPPPFTAPPPSRNRKKS----PGRHSN-------GSGSSSSSGGNSGLR  293

Query  1114  AGAivgivlgssavvlsaivvivYCLRRCKKKEFA-ARTSTGSLPLSTDKEV--------  1266
             AGAI GI++    +       ++   R+  ++E    R    S P +  K+V        
Sbjct  294   AGAIAGIIVALLVIGAVVAFFLIKRKRKGTRQEHVEQRQPFNSYPSNEVKDVKPIPESTK  353

Query  1267  LDQRAKSTATVVDLKPPPSEKVTIERMQG--------KNGSLRR----SPITATPYTVAV  1410
             ++     +   V LKPPP     IER Q          N  + +    + + AT Y+VA 
Sbjct  354   IEVEPLPSPVAVSLKPPPK----IERNQSFDDDDDDFSNKPVAKKSNSASVKATVYSVAD  409

Query  1411  LQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSR  1590
             LQ AT+SF+ +NLVGEG+ GRVYRA F +GKVLA+KK++S  L  Q  D+F + +SN+S+
Sbjct  410   LQMATDSFNMDNLVGEGTFGRVYRAQFSDGKVLAVKKLNSTVLPSQSSDDFFDLVSNISK  469

Query  1591  LRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARA  1770
             L HPN+  LVGYC EHGQ LLVYD+  NGSLHDMLH  DE S+ L+WN+RV++ALG+ARA
Sbjct  470   LHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDMLHLPDEYSKPLSWNSRVKIALGSARA  529

Query  1771  LEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYS  1950
             LEYLHE+C PS++H+NFKS+NILLD E NPH+SD GLA+  P++E Q S     GS GYS
Sbjct  530   LEYLHEICSPSIIHKNFKSSNILLDTEFNPHVSDAGLASSVPDSEFQASDQ---GS-GYS  585

Query  1951  APEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSK  2130
             APE  ++G YT+KSDVYSFGVVMLELLTGRKP DS+R R+EQSLVRWATPQLHDIDAL +
Sbjct  586   APEVDMTGQYTLKSDVYSFGVVMLELLTGRKPFDSARLRTEQSLVRWATPQLHDIDALDR  645

Query  2131  MVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDE  2310
             MVDPAL G+YPAKSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R    E
Sbjct  646   MVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMTRRMIDGE  705

Query  2311  SG  2316
              G
Sbjct  706   EG  707



>ref|XP_004144448.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/732 (51%), Positives = 477/732 (65%), Gaps = 51/732 (7%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             +++ I  L  R+ F+  ATDP D+ AL  +Y SLNSP  L+ W +SGGDPCG+ WKG+TC
Sbjct  12    LLVSICILGWRISFINGATDPGDVSALNAMYTSLNSPPILTQWSSSGGDPCGQIWKGITC  71

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
              G  V  I + GLGL+GT+GY L+  TSL  LD+S+N +   IPYQLP NL  LNL  NN
Sbjct  72    LGLRVTEISLSGLGLSGTLGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNN  131

Query  601   ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
              +GSIPYSIS M+ L  LN S N L   + DMF   S L  LD+SFN  SG LP S   L
Sbjct  132   FSGSIPYSISQMSLLISLNMSHNQLQNQVNDMFWKLSSLAMLDVSFNFLSGALPQSFSNL  191

Query  781   SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN--  954
             ++L+ + +QNNQ +G+++VL +LPL +LNV NN F+GW+P  L +I   +  GNS+S   
Sbjct  192   TSLNAMFLQNNQFSGTIDVLANLPLQNLNVENNHFTGWVPERLKNI-NIQEGGNSWSFGL  250

Query  955   SpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngk--ngVKAGAiv  1128
             +P PPP         R HK  N  +P S    G   N S    G   G   + +  GAI+
Sbjct  251   APPPPPGTPPANQNYRYHKAGNSYSPLSSDAAGGGSNRSGIGGGAIAGILISVLVVGAIL  310

Query  1129  givlgssavvlsaivvivYCL--RRCKKKEF-AARTSTGSLPLST--DKEVLDQRAK---  1284
                               Y L  RR K+      +   G+LP+ +    EV D  A+   
Sbjct  311   A-----------------YLLAKRRSKRPSTDIEKQKHGNLPIVSPASNEVQDALAEMKL  353

Query  1285  ------------STATVVDLKPPPSE--KVTIERMQGKNGSLRRS----PITATPYTVAV  1410
                          +   ++LKPPP +  K   +    K   ++++    PI+   Y++A 
Sbjct  354   VHTSSSFDAKELDSPASINLKPPPIDRHKSFDDNDTSKVPVVKKTNVTAPISVKSYSIAD  413

Query  1411  LQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSR  1590
             LQ AT SF+ ENL+GEG LGRVYRA F +GKVLA+KK+DSAA   +  ++F E ++N+S+
Sbjct  414   LQMATGSFNVENLLGEGPLGRVYRAQFNDGKVLAVKKIDSAAFHRELLEDFTEIVANISQ  473

Query  1591  LRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARA  1770
             L HPN+  L GYC+EHG  LL+Y++  NGSLHD LH +DE S+ LTWN+RV++ALGTARA
Sbjct  474   LHHPNVTELTGYCSEHGLHLLIYEFHKNGSLHDFLHISDEYSKPLTWNSRVKIALGTARA  533

Query  1771  LEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYS  1950
             LEYLHEVC PSVVHRN KSANILLD E+NPHLSDCGLA+   N +  +      GS GYS
Sbjct  534   LEYLHEVCAPSVVHRNIKSANILLDAEMNPHLSDCGLASFITNLDHALDQQ--AGS-GYS  590

Query  1951  APEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSK  2130
             APE  +SG YT+KSDVYSFGVVMLELL+GRKP DSSR R+EQSLVRWATPQLHDIDAL+K
Sbjct  591   APEVTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTK  650

Query  2131  MVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDE  2310
             MVDPAL G+YP KSLSRFAD++ALCVQPEPEFRPPMSEVV+ALVRLVQR+++  R +  +
Sbjct  651   MVDPALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSD  710

Query  2311  SGFAYKTPDHDA  2346
              G +++T D +A
Sbjct  711   HGSSFRTDDLEA  722



>ref|XP_004165988.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/732 (51%), Positives = 477/732 (65%), Gaps = 51/732 (7%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             +++ I  L  R+ F+  ATDP D+ AL  +Y SLNSP  L+ W +SGGDPCG+ WKG+TC
Sbjct  12    LLVSICILGWRISFINGATDPGDVSALNAMYTSLNSPPILTQWSSSGGDPCGQIWKGITC  71

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
              G  V  I + GLGL+GT+GY L+  TSL  LD+S+N +   IPYQLP NL  LNL  NN
Sbjct  72    LGLRVTEISLSGLGLSGTLGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNN  131

Query  601   ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
              +GSIPYSIS M+ L  LN S N L   + DMF   S L  LD+SFN  SG LP S   L
Sbjct  132   FSGSIPYSISQMSLLISLNMSHNQLQNQVNDMFWKLSSLAMLDVSFNFLSGALPQSFSNL  191

Query  781   SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN--  954
             ++L+ + +QNNQ +G+++VL +LPL +LNV NN F+GW+P  L +I   +  GNS+S   
Sbjct  192   TSLNAMFLQNNQFSGTIDVLANLPLQNLNVENNHFTGWVPERLKNI-NIQEGGNSWSFGL  250

Query  955   SpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngk--ngVKAGAiv  1128
             +P PPP         R HK  N  +P S    G   N S    G   G   + +  GAI+
Sbjct  251   APPPPPGTPPANQSYRYHKAGNSYSPLSSDAAGGGSNRSGIGGGAIAGILISVLVVGAIL  310

Query  1129  givlgssavvlsaivvivYCL--RRCKKKEF-AARTSTGSLPLST--DKEVLDQRAK---  1284
                               Y L  RR K+      +   G+LP+ +    EV D  A+   
Sbjct  311   A-----------------YLLAKRRSKRPSTDIEKQKHGNLPIVSPASNEVQDALAEMKL  353

Query  1285  ------------STATVVDLKPPPSE--KVTIERMQGKNGSLRRS----PITATPYTVAV  1410
                          +   ++LKPPP +  K   +    K   ++++    PI+   Y++A 
Sbjct  354   VHTSSSFDAKELDSPASINLKPPPIDRHKSFDDNDTSKVPVVKKTNVTAPISVKSYSIAD  413

Query  1411  LQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSR  1590
             LQ AT SF+ ENL+GEG LGRVYRA F +GKVLA+KK+DSAA   +  ++F E ++N+S+
Sbjct  414   LQMATGSFNVENLLGEGPLGRVYRAQFNDGKVLAVKKIDSAAFHRELLEDFTEIVANISQ  473

Query  1591  LRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARA  1770
             L HPN+  L GYC+EHG  LL+Y++  NGSLHD LH +DE S+ LTWN+RV++ALGTARA
Sbjct  474   LHHPNVTELTGYCSEHGLHLLIYEFHKNGSLHDFLHISDEYSKPLTWNSRVKIALGTARA  533

Query  1771  LEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYS  1950
             LEYLHEVC PSVVHRN KSANILLD E+NPHLSDCGLA+   N +  +      GS GYS
Sbjct  534   LEYLHEVCAPSVVHRNIKSANILLDAEMNPHLSDCGLASFITNLDHALDQQ--AGS-GYS  590

Query  1951  APEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSK  2130
             APE  +SG YT+KSDVYSFGVVMLELL+GRKP DSSR R+EQSLVRWATPQLHDIDAL+K
Sbjct  591   APEVTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTK  650

Query  2131  MVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDE  2310
             MVDPAL G+YP KSLSRFAD++ALCVQPEPEFRPPMSEVV+ALVRLVQR+++  R +  +
Sbjct  651   MVDPALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSD  710

Query  2311  SGFAYKTPDHDA  2346
              G +++T D +A
Sbjct  711   HGSSFRTDDLEA  722



>gb|ACG49227.1| leucine-rich repeat transmembrane protein kinase 1 [Zea mays]
Length=676

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/694 (53%), Positives = 464/694 (67%), Gaps = 53/694 (8%)
 Frame = +1

Query  340   LNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELD  519
             +NSP QL GWK SGGDPCGESW+G+TC GS+V +I++P LGL+G + Y +N   SL ELD
Sbjct  1     MNSPGQLQGWKVSGGDPCGESWQGITCSGSSVTAIKLPNLGLSGNLAYNMNTMDSLVELD  60

Query  520   LSSNEIH--DLIPYQLP-PNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIG  690
             +S N +     IPY LP   L  LNLA N  +GS+PYSIS M ++ YLN + N L+  I 
Sbjct  61    MSHNNLGGGQQIPYNLPNKKLERLNLAENQFSGSVPYSISTMPNIKYLNLNHNQLSGDIT  120

Query  691   DMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNV  870
             D+F+N   LTT+DLS N+ +G+LP S   LS+L  L +QNNQLTGS+NVL +LPL DLNV
Sbjct  121   DIFSNLPSLTTVDLSSNSLTGNLPQSFTSLSSLKTLYLQNNQLTGSINVLANLPLDDLNV  180

Query  871   ANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTP  1050
             ANNRF+GWIP EL  I   +  GNS+S   APPPPPFT PP      R    +PG H   
Sbjct  181   ANNRFTGWIPEELKKINSLQTDGNSWSTGSAPPPPPFTAPP----RSRNRRKSPGQHSN-  235

Query  1051  GSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKK-----EF  1215
                         N +   G  +     I     +V++   +V  + ++R K+K      +
Sbjct  236   ----------GSNNSSSGGSSSIGAGAIAGIIISVLVVGALVAFFLIKRNKRKSAMPEHY  285

Query  1216  AARTSTGSLPLSTDKEVLDQRAKSTATV--------VDLKPPPSEKVTIERMQ-------  1350
               R    S P +  K +      +T  V        V+LKPPP     IER Q       
Sbjct  286   EQRQPFNSFPSNEVKNMKPIEEATTVEVESLPSPAAVNLKPPPK----IERNQSFDDDDF  341

Query  1351  -----GKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAI  1515
                      +   +P+ AT Y+VA LQ AT+SF+ +NL+GEG+LGRVY+A F +GKVLA+
Sbjct  342   ANKPVAMKSNAAAAPVKATVYSVADLQMATDSFNMDNLIGEGTLGRVYKAQFSDGKVLAV  401

Query  1516  KKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDML  1695
             KK++S  L  Q  D+F E +SN+S+L HPN+  LVGYC EHGQ LLVYD+  NGSLHDML
Sbjct  402   KKLNSTTLPRQSSDDFYELVSNISKLHHPNLSELVGYCMEHGQHLLVYDFHRNGSLHDML  461

Query  1696  HFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDC  1875
             H +D+ ++ L+WN+RV++ALG+ARALE+LHE+C PS++H+NFKS+NILLD ELNPH+SD 
Sbjct  462   HLSDDYNKPLSWNSRVKIALGSARALEHLHEICSPSIIHKNFKSSNILLDTELNPHISDA  521

Query  1876  GLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDS  2055
             G ++  P+ E Q S     GS GYSAPE  +SG YT+KSDVYSFGVVMLELLTGRKP DS
Sbjct  522   GHSSFVPDAEFQASDQ---GS-GYSAPEVEMSGQYTLKSDVYSFGVVMLELLTGRKPFDS  577

Query  2056  SRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPP  2235
              R RSEQSLVRWATPQLHDIDAL +MVDPAL G+YPAKSLSRFAD+IALCVQPEPEFRPP
Sbjct  578   XRPRSEQSLVRWATPQLHDIDALDQMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPP  637

Query  2236  MSEVVQALVRLVQRASVVIRRYSDESGFAYKTPD  2337
             MSEVVQALVRLVQRA++  R    E   A + PD
Sbjct  638   MSEVVQALVRLVQRANMTRRMLDGEE--ASRRPD  669



>ref|XP_006465790.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Citrus 
sinensis]
Length=723

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/704 (52%), Positives = 474/704 (67%), Gaps = 21/704 (3%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             V+  +  L  +   + AATDP+D  AL+++Y SLNSPSQLS W A+G DPCG+SWKGV C
Sbjct  14    VLFEVCILGWKTSCINAATDPSDASALKIMYSSLNSPSQLSQWSATGDDPCGQSWKGVIC  73

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
              G  V  +++ GLGL+G+MGY L+  T+L  LDLS+N     IPY +P NL  L+L NN 
Sbjct  74    SGQRVTELKLSGLGLSGSMGYQLSSLTALTNLDLSNNNFGPDIPYNVPQNLERLDLGNNK  133

Query  601   ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
              TG++PY  S M +L YLN + N L   + DMF     L+TLDLSFN  SG+LP S   L
Sbjct  134   FTGNVPYYFSQMKTLKYLNIAHNQLQGQLNDMFGQLPSLSTLDLSFNTLSGNLPQSFSSL  193

Query  781   SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSp  960
             S+LS L +QNNQ +G+++VL +LPL +LN+ANNRF+GW+P +L +I   +  GNS+S+ P
Sbjct  194   SSLSSLYLQNNQFSGTIDVLANLPLDNLNIANNRFTGWVPEQLKNI-NLQKDGNSWSSGP  252

Query  961   apppppftppppgr--pHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgi  1134
             APPPPP TPP       HK  ++ +P   +                     V  G +   
Sbjct  253   APPPPPGTPPARKNNPKHKSDSNKSPSESEGGSKKSGIGGGGIAGILISLFVVGGIVAFF  312

Query  1135  vlgssavvlsaivvivYCLRRCKKKEFAARTSTGS----LPLSTDKEVLDQRAKSTATVV  1302
             ++       S+       + +   + FA   ++ +    L L      +D +   TA  +
Sbjct  313   LVKRRRSRRSSTD-----IEKLDNQPFAPLAASSNEVQELKLVQSSSSIDTKTFDTAVSI  367

Query  1303  DLKPPPSEK---VTIERMQGKNGSLR---RSPITATPYTVAVLQTATNSFSQENLVGEGS  1464
             +L+PPP ++      E    K+  ++   ++P   T Y++A LQ AT SF+ ENL+GEG+
Sbjct  368   NLRPPPIDRHKSFDEEDFSKKSIVVKKAVKAPTNVTSYSIADLQMATGSFNVENLLGEGT  427

Query  1465  LGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQ  1644
              GRVYRA F +GKVLA+KK+DS+AL  +  D+F+E +SN+S+L HPNI+ LVGYC+E+GQ
Sbjct  428   FGRVYRAQFADGKVLAVKKIDSSALPSEMCDDFIEMVSNISQLHHPNIMELVGYCSEYGQ  487

Query  1645  RLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFK  1824
              LLVY++  NGSLHD LH  DE ++ L WN+RV++ALGTARALEYLHEVC  SVVH+N K
Sbjct  488   HLLVYEFRKNGSLHDFLHLLDEDNKPLIWNSRVKIALGTARALEYLHEVCSLSVVHKNIK  547

Query  1825  SANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYS  2004
             SANILLD ELNP LSDCGLA+  PN +  +++    GS GY APE A+SG Y +KSDVYS
Sbjct  548   SANILLDNELNPQLSDCGLASNMPNADEALNND--AGS-GYGAPEVAMSGQYNIKSDVYS  604

Query  2005  FGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRF  2184
             FGVVMLELLTGRKP DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRF
Sbjct  605   FGVVMLELLTGRKPFDSSRPRLEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRF  664

Query  2185  ADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             AD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R   ++ G
Sbjct  665   ADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTIGNDQG  708



>ref|XP_006604928.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN11358.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=721

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/693 (54%), Positives = 479/693 (69%), Gaps = 36/693 (5%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             AATDPND  A+  L+ ++NSP QL GW  +G DPCG+SWKG+TC G+ V  I++  LGL 
Sbjct  25    AATDPNDAAAVRFLFQNMNSPPQL-GWPPNGDDPCGQSWKGITCSGNRVTEIKLSNLGLT  83

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             G++ Y L   TSL  +D+SSN +   IPYQLPP L  LNLA NNITG++PYSIS +T+L 
Sbjct  84    GSLPYGLQVLTSLTYVDMSSNSLGGSIPYQLPPYLQHLNLAYNNITGTVPYSISNLTALT  143

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
              LNFS N L Q +G  F N S L+TLDLSFN  +GDLP ++  LS ++ + +QNNQ TG+
Sbjct  144   DLNFSHNQLQQGLGVDFLNLSTLSTLDLSFNFLTGDLPQTMSSLSRITTMYLQNNQFTGT  203

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             ++VL +LPL +LNV NN F+GWIP +L +I   +  GN++S+ PAPPPPP TPP P    
Sbjct  204   IDVLANLPLDNLNVENNNFTGWIPEQLKNI-NLQTGGNAWSSGPAPPPPPGTPPAP----  258

Query  1009  KRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYC  1188
             K   H     HK+ G     SD   G+ +   G K+G   G + G    V+    ++ + 
Sbjct  259   KSNQH-----HKSGGGSTTPSDTATGSSSIDEGKKSGTGGGAIAGIVISVIVVGAIVAFF  313

Query  1189  L----RRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVD-----------LKPPPS  1323
             L     +    +   + +    PL ++ EV ++++  T++V D           LKPPP 
Sbjct  314   LVKRKSKKSSSDLEKQDNQSFAPLPSN-EVHEEKSMQTSSVTDLKTFDTSASINLKPPPI  372

Query  1324  EK---VTIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRA  1485
             ++      E    +   ++++   P     Y++A LQ AT SFS ++LVGEGS GRVYRA
Sbjct  373   DRHKSFDDEEFSKRPTIVKKTVTAPANVKSYSIAELQIATGSFSVDHLVGEGSFGRVYRA  432

Query  1486  DFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDY  1665
              F +G+VLA+KK+DS+ L     D+F++ ISN+S L HPN+  LVGYC+E+GQ LLVY++
Sbjct  433   QFDDGQVLAVKKIDSSILPNDLTDDFIQIISNISNLHHPNVTELVGYCSEYGQHLLVYEF  492

Query  1666  IGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLD  1845
               NGSLHD LH +DE S+ L WN+RV++ALGTARALEYLHEV  PSVVH+N KSANILLD
Sbjct  493   HKNGSLHDFLHLSDEYSKPLIWNSRVKIALGTARALEYLHEVSSPSVVHKNIKSANILLD  552

Query  1846  EELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLE  2025
              ELNPHLSD GLA+  PN ++ ++  H VGS GY APE ALSG YT+KSDVYSFGVVMLE
Sbjct  553   TELNPHLSDSGLASYIPNADQILN--HNVGS-GYDAPEVALSGQYTLKSDVYSFGVVMLE  609

Query  2026  LLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALC  2205
             LL+GR P DSSR RSEQSLVRWATPQLHDIDAL+KMVDPA+ G+YP KSLSRFAD+IALC
Sbjct  610   LLSGRNPFDSSRPRSEQSLVRWATPQLHDIDALAKMVDPAMKGLYPVKSLSRFADVIALC  669

Query  2206  VQPEPEFRPPMSEVVQALVRLVQRASVVIRRYS  2304
             VQPEPEFRPPMSEVVQALVRLVQRA++  R +S
Sbjct  670   VQPEPEFRPPMSEVVQALVRLVQRANMSKRTFS  702



>ref|XP_010542346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Tarenaya hassleriana]
Length=716

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/717 (51%), Positives = 487/717 (68%), Gaps = 45/717 (6%)
 Frame = +1

Query  214   KNGAFLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPC  393
             +N   +   + L I  L  R  F+  ATD +D  AL  +Y S+NSPSQLS WK SGGDPC
Sbjct  3     ENRVVMVALLTLCIVGLEPR--FINGATDSSDTSALNTMYSSMNSPSQLSEWKPSGGDPC  60

Query  394   GESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNL  573
             GE WKGVTC GS V  +++P LGL+G++GYML+  +++ E DLS+N +   +PYQLPP +
Sbjct  61    GEHWKGVTCSGSRVTEVKLPNLGLSGSLGYMLDKLSAVTEFDLSNNNLGGDLPYQLPPAV  120

Query  574   TSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSG  753
               LNLANN  TGS  YSISLM SL YLN + N     +   FT  + LT LDLS N+FSG
Sbjct  121   QRLNLANNQFTGSAQYSISLMASLKYLNLAHNQFKGQLAVDFTKLTSLTFLDLSSNSFSG  180

Query  754   DLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEY  933
              LP+S   L+++  + +QNNQ TG+++VL  LPL +LN+ANN+F+GWIP+ L  I   + 
Sbjct  181   SLPSSFTSLTSIKSMYLQNNQFTGTIDVLASLPLENLNIANNQFTGWIPDSLKGI-NLQK  239

Query  934   SGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVK  1113
              GNSF++ PAPPPPP TPP     H+  +H + G  +    D ++S  E          K
Sbjct  240   DGNSFNSGPAPPPPPGTPPI----HRSPSHKSGGGEQGSNGDSSNSKSE----------K  285

Query  1114  AGAivgivlgssavvlsaivvivYCLRRCKKKEFAA----RTSTGSLPLSTDKEVLDQRA  1281
             +G   G + G    +L    V+ + L + K+ + A+    +T      L++++   ++  
Sbjct  286   SGIGAGGIAGIIISLLVVGAVVAFFLFKKKRSKRASTDIEKTDNQPFTLASNEFHENKSV  345

Query  1282  KSTATV----------VDLKPPPSEKVTIERMQGKNGSLRRS---------PITATPYTV  1404
             +S+++V          ++L+PPP+++    +   +  S R+          P     Y+V
Sbjct  346   QSSSSVEAKKLDTSLSINLRPPPADR---HKSFDEEDSTRKPVIVKKTAVVPSNVKAYSV  402

Query  1405  AVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNM  1584
             A LQ AT SFS EN +GEG+ GRVYRA F +GK  A+KK+DS+AL +   ++F E +S +
Sbjct  403   ADLQIATGSFSSENFLGEGTFGRVYRAQFDDGKFFAVKKIDSSALPVDMAEDFTEIVSKI  462

Query  1585  SRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTA  1764
             +RL +PN++ LVGYC+EHGQ LLVY++  NGSLHD LH ++E S+ L WN+RV++ALGTA
Sbjct  463   ARLDNPNVIKLVGYCSEHGQHLLVYEFHKNGSLHDFLHLSEEESKPLIWNSRVKIALGTA  522

Query  1765  RALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFG  1944
             RALEYLHEVC PSVVH+N KSANILLD ELNPHLSD GLA+  P T  ++ + +  GS G
Sbjct  523   RALEYLHEVCSPSVVHKNIKSANILLDSELNPHLSDSGLASFLP-TADEVLNQNDEGS-G  580

Query  1945  YSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDAL  2124
             YSAPE ++SG Y+++SDVYSFGVVMLELLTGRKP DS+R RSEQSLVRWATPQLHDIDAL
Sbjct  581   YSAPEVSMSGQYSMQSDVYSFGVVMLELLTGRKPFDSARPRSEQSLVRWATPQLHDIDAL  640

Query  2125  SKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIR  2295
             SKMVDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPMSEVVQALV LVQRA++  R
Sbjct  641   SKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVVLVQRANMSKR  697



>gb|KEH24658.1| strubbelig-receptor family protein [Medicago truncatula]
Length=723

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/716 (52%), Positives = 473/716 (66%), Gaps = 29/716 (4%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGG---DPCGE  399
             L T  ++++      L    AATDP D+ +++ ++ S NS  QL GW A+G    DPCG+
Sbjct  4     LLTTCIILVLVWNWNLNGATAATDPTDVASVKAIFQSANSAPQL-GWPANGDTDDDPCGQ  62

Query  400   SWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTS  579
             SWKG+TC  + V  I +  L L GT+ Y L GFTSL  LD+S+N +   IPYQLPPNL  
Sbjct  63    SWKGITCSDNRVTQINLSNLALTGTLPYGLQGFTSLTILDMSNNNLVGTIPYQLPPNLHR  122

Query  580   LNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDL  759
             LN ANNN+TG +PYSIS +TSL  LN + N L Q +   F N S L+ LDLSFN+ +GDL
Sbjct  123   LNFANNNLTGPLPYSISNLTSLTDLNLNHNQLQQALNVNFQNLSTLSKLDLSFNSLTGDL  182

Query  760   PASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSG  939
             P ++  L+ ++ + +QNNQ TG++++L DLPL  LNV NN F+GWIP +L +I   +  G
Sbjct  183   PQTMSSLTGITTMYLQNNQFTGAIDILADLPLNSLNVENNNFTGWIPEQLKNI-DLQTGG  241

Query  940   NSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAG  1119
             N++S+ PAPPPPP TP  P       +H T G   T G D N SD  N       G    
Sbjct  242   NAWSSGPAPPPPPGTPLVPKSNQ---HHKTGGGRSTTGQDAN-SDTSNEGKKSGIGGGGI  297

Query  1120  AivgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEV--------LDQ  1275
               + I +     +++  +V     +     E     ST  LP +   EV         D 
Sbjct  298   VGIVISVIVVGAIVAFFLVKRKSKKSSSDLEKLGNQSTVPLPSNEVPEVTSVQTSPVFDL  357

Query  1276  RAKSTATVVDLKPPPSE--KVTIERMQGKNGSLRRSPITATP----YTVAVLQTATNSFS  1437
             +   ++  ++L PPP +  K   +    K  ++ +  ITA P    Y++A LQ  T SFS
Sbjct  358   KKFDSSASINLIPPPIDRHKSFDDNEFSKKTTIVKKTITAPPDLQSYSIADLQITTGSFS  417

Query  1438  QENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPL  1617
              ++LVGEGS GRVY A F +GKVLA+KK+DS+ L     ++F+E +SN+S L HPN+  L
Sbjct  418   VDHLVGEGSFGRVYHAQFDDGKVLAVKKIDSSVLPNDFSEDFIEIVSNISCLHHPNVTEL  477

Query  1618  VGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCL  1797
             VGYC+EHGQ LLVY++  NGSLHD LH +DE S+ L WN+RV++ALGTARALEYLHEVC 
Sbjct  478   VGYCSEHGQHLLVYEFHKNGSLHDYLHVSDEYSKPLIWNSRVKIALGTARALEYLHEVCS  537

Query  1798  PSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGV  1977
             PSVVH+N KSANILLD ELNPHLSDCGLA+  PN E+ ++  H VGS GY APE ALSG 
Sbjct  538   PSVVHKNIKSANILLDAELNPHLSDCGLASYIPNAEQILN--HNVGS-GYDAPEVALSGQ  594

Query  1978  YTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGM  2157
             YT KSD+YSFGVVMLELL+GR+P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+
Sbjct  595   YTFKSDIYSFGVVMLELLSGRRPFDSSRARQEQSLVRWATPQLHDIDALAKMVDPTLKGL  654

Query  2158  YPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRY---SDESG  2316
             YP KSLSRFAD+IALCVQPEPEFRP MSEVVQALVRLVQRA++  R +   SD  G
Sbjct  655   YPVKSLSRFADVIALCVQPEPEFRPQMSEVVQALVRLVQRANMSRRTFTFGSDHGG  710



>gb|KHN16389.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=722

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/693 (54%), Positives = 481/693 (69%), Gaps = 37/693 (5%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             AATDPND  A+  L+ ++NSP QL GW  +G DPCG+SWKG+TC G+ V  I++  LGL 
Sbjct  27    AATDPNDAAAVRFLFQNMNSPPQL-GWPPNGDDPCGQSWKGITCSGNRVTEIKLSNLGLT  85

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             G++ Y L   TSL +LD+SSN +   IPYQLPP L  LNLA NNITG++PYSIS +T+L 
Sbjct  86    GSVPYGLQVLTSLNDLDMSSNRLGGSIPYQLPPYLQRLNLAYNNITGTVPYSISNLTALT  145

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
              LN   N L Q +G  F N S L+TLDLSFN+ +GDLP ++  LS ++ + +QNNQ TG+
Sbjct  146   DLNLGHNQLQQGLGVDFHNLSTLSTLDLSFNSLTGDLPQTMSSLSRITTMYLQNNQFTGT  205

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             ++VL +LPL +LNV NN F+GWIP +L +I   +  GN++S+ PAPPPPP TPP P    
Sbjct  206   IDVLANLPLDNLNVENNNFTGWIPEQLKNI-NLQTGGNAWSSGPAPPPPPGTPPAP----  260

Query  1009  KRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYC  1188
             K   H     HK+ G     SD  +G+ + + G K+G   G + G    V+    ++ + 
Sbjct  261   KSNQH-----HKSGGGSTTPSDTGSGSSSIEEGKKSGIGGGAIAGIVISVIVLGAIVAFF  315

Query  1189  L----RRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVD-----------LKPPPS  1323
             L     +    +   + +    PL ++ EV ++++  T++V D           LKPPP 
Sbjct  316   LVKRKSKKSSSDLEKQDNQSFAPLPSN-EVHEEKSMQTSSVTDWKTFDTSGSINLKPPPI  374

Query  1324  E--KVTIERMQGKNGSLRRSPITA----TPYTVAVLQTATNSFSQENLVGEGSLGRVYRA  1485
             +  K   E    K  ++ +  +TA      Y++A LQ AT SFS ++LVGEGS GRVY A
Sbjct  375   DHHKSFDEEEFSKKPTIVKKTVTAPANVKSYSIAELQIATGSFSVDHLVGEGSFGRVYHA  434

Query  1486  DFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDY  1665
              F +G+VLA+KK+DS+ L     D+F+E ISN+S L HPN+  LVGYC+++GQ LLVY++
Sbjct  435   QF-DGQVLAVKKIDSSVLPNDLTDDFIEIISNISNLHHPNVTELVGYCSKYGQHLLVYEF  493

Query  1666  IGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLD  1845
               NGSLHD LH  DE S+ L WN+RV++ALGTARALEYLHEV  PSVVH+N KSANILLD
Sbjct  494   HKNGSLHDFLHLPDEYSKPLIWNSRVKIALGTARALEYLHEVSSPSVVHKNIKSANILLD  553

Query  1846  EELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLE  2025
              ELNPHLSD GLA+  PN ++ ++  H VGS GY APE ALSG YT+KSDVYSFGVVMLE
Sbjct  554   TELNPHLSDSGLASYIPNADQILN--HNVGS-GYDAPEVALSGQYTLKSDVYSFGVVMLE  610

Query  2026  LLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALC  2205
             LL+GRKP DSSR RSEQSLVRWATPQLHDIDAL+KMVDPA+ G+YP KSLSRFAD+IALC
Sbjct  611   LLSGRKPFDSSRPRSEQSLVRWATPQLHDIDALAKMVDPAMKGLYPVKSLSRFADVIALC  670

Query  2206  VQPEPEFRPPMSEVVQALVRLVQRASVVIRRYS  2304
             VQPEPEFRPPMSEVVQALVRLVQRA++  R +S
Sbjct  671   VQPEPEFRPPMSEVVQALVRLVQRANMSKRTFS  703



>ref|XP_004494892.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cicer arietinum]
Length=722

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/721 (50%), Positives = 470/721 (65%), Gaps = 28/721 (4%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             LFT    ++   IS      A TDP  + AL+ ++ S+NSPSQL GW  +  DPCG+SWK
Sbjct  11    LFTSTYFILLVWISS---TAATTDPTHVAALKAMFQSMNSPSQL-GWPTNADDPCGQSWK  66

Query  409   GVTCQGSAVVSIEIPGLGLNGTM-GYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLN  585
             G+TC  ++V  I +  L L GT+  Y     TSL  LD+S+N +   IPYQLPPN+  LN
Sbjct  67    GITCSANSVTQIVLSNLALTGTLLPYGFQDLTSLTNLDISNNNLFGPIPYQLPPNVQRLN  126

Query  586   LANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPA  765
              A+NN+TG++PYSIS +TSL  LN S N L Q +   F   S L+ LDLSFN+ +GDLP 
Sbjct  127   FAHNNLTGAVPYSISNLTSLTDLNLSHNQLQQALNVNFQYLSTLSKLDLSFNSLAGDLPQ  186

Query  766   SLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNS  945
             ++  LS ++ + +QNNQ TG++++L +LPL  LNV NN F+GWIP  L +I   +  GN+
Sbjct  187   TMSSLSGITTMYLQNNQFTGTIDILANLPLHSLNVENNNFTGWIPERLKNI-DIQSGGNA  245

Query  946   FSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAi  1125
             +S+     P P  PP      K   H   G   T G D +    + G  +G  G     I
Sbjct  246   WSS----VPAPPPPPGTPPVPKSNQHHKSGGVSTTGQDASSGTIDEGKKSGIGGGGIAGI  301

Query  1126  vgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEV--------LDQRA  1281
             V  ++   AVV   ++           ++  ++ ST  LP +   EV         D + 
Sbjct  302   VISIIVVGAVVAFFLMKRKSKKSSSDVEKLGSQ-STAPLPSNEVHEVTSVQTSSVFDLKR  360

Query  1282  KSTATVVDLKPPPSE--KVTIERMQGKNGSLRRSPITA----TPYTVAVLQTATNSFSQE  1443
               T+  ++LKPPP +  K   +    K  ++ +  +TA      Y++A LQ  T SFS +
Sbjct  361   FDTSASINLKPPPIDRHKSFDDNEHSKKSTIVKKTVTAPADVQSYSIADLQITTGSFSVD  420

Query  1444  NLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVG  1623
             +LV EGS GRVYRA F +GKVLA+KK+DS+ L     ++F+E ++N+S L HPN+  LVG
Sbjct  421   HLVSEGSFGRVYRAQFDDGKVLAVKKIDSSVLPNDFSEDFIEIVANISHLHHPNVTELVG  480

Query  1624  YCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPS  1803
             YC+EHGQ LLVY++  NGSLHD LH +DE S+ L WN+RV++ALGTARALEYLHEVC PS
Sbjct  481   YCSEHGQHLLVYEFHKNGSLHDFLHVSDEYSKPLIWNSRVKIALGTARALEYLHEVCSPS  540

Query  1804  VVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYT  1983
             +VH+N KS NILLD ELNPHLSDCGLA+  PN E+ ++  H VGS GY APE ALSG YT
Sbjct  541   IVHKNIKSGNILLDAELNPHLSDCGLASYVPNAEQILN--HNVGS-GYDAPEVALSGQYT  597

Query  1984  VKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYP  2163
              KSDVYSFGVVMLELL+GRKP DSSR R+EQSLVRWATPQLHDIDAL+KMVDPAL G+YP
Sbjct  598   FKSDVYSFGVVMLELLSGRKPFDSSRLRAEQSLVRWATPQLHDIDALAKMVDPALKGLYP  657

Query  2164  AKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
              KSLSRFAD+IALCVQ EPEFRPPMSEVVQA+VRLVQRA++  R +  + G + +  D  
Sbjct  658   VKSLSRFADVIALCVQSEPEFRPPMSEVVQAMVRLVQRANMSRRTFGSDHGGSLRGSDEP  717

Query  2344  A  2346
             A
Sbjct  718   A  718



>gb|EEC82450.1| hypothetical protein OsI_26884 [Oryza sativa Indica Group]
Length=720

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/712 (52%), Positives = 472/712 (66%), Gaps = 26/712 (4%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             V+L +AA +S    V A TD +D+ AL VLY S+NSPSQL+ W +  GDPCG+SW G+TC
Sbjct  8     VMLFLAATLSG---VSAHTDSDDVNALNVLYTSMNSPSQLTNWVSQNGDPCGQSWLGITC  64

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDL-IPYQLPPNLTSLNLANN  597
              GS V +I++ G+G+NGT+GY +N  TSL ELD S N +    IPY LPPNL  LNLA N
Sbjct  65    SGSRVTAIKLSGMGINGTLGYNMNLLTSLVELDTSKNNLGGSDIPYNLPPNLERLNLAEN  124

Query  598   NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
             N TGSIPYSIS M +L  LN   N LA    DMF   ++LTTLDLS+N  SG++P S   
Sbjct  125   NFTGSIPYSISQMIALRILNLGHNHLAT-TNDMFNQLTNLTTLDLSYNTLSGNIPQSFNS  183

Query  778   LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNS  957
             L+NL  L +QNN   G+++VL DLPLTDLNVANN+F+GWIP++L  I   + +GNSF + 
Sbjct  184   LTNLRKLNLQNNGFNGTIDVLADLPLTDLNVANNQFTGWIPDKLKKIKNLQTNGNSFGSG  243

Query  958   papppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgiv  1137
             P+PPPPP+  PP   P  ++  S   +  T   ++N SD    +     G  AG +V +V
Sbjct  244   PSPPPPPYQSPPYKSPPYKSPQSRQPAPPTTTVNNNPSDDGRKHSKLSGGAIAGIVVCLV  303

Query  1138  lgssavvlsaivvivYCLRRC---KKKEFAARTSTG---SLPLSTDKEVLDQRAK---ST  1290
             +  + V    I    + L R    ++KE  +   +G   SL      +++    K     
Sbjct  304   VVGAIVAFFVIKKKYWSLPRGGDPEQKEPLSPIVSGFKDSLKQMKSIKIISTIGKEELQK  363

Query  1291  ATVVDLKPPPSEKV--TIERMQGKNGSLRR----SPITATPYTVAVLQTATNSFSQENLV  1452
                ++LKPP    +  +I+     + S  R    S I    YTVA LQ AT SF  +NL+
Sbjct  364   TVSMNLKPPTRIDLHKSIDENDVTSKSFTRKISLSSIRTPAYTVADLQVATGSFCADNLI  423

Query  1453  GEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCA  1632
             GEG  GRVY+A F + KVLA+KK++ +A      D F+E ++N+SRL HP++  LVGYC+
Sbjct  424   GEGLFGRVYKAKFNDHKVLAVKKINFSAFPGHPSDLFIELVANISRLNHPSLSELVGYCS  483

Query  1633  EHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVH  1812
             EHGQ LL Y++  NGSL D+LH  D++SQ L+WN+RV++ALG+ARALEYLHE C PSV+H
Sbjct  484   EHGQCLLAYEFYRNGSLKDLLHLVDDQSQPLSWNSRVKIALGSARALEYLHETCSPSVIH  543

Query  1813  RNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKS  1992
             +NFKS+NI LD ELNPHLSD G A L PN E Q+S        GY APE  +SG Y+VKS
Sbjct  544   KNFKSSNIFLDNELNPHLSDSGFADLIPNRESQVSDEDS----GYRAPEVTMSGQYSVKS  599

Query  1993  DVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKS  2172
             DVYSFGVVMLELLTGRKP D SR RSEQSLV WATPQLHDIDAL +MVDPAL G+YP+KS
Sbjct  600   DVYSFGVVMLELLTGRKPFDRSRPRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKS  659

Query  2173  LSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYK  2328
             LSRFAD IALCVQ EPEFRPPMSEVVQ LVRLVQRA++   R     G +++
Sbjct  660   LSRFADAIALCVQSEPEFRPPMSEVVQLLVRLVQRANMT--RMCGADGHSWR  709



>dbj|BAC10113.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC16030.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC21507.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
Length=720

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/712 (52%), Positives = 472/712 (66%), Gaps = 26/712 (4%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             V+L +AA +S    V A TD +D+ AL VLY S+NSPSQL+ W +  GDPCG+SW G+TC
Sbjct  8     VMLFLAATLSG---VSANTDSDDVNALNVLYTSMNSPSQLTNWVSQNGDPCGQSWLGITC  64

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDL-IPYQLPPNLTSLNLANN  597
              GS V +I++ G+G+NGT+GY +N  TSL ELD S N +    IPY LPPNL  LNLA N
Sbjct  65    SGSRVTAIKLSGMGINGTLGYNMNLLTSLVELDTSKNNLGGSDIPYNLPPNLERLNLAEN  124

Query  598   NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
             N TGSIPYSIS M +L  LN   N LA    DMF   ++LTTLDLS+N  SG++P S   
Sbjct  125   NFTGSIPYSISQMIALRILNLGHNHLAT-TNDMFNQLTNLTTLDLSYNTLSGNIPQSFNS  183

Query  778   LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNS  957
             L+NL  L +QNN   G+++VL DLPLTDLNVANN+F+GWIP++L  I   + +GNSF + 
Sbjct  184   LTNLRKLNLQNNGFNGTIDVLADLPLTDLNVANNQFTGWIPDKLKKIKNLQTNGNSFGSG  243

Query  958   papppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgiv  1137
             P+PPPPP+  PP   P  ++  S   +  T   ++N SD    +     G  AG +V +V
Sbjct  244   PSPPPPPYQSPPYKSPPYKSPQSRQPAPPTTTVNNNPSDDGRKHSKLSGGAIAGIVVCLV  303

Query  1138  lgssavvlsaivvivYCLRRC---KKKEFAARTSTG---SLPLSTDKEVLDQRAK---ST  1290
             +  + V    I    + L R    ++KE  +   +G   SL      +++    K     
Sbjct  304   VVGAIVAFFVIKKKYWSLPRGGDPEQKEPLSPIVSGFKDSLKQMKSIKIISTIGKEELQK  363

Query  1291  ATVVDLKPPPSEKV--TIERMQGKNGSLRR----SPITATPYTVAVLQTATNSFSQENLV  1452
                ++LKPP    +  +I+     + S  R    S I    YTVA LQ AT SF  +NL+
Sbjct  364   TVSMNLKPPTRIDLHKSIDENDVTSKSFTRKISFSSIRTPAYTVADLQVATGSFCADNLI  423

Query  1453  GEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCA  1632
             GEG  GRVY+A F + KVLA+KK++ +A      D F+E ++N+SRL HP++  LVGYC+
Sbjct  424   GEGLFGRVYKAKFNDHKVLAVKKINFSAFPGHPSDLFIELVANISRLNHPSLSELVGYCS  483

Query  1633  EHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVH  1812
             EHGQ LL Y++  NGSL D+LH  D++SQ L+WN+RV++ALG+ARALEYLHE C PSV+H
Sbjct  484   EHGQCLLAYEFYRNGSLKDLLHLVDDQSQPLSWNSRVKIALGSARALEYLHETCSPSVIH  543

Query  1813  RNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKS  1992
             +NFKS+NI LD ELNPHLSD G A L PN E Q+S        GY APE  +SG Y+VKS
Sbjct  544   KNFKSSNIFLDNELNPHLSDSGFADLIPNRESQVSDEDS----GYRAPEVTMSGQYSVKS  599

Query  1993  DVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKS  2172
             DVYSFGVVMLELLTGRKP D SR RSEQSLV WATPQLHDIDAL +MVDPAL G+YP+KS
Sbjct  600   DVYSFGVVMLELLTGRKPFDRSRPRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKS  659

Query  2173  LSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYK  2328
             LSRFAD IALCVQ EPEFRPPMSEVVQ LVRLVQRA++   R     G +++
Sbjct  660   LSRFADAIALCVQSEPEFRPPMSEVVQLLVRLVQRANMT--RMCGADGHSWR  709



>ref|XP_006604929.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Glycine max]
Length=708

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/684 (54%), Positives = 472/684 (69%), Gaps = 36/684 (5%)
 Frame = +1

Query  316   ALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNG  495
             A+  L+ ++NSP QL GW  +G DPCG+SWKG+TC G+ V  I++  LGL G++ Y L  
Sbjct  21    AVRFLFQNMNSPPQL-GWPPNGDDPCGQSWKGITCSGNRVTEIKLSNLGLTGSLPYGLQV  79

Query  496   FTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSL  675
              TSL  +D+SSN +   IPYQLPP L  LNLA NNITG++PYSIS +T+L  LNFS N L
Sbjct  80    LTSLTYVDMSSNSLGGSIPYQLPPYLQHLNLAYNNITGTVPYSISNLTALTDLNFSHNQL  139

Query  676   AQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPL  855
              Q +G  F N S L+TLDLSFN  +GDLP ++  LS ++ + +QNNQ TG+++VL +LPL
Sbjct  140   QQGLGVDFLNLSTLSTLDLSFNFLTGDLPQTMSSLSRITTMYLQNNQFTGTIDVLANLPL  199

Query  856   TDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPG  1035
              +LNV NN F+GWIP +L +I   +  GN++S+ PAPPPPP TPP P    K   H    
Sbjct  200   DNLNVENNNFTGWIPEQLKNI-NLQTGGNAWSSGPAPPPPPGTPPAP----KSNQH----  250

Query  1036  SHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCL----RRCK  1203
              HK+ G     SD   G+ +   G K+G   G + G    V+    ++ + L     +  
Sbjct  251   -HKSGGGSTTPSDTATGSSSIDEGKKSGTGGGAIAGIVISVIVVGAIVAFFLVKRKSKKS  309

Query  1204  KKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVD-----------LKPPPSEK---VTIE  1341
               +   + +    PL ++ EV ++++  T++V D           LKPPP ++      E
Sbjct  310   SSDLEKQDNQSFAPLPSN-EVHEEKSMQTSSVTDLKTFDTSASINLKPPPIDRHKSFDDE  368

Query  1342  RMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLA  1512
                 +   ++++   P     Y++A LQ AT SFS ++LVGEGS GRVYRA F +G+VLA
Sbjct  369   EFSKRPTIVKKTVTAPANVKSYSIAELQIATGSFSVDHLVGEGSFGRVYRAQFDDGQVLA  428

Query  1513  IKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDM  1692
             +KK+DS+ L     D+F++ ISN+S L HPN+  LVGYC+E+GQ LLVY++  NGSLHD 
Sbjct  429   VKKIDSSILPNDLTDDFIQIISNISNLHHPNVTELVGYCSEYGQHLLVYEFHKNGSLHDF  488

Query  1693  LHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSD  1872
             LH +DE S+ L WN+RV++ALGTARALEYLHEV  PSVVH+N KSANILLD ELNPHLSD
Sbjct  489   LHLSDEYSKPLIWNSRVKIALGTARALEYLHEVSSPSVVHKNIKSANILLDTELNPHLSD  548

Query  1873  CGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLD  2052
              GLA+  PN ++ ++  H VGS GY APE ALSG YT+KSDVYSFGVVMLELL+GR P D
Sbjct  549   SGLASYIPNADQILN--HNVGS-GYDAPEVALSGQYTLKSDVYSFGVVMLELLSGRNPFD  605

Query  2053  SSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRP  2232
             SSR RSEQSLVRWATPQLHDIDAL+KMVDPA+ G+YP KSLSRFAD+IALCVQPEPEFRP
Sbjct  606   SSRPRSEQSLVRWATPQLHDIDALAKMVDPAMKGLYPVKSLSRFADVIALCVQPEPEFRP  665

Query  2233  PMSEVVQALVRLVQRASVVIRRYS  2304
             PMSEVVQALVRLVQRA++  R +S
Sbjct  666   PMSEVVQALVRLVQRANMSKRTFS  689



>ref|NP_001060286.1| Os07g0618400 [Oryza sativa Japonica Group]
 dbj|BAF22200.1| Os07g0618400 [Oryza sativa Japonica Group]
Length=732

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/705 (52%), Positives = 467/705 (66%), Gaps = 23/705 (3%)
 Frame = +1

Query  262   LISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVS  441
             L + L  V A TD +D+ AL VLY S+NSPSQL+ W +  GDPCG+SW G+TC GS V +
Sbjct  24    LAATLSGVSANTDSDDVNALNVLYTSMNSPSQLTNWVSQNGDPCGQSWLGITCSGSRVTA  83

Query  442   IEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDL-IPYQLPPNLTSLNLANNNITGSIP  618
             I++ G+G+NGT+GY +N  TSL ELD S N +    IPY LPPNL  LNLA NN TGSIP
Sbjct  84    IKLSGMGINGTLGYNMNLLTSLVELDTSKNNLGGSDIPYNLPPNLERLNLAENNFTGSIP  143

Query  619   YSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSML  798
             YSIS M +L  LN   N LA    DMF   ++LTTLDLS+N  SG++P S   L+NL  L
Sbjct  144   YSISQMIALRILNLGHNHLAT-TNDMFNQLTNLTTLDLSYNTLSGNIPQSFNSLTNLRKL  202

Query  799   RVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpappppp  978
              +QNN   G+++VL DLPLTDLNVANN+F+GWIP++L  I   + +GNSF + P+PPPPP
Sbjct  203   NLQNNGFNGTIDVLADLPLTDLNVANNQFTGWIPDKLKKIKNLQTNGNSFGSGPSPPPPP  262

Query  979   ftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavv  1158
             +  PP   P  ++  S   +  T   ++N SD    +     G  AG +V +V+  + V 
Sbjct  263   YQSPPYKSPPYKSPQSRQPAPPTTTVNNNPSDDGRKHSKLSGGAIAGIVVCLVVVGAIVA  322

Query  1159  lsaivvivYCLRRC---KKKEFAARTSTG---SLPLSTDKEVLDQRAK---STATVVDLK  1311
                I    + L R    ++KE  +   +G   SL      +++    K        ++LK
Sbjct  323   FFVIKKKYWSLPRGGDPEQKEPLSPIVSGFKDSLKQMKSIKIISTIGKEELQKTVSMNLK  382

Query  1312  PPPSEKV--TIERMQGKNGSLRR----SPITATPYTVAVLQTATNSFSQENLVGEGSLGR  1473
             PP    +  +I+     + S  R    S I    YTVA LQ AT SF  +NL+GEG  GR
Sbjct  383   PPTRIDLHKSIDENDVTSKSFTRKISFSSIRTPAYTVADLQVATGSFCADNLIGEGLFGR  442

Query  1474  VYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLL  1653
             VY+A F + KVLA+KK++ +A      D F+E ++N+SRL HP++  LVGYC+EHGQ LL
Sbjct  443   VYKAKFNDHKVLAVKKINFSAFPGHPSDLFIELVANISRLNHPSLSELVGYCSEHGQCLL  502

Query  1654  VYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSAN  1833
              Y++  NGSL D+LH  D++SQ L+WN+RV++ALG+ARALEYLHE C PSV+H+NFKS+N
Sbjct  503   AYEFYRNGSLKDLLHLVDDQSQPLSWNSRVKIALGSARALEYLHETCSPSVIHKNFKSSN  562

Query  1834  ILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGV  2013
             I LD ELNPHLSD G A L PN E Q+S        GY APE  +SG Y+VKSDVYSFGV
Sbjct  563   IFLDNELNPHLSDSGFADLIPNRESQVSDEDS----GYRAPEVTMSGQYSVKSDVYSFGV  618

Query  2014  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  2193
             VMLELLTGRKP D SR RSEQSLV WATPQLHDIDAL +MVDPAL G+YP+KSLSRFAD 
Sbjct  619   VMLELLTGRKPFDRSRPRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADA  678

Query  2194  IALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYK  2328
             IALCVQ EPEFRPPMSEVVQ LVRLVQRA++   R     G +++
Sbjct  679   IALCVQSEPEFRPPMSEVVQLLVRLVQRANMT--RMCGADGHSWR  721



>ref|XP_004510591.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cicer arietinum]
Length=711

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/724 (52%), Positives = 479/724 (66%), Gaps = 47/724 (6%)
 Frame = +1

Query  247   LVIAALISRLGFV-GAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQ  423
             L++   IS    V    TDPND  AL +L+ SLNSP+QL+ W A+G DPCG+SWKG+TC 
Sbjct  6     LLMLIFISTCALVINGDTDPNDAAALTLLFQSLNSPAQLN-WPANGNDPCGQSWKGITCS  64

Query  424   GSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNI  603
             G+ +  I++PGLGL+GT+GY L+  ++L  LDLS+N I   IPY LP NL  LNLANNN+
Sbjct  65    GNRITEIKLPGLGLSGTLGYQLS-LSALTTLDLSNNNIGSNIPYSLPQNLQHLNLANNNL  123

Query  604   TGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLS  783
              G IPYS+S +TSL  +N   N L Q +   F   + L+TLDLSFN+ +GDLP ++  LS
Sbjct  124   NGGIPYSLSDITSLISMNLGHNQLQQGLTLNFQKLTSLSTLDLSFNSLTGDLPQTMNSLS  183

Query  784   NLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpa  963
             +++ + +QNNQLTG++NVL DLPL  LNV NN F+GWIP +L +I   +  GNS+S+ PA
Sbjct  184   SITTMYLQNNQLTGTINVLADLPLESLNVENNHFTGWIPEQLKNI-NIQKDGNSWSSGPA  242

Query  964   pppppftp--pppgrpHKRTNHST-PGSHKTPGSDDNHSDHEngngngkngVKAGAivgi  1134
             PPPPP TP        HK   HST P S  +  S  +        G   + +  GAI+  
Sbjct  243   PPPPPGTPPITKKSNTHKSGGHSTSPASGTSDESKKSGIGGGAIAGIVISILVVGAIIAF  302

Query  1135  vlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLS--TDKEVLDQRAKSTATVVD-  1305
                             + ++R  KK F       + PL+  T  EV +  +  T++V+D 
Sbjct  303   ----------------FLVKRRPKKSFRDVEKLDNQPLAPLTSNEVHEMNSTQTSSVIDF  346

Query  1306  ------------LKPPPSE--KVTIERMQGKNGSLRRSPITA----TPYTVAVLQTATNS  1431
                         LKPPPS+  K   E    K   + +  +TA      Y++A LQ AT S
Sbjct  347   KTFDDTSAATISLKPPPSDLHKSFDEDEFPKKPIVVKKTVTAPANLKAYSIADLQIATGS  406

Query  1432  FSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIV  1611
             FS + L+GEGS GRVYRA F +GKVLA+KK+DS+ L     ++F+E +SN+SR  HPN+ 
Sbjct  407   FSVDQLLGEGSFGRVYRAQFDDGKVLAVKKIDSSVLPNNLSEDFVEIVSNLSRFHHPNVT  466

Query  1612  PLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEV  1791
              LVGYC+EHGQ LLVY++  +GSLHD LH  DE ++ L WN+RV++ALG ARALEYLHEV
Sbjct  467   ELVGYCSEHGQHLLVYEFHKSGSLHDFLHLPDEYTKPLIWNSRVKIALGIARALEYLHEV  526

Query  1792  CLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALS  1971
             C PSVVH++ KSANILLD + NPHLSD GLA+  PN  + +++    GS GY APE  LS
Sbjct  527   CSPSVVHKDIKSANILLDVDFNPHLSDSGLASYIPNANQVLNNN--AGS-GYDAPEVGLS  583

Query  1972  GVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALN  2151
             G YT KSDVYSFGVVMLELL+GRKP DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL 
Sbjct  584   GQYTFKSDVYSFGVVMLELLSGRKPFDSSRSRFEQSLVRWATPQLHDIDALAKMVDPALE  643

Query  2152  GMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKT  2331
             G+YP KSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQR ++  R +  + G + + 
Sbjct  644   GLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRG  703

Query  2332  PDHD  2343
              D +
Sbjct  704   DDQE  707



>gb|EEC66871.1| hypothetical protein OsI_33412 [Oryza sativa Indica Group]
Length=719

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/722 (53%), Positives = 481/722 (67%), Gaps = 43/722 (6%)
 Frame = +1

Query  223   AFLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGES  402
             A+    +V    +   R   V A TD ND+  L  L+ SLNSP QL GW+ +GGDPCG S
Sbjct  5     AWPLVFLVSCCCSWTQRRILVAATTDANDVTVLNALFTSLNSPGQLRGWQVNGGDPCGAS  64

Query  403   WKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIH--DLIPYQLP-PNL  573
             W+G+TC GS+V +I++P LGL+G + Y +N   SL ELD+S N +     I Y LP   L
Sbjct  65    WQGITCSGSSVTAIKLPSLGLSGNLAYNMNTMESLVELDMSQNNLGGGQNIQYNLPNKKL  124

Query  574   TSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSG  753
               LNLA N   G++PYSIS M  L YLN + N L   + D+F+N   L+TLDLSFN+ +G
Sbjct  125   ERLNLAGNQFAGNVPYSISTMPKLKYLNLNHNQLQGNMTDVFSNLPSLSTLDLSFNSLTG  184

Query  754   DLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEY  933
             DLP S   LS+L  L +QNNQ TGS+NVL +L L +LNV NNRF+GWIPNEL  I   + 
Sbjct  185   DLPQSFTSLSSLKTLYLQNNQFTGSINVLANLLLDNLNVGNNRFTGWIPNELKKINSLQT  244

Query  934   SGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVK  1113
              GNS+S  PAPPPPPFT PPP R  K++    PG H             + +  G +G++
Sbjct  245   DGNSWSTGPAPPPPPFTAPPPSRNRKKS----PGRHSN-------GSGSSSSSGGNSGLR  293

Query  1114  AGAivgivlgssavvlsaivvivYCLRRCKKKEFA-ARTSTGSLPLSTDKEV--------  1266
             AGAI GI++    +       ++   R+  ++E    R    S P +  K+V        
Sbjct  294   AGAIAGIIVALLVIGAVVAFFLIKRKRKGTRQEHVEQRQPFNSYPSNEVKDVKPIPESTK  353

Query  1267  LDQRAKSTATVVDLKPPPSEKVTIERMQG--------KNGSLRR----SPITATPYTVAV  1410
             ++     +   V LKPPP     IER Q          N  + +    + + AT Y+VA 
Sbjct  354   IEVEPLPSPVAVSLKPPPK----IERNQSFDDDDDDFSNKPVAKKSNSASVKATVYSVAD  409

Query  1411  LQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSR  1590
             LQ AT+SF+ +NLVGEG+ GRVYRA F +GKVLA+KK++S  L  Q  D+F + +SN+S+
Sbjct  410   LQMATDSFNMDNLVGEGTFGRVYRAQFSDGKVLAVKKLNSTVLPSQSSDDFFDLVSNISK  469

Query  1591  LRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARA  1770
             L HPN+  LVGYC EHGQ LLVYD+  NGSLHDMLH  DE S+ L+WN+RV++ALG+ARA
Sbjct  470   LHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDMLHLPDEYSKPLSWNSRVKIALGSARA  529

Query  1771  LEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYS  1950
             LEYLHE+C PS++H+NFKS+NILLD E NPH+SD GLA+  P++E Q S     GS GYS
Sbjct  530   LEYLHEICSPSIIHKNFKSSNILLDTEFNPHVSDAGLASNVPDSEFQASDQ---GS-GYS  585

Query  1951  APEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSK  2130
             APE  ++G YT+KSDVYSFGVVMLELLTGRKP DS+R R+EQSLVRWATPQLHDIDAL +
Sbjct  586   APEVDMTGQYTLKSDVYSFGVVMLELLTGRKPFDSARLRTEQSLVRWATPQLHDIDALDR  645

Query  2131  MVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDE  2310
             MVDPAL G+YPAKSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R    E
Sbjct  646   MVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMTRRMIDGE  705

Query  2311  SG  2316
              G
Sbjct  706   EG  707



>ref|XP_006284970.1| hypothetical protein CARUB_v10006274mg [Capsella rubella]
 gb|EOA17868.1| hypothetical protein CARUB_v10006274mg [Capsella rubella]
Length=705

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/389 (79%), Positives = 348/389 (89%), Gaps = 5/389 (1%)
 Frame = +1

Query  1186  CLRRCKKK-EFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNG  1362
             C  + K+K   ++R +  ++PLS   E+ +QR KS A+V DLK  P EKVT++R+  KNG
Sbjct  313   CFHKKKRKVGGSSRAAQRNIPLSGIAEMQEQRVKSVASVADLKASPVEKVTVDRVM-KNG  371

Query  1363  SLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAA  1536
             S+ R  SPITA+ YTV+ LQ ATNSFSQEN++GEGSLGRVYRA+FPNGK++AIKK+D+AA
Sbjct  372   SISRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEFPNGKIMAIKKIDNAA  431

Query  1537  LSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERS  1716
             LSLQEEDNFLEAISNMSRLRHPNIVPL GYC EHGQRLLVY+Y+GNG+L DMLH  D+RS
Sbjct  432   LSLQEEDNFLEAISNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDMLHMNDDRS  491

Query  1717  QLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTP  1896
               LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSANILLDEELNPHLSD GLAALTP
Sbjct  492   MNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTP  551

Query  1897  NTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ  2076
             NTERQ+ ST VVGSFGYSAPEFALSGVYTVKSDVY+FGVVMLELLTGRKPLDSSR R+EQ
Sbjct  552   NTERQV-STQVVGSFGYSAPEFALSGVYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQ  610

Query  2077  SLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQA  2256
             SLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADIIALC+QPEPEFRPPMSEVVQ 
Sbjct  611   SLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQ  670

Query  2257  LVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             LVRLVQRASVV RR SD+SGF+Y+TP+H+
Sbjct  671   LVRLVQRASVVKRRSSDDSGFSYRTPEHE  699


 Score =   307 bits (786),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 189/242 (78%), Gaps = 1/242 (0%)
 Frame = +1

Query  229  LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
            +FT ++L IA+ IS    V   TDP+D+QAL+VLY SLNSPSQL+ WK  GGDPCGESWK
Sbjct  10   MFTVLLLFIAS-ISGFSLVRCVTDPSDVQALQVLYTSLNSPSQLTNWKIGGGDPCGESWK  68

Query  409  GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
            G+TC+GSAVV+I+I   G++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTS+NL
Sbjct  69   GITCEGSAVVTIDISDSGVSGTLGYLLSDLMSLRKLDVSGNSIHDTLPYQLPPNLTSINL  128

Query  589  ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
            + NN++G++PYSIS M SL+Y+N SGNSL+  IGD+F + + L+TLDLS NNFSGDLP S
Sbjct  129  SRNNLSGNLPYSISAMGSLSYMNVSGNSLSMSIGDIFADHNSLSTLDLSHNNFSGDLPTS  188

Query  769  LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
            L   S LS+L VQNNQLTGS++VL  LPL  LNVANN F+G IP EL SI    Y GNSF
Sbjct  189  LSTASKLSVLYVQNNQLTGSIDVLSGLPLKTLNVANNHFNGSIPKELSSIQTLIYDGNSF  248

Query  949  SN  954
             N
Sbjct  249  DN  250



>ref|XP_006598761.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN15854.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=715

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/729 (51%), Positives = 478/729 (66%), Gaps = 47/729 (6%)
 Frame = +1

Query  247   LVIAALISRLGF-VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQ  423
             LV+  LIS     +   TDPND+ +L+VL+ S+NSPSQL+ W  +G DPCG+SW+G+TC 
Sbjct  8     LVLVLLISTCILAINGDTDPNDVTSLKVLFQSMNSPSQLN-W--NGDDPCGQSWQGITCS  64

Query  424   GSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNI  603
             G+ V  I++PG  L+G++GY L   +S+  LDLS+N I   IPYQLPPNL  LNLANNN 
Sbjct  65    GNRVTEIKLPGRSLSGSLGYQLEPLSSVTNLDLSNNNIGGTIPYQLPPNLQYLNLANNNF  124

Query  604   TGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLS  783
              G+IPYS+S  TSL  LN   N L Q +   F   S L+TLDLSFN+ +GDLP ++  LS
Sbjct  125   NGAIPYSLSEKTSLVILNLGHNQLQQALNVDFQKLSSLSTLDLSFNSLTGDLPQTMSSLS  184

Query  784   NLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpa  963
             ++  + +QNNQ TG+++VL +LPL  LNV NN F+GWIP +L +I   +  GN +S+ PA
Sbjct  185   SIRTMYLQNNQFTGTIDVLANLPLGTLNVGNNHFTGWIPEQLNNI--IQKDGNEWSSGPA  242

Query  964   pppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlg  1143
             PPPPP TPP      +  NH + G          HS  + G+ +G          GI   
Sbjct  243   PPPPPGTPPVVS---RNRNHKSGG----------HSPSDAGSSDGGGKKSGIGGGGIAGI  289

Query  1144  ssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVD------  1305
               ++++   +V  + ++R  KK F       + PL+   EV +  +  T++V D      
Sbjct  290   VISILVVGAIVAFFLVKRRSKKSFNDVEKLDNQPLA-QHEVHEMNSMQTSSVTDFKTFDT  348

Query  1306  ------LKPPP------------SEKVTIERMQGKNGSLRRSPITATPYTVAVLQTATNS  1431
                   LKPPP            S K  I     K      +P     Y++A LQ AT S
Sbjct  349   SAAPISLKPPPFDRRKSFDEDEFSNKPVIVNKPTKVKKTVTAPANVKSYSIADLQIATGS  408

Query  1432  FSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIV  1611
             FS E L+GEGS GRVYRA F +GKVLA+KK+DS+ L     D+F+E +SN+S+L  PN+ 
Sbjct  409   FSVEQLLGEGSFGRVYRAQFDDGKVLAVKKIDSSVLPNDMSDDFVELVSNISQLHDPNVT  468

Query  1612  PLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEV  1791
              LVGYC+EHGQ LLVY++  NGSLHD LH  DE S+ L WN+RV++ALG ARALEYLHEV
Sbjct  469   ELVGYCSEHGQHLLVYEFHKNGSLHDFLHLPDECSKPLIWNSRVKIALGIARALEYLHEV  528

Query  1792  CLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALS  1971
             C PSVVH+N KSANILLD + NPHLSD GLA+  PN  + +++    GS GY APE  LS
Sbjct  529   CSPSVVHKNIKSANILLDTDFNPHLSDSGLASYIPNANQVLNNN--AGS-GYEAPEVGLS  585

Query  1972  GVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALN  2151
             G YT+KSDVYSFGVVMLELL+GRKP DSSR RSEQ+LVRWATPQLHDIDAL+KMVDPAL 
Sbjct  586   GHYTLKSDVYSFGVVMLELLSGRKPFDSSRPRSEQALVRWATPQLHDIDALAKMVDPALE  645

Query  2152  GMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKT  2331
             G+YP KSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQR ++  R +  + G + + 
Sbjct  646   GLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRG  705

Query  2332  PDHDAASGD  2358
              D +  + D
Sbjct  706   GDDNQDTQD  714



>ref|XP_010479951.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/708 (52%), Positives = 476/708 (67%), Gaps = 38/708 (5%)
 Frame = +1

Query  241   VVLVIAALIS-RLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVT  417
             V L    ++   L F+  ATD +D  AL  L+ S++SP+QL+ W A+ GDPCG++W+GVT
Sbjct  9     VALFTVCIVGFELRFIHGATDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQNWRGVT  68

Query  418   CQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANN  597
             C GS V  I++PGL L+GT+GYML+  TSL ELDLSSN +   +PYQLPPNL  LNLANN
Sbjct  69    CSGSRVTQIKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQRLNLANN  128

Query  598   NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
               TG+  YSIS MT L YLN   N     I   F+  + LTTLD SFN+F+  LP +   
Sbjct  129   QFTGAAQYSISHMTPLKYLNLGHNQFKGQIAIDFSKLNSLTTLDFSFNSFTNSLPGTFTS  188

Query  778   LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNS  957
             L++L  L +QNNQ +G+++VL  LPL  LN+ANN F+GWIP+ L  I   +  GNSF+  
Sbjct  189   LTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLKGITLIK-DGNSFNTG  247

Query  958   papppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgiv  1137
             PAPPPPP TPP          H +P S K+ G ++  S  ++ +         GA     
Sbjct  248   PAPPPPPGTPPI---------HGSP-SRKSGGHENRSSGDQSTSNGDSKKSGIGAGAIAG  297

Query  1138  lgssavvlsaivvivYCLRRCKKKEFAA-----RTSTGSLPLSTDKEVLDQRAKSTATV-  1299
             +  S +V++A++V  +  +R K K  ++     +T      L+++    +   +S+ +V 
Sbjct  298   IIISLLVVTALLVAFFLFKRKKTKRSSSSLDIEKTDNEPFTLASNDFHENNSIQSSTSVE  357

Query  1300  ---------VDLKPPPSEK---VTIERMQGKNGSLRRS----PITATPYTVAVLQTATNS  1431
                      ++L+PPP ++      E    K  ++++S    P     Y+VA LQ AT S
Sbjct  358   TKKLDTSLSINLRPPPVDRNKSFDDEDSTRKPSTVKKSMVVVPSHVKVYSVADLQIATGS  417

Query  1432  FSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIV  1611
             FS +NL+GEG+ GRVYRA+F +GKVLA+KK+DS+AL     D+F+  +S ++ L HPN+ 
Sbjct  418   FSVDNLLGEGTFGRVYRAEFDDGKVLAVKKIDSSALPHGMTDDFIGMVSKIASLNHPNVT  477

Query  1612  PLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEV  1791
              LVGYCAEHGQ L+VY++  NGSLHD LH ++E S+ L WN+RV++ALGTARALEYLHEV
Sbjct  478   KLVGYCAEHGQHLVVYEFHKNGSLHDFLHLSEEESKGLVWNSRVKIALGTARALEYLHEV  537

Query  1792  CLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALS  1971
             C PS+V +N KSANILLD ELNPHLSD GLA+  P  +  I+ T      GYSAPE ++S
Sbjct  538   CSPSIVDKNIKSANILLDSELNPHLSDSGLASFLPTADELINQTDE----GYSAPEVSMS  593

Query  1972  GVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALN  2151
             G YT+KSDVYSFGVVMLELLTGRKP DS+R RSEQSLVRWATPQLHDIDAL KMVDPAL 
Sbjct  594   GQYTLKSDVYSFGVVMLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALK  653

Query  2152  GMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIR  2295
             G+YP KSLSRFAD+IALCVQPEPEFRPPMSEVVQALV LVQRA++  R
Sbjct  654   GLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVVLVQRANMSKR  701



>ref|XP_006583189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Glycine 
max]
Length=713

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/702 (52%), Positives = 469/702 (67%), Gaps = 46/702 (7%)
 Frame = +1

Query  283   VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLG  462
             +   TDPND+ +L+VL+ S+NSPSQL+ W  +G DPCG+SW+G+TC G+ V  I++PG  
Sbjct  20    INGDTDPNDVASLKVLFQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRS  76

Query  463   LNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTS  642
             L+G++GY L   +S+  LDLS+N +   IPYQLPPNL  LNLANNN  G+IPYS+S  TS
Sbjct  77    LSGSLGYQLEPMSSVTNLDLSNNNLGGTIPYQLPPNLQYLNLANNNFNGAIPYSLSEKTS  136

Query  643   LNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLT  822
             L  LN   N L Q +   F   S L+TLDLSFN+ +GDLP ++  LS++  + +QNNQ T
Sbjct  137   LIVLNLGHNQLQQALNVDFQKLSSLSTLDLSFNSLTGDLPQTMSSLSSIRTMYLQNNQFT  196

Query  823   GSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgr  1002
             G+++VL +LPL  LNV NN F+GWIP +L +I   +  GN++S+ PAPPPPP TPP    
Sbjct  197   GTIDVLANLPLDTLNVGNNHFTGWIPEQLKNI--IQKDGNAWSSGPAPPPPPGTPPAVA-  253

Query  1003  pHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivviv  1182
               +  NH + G          HS  + G+ +G          GI     ++++   +V+ 
Sbjct  254   --RNRNHKSGG----------HSPSDGGSSDGGGKKSGIGGGGIAGIVISILVVGAIVVF  301

Query  1183  YCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLK------------PPP--  1320
             + ++R  KK F       + PL+ + EV +  +  T++V+DLK            PPP  
Sbjct  302   FLVKRRPKKSFNDVEKLDNQPLAQN-EVHEMNSMQTSSVIDLKTFDTSATPISLKPPPFD  360

Query  1321  ----------SEKVTIERMQGKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLG  1470
                       S K  I     K      +P     Y++A LQ AT SFS E L+GEGS G
Sbjct  361   RHKSFDEDEFSNKPVIVNKPTKVKKTVTAPTNVKSYSIADLQIATGSFSVEQLLGEGSFG  420

Query  1471  RVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRL  1650
             RVYRA F  GKVLA+KK+DS+ L     D+F+E +SN+S+L HPN+  LVGYC+EHGQ L
Sbjct  421   RVYRAQFDEGKVLAVKKIDSSVLPNDMSDDFVELVSNISQLHHPNVTELVGYCSEHGQHL  480

Query  1651  LVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSA  1830
             LVY++  NGSLHD LH  DE S+ L WN+RV++ALG ARALEYLHEVC PSVVH+N KSA
Sbjct  481   LVYEFHKNGSLHDFLHLPDEYSKPLIWNSRVKIALGIARALEYLHEVCSPSVVHKNIKSA  540

Query  1831  NILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFG  2010
             NILLD + NPHLSD GLA+  PN  + +++    GS GY APE  LSG YT+KSDVYSFG
Sbjct  541   NILLDTDFNPHLSDSGLASYIPNANQVLNNN--AGS-GYEAPEVGLSGHYTLKSDVYSFG  597

Query  2011  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFAD  2190
             VVMLELL+GRKP DSSR RSEQ+LVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD
Sbjct  598   VVMLELLSGRKPFDSSRPRSEQALVRWATPQLHDIDALAKMVDPTLEGLYPVKSLSRFAD  657

Query  2191  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             +IALCVQPEPEFRPPMSEVVQALVRLVQR ++  R +  + G
Sbjct  658   VIALCVQPEPEFRPPMSEVVQALVRLVQRTNMSKRTFGTDQG  699



>ref|XP_010439362.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Camelina sativa]
Length=703

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/389 (79%), Positives = 346/389 (89%), Gaps = 5/389 (1%)
 Frame = +1

Query  1186  CLRRCKKKEFAA-RTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNG  1362
             CL + K+K   + R +  SLPLS   E  +QR KS A+V DLK  P+EKVT++R+  KNG
Sbjct  311   CLHKRKRKVGGSTRAAQRSLPLSGTTETQEQRVKSVASVADLKSSPAEKVTVDRVM-KNG  369

Query  1363  SLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAA  1536
             S+ R  SPITA+ YTV+ LQ ATNSFSQEN++GEGSLGRVYRA+FPNGK++AIKK+D+ A
Sbjct  370   SISRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEFPNGKIMAIKKIDNVA  429

Query  1537  LSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERS  1716
             LSLQEEDNFLEA+SNMSRLRHPNIVPL GYC EHGQRLLVY+Y+GNG+L D LH  D+RS
Sbjct  430   LSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLHMNDDRS  489

Query  1717  QLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTP  1896
               LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSANILLDEELNPHLSD GLAALTP
Sbjct  490   MNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAALTP  549

Query  1897  NTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQ  2076
             NTERQ+ ST +VGSFGYSAPEFALSGVYTVKSDVY+FGVVMLELLTGRKPLDSSR R+EQ
Sbjct  550   NTERQV-STQIVGSFGYSAPEFALSGVYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQ  608

Query  2077  SLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQA  2256
             SLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADIIALC+QPEPEFRPPMSEVVQ 
Sbjct  609   SLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQ  668

Query  2257  LVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             LVRLVQRASVV RR SD++GF+Y+TP+H+
Sbjct  669   LVRLVQRASVVKRRSSDDTGFSYRTPEHE  697


 Score =   311 bits (798),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 189/242 (78%), Gaps = 1/242 (0%)
 Frame = +1

Query  229  LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
            LFT ++L IA+ IS    V   TDP+D+QAL+VLY SLNSPSQL+ WK  GGDPCGESW+
Sbjct  8    LFTVLLLFIAS-ISGFSVVRCVTDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWR  66

Query  409  GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
            G+TC+GSAVV+I+I  LG++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTS+NL
Sbjct  67   GITCEGSAVVTIDISDLGVSGTLGYLLSDLMSLRKLDVSGNSIHDTLPYQLPPNLTSINL  126

Query  589  ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
            + NN++G++PYSIS M SL+Y+N SGNSL+ PIGD+F N   L+TLDLS NNFSGDLP+S
Sbjct  127  SRNNLSGNLPYSISAMGSLSYMNVSGNSLSMPIGDIFANHKSLSTLDLSHNNFSGDLPSS  186

Query  769  LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
            L  +S LS L VQNNQ TGS+ VL  LPL  LNVANN F+G IP EL SI    Y GNSF
Sbjct  187  LSTVSKLSALYVQNNQFTGSIVVLSGLPLKTLNVANNHFNGSIPKELSSIQTIIYDGNSF  246

Query  949  SN  954
             N
Sbjct  247  DN  248



>ref|XP_010462281.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/697 (52%), Positives = 472/697 (68%), Gaps = 37/697 (5%)
 Frame = +1

Query  271   RLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEI  450
              L F+  ATD +D  AL  L+ S++SP+QL+ W A+ GDPCG++W+GVTC GS V  I++
Sbjct  20    ELRFIHGATDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQNWRGVTCSGSRVTQIKL  79

Query  451   PGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSIS  630
             PGL L+GT+GYML+  TSL ELDLSSN +   +PYQLPPNL  LNLANN  TG+  YSIS
Sbjct  80    PGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSIS  139

Query  631   LMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQN  810
              MT L YLN   N     I   F+  + LTTLD SFN+F+  LP +   L++L  L +QN
Sbjct  140   HMTPLKYLNLGHNQFKGQIAIDFSKLNSLTTLDFSFNSFTNSLPGTFTSLTSLKSLYLQN  199

Query  811   NQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftpp  990
             NQ +G+++VL  LPL  LN+ANN F+GWIP+ L  I   +  GNSF+  PAPPPPP TPP
Sbjct  200   NQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLKGITLIK-DGNSFNTGPAPPPPPGTPP  258

Query  991   ppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsai  1170
                       H +P S K+ G +   S  ++ +         GA     +  S +V++A+
Sbjct  259   I---------HGSP-SRKSGGHESRSSGDQSTSNGDSKKSGIGAGAIAGIIISLLVVTAL  308

Query  1171  vvivYCLRRCKKKEFAA-----RTSTGSLPLSTDKEVLDQRAKSTATV----------VD  1305
             +V  +  +R K K  ++     +T      L+++    +   +S+ +V          ++
Sbjct  309   LVAFFLFKRKKTKRSSSSLDIEKTDNQPFTLASNDFHENNSIQSSTSVETKKLDTSLSIN  368

Query  1306  LKPPPSEK---VTIERMQGKNGSLRRS----PITATPYTVAVLQTATNSFSQENLVGEGS  1464
             L+PPP ++      +    K  ++++S    P     Y+VA LQ AT SFS +NL+GEG+
Sbjct  369   LRPPPVDRNKSFDDDDSTRKPSTVKKSMVVVPSHVKVYSVADLQIATGSFSVDNLLGEGT  428

Query  1465  LGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQ  1644
              GRVYRA+F +GKVLA+KK+DS+AL     D+F+E +S ++ L HPN+  LVGYCAEHGQ
Sbjct  429   FGRVYRAEFDDGKVLAVKKIDSSALPHGMTDDFIEMVSKIASLNHPNVTKLVGYCAEHGQ  488

Query  1645  RLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFK  1824
              L+VY++  NGSLHD LH ++E S+ L WN+RV++ALGTARALEYLHEVC PS+V +N K
Sbjct  489   HLVVYEFHKNGSLHDFLHLSEEESKGLVWNSRVKIALGTARALEYLHEVCSPSIVDKNIK  548

Query  1825  SANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYS  2004
             SANILLD ELNPHLSD GLA+  P  +  I+ T      GYSAPE ++SG Y++KSDVYS
Sbjct  549   SANILLDSELNPHLSDSGLASFLPAADELINQTDE----GYSAPEVSMSGQYSLKSDVYS  604

Query  2005  FGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRF  2184
             FGVVMLELLTGRKP DS++ RSEQSLVRWATPQLHDIDAL KMVDPAL G+YP KSLSRF
Sbjct  605   FGVVMLELLTGRKPFDSTKSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRF  664

Query  2185  ADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIR  2295
             AD+IALCVQPEPEFRPPMSEVVQALV LVQRA++  R
Sbjct  665   ADVIALCVQPEPEFRPPMSEVVQALVVLVQRANMSKR  701



>ref|XP_010235400.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Brachypodium distachyon]
Length=712

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/683 (52%), Positives = 458/683 (67%), Gaps = 42/683 (6%)
 Frame = +1

Query  304   NDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGY  483
             N + AL V Y ++NSP QL  W +   DPCG+SW G+TC GS V +I++ G+GLNGT+GY
Sbjct  31    NQMTALNVFYTTMNSPPQLKNWVSQNADPCGQSWNGITCLGSRVTTIKLSGMGLNGTLGY  90

Query  484   MLNGFTSLKELDLSSNEIH-DLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNF  660
              +N  T+L +LD+S+N +    IPY LPPNL  LNLA N+ TG+ PYSIS M +L  LN 
Sbjct  91    NMNLLTALVQLDMSNNNLGGSDIPYNLPPNLEKLNLAGNHFTGTTPYSISQMFALKDLNL  150

Query  661   SGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVL  840
             + N ++  I DMF   ++LTT+DLS+N FS ++P S   L++L+ L +QNNQ +G+++VL
Sbjct  151   AHNQIST-ISDMFNQLTNLTTMDLSYNAFSANIPQSFNSLTSLTTLYLQNNQFSGTIDVL  209

Query  841   VDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTN  1020
              +LPLTDLN+ANNRF+GW+P++L  I   + +GNSFSN PAPPPPP T  PP  P +   
Sbjct  210   ANLPLTDLNIANNRFTGWVPDKLKKIRTLQTAGNSFSNGPAPPPPPGTTSPPQGPQR---  266

Query  1021  HSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRC  1200
              + P  +   GS D+ S H          +K GA+ GIV+    V         + ++R 
Sbjct  267   PALPSRNGNNGSSDSGSKHSK--------LKGGAVAGIVICLLVVSAIVAF---FVIKRK  315

Query  1201  KKKEFAARTSTGSLPLSTDKEVLDQRA--KSTATV----------VDLKPPPSEKVTIER  1344
               K    R    + PLS     L Q    K  +T+          + LKPP   K+ + +
Sbjct  316   SWKLSRGRDPEQNEPLSPLASGLKQMKSIKIISTIGKDQLQKTVSMSLKPP--TKIDMHK  373

Query  1345  MQGKNG----SLRR----SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNG  1500
                +N     S+ R    S I    YTVA LQ AT SFS  N + EGS GRV++A   + 
Sbjct  374   SFDENDLTSKSVTRKISLSSIRTPAYTVADLQVATGSFSANNFISEGSFGRVFKAQLNDQ  433

Query  1501  KVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGS  1680
             KVLA+KK++ +A      D F+E ++N+SRL HPN+  LVGYC+EHGQ LLVY++  NGS
Sbjct  434   KVLAVKKINFSAFPSYPSDLFIELVANISRLNHPNLAELVGYCSEHGQCLLVYEFYENGS  493

Query  1681  LHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNP  1860
             LHD+L+  D++S+ L+WN RV++ALG+ARALEYLHE C PSV+H+NFKS+NILLD ELNP
Sbjct  494   LHDLLNLVDDQSKPLSWNNRVKIALGSARALEYLHETCSPSVIHKNFKSSNILLDNELNP  553

Query  1861  HLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGR  2040
             HLSD G A L PN E Q S  +     GY APE  +SG Y++KSDVYSFGVVMLELLTGR
Sbjct  554   HLSDSGYADLIPNQEFQESEENS----GYRAPELTMSGQYSLKSDVYSFGVVMLELLTGR  609

Query  2041  KPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEP  2220
             KP D SR RSEQSLVRWATPQLHDIDAL +MVDPAL G+YP+KSLSRFAD IALCVQ EP
Sbjct  610   KPFDRSRPRSEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQAEP  669

Query  2221  EFRPPMSEVVQALVRLVQRASVV  2289
             EFRPPMSEVVQ+LVRLVQRA++ 
Sbjct  670   EFRPPMSEVVQSLVRLVQRANIT  692



>dbj|BAD37979.1| putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
 dbj|BAG99301.1| unnamed protein product [Oryza sativa Japonica Group]
Length=558

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/570 (61%), Positives = 426/570 (75%), Gaps = 29/570 (5%)
 Frame = +1

Query  694   MFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVA  873
             MF N + L+ LD+SFNN +G+LP SL  LSN+S + +QNNQL+G++NVL +L LT LN+A
Sbjct  1     MFGNLTALSELDVSFNNLNGNLPISLRSLSNISGIYLQNNQLSGTVNVLSNLSLTTLNIA  60

Query  874   NNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHST-PGSHKTP  1050
             NN FSG IP E  SI      GNSF N P+ PP   T PP G+P      +T P   + P
Sbjct  61    NNNFSGSIPQEFSSISHLILGGNSFLNVPSSPPSTITSPPQGQPDFPQGPTTAPNIPEIP  120

Query  1051  GSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFA----  1218
                D  SD +         ++ G ++GIV+GS A     +  +V CL   +K +      
Sbjct  121   --IDQGSDKKQR-------LRTGLVIGIVIGSMAAACGVLFALVLCLHNVRKSKDGGISE  171

Query  1219  ----ARTSTGSLPLSTDKEVLD---QRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRRS  1377
                 A T   ++  ++++E+ D   Q A  +++V+    PP  K+T ER+   N S+ + 
Sbjct  172   SKDVASTFAVNIDRASNREIWDHTQQDAPVSSSVL----PPMGKMTPERVYSTNSSMSKK  227

Query  1378  ---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQ  1548
                 +TA PYTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGKVLA+KK+DSA+LSL 
Sbjct  228   MKVSVTANPYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGKVLAVKKIDSASLSLY  287

Query  1549  EEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLT  1728
             EEDNFLE +S++SRLRHPNIVPL GYC EHGQRLLVY++IGNG+LHD+LHF D+ S++LT
Sbjct  288   EEDNFLEVVSSISRLRHPNIVPLAGYCVEHGQRLLVYEHIGNGTLHDILHFFDDTSKILT  347

Query  1729  WNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTER  1908
             WN R+R+ALGTARALEYLHEVCLP VVHRN KSANILLD+E +PHLSDCGLAALTPN ER
Sbjct  348   WNHRMRIALGTARALEYLHEVCLPPVVHRNLKSANILLDKEYSPHLSDCGLAALTPNPER  407

Query  1909  QISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVR  2088
             ++ ST V GSFGYSAPEFA+SG+YTVKSDVYSFGVVMLELLT RKPLDSSRERSEQSLV 
Sbjct  408   EV-STEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTARKPLDSSRERSEQSLVT  466

Query  2089  WATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRL  2268
             WATPQLHDIDAL+KMVDPA++GMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ LVRL
Sbjct  467   WATPQLHDIDALAKMVDPAMDGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQLVRL  526

Query  2269  VQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             VQRAS+V R+  ++ G +Y+ PD +  + D
Sbjct  527   VQRASMVRRQSGEDVGLSYRGPDREGGTAD  556



>gb|KCW53999.1| hypothetical protein EUGRSUZ_J03194, partial [Eucalyptus grandis]
Length=708

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/730 (48%), Positives = 452/730 (62%), Gaps = 54/730 (7%)
 Frame = +1

Query  226   FLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESW  405
             + F  + L++  + + +  V + TD  D+ AL V+Y SLNSPS L+GWK+ GGDPCGESW
Sbjct  8     YHFGVLALLVTCIGTLIPSVHSKTDAPDVSALNVMYSSLNSPSALTGWKSGGGDPCGESW  67

Query  406   KGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLN  585
             KG+ C GS+V  I++  LGL G++GY L+   S+   DLS N +   IPYQLPPN   ++
Sbjct  68    KGIKCSGSSVTEIKLSDLGLTGSIGYQLSSLKSVTYFDLSENNLRGDIPYQLPPNALHID  127

Query  586   LANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPA  765
             L++N  TG++PYSIS MT L YLN   N +   + DMF     L TLDLS+N+ SG+LP 
Sbjct  128   LSSNAFTGNVPYSISQMTDLKYLNLGHNQVKGQLSDMFGKLPKLATLDLSYNSLSGNLPQ  187

Query  766   SLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNS  945
             S G LS+L+ L +QNNQ TG +NVL DLPL DLNVANN+F+GW+PN L  I   E  GNS
Sbjct  188   SFGSLSSLTKLHLQNNQFTGPINVLTDLPLNDLNVANNQFTGWVPNALKDIDNIETEGNS  247

Query  946   FSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAi  1125
             +S                     +  S PG+ +   S          +G    G+  G +
Sbjct  248   WS---------------------SGPSPPGASRAKKSSKEGDGKSGVSGLAIAGIVMGVL  286

Query  1126  vgivlgssavvlsaivvivYCL---RRCKKKEF---AARTSTGSLPLSTDK--EVLDQRA  1281
             V + +  +     +     + L   R  +++ F   ++R  T  L   T K   VLD   
Sbjct  287   VVLAVLIALFSKRSSSPSSHFLDEERASQRRAFTPLSSRELTHDLRAETRKSFRVLDVDR  346

Query  1282  KSTAT-----VVDLKPPPS-----------EKVTIERMQGKNGSLRRSPITATPYTVAVL  1413
             KS  +     V  L+  PS           E +       +  + R +   AT Y +A L
Sbjct  347   KSVESSASIDVKALEKSPSIGFRSPLHNRMESLKDNEFASRLNARRSTSFRATAYNLADL  406

Query  1414  QTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRL  1593
             Q+AT +F+   L+GEGS+GRVYRA + +GKVLA+KK+DS+    +  D F E ++ +S L
Sbjct  407   QSATGNFATGRLIGEGSVGRVYRAKYADGKVLAVKKIDSSLFQGRRTDEFSEIVAKISML  466

Query  1594  RHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARAL  1773
              HPNI  LVGYC+E    +LVY+Y  NGSLH+ LH +D+ S+ LTWN RVR+ALGTARA+
Sbjct  467   HHPNIAELVGYCSEQRHNMLVYEYFRNGSLHEFLHLSDDYSKPLTWNTRVRIALGTARAV  526

Query  1774  EYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSA  1953
             EYLHEVC PSVVH+N KS+NILLD ELNP ++DCGLA     T + +         GY+A
Sbjct  527   EYLHEVCSPSVVHKNIKSSNILLDIELNPRITDCGLATFHQRTSQNL-------GVGYNA  579

Query  1954  PEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKM  2133
             PE      YT+KSDVYSFGVV LELLTGR PLDSS+ RSEQ LVRWATPQLHDIDAL +M
Sbjct  580   PECTKPSAYTLKSDVYSFGVVTLELLTGRMPLDSSKPRSEQCLVRWATPQLHDIDALGRM  639

Query  2134  VDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDES  2313
             VDPAL G+YP KS+SRFADIIALCVQ EPEFRPPMSEVV+ALVRLVQR+S  + +  +  
Sbjct  640   VDPALRGLYPPKSVSRFADIIALCVQSEPEFRPPMSEVVEALVRLVQRSS--MNKRGESP  697

Query  2314  GFAYKTPDHD  2343
             G + +  D D
Sbjct  698   GASRRMDDFD  707



>ref|XP_010034888.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Eucalyptus 
grandis]
Length=716

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/725 (47%), Positives = 450/725 (62%), Gaps = 49/725 (7%)
 Frame = +1

Query  226   FLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESW  405
             + F  + L++  + + +  V + TD  D+ AL V+Y SLNSPS L+GWK+ GGDPCGESW
Sbjct  21    YHFGVLALLVTCIGTLIPSVHSKTDAPDVSALNVMYSSLNSPSALTGWKSGGGDPCGESW  80

Query  406   KGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLN  585
             KG+ C GS+V  I++  LGL G++GY L+   S+   DLS N +   IPYQLPPN   ++
Sbjct  81    KGIKCSGSSVTEIKLSDLGLTGSIGYQLSSLKSVTYFDLSENNLRGDIPYQLPPNALHID  140

Query  586   LANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPA  765
             L++N  TG++PYSIS MT L YLN   N +   + DMF     L TLDLS+N+ SG+LP 
Sbjct  141   LSSNAFTGNVPYSISQMTDLKYLNLGHNQVKGQLSDMFGKLPKLATLDLSYNSLSGNLPQ  200

Query  766   SLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNS  945
             S G LS+L+ L +QNNQ TG +NVL DLPL DLNVANN+F+GW+PN L  I   E  GNS
Sbjct  201   SFGSLSSLTKLHLQNNQFTGPINVLTDLPLNDLNVANNQFTGWVPNALKDIDNIETEGNS  260

Query  946   FSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAi  1125
             +S                     +  S PG+ +   S          +G    G+  G +
Sbjct  261   WS---------------------SGPSPPGASRAKKSSKEGDGKSGVSGLAIAGIVMGVL  299

Query  1126  vgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEV-----LDQRAKST  1290
             V + +  +     +     + L   +  +  A T   S  L+ D        +D+++  +
Sbjct  300   VVLAVLIALFSKRSSSPSSHFLDEERASQRRAFTPLSSRELTHDLRAETLLDVDRKSVES  359

Query  1291  ATVVDLK---PPPS-----------EKVTIERMQGKNGSLRRSPITATPYTVAVLQTATN  1428
             +  +D+K     PS           E +       +  + R +   AT Y +A LQ+AT 
Sbjct  360   SASIDVKALEKSPSIGFRSPLHNRMESLKDNEFASRLNARRSTSFRATAYNLADLQSATG  419

Query  1429  SFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNI  1608
             +F+   L+GEGS+GRVYRA + +GKVLA+KK+DS+    +  D F E ++ +S L HPNI
Sbjct  420   NFATGRLIGEGSVGRVYRAKYADGKVLAVKKIDSSLFQGRRTDEFSEIVAKISMLHHPNI  479

Query  1609  VPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHE  1788
               LVGYC+E    +LVY+Y  NGSLH+ LH +D+ S+ LTWN RVR+ALGTARA+EYLHE
Sbjct  480   AELVGYCSEQRHNMLVYEYFRNGSLHEFLHLSDDYSKPLTWNTRVRIALGTARAVEYLHE  539

Query  1789  VCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFAL  1968
             VC PSVVH+N KS+NILLD ELNP ++DCGLA     T + +         GY+APE   
Sbjct  540   VCSPSVVHKNIKSSNILLDIELNPRITDCGLATFHQRTSQNL-------GVGYNAPECTK  592

Query  1969  SGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPAL  2148
                YT+KSDVYSFGVV LELLTGR PLDSS+ RSEQ LVRWATPQLHDIDAL +MVDPAL
Sbjct  593   PSAYTLKSDVYSFGVVTLELLTGRMPLDSSKPRSEQCLVRWATPQLHDIDALGRMVDPAL  652

Query  2149  NGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYK  2328
              G+YP KS+SRFADIIALCVQ EPEFRPPMSEVV+ALVRLVQR+S  + +  +  G + +
Sbjct  653   RGLYPPKSVSRFADIIALCVQSEPEFRPPMSEVVEALVRLVQRSS--MNKRGESPGASRR  710

Query  2329  TPDHD  2343
               D D
Sbjct  711   MDDFD  715



>gb|ADM07445.1| leucine-rich repeat receptor-like protein kinase [Glycine soja]
Length=714

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/716 (51%), Positives = 469/716 (66%), Gaps = 46/716 (6%)
 Frame = +1

Query  283   VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLG  462
             +   TDPND+ +L+VL+ S+NSPSQL+ W  +G DPCG+SW+G+TC G+ V  I++PG  
Sbjct  20    INGDTDPNDVTSLKVLFQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRS  76

Query  463   LNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTS  642
             L+G++GY L   +S+  LDLS+N I   IPYQ PPNL  LNLANNN  G+IPYS+S  TS
Sbjct  77    LSGSLGYQLEPLSSVTNLDLSNNNIGGTIPYQFPPNLQYLNLANNNFNGAIPYSLSEKTS  136

Query  643   LNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLT  822
             L  LN   N L Q +   F   S L+TLDLSFN+ +GDLP ++  LS++  + +QNNQ T
Sbjct  137   LVILNLGHNQLQQALNVDFQKLSSLSTLDLSFNSLTGDLPQTMSSLSSIRTMYLQNNQFT  196

Query  823   GSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgr  1002
             G+++VL +LPL  LNV NN F+GWIP +L +I   +  GN +S+ PAPPPPP TPP    
Sbjct  197   GTIDVLANLPLGTLNVGNNHFTGWIPEQLNNI--IQKDGNEWSSGPAPPPPPGTPPVVS-  253

Query  1003  pHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivviv  1182
               +  NH + G          HS  + G+ +G          GI     ++++   +V  
Sbjct  254   --RNRNHKSGG----------HSPSDAGSSDGGGKKSGIGGSGIAGIVISILVVGAIVAF  301

Query  1183  YCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVD------------LKPPP--  1320
             + ++R  KK F       + PL+   EV +  +  T+ V D            LKPPP  
Sbjct  302   FLVKRRSKKSFNDVEKLDNQPLAQ-HEVHEMNSMQTSPVTDFKTFDTSAAPISLKPPPFD  360

Query  1321  ----------SEKVTIERMQGKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLG  1470
                       S K  I     K      +P     Y++A LQ AT SFS E L+GEGS G
Sbjct  361   RRKSFDEDEFSNKPVIVNKPTKVKKTVTAPANVKSYSIADLQIATESFSVEQLLGEGSFG  420

Query  1471  RVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRL  1650
             RVYRA F +GKVLA+KK+DS+ L     D+F+E +SN+S+L  PN+  LVGYC+EHGQ L
Sbjct  421   RVYRAQFDDGKVLAVKKIDSSVLPNDMSDDFVELVSNISQLHDPNVTELVGYCSEHGQHL  480

Query  1651  LVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSA  1830
             LVY++  NGSLHD LH  DE S+ L WN+RV++ALG ARALEYLHEVC PSVVH+N KSA
Sbjct  481   LVYEFHKNGSLHDFLHLPDECSKPLIWNSRVKIALGIARALEYLHEVCSPSVVHKNIKSA  540

Query  1831  NILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFG  2010
             NILLD + NPHLSD GLA+  PN  + +++    GS GY APE  LSG YT+KSDVYSFG
Sbjct  541   NILLDTDFNPHLSDSGLASYIPNANQVLNNN--AGS-GYEAPEVGLSGHYTLKSDVYSFG  597

Query  2011  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFAD  2190
             VVMLELL+GRKP DSSR RSEQ+LVRWA PQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  598   VVMLELLSGRKPFDSSRPRSEQALVRWAAPQLHDIDALAKMVDPALEGLYPVKSLSRFAD  657

Query  2191  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             +IALCVQPEPEFRPPMSEVVQALVRLVQR ++  R +  + G + +  D +  + D
Sbjct  658   VIALCVQPEPEFRPPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDNQDTQD  713



>gb|EMT02096.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Aegilops tauschii]
Length=690

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/713 (50%), Positives = 460/713 (65%), Gaps = 72/713 (10%)
 Frame = +1

Query  280   FVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGL  459
              V A TD  DL AL  L+ SLNSP QL GW+ +GGDPCGESW+G+TC GS+V +I++P L
Sbjct  23    LVAATTDATDLTALNTLFTSLNSPGQLKGWQVNGGDPCGESWQGITCSGSSVTAIKLPSL  82

Query  460   GLNGTMGYMLNGFTSLKELDLSSNEIH--DLIPYQLPPNLTSLNLANNNITGSIPYSISL  633
             GL+G +GY +N  +SL E+D+S N +     I Y LP                       
Sbjct  83    GLSGNLGYNMNTMSSLVEIDMSQNSLGGGQAIQYNLP-----------------------  119

Query  634   MTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNN  813
                L  LN + N L   + D+F+N   LTT+DLSFN+ +GDLP  L  LS++  L +QNN
Sbjct  120   TAKLERLNLNHNQLQGKMTDVFSNLGSLTTVDLSFNSLTGDLPEGLSSLSSVKTLYLQNN  179

Query  814   QLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppp  993
             QLTGS+NVL DLPL+DLNVANNRF+GWIP++L  I   +  GNS++  PAPPPPPFT PP
Sbjct  180   QLTGSINVLADLPLSDLNVANNRFTGWIPSQLKKINSLQTDGNSWTTGPAPPPPPFTAPP  239

Query  994   pgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaiv  1173
               R + R         K+P   DN S   +G      G  AG ++ +++  + +    I 
Sbjct  240   SNRRNGR---------KSPAKKDNGSSSSDGKSGISGGAVAGIVISLLVVGAIIAFFVIK  290

Query  1174  vivYCLRRCKKKE-FAARTSTGSLPLSTDKEVLDQRAKSTATVVD-----------LKPP  1317
                   R+ K++E F       S P     EV D +    +T +D           LKPP
Sbjct  291   RK----RKSKREEHFEQHQPFTSFP---SNEVKDTKPFEESTTIDVDSLASPASVGLKPP  343

Query  1318  PSEKVTIERMQGKNGSL--------RRS---PITATPYTVAVLQTATNSFSQENLVGEGS  1464
                   IER +  +           R+S   PI A  Y+VA LQ AT+SFS +NLVGEG+
Sbjct  344   ----AKIERNKSFDDDDDFSSKPVARKSSTKPIKAVVYSVADLQIATDSFSMDNLVGEGT  399

Query  1465  LGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQ  1644
              GRVYR+ F +GKVLA+KK+D   +  Q  ++F+E +SN+S L HPN+  LVGYC EHGQ
Sbjct  400   FGRVYRSQFNDGKVLAVKKLDCTVIPFQSSEDFVELVSNISILHHPNLNELVGYCMEHGQ  459

Query  1645  RLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFK  1824
              LLVYD+  NGSLHD+LH +DE S+ L+WN+R+++ALG+ARALEYLHEVC PSVVH+NFK
Sbjct  460   HLLVYDFHRNGSLHDLLHLSDEYSKPLSWNSRIKIALGSARALEYLHEVCSPSVVHKNFK  519

Query  1825  SANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYS  2004
             S+NILLD E NPH+SD GLA+  P+ E Q +      S G +APE  ++G YT+KSDVYS
Sbjct  520   SSNILLDSEYNPHVSDAGLASFIPDAEFQTAEQ----SAGCTAPEVDMTGQYTMKSDVYS  575

Query  2005  FGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRF  2184
             FGVVMLELLTGRKP +SS+ RSEQSLVRWA+PQLHDIDAL +MVDPAL G+YPAKSLSRF
Sbjct  576   FGVVMLELLTGRKPFESSKPRSEQSLVRWASPQLHDIDALDRMVDPALKGLYPAKSLSRF  635

Query  2185  ADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             AD++ALCVQ EPEFRPPMSEVVQALVRLVQRA++  +    ++       D D
Sbjct  636   ADVLALCVQAEPEFRPPMSEVVQALVRLVQRANMTKKMLDGDASRRGDDQDQD  688



>ref|XP_010928424.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Elaeis guineensis]
Length=619

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/372 (81%), Positives = 339/372 (91%), Gaps = 4/372 (1%)
 Frame = +1

Query  1249  STDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRRS--PITATPYTVAVLQTA  1422
             +TDKE+ +QR +S A+V  LKPPP EK+ +E++ GKNGS ++   PITAT YTVA LQ A
Sbjct  247   ATDKEMREQRLES-ASVTSLKPPPVEKMMVEKVYGKNGSGKKPKVPITATSYTVASLQIA  305

Query  1423  TNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHP  1602
             TNSFSQ++L+GEGSLGRVYRA+F NGKVLA+KK+DSAALSLQEEDN+LEA+S+MSRL+HP
Sbjct  306   TNSFSQDSLLGEGSLGRVYRAEFSNGKVLAVKKIDSAALSLQEEDNYLEAVSSMSRLKHP  365

Query  1603  NIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYL  1782
             NIV LVGYC EHGQRLLVY+YIGN +LHDMLHFAD+ S  +TWNARVR+ALGTARALEYL
Sbjct  366   NIVTLVGYCVEHGQRLLVYEYIGNATLHDMLHFADDSSTKVTWNARVRIALGTARALEYL  425

Query  1783  HEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEF  1962
             HEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQ+ ST VVGSFGYSAPEF
Sbjct  426   HEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQV-STEVVGSFGYSAPEF  484

Query  1963  ALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDP  2142
             A+SG+YTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDAL+KMVDP
Sbjct  485   AMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDP  544

Query  2143  ALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFA  2322
             ALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ LVRL+QRAS+V R   DE G++
Sbjct  545   ALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRSSGDELGYS  604

Query  2323  YKTPDHDAASGD  2358
             Y+  +H+A++ D
Sbjct  605   YRISEHEASTTD  616


 Score =   228 bits (582),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +1

Query  283  VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLG  462
            V +ATDP+D+QAL VLY SLNSP QLSGW +SGGDPC +SWKG+TC GSAV +I++ G+G
Sbjct  21   VESATDPSDVQALGVLYSSLNSPPQLSGWTSSGGDPCRDSWKGITCSGSAVTAIQVSGMG  80

Query  463  LNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTS  642
            LNGT+GY+L+   SLK LD+S+N + + IPYQLPPNLT LNLA  N++GS+P+SIS M S
Sbjct  81   LNGTLGYLLSDLLSLKTLDISNNNLREGIPYQLPPNLTYLNLAKANLSGSLPFSISTMVS  140

Query  643  LNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLT  822
            LNY N S NSL+Q IGD+F N  DL+ LD+SFNN +GDLP SL  LSNLS L +Q+NQLT
Sbjct  141  LNYFNLSHNSLSQQIGDIFANLQDLSELDISFNNLTGDLPNSLSSLSNLSSLYLQDNQLT  200

Query  823  G  825
            G
Sbjct  201  G  201



>ref|XP_002513297.1| strubbelig receptor, putative [Ricinus communis]
 gb|EEF48700.1| strubbelig receptor, putative [Ricinus communis]
Length=694

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/713 (49%), Positives = 452/713 (63%), Gaps = 39/713 (5%)
 Frame = +1

Query  250   VIAALISRLGFVG----AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVT  417
             ++  LI  LGF+     + T+  D+ AL V++  LNSPSQLSGWK+SGGDPC +SW+G+T
Sbjct  5     LVGFLIVSLGFLSTLAHSKTNSQDVSALNVMFTGLNSPSQLSGWKSSGGDPCDDSWEGIT  64

Query  418   CQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANN  597
             C GS+V  I++ GLGL+G+MGY L+   S+   D+S N + + IPYQLPPN   L+L+NN
Sbjct  65    CSGSSVTQIKLSGLGLSGSMGYQLSNLKSVTYFDMSKNNLDNDIPYQLPPNTAHLDLSNN  124

Query  598   NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
               +G++PYSIS MT L YLN   N L   + DMF     L +LDLS+N+ SG+LP S   
Sbjct  125   GFSGNVPYSISQMTDLEYLNLGHNQLNGQLSDMFQKLPKLKSLDLSYNSLSGNLPQSFAS  184

Query  778   LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNS  957
             LS+L+ LR+Q+N+ TGS+NVL  LPL  L+V +N FSGW+P+EL  I   E  GNS+S+ 
Sbjct  185   LSSLNTLRLQDNKFTGSINVLAGLPLDTLDVEDNEFSGWVPDELEGIENIETGGNSWSSG  244

Query  958   papppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgiv  1137
             PAPPPPP          K+  H      K  G  D  S      G     +   ++V + 
Sbjct  245   PAPPPPPGAKSISA---KQKEH-----EKGAGGKDGMS------GLSIALIVLASLVVVA  290

Query  1138  lgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDK---EVLDQRAKSTATV---  1299
             L              + L   +  +  A T   S  LS D    E  D  A    T+   
Sbjct  291   LLIILFSTRKSSPSSHFLDEERASQRRAFTPLSSQELSNDSHKTEPFDSIAIDIKTMQKS  350

Query  1300  --VDLKPPPS---EKVTIERMQGKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEGS  1464
               V  KPP S   + +          + R + + A  Y++A LQTAT +F+   L+GEGS
Sbjct  351   PSVSYKPPHSDFAQSLNDNEFASHLNARRNTSVRAVSYSLADLQTATGNFAMGRLLGEGS  410

Query  1465  LGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQ  1644
             +GRVYRA +P+GKVLA+KK+DS+       + F   +S++S++ HPNI  L+GYC+E G 
Sbjct  411   IGRVYRAKYPDGKVLAVKKIDSSLFQSGRPEEFSGIVSSISKVYHPNIAELLGYCSEQGH  470

Query  1645  RLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFK  1824
              +L+Y+Y  NGSLHD LH +D+ S+ LTWN RVR+ALGTARA+EYLHEVC PS VH+N K
Sbjct  471   NMLIYEYYRNGSLHDFLHMSDDYSKPLTWNTRVRIALGTARAVEYLHEVCSPSYVHKNIK  530

Query  1825  SANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYS  2004
             S+NILLD ELNPHLSD GLA     T + +         GY+APE      YT KSD+YS
Sbjct  531   SSNILLDLELNPHLSDYGLANFHHRTSQNL-------GVGYNAPECTRPSAYTSKSDIYS  583

Query  2005  FGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRF  2184
             FGVVMLELLTGR P D+S+ RSEQ L RWATPQLHDIDAL+ MVDPAL G+YP KSLSRF
Sbjct  584   FGVVMLELLTGRMPFDNSKPRSEQCLARWATPQLHDIDALANMVDPALRGLYPTKSLSRF  643

Query  2185  ADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             ADIIALCVQ EPEFRPPMSEVVQALVRLVQR+S+ +R   D+   + +T + D
Sbjct  644   ADIIALCVQSEPEFRPPMSEVVQALVRLVQRSSMKMR---DDLAASVRTEESD  693



>dbj|BAG99361.1| unnamed protein product [Oryza sativa Japonica Group]
Length=683

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/679 (52%), Positives = 451/679 (66%), Gaps = 23/679 (3%)
 Frame = +1

Query  340   LNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELD  519
             +NSPSQL+ W +  GDPCG+SW G+TC GS V +I++ G+G+NGT+GY +N  TSL ELD
Sbjct  1     MNSPSQLTNWVSQNGDPCGQSWLGITCSGSRVTAIKLSGMGINGTLGYNMNLLTSLVELD  60

Query  520   LSSNEIHDL-IPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDM  696
              S N +    IPY LPPNL  LNLA NN TGSIPYSIS M +L  LN   N LA    DM
Sbjct  61    TSKNNLGGSDIPYNLPPNLERLNLAENNFTGSIPYSISQMIALRILNLGHNHLAT-TNDM  119

Query  697   FTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVAN  876
             F   ++LTTLDLS+N  SG++P S   L+NL  L +QNN   G+++VL DLPLTDLNVAN
Sbjct  120   FNQLTNLTTLDLSYNTLSGNIPQSFNSLTNLRKLNLQNNGFNGTIDVLADLPLTDLNVAN  179

Query  877   NRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGS  1056
             N+F+GWIP++L  I   + +GNSF + P+PPPPP+  PP   P  ++  S   +  T   
Sbjct  180   NQFTGWIPDKLKKIKNLQTNGNSFGSGPSPPPPPYQSPPYKSPPYKSPQSRQPAPPTTTV  239

Query  1057  DDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRC---KKKEFAART  1227
             ++N SD    +     G  AG +V +V+  + V    I    + L R    ++KE  +  
Sbjct  240   NNNPSDDGRKHSKLSGGAIAGIVVCLVVVGAIVAFFVIKKKYWSLPRGGDPEQKEPLSPI  299

Query  1228  STG---SLPLSTDKEVLDQRAK---STATVVDLKPPPSEKV--TIERMQGKNGSLRR---  1374
              +G   SL      +++    K        ++LKPP    +  +I+     + S  R   
Sbjct  300   VSGFKDSLKQMKSIKIISTIGKEELQKTVSMNLKPPTRIDLHKSIDENDVTSKSFTRKIS  359

Query  1375  -SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQE  1551
              S I    YTVA LQ AT SF  +NL+GEG  GRVY+A F + KVLA+KK++ +A     
Sbjct  360   FSSIRTPAYTVADLQVATGSFCADNLIGEGLFGRVYKAKFNDHKVLAVKKINFSAFPGHP  419

Query  1552  EDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTW  1731
              D F+E ++N+SRL HP++  LVGYC+EHGQ LL Y++  NGSL D+LH  D++SQ L+W
Sbjct  420   SDLFIELVANISRLNHPSLSELVGYCSEHGQCLLAYEFYRNGSLKDLLHLVDDQSQPLSW  479

Query  1732  NARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQ  1911
             N+RV++ALG+ARALEYLHE C PSV+H+NFKS+NI LD ELNPHLSD G A L PN E Q
Sbjct  480   NSRVKIALGSARALEYLHETCSPSVIHKNFKSSNIFLDNELNPHLSDSGFADLIPNRESQ  539

Query  1912  ISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRW  2091
             +S        GY APE  +SG Y+VKSDVYSFGVVMLELLTGRKP D SR RSEQSLV W
Sbjct  540   VSDEDS----GYRAPEVTMSGQYSVKSDVYSFGVVMLELLTGRKPFDRSRPRSEQSLVGW  595

Query  2092  ATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLV  2271
             ATPQLHDIDAL +MVDPAL G+YP+KSLSRFAD IALCVQ EPEFRPPMSEVVQ LVRLV
Sbjct  596   ATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQSEPEFRPPMSEVVQLLVRLV  655

Query  2272  QRASVVIRRYSDESGFAYK  2328
             QRA++   R     G +++
Sbjct  656   QRANMT--RMCGADGHSWR  672



>ref|NP_175777.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 sp|Q9C8M9.1|SRF6_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 6; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51974.1|AC024260_12 leucine-rich repeat transmembrane protein kinase 1, putative; 
10414-6710 [Arabidopsis thaliana]
 gb|AAQ89622.1| At1g53730 [Arabidopsis thaliana]
 gb|AAR99874.1| strubbelig receptor family 6 [Arabidopsis thaliana]
 dbj|BAE99117.1| LRR receptor-like protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59255.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE32990.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=719

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/716 (51%), Positives = 475/716 (66%), Gaps = 42/716 (6%)
 Frame = +1

Query  271   RLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEI  450
              L F+  ATD +D  AL  L+  ++SP+QL+ W A+ GDPCG++W+GVTC GS V  I++
Sbjct  19    ELRFIHGATDASDTSALNTLFSGMHSPAQLTQWTAAAGDPCGQNWRGVTCSGSRVTQIKL  78

Query  451   PGLGLNGTMG-YMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSI  627
              GL L+GT+G YML+  TSL ELDLSSN +   +PYQ PPNL  LNLANN  TG+  YS+
Sbjct  79    SGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDLPYQFPPNLQRLNLANNQFTGAASYSL  138

Query  628   SLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQ  807
             S +T L YLN   N     I   F+    LTTLD SFN+F+  LPA+   L++L  L +Q
Sbjct  139   SQITPLKYLNLGHNQFKGQIAIDFSKLDSLTTLDFSFNSFTNSLPATFSSLTSLKSLYLQ  198

Query  808   NNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftp  987
             NNQ +G+++VL  LPL  LN+ANN F+GWIP+ L  I   +  GNSF+  PAPPPPP TP
Sbjct  199   NNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLKGITLIK-DGNSFNTGPAPPPPPGTP  257

Query  988   pppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsa  1167
             P  G P +++           G  ++ S  E+           GA     +  S +V++A
Sbjct  258   PIRGSPSRKS-----------GGRESRSSDESTRNGDSKKSGIGAGAIAGIIISLLVVTA  306

Query  1168  ivvivYCLRRCKKKEFA----ARTSTGSLPLSTDKEVLDQRAKSTATV----------VD  1305
             ++V  +  RR K K  +     +T      L+++    +   +S+++V          ++
Sbjct  307   LLVAFFLFRRKKSKRSSPMDIEKTDNQPFTLASNDFHENNSIQSSSSVETKKLDTSLSIN  366

Query  1306  LKPPPSEK---VTIERMQGKNGSLRRS----PITATPYTVAVLQTATNSFSQENLVGEGS  1464
             L+PPP ++      E    K  ++++S    P     Y+VA LQ AT SFS +NL+GEG+
Sbjct  367   LRPPPIDRNKSFDDEDSTRKPIAVKKSTVVVPSNVRLYSVADLQIATGSFSVDNLLGEGT  426

Query  1465  LGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQ  1644
              GRVYRA+F +GKVLA+KK+DS+AL     D+F+E +S ++ L HPN+  LVGYCAEHGQ
Sbjct  427   FGRVYRAEFDDGKVLAVKKIDSSALPHGMTDDFIEMVSKIANLDHPNVTKLVGYCAEHGQ  486

Query  1645  RLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFK  1824
              L+VY++  NGSLHD LH ++E S+ L WN+RV++ALGTARALEYLHEVC PS+V +N K
Sbjct  487   HLVVYEFHKNGSLHDFLHLSEEESKALVWNSRVKIALGTARALEYLHEVCSPSIVDKNIK  546

Query  1825  SANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYS  2004
             SANILLD ELNPHLSD GLA+  P     ++ T      GYSAPE ++SG Y++KSD+YS
Sbjct  547   SANILLDSELNPHLSDSGLASFLPTANELLNQTDE----GYSAPEVSMSGQYSLKSDIYS  602

Query  2005  FGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRF  2184
             FGVVMLELLTGRKP DS+R RSEQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRF
Sbjct  603   FGVVMLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRF  662

Query  2185  ADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRY----SDESGFAYKTPDH  2340
             AD+IALCVQPEPEFRPPMSEVVQALV LVQRA++  R      S  +G A  T D+
Sbjct  663   ADVIALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRAGSADTTSDY  718



>ref|XP_003562663.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X3 [Brachypodium distachyon]
Length=1217

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/703 (52%), Positives = 470/703 (67%), Gaps = 44/703 (6%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             VVL+  A  S LG   A TD ND+ AL V Y ++NSP QL  W +   DPCG+SW G+TC
Sbjct  20    VVLLFLATAS-LG-ANANTDSNDVTALNVFYTTMNSPPQLKNWVSQNADPCGQSWNGITC  77

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDL-IPYQLPPNLTSLNLANN  597
              GS V +I++ G+GLNGT+GY +N  T+L +LD+S+N +    IPY LPPNL  LNLA N
Sbjct  78    LGSRVTTIKLSGMGLNGTLGYNMNLLTALVQLDMSNNNLGGSDIPYNLPPNLEKLNLAGN  137

Query  598   NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
             + TG+ PYSIS M +L  LN + N ++  I DMF   ++LTT+DLS+N FS ++P S   
Sbjct  138   HFTGTTPYSISQMFALKDLNLAHNQIST-ISDMFNQLTNLTTMDLSYNAFSANIPQSFNS  196

Query  778   LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNS  957
             L++L+ L +QNNQ +G+++VL +LPLTDLN+ANNRF+GW+P++L  I   + +GNSFSN 
Sbjct  197   LTSLTTLYLQNNQFSGTIDVLANLPLTDLNIANNRFTGWVPDKLKKIRTLQTAGNSFSNG  256

Query  958   papppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgiv  1137
             PAPPPPP T  PP  P +    + P  +   GS D+ S H          +K GA+ GIV
Sbjct  257   PAPPPPPGTTSPPQGPQR---PALPSRNGNNGSSDSGSKHSK--------LKGGAVAGIV  305

Query  1138  lgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRA--KSTATV----  1299
             +    V         + ++R   K    R    + PLS     L Q    K  +T+    
Sbjct  306   ICLLVVSAIVAF---FVIKRKSWKLSRGRDPEQNEPLSPLASGLKQMKSIKIISTIGKDQ  362

Query  1300  ------VDLKPPPSEKVTIERMQGKNG----SLRR----SPITATPYTVAVLQTATNSFS  1437
                   + LKPP   K+ + +   +N     S+ R    S I    YTVA LQ AT SFS
Sbjct  363   LQKTVSMSLKPP--TKIDMHKSFDENDLTSKSVTRKISLSSIRTPAYTVADLQVATGSFS  420

Query  1438  QENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPL  1617
               N + EGS GRV++A   + KVLA+KK++ +A      D F+E ++N+SRL HPN+  L
Sbjct  421   ANNFISEGSFGRVFKAQLNDQKVLAVKKINFSAFPSYPSDLFIELVANISRLNHPNLAEL  480

Query  1618  VGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCL  1797
             VGYC+EHGQ LLVY++  NGSLHD+L+  D++S+ L+WN RV++ALG+ARALEYLHE C 
Sbjct  481   VGYCSEHGQCLLVYEFYENGSLHDLLNLVDDQSKPLSWNNRVKIALGSARALEYLHETCS  540

Query  1798  PSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGV  1977
             PSV+H+NFKS+NILLD ELNPHLSD G A L PN E Q S  +     GY APE  +SG 
Sbjct  541   PSVIHKNFKSSNILLDNELNPHLSDSGYADLIPNQEFQESEENS----GYRAPELTMSGQ  596

Query  1978  YTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGM  2157
             Y++KSDVYSFGVVMLELLTGRKP D SR RSEQSLVRWATPQLHDIDAL +MVDPAL G+
Sbjct  597   YSLKSDVYSFGVVMLELLTGRKPFDRSRPRSEQSLVRWATPQLHDIDALDQMVDPALQGL  656

Query  2158  YPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASV  2286
             YP+KSLSRFAD IALCVQ EPEFRPPMSEVVQ+LVRLVQRA++
Sbjct  657   YPSKSLSRFADAIALCVQAEPEFRPPMSEVVQSLVRLVQRANI  699



>ref|XP_006845116.1| hypothetical protein AMTR_s00005p00184950 [Amborella trichopoda]
 gb|ERN06791.1| hypothetical protein AMTR_s00005p00184950 [Amborella trichopoda]
Length=381

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/370 (80%), Positives = 331/370 (89%), Gaps = 6/370 (2%)
 Frame = +1

Query  1246  LSTDKEVLDQRAKSTATVVDLKPPPSE--KVTIERMQGKNGSLRRS--PITATPYTVAVL  1413
             ++   E  +Q++K+ A + DLKPPP E  K+  +R  GK G+ +R+  PITAT Y VA L
Sbjct  8     IAASVESQEQKSKA-APITDLKPPPVEWQKIASDRTSGKPGAGKRTKAPITATSYAVAEL  66

Query  1414  QTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRL  1593
             QTATNSFSQE LVGEGSLGRVYRADF NGK+LA+KK+DS+ALSLQEEDNFLEA+SNMSRL
Sbjct  67    QTATNSFSQECLVGEGSLGRVYRADFSNGKILAVKKIDSSALSLQEEDNFLEAVSNMSRL  126

Query  1594  RHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARAL  1773
             RHPNI  L+GYCAEHGQ LLVY+Y GNG+LHDMLHF D+ S+ LTWNARVR+ALGTARAL
Sbjct  127   RHPNITTLLGYCAEHGQHLLVYEYFGNGTLHDMLHFTDDNSKALTWNARVRIALGTARAL  186

Query  1774  EYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSA  1953
             EYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQ+ ST ++GSFGYSA
Sbjct  187   EYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQV-STQMLGSFGYSA  245

Query  1954  PEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKM  2133
             PEFA+SG+YTVKSDVYSFGVVMLELLTGRKPLDSSR+RSEQSLVRWATPQLHDIDAL+KM
Sbjct  246   PEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRQRSEQSLVRWATPQLHDIDALAKM  305

Query  2134  VDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDES  2313
             VDPAL G+YPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRL+QRAS+  RR SDES
Sbjct  306   VDPALKGIYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLMQRASMNKRRSSDES  365

Query  2314  GFAYKTPDHD  2343
             G A+K PD++
Sbjct  366   GIAFKMPDYE  375



>emb|CDX82908.1| BnaC01g13580D [Brassica napus]
Length=706

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/392 (77%), Positives = 342/392 (87%), Gaps = 9/392 (2%)
 Frame = +1

Query  1186  CLRRCKKKEFAARTSTGS----LPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQG  1353
             CL + KK++    T+  S    LPLS   EV +QR K+ A +     PP +KVT++ +  
Sbjct  312   CLHKKKKRKVGESTTRASHRTSLPLSVIPEVQEQRVKTVADMKSSSSPP-DKVTVDNVM-  369

Query  1354  KNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVD  1527
             KNGSL R  SPIT + YTV+ LQ ATNSFSQEN++GEGSLGRVYRA+FPNGKV+A+KK+D
Sbjct  370   KNGSLTRMRSPITGSQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEFPNGKVMAVKKID  429

Query  1528  SAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFAD  1707
             +AALSLQEED FLEA+SNMSRLRHPNIVPL GYC EHGQRLLVY+Y+GNG+L DMLH  D
Sbjct  430   NAALSLQEEDCFLEAVSNMSRLRHPNIVPLGGYCTEHGQRLLVYEYVGNGNLDDMLHLND  489

Query  1708  ERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAA  1887
             +RS  LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSANILLDEELNPHLSDCGLAA
Sbjct  490   DRSMALTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDCGLAA  549

Query  1888  LTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRER  2067
             L PNTERQ+ ST VVGSFGYSAPEFALSG+YTVKSDVY+FGVVMLELLTGRKPLDSSR R
Sbjct  550   LNPNTERQV-STQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTR  608

Query  2068  SEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV  2247
             +EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADIIALC+QPEPEFRPPMSEV
Sbjct  609   AEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEV  668

Query  2248  VQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             VQ LVRLVQRASVV RR SD++GF+Y+TP+H+
Sbjct  669   VQQLVRLVQRASVVKRRSSDDTGFSYRTPEHE  700


 Score =   285 bits (728),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 189/239 (79%), Gaps = 1/239 (0%)
 Frame = +1

Query  241  VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
            ++LV+  L + +  V   TDP+D+QAL+VLY SLNSPSQL+ W  +GG PCGESWKGVTC
Sbjct  8    MLLVLLVLFTSIYVVRCVTDPSDVQALQVLYTSLNSPSQLTKWN-NGGGPCGESWKGVTC  66

Query  421  QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
            +GSAVVSI+I  LG++GT+GY+L+   SL++LD+S N IHD +PYQLPPNLTSLNLA NN
Sbjct  67   EGSAVVSIDISNLGVSGTLGYLLSDLMSLRKLDVSGNSIHDTLPYQLPPNLTSLNLARNN  126

Query  601  ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
            ++G++PYSIS M SL+Y+N SGNSL+  +GD+F +   L+TLDLS NNFSGDLP+SL  L
Sbjct  127  LSGNLPYSISAMGSLSYMNVSGNSLSMSVGDIFASLKSLSTLDLSHNNFSGDLPSSLSTL  186

Query  781  SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNS  957
            S LS++ VQNNQLTG+++VL  LPLT LNVANN F+G IP EL SI    Y GNSF N+
Sbjct  187  SQLSVIYVQNNQLTGTIDVLSGLPLTTLNVANNHFNGSIPKELSSIKTLIYDGNSFDNA  245



>ref|NP_001077716.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 gb|AEE32991.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=720

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/717 (51%), Positives = 475/717 (66%), Gaps = 43/717 (6%)
 Frame = +1

Query  271   RLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEI  450
              L F+  ATD +D  AL  L+  ++SP+QL+ W A+ GDPCG++W+GVTC GS V  I++
Sbjct  19    ELRFIHGATDASDTSALNTLFSGMHSPAQLTQWTAAAGDPCGQNWRGVTCSGSRVTQIKL  78

Query  451   PGLGLNGTMG-YMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSI  627
              GL L+GT+G YML+  TSL ELDLSSN +   +PYQ PPNL  LNLANN  TG+  YS+
Sbjct  79    SGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDLPYQFPPNLQRLNLANNQFTGAASYSL  138

Query  628   SLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQ  807
             S +T L YLN   N     I   F+    LTTLD SFN+F+  LPA+   L++L  L +Q
Sbjct  139   SQITPLKYLNLGHNQFKGQIAIDFSKLDSLTTLDFSFNSFTNSLPATFSSLTSLKSLYLQ  198

Query  808   NNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftp  987
             NNQ +G+++VL  LPL  LN+ANN F+GWIP+ L  I   +  GNSF+  PAPPPPP TP
Sbjct  199   NNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLKGITLIK-DGNSFNTGPAPPPPPGTP  257

Query  988   pppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsa  1167
             P  G P +++           G  ++ S  E+           GA     +  S +V++A
Sbjct  258   PIRGSPSRKS-----------GGRESRSSDESTRNGDSKKSGIGAGAIAGIIISLLVVTA  306

Query  1168  ivvivYCLRRCKKKEFA----ARTSTGSLPLSTDKEVLDQRAKSTATV----------VD  1305
             ++V  +  RR K K  +     +T      L+++    +   +S+++V          ++
Sbjct  307   LLVAFFLFRRKKSKRSSPMDIEKTDNQPFTLASNDFHENNSIQSSSSVETKKLDTSLSIN  366

Query  1306  LKPPPSEK---VTIERMQGKNGSLRRS----PITATPYTVAVLQTATNSFSQENLVGEGS  1464
             L+PPP ++      E    K  ++++S    P     Y+VA LQ AT SFS +NL+GEG+
Sbjct  367   LRPPPIDRNKSFDDEDSTRKPIAVKKSTVVVPSNVRLYSVADLQIATGSFSVDNLLGEGT  426

Query  1465  LGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQ  1644
              GRVYRA+F +GKVLA+KK+DS+AL     D+F+E +S ++ L HPN+  LVGYCAEHGQ
Sbjct  427   FGRVYRAEFDDGKVLAVKKIDSSALPHGMTDDFIEMVSKIANLDHPNVTKLVGYCAEHGQ  486

Query  1645  RLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFK  1824
              L+VY++  NGSLHD LH ++E S+ L WN+RV++ALGTARALEYLHEVC PS+V +N K
Sbjct  487   HLVVYEFHKNGSLHDFLHLSEEESKALVWNSRVKIALGTARALEYLHEVCSPSIVDKNIK  546

Query  1825  SANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYS  2004
             SANILLD ELNPHLSD GLA+  P     ++ T      GYSAPE ++SG Y++KSD+YS
Sbjct  547   SANILLDSELNPHLSDSGLASFLPTANELLNQTDE----GYSAPEVSMSGQYSLKSDIYS  602

Query  2005  FGVVMLELLTGRKPLDSS-RERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSR  2181
             FGVVMLELLTGRKP DSS R RSEQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSR
Sbjct  603   FGVVMLELLTGRKPFDSSTRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSR  662

Query  2182  FADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRY----SDESGFAYKTPDH  2340
             FAD+IALCVQPEPEFRPPMSEVVQALV LVQRA++  R      S  +G A  T D+
Sbjct  663   FADVIALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRAGSADTTSDY  719



>ref|XP_010534991.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Tarenaya 
hassleriana]
Length=718

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/705 (50%), Positives = 474/705 (67%), Gaps = 37/705 (5%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             ++L I  L  R  F+  ATD +D  AL  ++ S+NSPSQLS WK  GGDPCGE+W+G+TC
Sbjct  12    LILCIVGLEPR--FIHGATDSSDTSALNTMHSSMNSPSQLSQWKPWGGDPCGENWQGITC  69

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
               S V  +++P LGL+G++GYML+  T++ E DLS+N +   +PY LPPN+  LNLANN 
Sbjct  70    LDSRVTQVKLPNLGLSGSLGYMLDKLTAVTEFDLSNNNLGGDLPYNLPPNVQQLNLANNQ  129

Query  601   ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
              TG+  YSISLM SL YL+ + N     +   FT  + LT LDLS N+FSG LP+S   L
Sbjct  130   FTGNGQYSISLMASLKYLSLAHNQFKGQLAVDFTKLTSLTFLDLSSNSFSGSLPSSFTSL  189

Query  781   SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSp  960
             S++  + +QNNQ TG++++L  LPL +LN+ANN+F+GWIP+ L  I   +  GNSF+   
Sbjct  190   SSIKSMYLQNNQFTGTIDLLAGLPLENLNIANNKFTGWIPDSLKGINLLK-DGNSFN---  245

Query  961   apppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivl  1140
                P P TPP      +  +H++ GS       +NHS  ++ + + +        +  ++
Sbjct  246   -LGPAPPTPPGTSPIRRSPSHNSRGS-------ENHSSGDSSSSDSRKSGIGAGGIAGII  297

Query  1141  gssavvlsaivvivYCLRRCKKKEF-AARTSTGSLPLSTDKEVLDQRAKSTATV------  1299
              S  VV + +   ++  +R K+      RT      L++++   ++  + +++V      
Sbjct  298   ISLLVVGAVVSFFLFKRKRSKRPSLDIERTDNQPFTLTSNEFQENKSIQGSSSVETKKLD  357

Query  1300  ----VDLKPPPSEKVTIERMQGKNGSLRRSPI----TATP-----YTVAVLQTATNSFSQ  1440
                 ++L+PPP+++         + S+R+  I    T  P     Y+VA LQ AT SFS 
Sbjct  358   ISLSINLRPPPADRHK-SFDDDDDDSMRKPVIMKKTTVVPSNVKAYSVADLQIATGSFSL  416

Query  1441  ENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLV  1620
             EN +GEG+ GRVYRA F +GKVLA+KK+DS+AL   + D+F+E +SN++RL +PN+  LV
Sbjct  417   ENFLGEGTFGRVYRAHFEDGKVLAVKKIDSSALPGDQVDDFIETVSNIARLDNPNVTKLV  476

Query  1621  GYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLP  1800
             GYC+EHGQ LLVY++  NGSLHD LH ++E ++ L WN+RV++ALGTARALEYLHEVC P
Sbjct  477   GYCSEHGQHLLVYEFHKNGSLHDFLHLSEEENKPLIWNSRVKIALGTARALEYLHEVCSP  536

Query  1801  SVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVY  1980
             S+VH+N KS+NILLD ELNPHLSD GL    P  +  ++ +      GYSAPE ++SG Y
Sbjct  537   SIVHKNIKSSNILLDSELNPHLSDSGLTCFLPMADELLNQSD--EGTGYSAPEVSMSGQY  594

Query  1981  TVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMY  2160
             + KSDVYSFGVVMLELLTGRKP DS+R RSEQSLVRWATPQLHDI+AL KMVDP+L  +Y
Sbjct  595   STKSDVYSFGVVMLELLTGRKPFDSTRPRSEQSLVRWATPQLHDINALGKMVDPSLKRLY  654

Query  2161  PAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIR  2295
             P KSLSRFAD+IALCVQPEPEFRPPMSEVVQALV LVQRA++  R
Sbjct  655   PVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVVLVQRANMSKR  699



>gb|AFW76248.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=854

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/687 (54%), Positives = 451/687 (66%), Gaps = 88/687 (13%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TD  D+ AL  LY S NSP+QL+GW ASGGDPCG +W GV+C GSAV SI++ G+ LN
Sbjct  24    ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             GT+GY L+   +LK ++                     NLA NN +G++PYSIS + SL 
Sbjct  84    GTLGYQLSSLQALKTIEYR-------------------NLAKNNFSGNLPYSISNLVSLE  124

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YL                        D+SFNN +G+LP S+G LS LS L +QNNQL+G+
Sbjct  125   YL------------------------DVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  160

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             ++VL ++ L  LN+A+N FSG IP E  SIP     GNSF N    P  P +   P    
Sbjct  161   VDVLSNISLATLNIADNNFSGMIPQEFSSIPNLIVGGNSFVN---MPASPPSTLKPPLEE  217

Query  1009  KRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYC  1188
              +   S P S  TP   D+              ++ G ++GI +GS A     + V+V+C
Sbjct  218   PQGPVSAPTSPDTPIDQDDRK------------IQTGPLIGIAVGSIAAASCVLFVLVFC  265

Query  1189  L---RRCKKKEFAA-RTSTGSLPLSTD-----KEVLDQRAKSTATVV-DLKPPPSEKVTI  1338
             L   RR    E +  +   GSL +S +     +EVL+   +++A    DL+      +T 
Sbjct  266   LHNARRRNDDEISEPKDLVGSLAVSIETAASSREVLNNNHENSAVATSDLQHAGKMMMTP  325

Query  1339  ERM--QGKNGSLR----RSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNG  1500
             +R+     NGS      + P+T T YTVA LQ ATNSF +++L+GEGSLGRVY+A FPNG
Sbjct  326   DRVLHDTTNGSSTAKRPKVPVTVTSYTVADLQVATNSFCEDSLLGEGSLGRVYKAGFPNG  385

Query  1501  KVLAIKKVD-SAALSLQE--EDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIG  1671
             KVLA+KKVD SA LSL    ED FLE +SN+SRLRHPNIVPL GYC EHGQRLLVY+Y+G
Sbjct  386   KVLAVKKVDDSALLSLYGGGEDAFLELVSNVSRLRHPNIVPLTGYCVEHGQRLLVYEYVG  445

Query  1672  NGSLHDMLHFA---DE-RSQLLTWNARVRVALGTARALEYLHEVCLPSVVH-RNFKSANI  1836
             NG+L D+L      DE  S+ LTWN RVR+ALGTARALEYLHEVC+P VVH R FK++NI
Sbjct  446   NGTLRDVLQHCLSDDEGASKKLTWNTRVRIALGTARALEYLHEVCIPPVVHSRTFKASNI  505

Query  1837  LLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVV  2016
             LLDEE +PHLSDCGLAALT      + S   VGSFGYSAPE A+SG YT KSDVYSFGVV
Sbjct  506   LLDEEYSPHLSDCGLAALT-----TVVSPEAVGSFGYSAPELAMSGTYTAKSDVYSFGVV  560

Query  2017  MLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADII  2196
             MLELLTGRKPLDSSRERSEQSLVRWA PQLHDID L++MVDPAL+G+YP+KSLSRFADII
Sbjct  561   MLELLTGRKPLDSSRERSEQSLVRWAAPQLHDIDLLARMVDPALDGLYPSKSLSRFADII  620

Query  2197  ALCVQPEPEFRPPMSEVVQALVRLVQR  2277
             A+CVQPEPEFRPPMSEVVQ L R VQ 
Sbjct  621   AICVQPEPEFRPPMSEVVQQL-RAVQE  646



>gb|KHN01483.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=675

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/683 (52%), Positives = 455/683 (67%), Gaps = 46/683 (7%)
 Frame = +1

Query  340   LNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELD  519
             +NSPSQL+ W  +G DPCG+SW+G+TC G+ V  I++PG  L+G++GY L   +S+  LD
Sbjct  1     MNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSGSLGYQLEPMSSVTNLD  57

Query  520   LSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMF  699
             LS+N +   IPYQLPPNL  LNLANNN  G+IPYS+S  TSL  LN   N L Q +   F
Sbjct  58    LSNNNLGGTIPYQLPPNLQYLNLANNNFNGAIPYSLSEKTSLIVLNLGHNQLQQALNVDF  117

Query  700   TNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANN  879
                S L+TLDLSFN+ +GDLP ++  LS++  + +QNNQLTG+++VL +LPL  LNV NN
Sbjct  118   QKLSSLSTLDLSFNSLTGDLPQTMSSLSSIRTMYLQNNQLTGTIDVLANLPLDTLNVGNN  177

Query  880   RFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSD  1059
              F+GWIP +L +I   +  GN++S+ PAPPPPP TPP      +  NH + G        
Sbjct  178   HFTGWIPEQLKNI--IQKDGNAWSSGPAPPPPPGTPPAVA---RNRNHKSGG--------  224

Query  1060  DNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGS  1239
               HS  + G+ +G          GI     ++++   +V+ + ++R  KK F       +
Sbjct  225   --HSPSDGGSSDGGGKKSGIGGGGIAGIVISILVVGAIVVFFLVKRRPKKSFNDVEKLDN  282

Query  1240  LPLSTDKEVLDQRAKSTATVVDLK------------PPP------------SEKVTIERM  1347
              PL+ + EV +  +  T++V+DLK            PPP            S K  I   
Sbjct  283   QPLAQN-EVHEMNSMQTSSVIDLKTFDTSATPISLKPPPFDRHKSFDEDEFSNKPVIVNK  341

Query  1348  QGKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVD  1527
               K      +P     Y++A LQ AT SFS E L+GEGS GRVYRA F  GKVLA+KK+D
Sbjct  342   PTKVKKTVTAPTNVKSYSIADLQIATGSFSVEQLLGEGSFGRVYRAQFDEGKVLAVKKID  401

Query  1528  SAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFAD  1707
             S+ L     D+F+E +SN+S+L HPN+  LVGYC+EHGQ LLVY++  NGSLHD LH  D
Sbjct  402   SSVLPNDMSDDFVELVSNISQLHHPNVTELVGYCSEHGQHLLVYEFHKNGSLHDFLHLPD  461

Query  1708  ERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAA  1887
             E S+ L WN+RV++ALG ARALEYLHEVC PSVVH+  KSANILLD + NPHLSD GLA+
Sbjct  462   EYSKPLIWNSRVKIALGIARALEYLHEVCSPSVVHKTIKSANILLDTDFNPHLSDSGLAS  521

Query  1888  LTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRER  2067
               PN  + +++    GS GY APE  LSG YT+KSDVYSFGVVMLELL+GRKP DSSR R
Sbjct  522   YIPNANQVLNNN--AGS-GYEAPEVGLSGHYTLKSDVYSFGVVMLELLSGRKPFDSSRPR  578

Query  2068  SEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV  2247
             SEQ+LVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPEPEFRPPMSEV
Sbjct  579   SEQALVRWATPQLHDIDALAKMVDPTLEGLYPVKSLSRFADVIALCVQPEPEFRPPMSEV  638

Query  2248  VQALVRLVQRASVVIRRYSDESG  2316
             VQALVRLVQR ++  R +  + G
Sbjct  639   VQALVRLVQRTNMSKRTFGTDQG  661



>gb|AFW76246.1| putative STRUBBELIG family receptor protein kinase isoform 1 
[Zea mays]
 gb|AFW76247.1| putative STRUBBELIG family receptor protein kinase isoform 2 
[Zea mays]
Length=955

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/687 (54%), Positives = 451/687 (66%), Gaps = 88/687 (13%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TD  D+ AL  LY S NSP+QL+GW ASGGDPCG +W GV+C GSAV SI++ G+ LN
Sbjct  24    ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             GT+GY L+   +LK ++                     NLA NN +G++PYSIS + SL 
Sbjct  84    GTLGYQLSSLQALKTIEYR-------------------NLAKNNFSGNLPYSISNLVSLE  124

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YL                        D+SFNN +G+LP S+G LS LS L +QNNQL+G+
Sbjct  125   YL------------------------DVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  160

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             ++VL ++ L  LN+A+N FSG IP E  SIP     GNSF N    P  P +   P    
Sbjct  161   VDVLSNISLATLNIADNNFSGMIPQEFSSIPNLIVGGNSFVN---MPASPPSTLKPPLEE  217

Query  1009  KRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYC  1188
              +   S P S  TP   D+              ++ G ++GI +GS A     + V+V+C
Sbjct  218   PQGPVSAPTSPDTPIDQDDRK------------IQTGPLIGIAVGSIAAASCVLFVLVFC  265

Query  1189  L---RRCKKKEFAA-RTSTGSLPLSTD-----KEVLDQRAKSTATVV-DLKPPPSEKVTI  1338
             L   RR    E +  +   GSL +S +     +EVL+   +++A    DL+      +T 
Sbjct  266   LHNARRRNDDEISEPKDLVGSLAVSIETAASSREVLNNNHENSAVATSDLQHAGKMMMTP  325

Query  1339  ERM--QGKNGSLR----RSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNG  1500
             +R+     NGS      + P+T T YTVA LQ ATNSF +++L+GEGSLGRVY+A FPNG
Sbjct  326   DRVLHDTTNGSSTAKRPKVPVTVTSYTVADLQVATNSFCEDSLLGEGSLGRVYKAGFPNG  385

Query  1501  KVLAIKKVD-SAALSLQE--EDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIG  1671
             KVLA+KKVD SA LSL    ED FLE +SN+SRLRHPNIVPL GYC EHGQRLLVY+Y+G
Sbjct  386   KVLAVKKVDDSALLSLYGGGEDAFLELVSNVSRLRHPNIVPLTGYCVEHGQRLLVYEYVG  445

Query  1672  NGSLHDMLHFA---DE-RSQLLTWNARVRVALGTARALEYLHEVCLPSVVH-RNFKSANI  1836
             NG+L D+L      DE  S+ LTWN RVR+ALGTARALEYLHEVC+P VVH R FK++NI
Sbjct  446   NGTLRDVLQHCLSDDEGASKKLTWNTRVRIALGTARALEYLHEVCIPPVVHSRTFKASNI  505

Query  1837  LLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVV  2016
             LLDEE +PHLSDCGLAALT      + S   VGSFGYSAPE A+SG YT KSDVYSFGVV
Sbjct  506   LLDEEYSPHLSDCGLAALT-----TVVSPEAVGSFGYSAPELAMSGTYTAKSDVYSFGVV  560

Query  2017  MLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADII  2196
             MLELLTGRKPLDSSRERSEQSLVRWA PQLHDID L++MVDPAL+G+YP+KSLSRFADII
Sbjct  561   MLELLTGRKPLDSSRERSEQSLVRWAAPQLHDIDLLARMVDPALDGLYPSKSLSRFADII  620

Query  2197  ALCVQPEPEFRPPMSEVVQALVRLVQR  2277
             A+CVQPEPEFRPPMSEVVQ L R VQ 
Sbjct  621   AICVQPEPEFRPPMSEVVQQL-RAVQE  646



>emb|CDY24077.1| BnaA06g00750D [Brassica napus]
Length=719

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/714 (50%), Positives = 467/714 (65%), Gaps = 39/714 (5%)
 Frame = +1

Query  271   RLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEI  450
              L F+  ATD +D  AL  L+ S++SP+QL+ W AS GDPCG++W+GV C G+ V  I+I
Sbjct  20    ELSFIHGATDASDTSALNTLFSSMHSPAQLTQWTASAGDPCGQNWRGVNCSGTRVTQIKI  79

Query  451   PGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSIS  630
              GL L+GT+GY L+  T+L ELD+SSN +   +PYQ PPNL  LNLA N  TG+  YSIS
Sbjct  80    SGLELSGTLGYKLDSLTNLTELDVSSNNLGGDLPYQFPPNLERLNLAFNQFTGAAQYSIS  139

Query  631   LMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQN  810
              +  L YLN   N     I   F+  + +TTLD SFN+F+  LP +   L++L  L +QN
Sbjct  140   QIVPLKYLNLGHNQFKGQIAIDFSKLTSITTLDFSFNSFTDSLPGTFTSLTSLKSLYLQN  199

Query  811   NQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftpp  990
             NQ +G+++VL  LPL  LN+ANN F+GWIP+ L  I   +  GNSFS  PAPPPPP TPP
Sbjct  200   NQFSGTVDVLAGLPLDILNIANNDFTGWIPSSLKGIDLIK-DGNSFSTGPAPPPPPGTPP  258

Query  991   ppgr----------pHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivl  1140
             PP             HK TNHS         S D+ S+ E+       GV AG ++ +++
Sbjct  259   PPPPHGTPPTHGTPSHKSTNHS---------SIDSTSNGESKKSGIGVGVIAGIVISVLV  309

Query  1141  gssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVL------DQRAKSTATVV  1302
              ++ V    +       R         +T+     ++ +  +L      + +   T+  +
Sbjct  310   VTALVAFFLVKRRRRSKRSPSSSMDIEKTNNQPHMVAENNSILQSSSSVEAKKLDTSLSI  369

Query  1303  DLKPPPSEK--------VTIERMQGKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGE  1458
             +L+PPP+E+         T E +  K  ++   P     Y+VA LQ AT SFS ++L+GE
Sbjct  370   NLRPPPAERHKSFDDEDATREPIVVKKSTVV-VPSNVRVYSVADLQIATGSFSVDHLLGE  428

Query  1459  GSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEH  1638
             G+ GRVYRA+F +GKVLA+KK+DS+AL     D+F E +S ++ L HPN+  LVGYC+EH
Sbjct  429   GTFGRVYRAEFEDGKVLAVKKIDSSALPHDTTDDFTEIVSKLAVLDHPNVTRLVGYCSEH  488

Query  1639  GQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRN  1818
             GQ LLVY++   GSLHD LH ++E S+ L WN+RV++ALGTAR LEYLHEVC PS+V +N
Sbjct  489   GQHLLVYEFHSKGSLHDFLHLSEEESKALVWNSRVKIALGTARGLEYLHEVCSPSIVDKN  548

Query  1819  FKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDV  1998
              KS+NILLD E+NPHLSD GLA+  P    Q+ +       GYSAPE ++SG Y++KSDV
Sbjct  549   IKSSNILLDSEMNPHLSDSGLASFLPTANVQLLNQ---TDEGYSAPEVSMSGQYSLKSDV  605

Query  1999  YSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLS  2178
             YSFGVVMLELLTGRKP DS+R R+EQSLVRWATPQLHDIDAL KMVDPAL G+YP KSLS
Sbjct  606   YSFGVVMLELLTGRKPFDSTRSRAEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLS  665

Query  2179  RFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDH  2340
             RFAD+IALCVQ EPEFRPPMSEVVQ+LV LVQRA++  +R S  SG A  T D+
Sbjct  666   RFADVIALCVQAEPEFRPPMSEVVQSLVVLVQRANMS-KRTSKRSGSADATNDY  718



>ref|XP_009591325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=701

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/721 (48%), Positives = 460/721 (64%), Gaps = 58/721 (8%)
 Frame = +1

Query  223   AFLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKAS-GGDPCGE  399
             + +  +VV+V    +S   F  A TDP+D  AL V+Y SLNSP+QL+ W +S G DPCGE
Sbjct  2     SLVVIQVVMVALLFVSNHSFANAGTDPSDASALRVMYSSLNSPAQLTKWNSSDGSDPCGE  61

Query  400   SWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTS  579
             SWKG+TC G+ V  I + GLGL+G+MGY L   TS+   D+S+N + + IPYQLPPN+  
Sbjct  62    SWKGITCYGNRVNEIHLSGLGLSGSMGYQLTSLTSVINFDISNNNLGNQIPYQLPPNVQK  121

Query  580   LNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDL  759
             LNLA N  TG +PYSIS M SL YLN S N +   + DMF + S L TLD+SFN+ +G L
Sbjct  122   LNLAGNGFTGGLPYSISQMASLQYLNVSHNQIQGELNDMFGSLSSLNTLDISFNSMTGKL  181

Query  760   PASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSG  939
             P S   L+++  + +QNNQ TG+++VL +LPL +LN+ NN+F+G IP +L  I +     
Sbjct  182   PQSFQSLTSMKKIYLQNNQYTGNIDVLANLPLDNLNLENNQFTGAIPEKLRGILQ-----  236

Query  940   NSFSNSpapppppftppppgrpHKRTNHS-TPGSHKTPGSDDNHSDHEngngngkngVKA  1116
              S SN+ +  P P +PP     ++ +N S   G + +P +    SD +  +G    GV A
Sbjct  237   RSNSNTGSSGPAPPSPPGTSPANRSSNRSHKSGGNGSPFTGGGSSDRDEKSGISGGGV-A  295

Query  1117  GAivgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSL--------PLSTDKEVLD  1272
             G ++ + +  +  V          +   KK+   + T    L        P    +  L 
Sbjct  296   GIVISVSVVGAVAV----------IFSIKKRHRKSSTDIEKLDVQPIALHPQEERERKLS  345

Query  1273  QRAKSTA-------TVVDLKPPPSEKVTIERMQGKNG-SLRRSPIT-----------ATP  1395
             Q + +T+       T   L+PPP     I   +  NG ++   PI               
Sbjct  346   QNSSTTSMKAVETPTSATLRPPP-----INPHKSFNGDTISAKPIVPQNETHTDQMNVLQ  400

Query  1396  YTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAI  1575
             Y+ A LQ AT+ FS ENL+GEGS+G VY+A F NG+VL +KK++S    L+  ++FL  +
Sbjct  401   YSFADLQMATDRFSDENLIGEGSIGSVYQAHFDNGEVLTVKKINST--ELRNPEDFLNQV  458

Query  1576  SNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERS-QLLTWNARVRVA  1752
             S++SR+ HPN+  L+GYC+EHGQ LL+Y++   GSLHD LH  DE     LTW++R+++A
Sbjct  459   SDISRMHHPNVTELIGYCSEHGQYLLIYEFYRTGSLHDFLHRMDEEDGTRLTWDSRLKIA  518

Query  1753  LGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVV  1932
             LGTARALEY HE C PS+VH+N KS NILLD +LNPHLSD GLA L  +T++ +++    
Sbjct  519   LGTARALEYQHEACSPSLVHKNVKSENILLDTDLNPHLSDSGLANLIADTDQGLNTES--  576

Query  1933  GSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHD  2112
                GY APE A+SG  + KSDVYSFGVVMLEL +GRKP D SR RSEQSLVRWATPQLHD
Sbjct  577   ---GYGAPEAAISGKCSTKSDVYSFGVVMLELFSGRKPFDCSRPRSEQSLVRWATPQLHD  633

Query  2113  IDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVI  2292
             IDAL KMVDPAL G+Y  KSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  
Sbjct  634   IDALEKMVDPALVGLYSVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANLSK  693

Query  2293  R  2295
             R
Sbjct  694   R  694



>ref|XP_009147586.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=719

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/725 (50%), Positives = 471/725 (65%), Gaps = 40/725 (6%)
 Frame = +1

Query  241   VVLVIAALIS-RLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVT  417
             VVL    ++   L F+  ATD +D  AL  L+ S++SP+QL+ W AS GDPCG++W+GV 
Sbjct  9     VVLFTVCIVGFELSFIYGATDASDTSALNTLFSSMHSPAQLTQWTASAGDPCGQNWRGVN  68

Query  418   CQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANN  597
             C G+ V  I+I GL L+GT+GY L+  T+L ELD+SSN +   +PYQ PPNL  LNLA N
Sbjct  69    CSGTRVTQIKISGLELSGTLGYKLDSLTNLTELDVSSNNLGGDLPYQFPPNLERLNLAFN  128

Query  598   NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
               TG+  YSIS +  L YLN   N     I   F+  + +TTLD SFN+F+  LP +   
Sbjct  129   QFTGAAQYSISQIVPLKYLNLGHNQFKGQIAIDFSKLTSITTLDFSFNSFTDSLPGTFTS  188

Query  778   LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNS  957
             L++L  L +QNNQ +G+++VL  LPL  LN+ANN F+GWIP+ L  I   +  GNSFS  
Sbjct  189   LTSLKSLYLQNNQFSGTVDVLAGLPLDILNIANNDFTGWIPSSLKGIDLIK-DGNSFSTG  247

Query  958   papppppftppppgr----------pHKRTNHSTPGSHKTPGSDDNHSDHEngngngkng  1107
             PAPPPPP TPPPP             HK TNHS         S D+ S+ E+       G
Sbjct  248   PAPPPPPGTPPPPPPHGTPPTHGTPSHKSTNHS---------SIDSTSNGESKKSGIGVG  298

Query  1108  VKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVL------  1269
             V AG ++ +++ ++ V    +       R         +T+     ++ +  +L      
Sbjct  299   VIAGIVISVLVVTALVAFFLVKRRRRSKRSPSSSMDIEKTNNQPHMVAENNSILQSSSSV  358

Query  1270  DQRAKSTATVVDLKPPPSEK--------VTIERMQGKNGSLRRSPITATPYTVAVLQTAT  1425
             + +   T+  ++L+PPP+E+         T E +  K  ++   P     Y+VA LQ AT
Sbjct  359   EAKKLDTSLSINLRPPPAERHKSFDDEDATREPIVVKKSTVV-VPSNVRVYSVADLQIAT  417

Query  1426  NSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPN  1605
              SFS ++L+GEG+ GRVYRA+F +GKVLA+KK+DS+AL     D+F E +S ++ L HPN
Sbjct  418   GSFSVDHLLGEGTFGRVYRAEFEDGKVLAVKKIDSSALPHDTTDDFTEIVSKLAVLDHPN  477

Query  1606  IVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLH  1785
             +  LVGYC+EHGQ LLVY++   GSLHD LH ++E S+ L WN+RV++ALGTAR LEYLH
Sbjct  478   VTRLVGYCSEHGQHLLVYEFHSKGSLHDFLHLSEEESKALVWNSRVKIALGTARGLEYLH  537

Query  1786  EVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFA  1965
             EVC PS+V +N KS+NILLD E+NPHLSD GLA+  P    Q+ +       GYSA E +
Sbjct  538   EVCSPSIVDKNIKSSNILLDSEMNPHLSDSGLASFLPTANVQLLNQ---TDEGYSASEVS  594

Query  1966  LSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPA  2145
             +SG Y++KSDVYSFGVVMLELLTGRKP DS+R R+EQSLVRWATPQLHDIDAL KMVDPA
Sbjct  595   MSGQYSLKSDVYSFGVVMLELLTGRKPFDSTRSRAEQSLVRWATPQLHDIDALGKMVDPA  654

Query  2146  LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAY  2325
             L G+YP KSLSRFAD+IALCVQ EPEFRPPMSEVVQ+LV LVQRA++  +R S  SG A 
Sbjct  655   LEGLYPVKSLSRFADVIALCVQAEPEFRPPMSEVVQSLVVLVQRANMS-KRTSKRSGSAD  713

Query  2326  KTPDH  2340
              T D+
Sbjct  714   TTNDY  718



>ref|XP_007135353.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
 gb|ESW07347.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
Length=718

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/714 (51%), Positives = 465/714 (65%), Gaps = 45/714 (6%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L + +VLV+      L   G  TDPND+ +L+V++ S+NSP QL+ W  +G DPCG+SW+
Sbjct  3     LDSRLVLVLFISTCILAINGGETDPNDVASLKVMFQSMNSPPQLN-W--NGDDPCGQSWQ  59

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             G+TC G+ V  I++PG  L+G++GY L   + +  LDLS+N +   IPYQLPPNL  LNL
Sbjct  60    GITCSGNRVTEIKLPGRSLSGSLGYQLESLSLVTNLDLSNNNLGGTIPYQLPPNLQYLNL  119

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             ANNN  G +PYS+S  TSL  +N   N L Q +   F   S L+TLDLSFN+ +G+LP +
Sbjct  120   ANNNFNGEVPYSLSQKTSLVVVNLGHNQLQQALNVDFQKLSSLSTLDLSFNSLTGNLPQT  179

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
             L  LS++S + +QNNQ TG++NVL +LPL  LNV NN F+GWIP +L +I   +  GN +
Sbjct  180   LSSLSSISTMYLQNNQFTGTINVLANLPLETLNVGNNHFTGWIPEQLNNI-NLQKDGNDW  238

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
             S+ PAPPPPP TPP      +  NH + G  +TP    + SD                  
Sbjct  239   SSGPAPPPPPGTPPVAT---RNRNHRSGG--QTPSDAGSSSD--------GGKKSGIGGG  285

Query  1129  givlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPL----STDKEVLDQRAKST--  1290
             GI     ++++   +V  + +++  KK F+      + PL    S   EV   +  S   
Sbjct  286   GIAGIVISILVVGAIVAFFLVKKRSKKSFSDIEKLDNQPLAPHTSRHHEVNSMQTSSVID  345

Query  1291  -------ATVVDLKPPP------------SEKVTIERMQGKNGSLRRSPITATPYTVAVL  1413
                    A  + LKPPP            S+K T             +P     Y++A L
Sbjct  346   LNTFDTPAAPISLKPPPIDRHKSFDEDEFSKKPTTVIKPTTVKKTVTAPTNVKSYSIADL  405

Query  1414  QTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRL  1593
             Q AT SFS + L+GEGS GRVYRA F +GKVLA+KK+DS+ L     D+FLE +S++S L
Sbjct  406   QIATGSFSVDQLLGEGSFGRVYRAQFDDGKVLAVKKIDSSVLPNDLSDDFLELVSSISNL  465

Query  1594  RHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARAL  1773
              HPN+  L GYC+EHGQ LLVY++  NGSLHD LH  DE S+ L WN+RV++ALG ARAL
Sbjct  466   HHPNVTELAGYCSEHGQHLLVYEFHQNGSLHDFLHLPDEYSKPLIWNSRVKIALGIARAL  525

Query  1774  EYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSA  1953
             EYLHEVC PSVVH+N KSANILLD +LNPHLSD GLA+  PN  + +++    GS GY A
Sbjct  526   EYLHEVCSPSVVHKNIKSANILLDTDLNPHLSDSGLASYIPNANQVLNNNS--GS-GYEA  582

Query  1954  PEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKM  2133
             PE  +SG YT+KSDV+SFGV+MLELL+GRKP DSSR RSEQ LVRWATPQLHDIDAL+KM
Sbjct  583   PEVGMSGQYTLKSDVFSFGVIMLELLSGRKPFDSSRPRSEQGLVRWATPQLHDIDALAKM  642

Query  2134  VDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIR  2295
             VDPAL G+YP KSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQR ++  R
Sbjct  643   VDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRTNMSKR  696



>gb|AAK52120.1|AC079936_16 Putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
Length=736

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/763 (48%), Positives = 466/763 (61%), Gaps = 108/763 (14%)
 Frame = +1

Query  223   AFLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGES  402
             A+    +V    +   R   V A TD ND+  L  L+ SLNSP QL GW+ +GGDPCG S
Sbjct  5     AWPLVFLVSCCCSWTQRRILVAATTDANDVTVLNALFTSLNSPGQLRGWQVNGGDPCGAS  64

Query  403   WKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIH--DLIPYQLP-PNL  573
             W+G+TC GS+V +I++P LGL+G + Y +N   SL ELD+S N +     I Y LP   L
Sbjct  65    WQGITCSGSSVTAIKLPSLGLSGNLAYNMNTMESLVELDMSQNNLGGGQNIQYNLPNKKL  124

Query  574   TSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSG  753
               LNLA N   G++PYSIS M  L YLN + N L   + D+F+N                
Sbjct  125   ERLNLAGNQFAGNVPYSISTMPKLKYLNLNHNQLQGNMTDVFSN----------------  168

Query  754   DLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEY  933
                     L +LS L +QNNQ TGS+NVL +LPL +LNV NNRF+GWIPNEL  I   + 
Sbjct  169   --------LPSLSTLYLQNNQFTGSINVLANLPLDNLNVGNNRFTGWIPNELKKINSLQT  220

Query  934   SGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVK  1113
              GNS+S  PAPPPPPFT PPP R  K++    PG H             + +  G +G++
Sbjct  221   DGNSWSTGPAPPPPPFTAPPPSRNRKKS----PGRHSN-------GSGSSSSSGGNSGLR  269

Query  1114  AGAivgivlgssavvlsaivvivYCLRRCKKKEFA-ARTSTGSLPLSTDKEV--------  1266
             AGAI GI++    +       ++   R+  ++E    R    S P +  K+V        
Sbjct  270   AGAIAGIIVALLVIGAVVAFFLIKRKRKGTRQEHVEQRQPFNSYPSNEVKDVKPIPESTK  329

Query  1267  LDQRAKSTATVVDLKPPPSEKVTIERMQG--------KNGSLRR----SPITATPYTVAV  1410
             ++     +   V LKPPP     IER Q          N  + +    + + AT Y+VA 
Sbjct  330   IEVEPLPSPVAVSLKPPPK----IERNQSFDDDDDDFSNKPVAKKSNSASVKATVYSVAD  385

Query  1411  LQTATNSFSQENLVGEGSLGRVYRADFPNGK-----------------------------  1503
             LQ AT+SF+ +NLVGEG+ GRVYRA F +GK                             
Sbjct  386   LQMATDSFNMDNLVGEGTFGRVYRAQFSDGKISTIIYLFCLGSYQVFHTWIYKDSSFLHM  445

Query  1504  ------------VLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQR  1647
                         VLA+KK++S  L  Q  D+F + +SN+S+L HPN+  LVGYC EHGQ 
Sbjct  446   INVAYISPYMNQVLAVKKLNSTVLPSQSSDDFFDLVSNISKLHHPNLNELVGYCMEHGQH  505

Query  1648  LLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKS  1827
             LLVYD+  NGSLHDMLH  DE S+ L+WN+RV++ALG+ARALEYLHE+C PS++H+NFKS
Sbjct  506   LLVYDFHRNGSLHDMLHLPDEYSKPLSWNSRVKIALGSARALEYLHEICSPSIIHKNFKS  565

Query  1828  ANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSF  2007
             +NILLD E NPH+SD GLA+  P++E Q S     GS GYSAPE  ++G YT+KSDVYSF
Sbjct  566   SNILLDTEFNPHVSDAGLASSVPDSEFQASDQ---GS-GYSAPEVDMTGQYTLKSDVYSF  621

Query  2008  GVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFA  2187
             GVVMLELLTGRKP DS+R R+EQSLVRWATPQLHDIDAL +MVDPAL G+YPAKSLSRFA
Sbjct  622   GVVMLELLTGRKPFDSARLRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFA  681

Query  2188  DIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             D+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R    E G
Sbjct  682   DVIALCVQPEPEFRPPMSEVVQALVRLVQRANMTRRMIDGEEG  724



>gb|KGN45936.1| hypothetical protein Csa_6G024930 [Cucumis sativus]
Length=696

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/715 (47%), Positives = 444/715 (62%), Gaps = 36/715 (5%)
 Frame = +1

Query  235   TEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGV  414
             T V  +I   I  +G       P D+ AL V++ SLNSPSQLSGW +SGGDPCG SW+G+
Sbjct  5     TLVFWIIQISIHGVGVFSKTKAP-DVSALNVMFSSLNSPSQLSGWGSSGGDPCGNSWEGI  63

Query  415   TCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLAN  594
              C GS+V  I +   GL+G+MGY L+   S+   DLS N ++  IPYQLPPN   ++L+ 
Sbjct  64    QCSGSSVTEISLSDFGLSGSMGYQLSNLASVTYFDLSKNNLNGEIPYQLPPNAVHIDLSG  123

Query  595   NNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLG  774
             N+ TGS+PYSIS M+ L +LN   N L+  + DMF   + L  LDLSFN+ SG+LP S  
Sbjct  124   NSFTGSVPYSISQMSELEFLNLGHNKLSNQLSDMFGKLAKLKRLDLSFNSISGNLPQSFK  183

Query  775   LLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN  954
              LS+L++L +Q+N+ +GS+N L DLPL DLNVANN+F+GWIP  L  I   E  GNS+S 
Sbjct  184   KLSSLTVLHIQDNKFSGSINFLADLPLDDLNVANNKFTGWIPESLEDIDNLETVGNSWST  243

Query  955   SpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgi  1134
              PAPPPPP T              +P + K+   + N       +G    G+  G +  I
Sbjct  244   GPAPPPPPGTV-------------SPTNKKSNKEESNKISSAVKSGLVIAGIAMGVLAVI  290

Query  1135  vlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLK-  1311
              +           V  Y      +       ++  L    D   +D+++ ++   VD+K 
Sbjct  291   AIVIGMTTKRRRHVSHYLDEDTNQHRSFTPLTSQELAKGNDNNGIDRKSFTSDASVDIKG  350

Query  1312  ----PPPSEKVTIERMQGK------NGSLRRSPITATPYTVAVLQTATNSFSQENLVGEG  1461
                 PPP+   +I            N   R +   A  Y++  LQTAT +FS   L+GEG
Sbjct  351   GVVRPPPAPLDSIRSFSDNQFASRLNSKRRSTSFRAISYSLVDLQTATANFSPSRLLGEG  410

Query  1462  SLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHG  1641
             ++GRVY+A + +GKVLA+KK+DS     +  + F E ++ +S+L H NI  +VG+C+E G
Sbjct  411   TIGRVYKAKYGDGKVLAVKKIDSTVFQGRRTEEFSEVVAIISKLNHTNIAEVVGFCSEQG  470

Query  1642  QRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNF  1821
               L +Y++  NGSLH+ LH +D+ S+ LTWN RVR+ALGTARALEYLHEVC PS++H N 
Sbjct  471   HHLFIYEFFTNGSLHEFLHMSDDFSKPLTWNTRVRIALGTARALEYLHEVCSPSIIHMNI  530

Query  1822  KSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSG-VYTVKSDV  1998
             KS+NILLD ELNP LSD GLA    +  +           GY APE +  G  YT+KSD+
Sbjct  531   KSSNILLDAELNPRLSDYGLATFYKSRRQNPEG-------GYDAPECSTKGSSYTMKSDI  583

Query  1999  YSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLS  2178
             +S GVVMLELLTGR P DSS+ + EQ LVRWATPQLHDIDAL KMVDPAL G+YP KS+S
Sbjct  584   HSLGVVMLELLTGRMPFDSSKAKVEQCLVRWATPQLHDIDALDKMVDPALRGLYPPKSVS  643

Query  2179  RFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             RFADIIALCVQ EPEFRPPMSEVVQALV LVQR+S+ +R   D+ G + +  D+D
Sbjct  644   RFADIIALCVQSEPEFRPPMSEVVQALVTLVQRSSMNMR---DDLGNSRRMDDYD  695



>emb|CAA18116.1| serine/threonine protein kinase like protein [Arabidopsis thaliana]
 emb|CAB79168.1| serine/threonine protein kinase like protein [Arabidopsis thaliana]
 gb|ABL66730.1| At4g22130 [Arabidopsis thaliana]
Length=338

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/332 (85%), Positives = 311/332 (94%), Gaps = 3/332 (1%)
 Frame = +1

Query  1354  KNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVD  1527
             KNGS+ R  SPITA+ YTV+ LQ ATNSFSQEN++GEGSLGRVYRA+FPNGK++AIKK+D
Sbjct  2     KNGSISRIRSPITASQYTVSSLQVATNSFSQENIIGEGSLGRVYRAEFPNGKIMAIKKID  61

Query  1528  SAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFAD  1707
             +AALSLQEEDNFLEA+SNMSRLRHPNIVPL GYC EHGQRLLVY+Y+GNG+L D LH  D
Sbjct  62    NAALSLQEEDNFLEAVSNMSRLRHPNIVPLAGYCTEHGQRLLVYEYVGNGNLDDTLHTND  121

Query  1708  ERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAA  1887
             +RS  LTWNARV+VALGTA+ALEYLHEVCLPS+VHRNFKSANILLDEELNPHLSD GLAA
Sbjct  122   DRSMNLTWNARVKVALGTAKALEYLHEVCLPSIVHRNFKSANILLDEELNPHLSDSGLAA  181

Query  1888  LTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRER  2067
             LTPNTERQ+ ST VVGSFGYSAPEFALSG+YTVKSDVY+FGVVMLELLTGRKPLDSSR R
Sbjct  182   LTPNTERQV-STQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTR  240

Query  2068  SEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV  2247
             +EQSLVRWATPQLHDIDALSKMVDP+LNGMYPAKSLSRFADIIALC+QPEPEFRPPMSEV
Sbjct  241   AEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEV  300

Query  2248  VQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             VQ LVRLVQRASVV RR SD++GF+Y+TP+H+
Sbjct  301   VQQLVRLVQRASVVKRRSSDDTGFSYRTPEHE  332



>ref|XP_004138532.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cucumis 
sativus]
 ref|XP_004160222.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cucumis 
sativus]
Length=662

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/684 (48%), Positives = 431/684 (63%), Gaps = 35/684 (5%)
 Frame = +1

Query  328   LYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSL  507
             ++ SLNSPSQLSGW +SGGDPCG SW+G+ C GS+V  I +   GL+G+MGY L+   S+
Sbjct  1     MFSSLNSPSQLSGWGSSGGDPCGNSWEGIQCSGSSVTEISLSDFGLSGSMGYQLSNLASV  60

Query  508   KELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPI  687
                DLS N ++  IPYQLPPN   ++L+ N+ TGS+PYSIS M+ L +LN   N L+  +
Sbjct  61    TYFDLSKNNLNGEIPYQLPPNAVHIDLSGNSFTGSVPYSISQMSELEFLNLGHNKLSNQL  120

Query  688   GDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLN  867
              DMF   + L  LDLSFN+ SG+LP S   LS+L++L +Q+N+ +GS+N L DLPL DLN
Sbjct  121   SDMFGKLAKLKRLDLSFNSISGNLPQSFKKLSSLTVLHIQDNKFSGSINFLADLPLDDLN  180

Query  868   VANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKT  1047
             VANN+F+GWIP  L  I   E  GNS+S  PAPPPPP T              +P + K+
Sbjct  181   VANNKFTGWIPESLEDIDNLETVGNSWSTGPAPPPPPGTV-------------SPTNKKS  227

Query  1048  PGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAART  1227
                + N       +G    G+  G +  I +           V  Y      +       
Sbjct  228   NKEESNKISSAVKSGLVIAGIAMGVLAVIAIVIGMTTKRRRHVSHYLDEDTNQHRSFTPL  287

Query  1228  STGSLPLSTDKEVLDQRAKSTATVVDLK-----PPPSEKVTIERMQGK------NGSLRR  1374
             ++  L    D   +D+++ ++   VD+K     PPP+   +I            N   R 
Sbjct  288   TSQELAKGNDNNGIDRKSFTSDASVDIKGGVVRPPPAPLDSIRSFSDNQFASRLNSKRRS  347

Query  1375  SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEE  1554
             +   A  Y++  LQTAT +FS   L+GEG++GRVY+A + +GKVLA+KK+DS     +  
Sbjct  348   TSFRAISYSLVDLQTATANFSPSRLLGEGTIGRVYKAKYGDGKVLAVKKIDSTVFQGRRT  407

Query  1555  DNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWN  1734
             + F E ++ +S+L H NI  +VG+C+E G  L +Y++  NGSLH+ LH +D+ S+ LTWN
Sbjct  408   EEFSEVVAIISKLNHTNIAEVVGFCSEQGHHLFIYEFFTNGSLHEFLHMSDDFSKPLTWN  467

Query  1735  ARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQI  1914
              RVR+ALGTARALEYLHEVC PS++H N KS+NILLD ELNP LSD GLA    +  +  
Sbjct  468   TRVRIALGTARALEYLHEVCSPSIIHMNIKSSNILLDAELNPRLSDYGLATFYKSRRQNP  527

Query  1915  SSTHVVGSFGYSAPEFALSG-VYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRW  2091
                      GY APE +  G  YT+KSD++S GVVMLELLTGR P DSS+ + EQ LVRW
Sbjct  528   EG-------GYDAPECSTKGSSYTMKSDIHSLGVVMLELLTGRMPFDSSKAKVEQCLVRW  580

Query  2092  ATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLV  2271
             ATPQLHDIDAL KMVDPAL G+YP KS+SRFADIIALCVQ EPEFRPPMSEVVQALV LV
Sbjct  581   ATPQLHDIDALDKMVDPALRGLYPPKSVSRFADIIALCVQSEPEFRPPMSEVVQALVTLV  640

Query  2272  QRASVVIRRYSDESGFAYKTPDHD  2343
             QR+S+ +R   D+ G + +  D+D
Sbjct  641   QRSSMNMR---DDLGNSRRMDDYD  661



>ref|XP_002316560.2| hypothetical protein POPTR_0011s01540g [Populus trichocarpa]
 gb|EEE97172.2| hypothetical protein POPTR_0011s01540g [Populus trichocarpa]
Length=520

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/500 (65%), Positives = 392/500 (78%), Gaps = 12/500 (2%)
 Frame = +1

Query  358   LSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEI  537
             L+ WK+ GGDPCGESWKG+TC+GSAVVS++I GLGL+GTMGYML+   SL+  DLS N I
Sbjct  5     LTSWKSIGGDPCGESWKGITCEGSAVVSVQISGLGLDGTMGYMLSNLMSLRTFDLSDNNI  64

Query  538   HDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDL  717
             HD +PYQLPPNLTSLNLA NN++G++PYSIS M SL+YLN S NSL+Q IGD+F N S L
Sbjct  65    HDPLPYQLPPNLTSLNLAINNLSGNLPYSISTMVSLSYLNVSRNSLSQSIGDVFHNLSLL  124

Query  718   TTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWI  897
             +T+D+SFNN SGD+P+S   LSNLS L VQNNQLTGSLNVL  LPLT LNVANN  SGWI
Sbjct  125   STMDVSFNNLSGDIPSSFSSLSNLSTLNVQNNQLTGSLNVLTGLPLTTLNVANNNLSGWI  184

Query  898   PNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDH  1077
             P EL SIP F Y+GNSF N PAPPPPP+T PP G+ H+   H   G+ +T  SD   S+ 
Sbjct  185   PQELSSIPNFIYNGNSFDNGPAPPPPPYTSPPSGKSHRNRTHPGSGAPRTSSSDGQPSES  244

Query  1078  EngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLS--  1251
             +        G+  GAIVG+ LGS  +VL A++ +V+C+++ + KE     S GS P    
Sbjct  245   D-------KGISVGAIVGVALGSVVLVLIALLALVFCIKKHQGKEIDPLASRGSRPADTY  297

Query  1252  -TDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTA  1422
              T  E+ + R K+ A V DLKPPP+EK+  ER+ G +GS++R  SPITAT Y+VA LQTA
Sbjct  298   YTGAEMQEPRVKNMAAVTDLKPPPAEKLVAERLLGNSGSIKRMKSPITATSYSVASLQTA  357

Query  1423  TNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHP  1602
             TNSFSQE ++GEGSLGRVYR DFP+GK++A+KK+D+AALSLQEEDNFLEA+SNMS LRHP
Sbjct  358   TNSFSQEFIIGEGSLGRVYRGDFPHGKIMAVKKIDNAALSLQEEDNFLEAVSNMSHLRHP  417

Query  1603  NIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYL  1782
             NIV LVGYC EHGQRLLVY+YI NGSLHD+LHFAD+ S+ L+WNARVRVALGTARALEYL
Sbjct  418   NIVSLVGYCVEHGQRLLVYEYIANGSLHDILHFADDGSKTLSWNARVRVALGTARALEYL  477

Query  1783  HEVCLPSVVHRNFKSANILL  1842
             HEVCLPSVVHRNFKSA + L
Sbjct  478   HEVCLPSVVHRNFKSAIVRL  497



>ref|XP_001763842.1| predicted protein [Physcomitrella patens]
 gb|EDQ71246.1| predicted protein [Physcomitrella patens]
Length=681

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/681 (49%), Positives = 459/681 (67%), Gaps = 28/681 (4%)
 Frame = +1

Query  316   ALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTM-GYMLN  492
             AL  ++   NS  +L+ W  + GDPCG +W GVTC G+ V SI++  +GLNG + G++L 
Sbjct  2     ALNTMFTGFNSDPKLTNWVQNAGDPCGTNWLGVTCDGTFVTSIKLSNMGLNGKVEGWVLQ  61

Query  493   GFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNS  672
              F  L  LDLS N +   IP   PP LT L+L+ N +TGS PY I  + +L  +  + N 
Sbjct  62    KFQHLSVLDLSHNNLASGIPEMFPPKLTELDLSYNQLTGSFPYLIINIPTLTSIKLNNNK  121

Query  673   LAQPI-GDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSL-NVLVD  846
             L+  + G +F+  ++L TLD+S N  +G +P  +G + +L  L +QNN+LTG + + L +
Sbjct  122   LSGTLDGQVFSKLTNLITLDISNNAITGPIPEGMGDMVSLRFLNMQNNKLTGPIPDTLAN  181

Query  847   LP-LTDLNVANNRFSGWIPNELISIPK-FEYSGNSFSNSpapppppftppppgrpHKRTN  1020
             +P L  L+V+NN  +G++P  L   PK F Y GN  +    PPPP   PPP   P     
Sbjct  182   IPSLETLDVSNNALTGFLPPNLN--PKNFRYGGNPLNTQAPPPPPFTPPPPSKNPKPIPP  239

Query  1021  HSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRC  1200
                PGS +TP +              + G+ +GA +  ++  + +VL+AI + V+     
Sbjct  240   PPHPGS-RTPDT----------APKAEGGIVSGAAIAGIVVGAILVLAAIFIAVWFFVVR  288

Query  1201  KKKEF-------AARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKN  1359
             K+ E        A  +S  +  L     V + + K+   +  LK PP+ KV     + ++
Sbjct  289   KRSELTKPLDLEANHSSRRTWFLPLIPAVEEPKIKALPPLKSLKVPPALKVEEATYKVES  348

Query  1360  -GSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAA  1536
              G + +S ITA  ++VA LQ AT+SFS++NL+GEGSLG VYRA+FP+G+VLA+KK+D+ A
Sbjct  349   EGKVNKSNITAREFSVAELQAATDSFSEDNLLGEGSLGCVYRAEFPDGEVLAVKKLDTTA  408

Query  1537  LSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERS  1716
               ++ ED+FL  +  ++RL+H N   LVGYCAEHGQRLLVY +I  G+LH++LH + +  
Sbjct  409   SMVRNEDDFLSVVDGLARLQHTNSNELVGYCAEHGQRLLVYKFISRGTLHELLHGSADSP  468

Query  1717  QLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTP  1896
             + L+WN RV++ALG ARALEY HE+    VVHRNF+S+NILLD+ELNPH+SDCGLAA TP
Sbjct  469   KELSWNVRVKIALGCARALEYFHEIVSQPVVHRNFRSSNILLDDELNPHVSDCGLAAFTP  528

Query  1897  NT-ERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSE  2073
             ++ ERQ+S+  V+GSFGYS PEF+ SG+Y VKSDVYSFGVVMLEL+TGRKPLDSSR RSE
Sbjct  529   SSAERQVSA-QVLGSFGYSPPEFSTSGMYDVKSDVYSFGVVMLELMTGRKPLDSSRPRSE  587

Query  2074  QSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ  2253
             Q+LVRWATPQLHDIDAL++MVDPAL G YPAKSLSRFADI+ALCVQPEPEFRPP+SEVVQ
Sbjct  588   QNLVRWATPQLHDIDALARMVDPALEGAYPAKSLSRFADIVALCVQPEPEFRPPISEVVQ  647

Query  2254  ALVRLVQRASVVIRRYSDESG  2316
             +LVRL+QRA++  RR+   +G
Sbjct  648   SLVRLMQRAALSKRRHEYNAG  668



>ref|XP_006841742.1| hypothetical protein AMTR_s00003p00260350 [Amborella trichopoda]
 gb|ERN03417.1| hypothetical protein AMTR_s00003p00260350 [Amborella trichopoda]
Length=737

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/734 (47%), Positives = 454/734 (62%), Gaps = 34/734 (5%)
 Frame = +1

Query  244   VLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQ  423
             VL+ A  +  + F    TD  D+ A+  LY +L+SP  + GW A GGDPCG+ W+GV C 
Sbjct  10    VLIGALFLPSIPFSHCYTDVQDVFAINSLYAALDSPP-IPGWVALGGDPCGDMWQGVQCT  68

Query  424   GSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNI  603
              + + +I +    L G +G  L  FTSL  ++LS+N I   IP  LPP+L  L L++N  
Sbjct  69    FANITAIVLNAANLGGQLGAALGNFTSLITINLSNNHIGATIPDSLPPHLQQLFLSDNQF  128

Query  604   TGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLS  783
              G+IP S+S ++ L  ++ + N L  PI D F   S +  LDLS NN +G LPAS+  LS
Sbjct  129   IGTIPSSLSELSLLLDMSLNDNLLTGPIPDAFQALSSIINLDLSNNNITGQLPASMQDLS  188

Query  784   NLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpa  963
             +L+ L +QNNQL+G L+VL +LPL +L++ NN FSG IP  L +IP F   GN F+ +PA
Sbjct  189   SLTTLHLQNNQLSGILDVLENLPLKNLHIENNLFSGPIPPALFNIPDFVKDGNPFNTTPA  248

Query  964   pppppftppppgrpHKRTNHSTPGSHKT------PGSDDNHSDHEngngngkngVKAGAi  1125
             P PPP    PP   +   +   P  H         GSD +    +        G+ A   
Sbjct  249   PSPPPHVISPPPISNSPVSEVPPRMHAQGPSSTQSGSDLDAGSRKFLATKNIVGLSAAGA  308

Query  1126  vgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSL----------PLSTDKEVLDQ  1275
             V I     +++  A        R  K +E    +    L          P   D E   Q
Sbjct  309   VIIAFVVCSLIFIACRKRKSRNRPSKTQEMGKESPKKQLLADSLVRPSNPSKKDHEGRVQ  368

Query  1276  R------AKSTATVVDLKPPPSE---KVTIERMQGKNGSLRRSP---ITATPYTVAVLQT  1419
             +          AT  +LK PP E   K+ ++++  +   ++++P   I+A PYT+A LQ 
Sbjct  369   KQGDEHHVNMVATDANLKQPPGENATKMPVKKLTWR--PIQKNPNNSISAVPYTIASLQQ  426

Query  1420  ATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRH  1599
              TNSF+QENL+GEGSLGRVYRA   +GK+LA+KK+D  +  +Q ++ FLE +S++S+LRH
Sbjct  427   FTNSFAQENLIGEGSLGRVYRAKLFDGKLLAVKKLDIPSPLMQSDETFLELVSSISKLRH  486

Query  1600  PNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEY  1779
              NI  LVGYC+EHGQ+LLVY+Y GN +LH+ LH  DE  + L+WN R++VALG +RAL Y
Sbjct  487   VNIAELVGYCSEHGQQLLVYEYYGNRTLHEALHLGDEVGRKLSWNVRLKVALGVSRALAY  546

Query  1780  LHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPE  1959
             LHE C P V H+NFKSANIL DEE++  LSDCGL+AL  +       +  +GSFGYS PE
Sbjct  547   LHEACEPPVAHQNFKSANILFDEEMSARLSDCGLSALISSDLMSPIPSLALGSFGYSPPE  606

Query  1960  FALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVD  2139
              ++SG YT++SDVY FGVVMLELLTGRKP D  R R E SLVRWA PQLHDI+ALSKMVD
Sbjct  607   VSMSGAYTLQSDVYCFGVVMLELLTGRKPFDRERPRGEHSLVRWAAPQLHDIEALSKMVD  666

Query  2140  PALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGF  2319
             PAL+G YPAKSLSRFADII+LCVQPEPEFRPPMSE+VQALVR++QR +   +      G 
Sbjct  667   PALSGNYPAKSLSRFADIISLCVQPEPEFRPPMSEIVQALVRMIQRENPTNKNSRSNGGL  726

Query  2320  AYKTPDHDAASGDP  2361
                 P+H A+S  P
Sbjct  727   ---DPEHHASSSRP  737



>ref|XP_006383865.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
 gb|ERP61662.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
Length=481

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/531 (62%), Positives = 387/531 (73%), Gaps = 56/531 (11%)
 Frame = +1

Query  328   LYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSL  507
             +Y SLNSPSQL+ WK++GGDPC ESWKG+TC+GSAVVSI+I GLGL+GTMGY+L    SL
Sbjct  1     MYTSLNSPSQLTTWKSNGGDPCAESWKGITCEGSAVVSIQISGLGLDGTMGYLLANLMSL  60

Query  508   KELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPI  687
             + LDLS N +HD  PYQLPPNLTSLNLA NN++G+IPYS+S M SL+YLN S NSLAQ I
Sbjct  61    RTLDLSDNHLHDSFPYQLPPNLTSLNLAKNNLSGNIPYSMSSMVSLSYLNISRNSLAQSI  120

Query  688   GDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLN  867
             GD+F N S L T+DLSFN+FSGDLP+S   LSNLS L VQNNQLTGSLNVL  LPLT LN
Sbjct  121   GDVFLNLSLLATMDLSFNSFSGDLPSSFNSLSNLSTLNVQNNQLTGSLNVLTGLPLTTLN  180

Query  868   VANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKT  1047
             VANN FSGWIP EL SIP F Y GNSF N P+PPPPP+TPPPPG+ H+   H   G+  T
Sbjct  181   VANNNFSGWIPQELSSIPNFIYDGNSFDNGPSPPPPPYTPPPPGKSHRNRTHPGSGAPVT  240

Query  1048  PGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAART  1227
             P SD   S  +        G+  GAIVG+ LGS  +VL  ++ +V+C+++ K KE     
Sbjct  241   PSSDGQPSQSD-------KGISVGAIVGVALGSLVLVLIVLLALVFCIKKHKSKEI----  289

Query  1228  STGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRR--SPITATPYT  1401
                      D+++ + R K+ A V DLKPPP+E  +     G +GS++R  SPITAT Y+
Sbjct  290   --------VDRDMQESRVKNMAAVTDLKPPPAEIASYNE-HGNSGSIKRMKSPITATSYS  340

Query  1402  VAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISN  1581
                                               ++A+KK+D+AALSLQEEDNFLEA+SN
Sbjct  341   ----------------------------------MMAVKKIDNAALSLQEEDNFLEAVSN  366

Query  1582  MSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGT  1761
             MS LRHPNIV LVGYC EHGQRLLVY+YI NGS+HD+LHFAD+ S+ L+WNARVRVALGT
Sbjct  367   MSHLRHPNIVSLVGYCVEHGQRLLVYEYIANGSVHDILHFADDGSKTLSWNARVRVALGT  426

Query  1762  ARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQI  1914
             ARALEYLHEVCLPSVVHRN KSANILLDEELNPHLSDCGLAALTPNTERQ+
Sbjct  427   ARALEYLHEVCLPSVVHRNLKSANILLDEELNPHLSDCGLAALTPNTERQV  477



>gb|EEE67594.1| hypothetical protein OsJ_25142 [Oryza sativa Japonica Group]
Length=680

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/712 (49%), Positives = 442/712 (62%), Gaps = 66/712 (9%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             V+L +AA +S    V A TD +D+ AL VLY S+NSPSQL+ W +  GDPCG+SW G+TC
Sbjct  8     VMLFLAATLSG---VSANTDSDDVNALNVLYTSMNSPSQLTNWVSQNGDPCGQSWLGITC  64

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDL-IPYQLPPNLTSLNLANN  597
              GS V +I++ G+G+NGT+GY +N  TSL ELD S N +    IPY LPPNL  LNLA N
Sbjct  65    SGSRVTAIKLSGMGINGTLGYNMNLLTSLVELDTSKNNLGGSDIPYNLPPNLERLNLAEN  124

Query  598   NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
             N TGSIPYSIS M +L  LN   N LA    DMF   ++LTT +L               
Sbjct  125   NFTGSIPYSISQMIALRILNLGHNHLAT-TNDMFNQLTNLTTFNL---------------  168

Query  778   LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNS  957
                      QNN   G+++VL DLPLTDLNVANN+F+GWIP++L  I   + +GNSF + 
Sbjct  169   ---------QNNGFNGTIDVLADLPLTDLNVANNQFTGWIPDKLKKIKNLQTNGNSFGSG  219

Query  958   papppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgiv  1137
             P+PPPPP+  PP   P  ++  S   +  T   ++N SD    +     G  AG +V +V
Sbjct  220   PSPPPPPYQSPPYKSPPYKSPQSRQPAPPTTTVNNNPSDDGRKHSKLSGGAIAGIVVCLV  279

Query  1138  lgssavvlsaivvivYCLRRC---KKKEFAARTSTG---SLPLSTDKEVLDQRAK---ST  1290
             +  + V    I    + L R    ++KE  +   +G   SL      +++    K     
Sbjct  280   VVGAIVAFFVIKKKYWSLPRGGDPEQKEPLSPIVSGFKDSLKQMKSIKIISTIGKEELQK  339

Query  1291  ATVVDLKPPPSEKV--TIERMQGKNGSLRR----SPITATPYTVAVLQTATNSFSQENLV  1452
                ++LKPP    +  +I+     + S  R    S I    YTVA LQ AT SF  +NL+
Sbjct  340   TVSMNLKPPTRIDLHKSIDENDVTSKSFTRKISFSSIRTPAYTVADLQVATGSFCADNLI  399

Query  1453  GEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCA  1632
             GEG  GRVY+A F + KVLA+KK++ +A      D F+E ++N+SRL HP++  LVGYC+
Sbjct  400   GEGLFGRVYKAKFNDHKVLAVKKINFSAFPGHPSDLFIELVANISRLNHPSLSELVGYCS  459

Query  1633  EHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVH  1812
             EHGQ LL Y++  NGSL D+LH  D++SQ L+WN+RV++ALG+ARALEYLHE C PSV+H
Sbjct  460   EHGQCLLAYEFYRNGSLKDLLHLVDDQSQPLSWNSRVKIALGSARALEYLHETCSPSVIH  519

Query  1813  RNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKS  1992
             +NFKS+NI LD ELNPHLSD G A L PN E Q+S        GY APE  +SG Y+VKS
Sbjct  520   KNFKSSNIFLDNELNPHLSDSGFADLIPNRESQVSDEDS----GYRAPEVTMSGQYSVKS  575

Query  1993  DVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKS  2172
             DVYSFGVVMLELLTGRKP D SR RSEQSL                MVDPAL G+YP+KS
Sbjct  576   DVYSFGVVMLELLTGRKPFDRSRPRSEQSL----------------MVDPALQGLYPSKS  619

Query  2173  LSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYK  2328
             LSRFAD IALCVQ EPEFRPPMSEVVQ LVRLVQRA++   R     G +++
Sbjct  620   LSRFADAIALCVQSEPEFRPPMSEVVQLLVRLVQRANMT--RMCGADGHSWR  669



>gb|EMT07607.1| Protein STRUBBELIG-RECEPTOR FAMILY 7 [Aegilops tauschii]
Length=1220

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/734 (48%), Positives = 458/734 (62%), Gaps = 80/734 (11%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TD ND+ AL V Y ++N P QL  W +  GDPCG+SW+G+TC GS V +I        
Sbjct  27    ANTDSNDVTALNVFYTTMNHPPQLKNWVSQNGDPCGQSWQGITCSGSRVTAI--------  78

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDL-IPYQLPPNLTSL---------------------  582
                        S+   D+S+N +    IPY LPPNL  L                     
Sbjct  79    -----------SVLCSDMSNNNLGGSDIPYNLPPNLEKLLVLLCVTQASLIYMRNNLLVL  127

Query  583   -------NLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFN  741
                    NLA N+ TG+ PYSIS M +L  LN + N L+  I DMF   ++LTT+D+SFN
Sbjct  128   TENLICRNLAGNHFTGTTPYSISQMVALKDLNLAHNQLST-ISDMFNQLTNLTTMDISFN  186

Query  742   NFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIP  921
              FSG++P S   +++L  L +QNNQ +G+++VL +LPLTDLNVANN+F+GW+P++L  I 
Sbjct  187   TFSGNIPQSFNSITSLKTLYLQNNQFSGTIDVLANLPLTDLNVANNQFTGWVPDKLKKIS  246

Query  922   KFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngk  1101
               + +GNSFSN PAPPPPP T P P         + P S+   G   + S H    G   
Sbjct  247   SLQTTGNSFSNGPAPPPPPATNPTPTPTPMPQRPALPSSNDNNGPSGSGSKHSKLQGGAI  306

Query  1102  ngVKAGAivgivlgssavvlsaivvivYCLRRCK---KKEFAARTSTGSLPLSTDKEV--  1266
                 AG ++ +++  +      I    + L R +   +KE  +  ++G   + + K +  
Sbjct  307   ----AGIVICLLVLGAMFAFFVIKRKSWKLSRGRDPEQKEPLSPLASGFKQMKSIKIIST  362

Query  1267  --LDQRAKSTATVVDLKPPPSEKVTIERMQGKNG----SLRR----SPITATPYTVAVLQ  1416
                DQ  K+ +  + LKPP   K+ + +   +N     S+ R    S I    YTVA LQ
Sbjct  363   TGKDQFQKTVS--MSLKPP--TKIDLHKSFDENDLTTKSVTRKISLSSIKIPAYTVADLQ  418

Query  1417  TATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLR  1596
              AT SFS ++ + EGS GRV+RA F + KVLA+KK++ +A      D F+E ++N+SRL 
Sbjct  419   IATGSFSADHFISEGSFGRVFRAQFNDQKVLAVKKINFSAFPGYPSDLFIELVANISRLN  478

Query  1597  HPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALE  1776
             HPN+  LVGYCAEHGQ LLVY++  NGSL D+L+  D++S+ L+W++RV++ALG+ARALE
Sbjct  479   HPNLAELVGYCAEHGQCLLVYEFYQNGSLCDLLNLVDDQSKPLSWSSRVKIALGSARALE  538

Query  1777  YLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAP  1956
             YLHE C PSV+H+NFKS+NILLD ELNPHLSD G   L PN E Q S  +     GY AP
Sbjct  539   YLHETCSPSVIHKNFKSSNILLDNELNPHLSDSGYGDLIPNQEFQESEENS----GYRAP  594

Query  1957  EFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMV  2136
             E A+SG Y++KSDVYSFGVVMLELLTGRKP D SR RSEQSLVRWA PQLHDIDAL +MV
Sbjct  595   EVAMSGQYSLKSDVYSFGVVMLELLTGRKPFDRSRPRSEQSLVRWAAPQLHDIDALDQMV  654

Query  2137  DPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             DPAL G+Y +KSLSRFAD IALCVQ EPEFRPPMSEVVQ+LVRLVQRA++  R  S ES 
Sbjct  655   DPALQGLYHSKSLSRFADAIALCVQAEPEFRPPMSEVVQSLVRLVQRANMT-RMSSSES-  712

Query  2317  FAYKTPDHDAASGD  2358
               Y   D ++A+ D
Sbjct  713   --YTRRDRESAAWD  724



>ref|XP_008649052.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Zea mays]
Length=734

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/612 (55%), Positives = 416/612 (68%), Gaps = 43/612 (7%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TD  D+ AL  LY S NSP+QL+GW ASGGDPCG +W GV+C GSAV SI++ G+ LN
Sbjct  24    ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             GT+GY L+   +LK +DLS+N +HD IPYQLP NLT LNLA NN +G++PYSIS + SL 
Sbjct  84    GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YLN S NSL Q IG++F + + L+ LD+SFNN +G+LP S+G LS LS L +QNNQL+G+
Sbjct  144   YLNLSHNSLFQEIGELFGSLNSLSELDVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  203

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             ++VL ++ L  LN+A+N FSG IP E  SIP     GNSF N    P  P +   P    
Sbjct  204   VDVLSNISLATLNIADNNFSGMIPQEFSSIPNLIVGGNSFVN---MPASPPSTLKPPLEE  260

Query  1009  KRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYC  1188
              +   S P S  TP   D+              ++ G ++GI +GS A     + V+V+C
Sbjct  261   PQGPVSAPTSPDTPIDQDDRK------------IQTGPLIGIAVGSIAAASCVLFVLVFC  308

Query  1189  L---RRCKKKEFAA-RTSTGSLPLSTD----KEVLDQRAKSTATVV-DLKPPPSEKVTIE  1341
             L   RR    E +  +   GSL +S +    +EVL+   +++A    DL+      +T +
Sbjct  309   LHNARRRNDDEISEPKDLVGSLAVSIETASSREVLNNNHENSAVATSDLQHAGKMMMTPD  368

Query  1342  RM--QGKNGSLR----RSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGK  1503
             R+     NGS      + P+T T YTVA LQ ATNSF +++L+GEGSLGRVY+A FPNGK
Sbjct  369   RVLHDTTNGSSTAKRPKVPVTVTSYTVADLQVATNSFCEDSLLGEGSLGRVYKAGFPNGK  428

Query  1504  VLAIKKVD-SAALSLQE--EDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGN  1674
             VLA+KKVD SA LSL    ED FLE +SN+SRLRHPNIVPL GYC EHGQRLLVY+Y+GN
Sbjct  429   VLAVKKVDDSALLSLYGGGEDAFLELVSNVSRLRHPNIVPLTGYCVEHGQRLLVYEYVGN  488

Query  1675  GSLHDMLHFA---DE-RSQLLTWNARVRVALGTARALEYLHEVCLPSVVH-RNFKSANIL  1839
             G+L D+L      DE  S+ LTWN RVR+ALGTARALEYLHEVC+P VVH R FK++NIL
Sbjct  489   GTLRDVLQHCLSDDEGASKKLTWNTRVRIALGTARALEYLHEVCIPPVVHSRTFKASNIL  548

Query  1840  LDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVM  2019
             LDEE +PHLSDCGLAALT      + S   VGSFGYSAPE A+SG YT KSDVYSFGVVM
Sbjct  549   LDEEYSPHLSDCGLAALT-----TVVSPEAVGSFGYSAPELAMSGTYTAKSDVYSFGVVM  603

Query  2020  LELLTGRKPLDS  2055
             LELLTGRKPLDS
Sbjct  604   LELLTGRKPLDS  615



>ref|XP_006850050.1| hypothetical protein AMTR_s00022p00198910 [Amborella trichopoda]
 gb|ERN11631.1| hypothetical protein AMTR_s00022p00198910 [Amborella trichopoda]
Length=667

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/649 (50%), Positives = 406/649 (63%), Gaps = 33/649 (5%)
 Frame = +1

Query  280   FVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGL  459
              V A TD +D++AL+ +Y SLN P QL GW + GGDPC ESW G++C  SAV SI+I GL
Sbjct  22    IVVAETDESDVRALQDIYVSLNFPFQLIGWNSIGGDPCRESWMGISCSVSAVTSIDIHGL  81

Query  460   GLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMT  639
             GL GT+GY L+   SLK LD+S+N IHD IP QLP N+T LNLA NN   S+PYSIS ++
Sbjct  82    GLTGTLGYQLSNLASLKALDVSNNSIHDAIPSQLPSNITYLNLAYNNFNQSLPYSISELS  141

Query  640   SLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQL  819
             SL  LN S NSL+ PIGD+F    +L+ LDLSFNNF+GDLP S   LS LS L +QNN L
Sbjct  142   SLASLNVSHNSLSGPIGDIFNKLQNLSLLDLSFNNFTGDLPLSFITLSKLSNLFLQNNYL  201

Query  820   TGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpappp---ppftpp  990
             +GS++ L  LPL+DLNV NN FSGWIP E  SIP    SGN F N               
Sbjct  202   SGSVDFLSHLPLSDLNVENNYFSGWIPKEFDSIPYLRISGNLFQNGAPQSSHPFSELPSG  261

Query  991   ppgrpHKRTNH--STPGSHKTPGSDDN-HSDHEngngngkngVKAGAivgivlgssavvl  1161
                  H  TN   + PG+  +  SD N   DH+        GV A  ++ IV GS   + 
Sbjct  262   VVEPKHNITNKPLTVPGAFVSLPSDQNCERDHKRLVAGLMIGVAAAGVLIIVGGSLCFIF  321

Query  1162  saivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATV------VDLKPPPS  1323
             +       C  R   K+     S  +LP++T  E    R +   T        +LKPPP 
Sbjct  322   A-------CYHRSFPKKMLC-ASLCTLPITT-SEASKMRVEKVWTKNPSPHEFELKPPPG  372

Query  1324  E--KVTIERMQGKN--GSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADF  1491
             +  + + ER   +   G  RR P+ A  Y++A LQTATNSF  E+ VG GSLG VY+A F
Sbjct  373   QLKRKSCERAAARKSMGKRRRGPLNAVSYSLADLQTATNSFGPESFVGGGSLGCVYKAQF  432

Query  1492  PNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIG  1671
             P+GKVLA+K ++   L +QE+D FLE I  +S L+HPNI  L GYC E GQ+LLVYDYI 
Sbjct  433   PDGKVLAVKYINLQGLYIQEQDAFLEMIYCLSELKHPNIASLQGYCIEQGQKLLVYDYIV  492

Query  1672  NGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE  1851
             NG+L+D LH +   S++L WNARV +AL  AR LEYLH   L  ++H N KS NI+ DE 
Sbjct  493   NGTLYDALHRSGPCSKILKWNARVDIALHIARGLEYLHSGGLTPIIHGNLKSENIMFDEY  552

Query  1852  LNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELL  2031
              NP L+DCGLA L P      S  HV GSFG + PE  +SGVY  KSD+Y+FGVV+LELL
Sbjct  553   RNPRLTDCGLATLMP------SKHHVSGSFGCTPPEVVISGVYIEKSDIYNFGVVLLELL  606

Query  2032  TGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLS  2178
             TGR PLD  R + +QSLV WATPQLHDIDAL KMVDPAL+G++P    S
Sbjct  607   TGRVPLD--RGKWQQSLVDWATPQLHDIDALVKMVDPALSGIFPKNLFS  653



>ref|XP_008649051.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Zea mays]
Length=735

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/613 (54%), Positives = 416/613 (68%), Gaps = 44/613 (7%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TD  D+ AL  LY S NSP+QL+GW ASGGDPCG +W GV+C GSAV SI++ G+ LN
Sbjct  24    ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             GT+GY L+   +LK +DLS+N +HD IPYQLP NLT LNLA NN +G++PYSIS + SL 
Sbjct  84    GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YLN S NSL Q IG++F + + L+ LD+SFNN +G+LP S+G LS LS L +QNNQL+G+
Sbjct  144   YLNLSHNSLFQEIGELFGSLNSLSELDVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  203

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             ++VL ++ L  LN+A+N FSG IP E  SIP     GNSF N    P  P +   P    
Sbjct  204   VDVLSNISLATLNIADNNFSGMIPQEFSSIPNLIVGGNSFVN---MPASPPSTLKPPLEE  260

Query  1009  KRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYC  1188
              +   S P S  TP   D+              ++ G ++GI +GS A     + V+V+C
Sbjct  261   PQGPVSAPTSPDTPIDQDDRK------------IQTGPLIGIAVGSIAAASCVLFVLVFC  308

Query  1189  L---RRCKKKEFAA-RTSTGSLPLSTD-----KEVLDQRAKSTATVV-DLKPPPSEKVTI  1338
             L   RR    E +  +   GSL +S +     +EVL+   +++A    DL+      +T 
Sbjct  309   LHNARRRNDDEISEPKDLVGSLAVSIETAASSREVLNNNHENSAVATSDLQHAGKMMMTP  368

Query  1339  ERM--QGKNGSLR----RSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNG  1500
             +R+     NGS      + P+T T YTVA LQ ATNSF +++L+GEGSLGRVY+A FPNG
Sbjct  369   DRVLHDTTNGSSTAKRPKVPVTVTSYTVADLQVATNSFCEDSLLGEGSLGRVYKAGFPNG  428

Query  1501  KVLAIKKVD-SAALSLQE--EDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIG  1671
             KVLA+KKVD SA LSL    ED FLE +SN+SRLRHPNIVPL GYC EHGQRLLVY+Y+G
Sbjct  429   KVLAVKKVDDSALLSLYGGGEDAFLELVSNVSRLRHPNIVPLTGYCVEHGQRLLVYEYVG  488

Query  1672  NGSLHDMLHFA---DE-RSQLLTWNARVRVALGTARALEYLHEVCLPSVVH-RNFKSANI  1836
             NG+L D+L      DE  S+ LTWN RVR+ALGTARALEYLHEVC+P VVH R FK++NI
Sbjct  489   NGTLRDVLQHCLSDDEGASKKLTWNTRVRIALGTARALEYLHEVCIPPVVHSRTFKASNI  548

Query  1837  LLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVV  2016
             LLDEE +PHLSDCGLAALT      + S   VGSFGYSAPE A+SG YT KSDVYSFGVV
Sbjct  549   LLDEEYSPHLSDCGLAALT-----TVVSPEAVGSFGYSAPELAMSGTYTAKSDVYSFGVV  603

Query  2017  MLELLTGRKPLDS  2055
             MLELLTGRKPLDS
Sbjct  604   MLELLTGRKPLDS  616



>ref|XP_002532341.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30043.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=718

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/685 (45%), Positives = 428/685 (62%), Gaps = 16/685 (2%)
 Frame = +1

Query  226   FLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESW  405
             F FT V++  A L+S+     A TDP D  ALE LY +LN P QL  WK  GGDPC ESW
Sbjct  8     FYFT-VIVFSAILVSQ---AWAVTDPYDAIALENLYLALNKPPQLKSWKLEGGDPCQESW  63

Query  406   KGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLN  585
              GV+C GS++V ++I GL L+G +G  L+   +LK LD+SSN I   IPY LPPN+T++N
Sbjct  64    TGVSCSGSSIVHLKIQGLNLSGYLGTQLHYLHNLKYLDVSSNYILGEIPYSLPPNVTNIN  123

Query  586   LANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPA  765
             LA NN++ +IP+S+S +  L +LN S N L+ PIG++FT   +L  +DLS+N+FSGDLP 
Sbjct  124   LAFNNLSQNIPHSLSSLKVLRHLNLSHNLLSGPIGNVFTGLKNLKAMDLSYNDFSGDLPP  183

Query  766   SLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNS  945
             S G L NLS L +QNNQ TGS+  L DLPLTDLN+ +N+FSG IP +   IP     GN 
Sbjct  184   SFGSLKNLSRLFLQNNQFTGSVIYLADLPLTDLNIQSNQFSGVIPTQFQYIPNLWIDGNK  243

Query  946   FSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAi  1125
             F      PP  +            N S P S ++  + +N+ +H+      +   + G  
Sbjct  244   FHIGANYPPWNYPLENVTIGQ---NFSGPPSAES-SALENYPNHKAAEHKKR---RLGPG  296

Query  1126  vgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVD  1305
                 +     ++ A   I + +R  +  +F  R      P + D        KS  T+  
Sbjct  297   GIACVVGGTTLVVACAAIFFAVRVKQSVDFPVRNREDCSPAAYDASPQLLPVKSPPTLGL  356

Query  1306  LKPPPSEKVTIERMQGKNGSLRR--SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVY  1479
                PP+ +   E+M  +    ++  +P +A  YTV  LQ+ATNSFS++NL+GEGSLG VY
Sbjct  357   NYVPPACRTRNEKMSRRRSFAKKYKAPASAKIYTVVELQSATNSFSEKNLIGEGSLGSVY  416

Query  1480  RADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVY  1659
             RA+FP+G++LA++ +   +LS QEE+ F++ I   SRLRHPNI  L+GYC EHGQ LLVY
Sbjct  417   RAEFPDGQILAVRNISMVSLSFQEEEQFMDVIWTASRLRHPNIATLLGYCVEHGQHLLVY  476

Query  1660  DYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  1839
             +YI + SL ++LH   E  + L W  R+ +ALG ARAL+YLH    P + H N K++N+L
Sbjct  477   EYIKSLSLDNVLH--GEGYKPLPWTVRLNIALGVARALDYLHSTFCPPIAHGNIKASNVL  534

Query  1840  LDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVM  2019
             LDEEL P L DCG+A L P T    S    VG  GY+APE    G    KSDVY+FGV++
Sbjct  535   LDEELKPRLCDCGIAILRPLTSNSASEI-AVGDTGYTAPEHGEPGTDNTKSDVYAFGVLL  593

Query  2020  LELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIA  2199
             LELLTGRKP DSS+ R EQSL +WA+ +LHD   L++MVDP++     +K++SR+ADI++
Sbjct  594   LELLTGRKPFDSSKSRKEQSLAKWASSRLHDNAYLAQMVDPSIKRTLTSKTISRYADIVS  653

Query  2200  LCVQPEPEFRPPMSEVVQALVRLVQ  2274
              C+QPE  FRPPMSE+V++L  L+Q
Sbjct  654   FCIQPEKLFRPPMSEIVESLASLLQ  678



>tpg|DAA46922.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=632

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/644 (50%), Positives = 412/644 (64%), Gaps = 51/644 (8%)
 Frame = +1

Query  241   VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
             ++    A   R   V AATD ND+ AL  L+ S+NSP QL GWK SGGDPCGESW+G+TC
Sbjct  12    ILTCFGAWTPRQILVAAATDANDVTALNTLFTSMNSPGQLQGWKVSGGDPCGESWQGITC  71

Query  421   QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIH--DLIPYQLP-PNLTSLNLA  591
              GS+V +I++P LGL+G + Y +N   SL ELD+S N +     IPY LP   L  LNLA
Sbjct  72    SGSSVTAIKLPNLGLSGNLAYNMNTMDSLVELDMSHNNLGGGQQIPYNLPNKKLERLNLA  131

Query  592   NNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASL  771
              N  +GS+PYSIS M ++ YLN + N L+  I D+F+N   LTT+DLS N+ +G+LP S 
Sbjct  132   ENQFSGSVPYSISTMPNIKYLNLNHNQLSGDITDIFSNLPSLTTVDLSSNSLTGNLPQSF  191

Query  772   GLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
               LS+L  L +QNNQLTGS+NVL +LPL DLNVANNRF+GWIP EL  I   +  GNS+S
Sbjct  192   TSLSSLKTLYLQNNQLTGSINVLANLPLDDLNVANNRFTGWIPEELKKINSLQTDGNSWS  251

Query  952   NSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivg  1131
                APPPPPFT PP      R    +PG H               N +   G  +     
Sbjct  252   TGSAPPPPPFTAPP----RSRNRRKSPGQHSN-----------GSNNSSSGGSSSIGAGA  296

Query  1132  ivlgssavvlsaivvivYCLRRCKKK-----EFAARTSTGSLPLSTDKEVLDQRAKSTAT  1296
             I     +V++   +V  + ++R K+K      +  R    S P +  K +      +T  
Sbjct  297   IAGIIISVLVVGALVAFFLIKRNKRKSAMPEHYEQRQPFNSFPSNEVKNMKPIEEATTVE  356

Query  1297  V--------VDLKPPPSEKVTIERMQ------------GKNGSLRRSPITATPYTVAVLQ  1416
             V        V+LKPPP     IER Q                +   +P+ AT Y+VA LQ
Sbjct  357   VESLPSPAAVNLKPPPK----IERNQSFDDDDFANKPVAMKSNAAAAPVKATVYSVADLQ  412

Query  1417  TATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLR  1596
              AT+SF+ +NL+GEG+LGRVY+A F +GKVLA+KK++S  L  Q  D+F E +SN+S+L 
Sbjct  413   MATDSFNMDNLIGEGTLGRVYKAQFSDGKVLAVKKLNSTTLPRQSSDDFYELVSNISKLH  472

Query  1597  HPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALE  1776
             HPN+  LVGYC EHGQ LLVYD+  NGSLHDMLH +D+ ++ L+WN+RV++ALG+ARALE
Sbjct  473   HPNLSELVGYCMEHGQHLLVYDFHRNGSLHDMLHLSDDYNKPLSWNSRVKIALGSARALE  532

Query  1777  YLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAP  1956
             +LHE+C PS++H+NFKS+NILLD ELNPH+SD G ++  P+ E Q S     GS GYSAP
Sbjct  533   HLHEICSPSIIHKNFKSSNILLDTELNPHISDAGHSSFVPDAEFQASDQ---GS-GYSAP  588

Query  1957  EFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVR  2088
             E  +SG YT+KSDVYSFGVVMLELLTGRKP DSSR RSEQSLVR
Sbjct  589   EVEMSGQYTLKSDVYSFGVVMLELLTGRKPFDSSRPRSEQSLVR  632



>dbj|BAJ88293.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/345 (76%), Positives = 299/345 (87%), Gaps = 4/345 (1%)
 Frame = +1

Query  1333  TIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGK  1503
             T ER  G N S  +    P  AT YTVA LQ ATNSF Q++L+GEGSLGRVY+ADFPNGK
Sbjct  105   TPERAYGINSSPAKKIKVPGAATSYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGK  164

Query  1504  VLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSL  1683
             VLA+KK+DSAALSL EED+FLE +SN+SRLRHPNIV L GYCA+HGQRLLVY++IGNG+L
Sbjct  165   VLAVKKIDSAALSLYEEDHFLEVVSNISRLRHPNIVSLTGYCADHGQRLLVYEHIGNGTL  224

Query  1684  HDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPH  1863
             HDMLHF+DE S+ LTWNARVR+ALGTARALEYLHEVCLP VVHRN KS+NILLDEE +PH
Sbjct  225   HDMLHFSDEASKNLTWNARVRIALGTARALEYLHEVCLPPVVHRNLKSSNILLDEECSPH  284

Query  1864  LSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRK  2043
             LSDCGLAA +PN ER++ ST V+GS GYSAPEFA+SG YTVKSDVYSFGVVMLELLTGRK
Sbjct  285   LSDCGLAAFSPNPEREV-STEVLGSLGYSAPEFAMSGTYTVKSDVYSFGVVMLELLTGRK  343

Query  2044  PLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPE  2223
             PLD SRERSEQSLV WATPQLHDIDAL+KMVDPA++GMYPAKSLSRFADIIAL VQPEPE
Sbjct  344   PLDRSRERSEQSLVGWATPQLHDIDALAKMVDPAMDGMYPAKSLSRFADIIALSVQPEPE  403

Query  2224  FRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             FRPP+SEVVQ LVRL+QRAS++ R+  D+ G +Y+ P+ +  + D
Sbjct  404   FRPPISEVVQQLVRLMQRASMLRRQSGDDLGSSYRAPEREGGASD  448



>gb|AFW76250.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=536

 Score =   543 bits (1400),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 317/555 (57%), Positives = 389/555 (70%), Gaps = 46/555 (8%)
 Frame = +1

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
             +G LS LS L +QNNQL+G+++VL ++ L  LN+A+N FSG IP E  SIP     GNSF
Sbjct  1     MGALSKLSSLYMQNNQLSGTVDVLSNISLATLNIADNNFSGMIPQEFSSIPNLIVGGNSF  60

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N    P  P +   P     +   S P S  TP   D+              ++ G ++
Sbjct  61    VN---MPASPPSTLKPPLEEPQGPVSAPTSPDTPIDQDDRK------------IQTGPLI  105

Query  1129  givlgssavvlsaivvivYCL---RRCKKKEFAA-RTSTGSLPLSTD----KEVLDQRAK  1284
             GI +GS A     + V+V+CL   RR    E +  +   GSL +S +    +EVL+   +
Sbjct  106   GIAVGSIAAASCVLFVLVFCLHNARRRNDDEISEPKDLVGSLAVSIETASSREVLNNNHE  165

Query  1285  STATVV-DLKPPPSEKVTIERM-----QGKNGSLR-RSPITATPYTVAVLQTATNSFSQE  1443
             ++A    DL+      +T +R+      G + + R + P+T T YTVA LQ ATNSF ++
Sbjct  166   NSAVATSDLQHAGKMMMTPDRVLHDTTNGSSTAKRPKVPVTVTSYTVADLQVATNSFCED  225

Query  1444  NLVGEGSLGRVYRADFPNGKVLAIKKVD-SAALSLQE--EDNFLEAISNMSRLRHPNIVP  1614
             +L+GEGSLGRVY+A FPNGKVLA+KKVD SA LSL    ED FLE +SN+SRLRHPNIVP
Sbjct  226   SLLGEGSLGRVYKAGFPNGKVLAVKKVDDSALLSLYGGGEDAFLELVSNVSRLRHPNIVP  285

Query  1615  LVGYCAEHGQRLLVYDYIGNGSLHDMLHFA---DE-RSQLLTWNARVRVALGTARALEYL  1782
             L GYC EHGQRLLVY+Y+GNG+L D+L      DE  S+ LTWN RVR+ALGTARALEYL
Sbjct  286   LTGYCVEHGQRLLVYEYVGNGTLRDVLQHCLSDDEGASKKLTWNTRVRIALGTARALEYL  345

Query  1783  HEVCLPSVVH-RNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPE  1959
             HEVC+P VVH R FK++NILLDEE +PHLSDCGLAALT      + S   VGSFGYSAPE
Sbjct  346   HEVCIPPVVHSRTFKASNILLDEEYSPHLSDCGLAALT-----TVVSPEAVGSFGYSAPE  400

Query  1960  FALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVD  2139
              A+SG YT KSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWA PQLHDID L++MVD
Sbjct  401   LAMSGTYTAKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWAAPQLHDIDLLARMVD  460

Query  2140  PALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGF  2319
             PAL+G+YP+KSLSRFADIIA+CVQPEPEFRPPMSEVVQ LVRL+QRA+ +IRR SD+ G+
Sbjct  461   PALDGLYPSKSLSRFADIIAICVQPEPEFRPPMSEVVQQLVRLMQRAA-IIRRQSDDLGY  519

Query  2320  AYKTPDHD--AASGD  2358
             +Y+ PD D  AA+GD
Sbjct  520   SYRVPDRDGGAAAGD  534



>gb|AFW76249.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=537

 Score =   543 bits (1399),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 316/556 (57%), Positives = 390/556 (70%), Gaps = 47/556 (8%)
 Frame = +1

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
             +G LS LS L +QNNQL+G+++VL ++ L  LN+A+N FSG IP E  SIP     GNSF
Sbjct  1     MGALSKLSSLYMQNNQLSGTVDVLSNISLATLNIADNNFSGMIPQEFSSIPNLIVGGNSF  60

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              N    P  P +   P     +   S P S  TP   D+              ++ G ++
Sbjct  61    VN---MPASPPSTLKPPLEEPQGPVSAPTSPDTPIDQDDRK------------IQTGPLI  105

Query  1129  givlgssavvlsaivvivYCL---RRCKKKEFAA-RTSTGSLPLSTD-----KEVLDQRA  1281
             GI +GS A     + V+V+CL   RR    E +  +   GSL +S +     +EVL+   
Sbjct  106   GIAVGSIAAASCVLFVLVFCLHNARRRNDDEISEPKDLVGSLAVSIETAASSREVLNNNH  165

Query  1282  KSTATVV-DLKPPPSEKVTIERM-----QGKNGSLR-RSPITATPYTVAVLQTATNSFSQ  1440
             +++A    DL+      +T +R+      G + + R + P+T T YTVA LQ ATNSF +
Sbjct  166   ENSAVATSDLQHAGKMMMTPDRVLHDTTNGSSTAKRPKVPVTVTSYTVADLQVATNSFCE  225

Query  1441  ENLVGEGSLGRVYRADFPNGKVLAIKKVD-SAALSLQE--EDNFLEAISNMSRLRHPNIV  1611
             ++L+GEGSLGRVY+A FPNGKVLA+KKVD SA LSL    ED FLE +SN+SRLRHPNIV
Sbjct  226   DSLLGEGSLGRVYKAGFPNGKVLAVKKVDDSALLSLYGGGEDAFLELVSNVSRLRHPNIV  285

Query  1612  PLVGYCAEHGQRLLVYDYIGNGSLHDMLH--FADER--SQLLTWNARVRVALGTARALEY  1779
             PL GYC EHGQRLLVY+Y+GNG+L D+L    +D+   S+ LTWN RVR+ALGTARALEY
Sbjct  286   PLTGYCVEHGQRLLVYEYVGNGTLRDVLQHCLSDDEGASKKLTWNTRVRIALGTARALEY  345

Query  1780  LHEVCLPSVVH-RNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAP  1956
             LHEVC+P VVH R FK++NILLDEE +PHLSDCGLAALT      + S   VGSFGYSAP
Sbjct  346   LHEVCIPPVVHSRTFKASNILLDEEYSPHLSDCGLAALT-----TVVSPEAVGSFGYSAP  400

Query  1957  EFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMV  2136
             E A+SG YT KSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWA PQLHDID L++MV
Sbjct  401   ELAMSGTYTAKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWAAPQLHDIDLLARMV  460

Query  2137  DPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             DPAL+G+YP+KSLSRFADIIA+CVQPEPEFRPPMSEVVQ LVRL+QRA+ +IRR SD+ G
Sbjct  461   DPALDGLYPSKSLSRFADIIAICVQPEPEFRPPMSEVVQQLVRLMQRAA-IIRRQSDDLG  519

Query  2317  FAYKTPDHD--AASGD  2358
             ++Y+ PD D  AA+GD
Sbjct  520   YSYRVPDRDGGAAAGD  535



>ref|XP_011075267.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2 [Sesamum indicum]
Length=727

 Score =   549 bits (1414),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 307/681 (45%), Positives = 427/681 (63%), Gaps = 28/681 (4%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A+TD  D++AL+ LY SLN P QL  WK  GGDPC E+W GV C  S+++++++ GLGL 
Sbjct  7     ASTDEWDVEALQNLYISLNRPLQLEHWKLVGGDPCEEAWIGVECFQSSIINLKLHGLGLT  66

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             G++G+ L+   +LK LDLSSN I   IPY LPPN+T LNLA N  + SIPYS+  M  L 
Sbjct  67    GSLGFELSILRNLKHLDLSSNNIEGTIPYSLPPNITHLNLAENKFSQSIPYSLENMKHLR  126

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             +LN S N L+ P+GD+F     L  +DLSFN+F+GDLP S   L+NL+ L +QNNQ TGS
Sbjct  127   HLNLSHNLLSAPLGDVFNGLESLREMDLSFNSFTGDLPPSFRSLTNLNGLFLQNNQFTGS  186

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             +  L +L L+DLN+ +N FSG IP +  +IP    +GN F      PP  F         
Sbjct  187   VIFLANLSLSDLNIEDNHFSGVIPEKFQTIPNLRIAGNKFDKETNYPPWNFPSETMP---  243

Query  1009  KRTNHSTPGSHKTPGSD----DNHSDHEngngngkngVKAGAivgivlgssavvlsaivv  1176
             +  N S+P     P S+    ++H     G    KN  +AG ++ I   +    L+ + +
Sbjct  244   REQNISSP-----PASNLSAIESHPSRVIGVLKKKNPHEAGIVLVIAGVTLIAALAVLAI  298

Query  1177  ivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTAT-----------VVDLKPPPS  1323
             +VY  R   K   +  +S  S+  +T   V D  + +T +           ++   P P 
Sbjct  299   VVYRHRSRGKTRGSLGSSEESMRSTTIGIVQDYASTNTQSSPPLSAFSNSRLITPSPLPP  358

Query  1324  EKVTIERMQGKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGK  1503
              +    ++  ++ S  +  +    YT+A LQ ATNSFS+ENL+GEGSLG VY+A+FP+GK
Sbjct  359   IRTKTMKVSQRSSSRSKMSVGTKVYTIAELQIATNSFSEENLIGEGSLGSVYKAEFPDGK  418

Query  1504  VLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSL  1683
             +LA+K + +  LS+ EE  FL+ I N S LRHPNIV LVGYC EHGQ L+V+++I   SL
Sbjct  419   ILAVKNIKTVPLSIIEEQQFLDVIRNASCLRHPNIVTLVGYCMEHGQHLVVFEFIRKFSL  478

Query  1684  HDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPH  1863
             ++ LH      + L+W+ R+++ALG  RAL Y+H   +P + H N K+ANILLDEEL P 
Sbjct  479   NEALHSV--VCKPLSWSQRLKIALGIGRALTYIHSSSVPPIAHSNLKAANILLDEELMPR  536

Query  1864  LSDCGLAALTP---NTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLT  2034
             +SDCGLA L P   NT +  +S   +   GY APE    G    K+DVY+FGV++LELLT
Sbjct  537   VSDCGLAVLRPLASNTVKLKASEMAIADSGYIAPEHVQPGTGNTKADVYAFGVLLLELLT  596

Query  2035  GRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQP  2214
             GRKP D+SR ++EQSLVRWA+ +LHD  +L +MVDP +  M  +KSLSR ADI++LC+QP
Sbjct  597   GRKPFDNSRPKTEQSLVRWASSRLHDSTSLRQMVDPVITRMISSKSLSRLADIVSLCIQP  656

Query  2215  EPEFRPPMSEVVQALVRLVQR  2277
             E EFRPPMSE+V++L+ L+QR
Sbjct  657   EQEFRPPMSEIVESLMYLLQR  677



>ref|XP_010928729.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Elaeis 
guineensis]
Length=684

 Score =   543 bits (1398),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 308/699 (44%), Positives = 408/699 (58%), Gaps = 52/699 (7%)
 Frame = +1

Query  232   FTEVVLVIAALISRLGFVGAA---TDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGES  402
             +  V+L +A     LG V +A   TD +D+ AL VL+ SLNSP QL+GW +SGGDPCGE 
Sbjct  4     YLPVLLAVA-----LGLVFSALAETDQDDVSALNVLFLSLNSPPQLTGWSSSGGDPCGED  58

Query  403   WKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSL  582
             WKGV C   +V  I +  LGL G++GY L+  TS+   D+S N +   IPYQLPP +  L
Sbjct  59    WKGVKCSDLSVTEISLADLGLTGSLGYQLSSLTSITYFDMSKNNLRGNIPYQLPPKVEHL  118

Query  583   NLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLP  762
             NLA N  TG IPYSIS MT L YLN   N L   + D+F   + L+ + LSFN  SG+LP
Sbjct  119   NLAENAFTGGIPYSISQMTDLKYLNLGKNQLNGQLNDIFGKLTRLSEMYLSFNQLSGNLP  178

Query  763   ASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIP--KFEYS  936
              S   L +L +L +Q                      NN+FSG I N L ++P       
Sbjct  179   HSSQSLKSLKVLHLQ----------------------NNQFSGSI-NVLANLPLEDLNVE  215

Query  937   GNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKA  1116
              N FS               G     +  + PG  K   +D +              V A
Sbjct  216   NNQFSGWIPKKLKNIDTLQIGGNSWSSGPAPPGMDKASNTDSHTGKKGGKQSVVNEAVIA  275

Query  1117  GAivgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLST------DKEVLDQR  1278
             G ++ ++  +  ++                +    ++ T   PL +      D  ++D +
Sbjct  276   GIVIAVLAVALILLALIKRRSSPSSHYIDDQSSQNKSLT---PLVSHELGLKDSSLIDIK  332

Query  1279  AKSTATVVDLKPPPSEKVTIERMQGKNGSLRR---SPITATPYTVAVLQTATNSFSQENL  1449
             A  T   + LKPPP   +     +  N    +    P++ T Y++  LQ AT SFS   L
Sbjct  333   ALQTPPSMGLKPPPVPHILFSDTEFVNKLSPKPSTKPVSVTAYSLVDLQAATGSFSTSCL  392

Query  1450  VGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYC  1629
             +G+G++G VY+A + +GKVLA+KK+D   LS     +FLE +S +S+L HPNI  L+GYC
Sbjct  393   LGQGTIGNVYKAKYADGKVLAVKKIDVINLSGGTSYDFLELVSGISKLHHPNIAELLGYC  452

Query  1630  AEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVV  1809
             +E    LL+Y++  NGSLHD LH +DE S+ LTW+ RVR+ALGTA A+EYLH++C PSV+
Sbjct  453   SEPQYHLLIYEFQMNGSLHDFLHLSDEYSKPLTWDTRVRIALGTACAVEYLHDLCSPSVI  512

Query  1810  HRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVK  1989
             H+N K+ANILLD ELNPHLSDCGLA    +T   + +       GY+APE      YT+K
Sbjct  513   HKNIKAANILLDAELNPHLSDCGLAVFYQDTSENLGA-------GYNAPECTKPSAYTMK  565

Query  1990  SDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAK  2169
             SD+YSFGVVMLELLTGRKP DSS+   EQSLVRWA PQLHDI+AL +MVDP+L G+YP K
Sbjct  566   SDIYSFGVVMLELLTGRKPFDSSKPIMEQSLVRWAAPQLHDINALRQMVDPSLRGLYPPK  625

Query  2170  SLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASV  2286
             SLSRFAD+IALC+Q EPEFRPPMSEVVQ+L + VQR  +
Sbjct  626   SLSRFADVIALCIQSEPEFRPPMSEVVQSLDQCVQRTGI  664



>ref|XP_002521411.1| lrr receptor-linked protein kinase, putative [Ricinus communis]
 gb|EEF40901.1| lrr receptor-linked protein kinase, putative [Ricinus communis]
Length=672

 Score =   541 bits (1394),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 326/677 (48%), Positives = 427/677 (63%), Gaps = 19/677 (3%)
 Frame = +1

Query  247   LVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQG  426
             LV+ A  +   F  A TDP D+ A+  L+ SLN P  L GW   GGDPCGE W+GV+C  
Sbjct  13    LVLVAFTA--SFCVAITDPRDVVAMNSLWVSLNFPPLL-GW-LPGGDPCGEEWQGVSCVF  68

Query  427   SAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNIT  606
             S + ++++ G+ L GT+   L  F S+ E+DLS+N I   IP  LPP L   +LA N   
Sbjct  69    SNITALKLSGMNLGGTLADDLALFESIIEIDLSNNHIGGSIPSSLPPTLRIFSLAGNQFN  128

Query  607   GSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSN  786
             GSIP ++S +T L++L+ + N L+  + D F   + LT LDLS NN SG LP SLG LS+
Sbjct  129   GSIPDTLSTLTQLSHLSINDNHLSGEMPDAFQQLTSLTNLDLSGNNLSGQLPPSLGNLSS  188

Query  787   LSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpap  966
             LS L +Q+N+  G L+VL DLPL DLNV NN FSG IP +L++IP F   GN F+ +   
Sbjct  189   LSSLHLQSNKFVGVLDVLQDLPLQDLNVENNLFSGPIPAKLLNIPNFRKDGNPFNTTIIA  248

Query  967   ppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgs  1146
              PP    P P  P        P       S       E  +       K   +V + +  
Sbjct  249   SPPLALSPSPAMPPSSAE--APEKQGYWPSISQTPKAEAESSRAFLTTKRAILVTVAVVV  306

Query  1147  savvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSE  1326
               ++L   V++  C +R K KE A R     +P     E  + +A        L+    E
Sbjct  307   IVIILVLCVLVSSCSKRKKVKEDAERHV---VPYKGHIEKPNSKAS-------LQQTNEE  356

Query  1327  KVTIERMQGKNGSLR--RSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNG  1500
             KV    +  ++ S +  +S  +   +T+A LQ  TNSFS+EN VGEG+LG VY+A+ P+ 
Sbjct  357   KVVPAEIYTRSSSTKNLKSSSSLRVFTIATLQQYTNSFSEENFVGEGTLGSVYKAELPDR  416

Query  1501  KVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGS  1680
             K+LA+KK++S A   Q E  FL+ +S +S++RHPNIV L+GYC EHGQRLLVY++   G+
Sbjct  417   KLLAVKKLNSMATRQQTEKEFLDLVSTVSKIRHPNIVELLGYCNEHGQRLLVYEFCETGT  476

Query  1681  LHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNP  1860
             L+D LH  DE  + L+WNAR+R+ALG ARAL+YLHEVC PS+VH+NF+S+NILLDE+L  
Sbjct  477   LNDALHMDDEIHKKLSWNARIRLALGAARALQYLHEVCEPSIVHQNFRSSNILLDEKLAA  536

Query  1861  HLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGR  2040
              +SDCGLA L  ++     S  ++ + GY APEF L G YT KSDVYSFGVVMLELLTGR
Sbjct  537   CVSDCGLAPLQSSSSANELSGRLLSTSGYGAPEFEL-GSYTCKSDVYSFGVVMLELLTGR  595

Query  2041  KPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEP  2220
             K  D SR R EQSLVRWA P+LHDID+L  MVDP+LNG YPAKSLSRFADIIA CVQ EP
Sbjct  596   KSYDRSRSRGEQSLVRWAIPRLHDIDSLCGMVDPSLNGSYPAKSLSRFADIIARCVQWEP  655

Query  2221  EFRPPMSEVVQALVRLV  2271
             EFRP MSE+VQ L+R++
Sbjct  656   EFRPAMSEIVQDLLRML  672



>ref|XP_010914020.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Elaeis guineensis]
Length=765

 Score =   537 bits (1384),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 304/683 (45%), Positives = 412/683 (60%), Gaps = 49/683 (7%)
 Frame = +1

Query  280   FVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGE-SWKGVTCQGSAVVSIEIPG  456
             F  A TDP D+ ALE LYGSLN+P QL GWKA+GGDPCGE  W+GV+C G +VVSI+I G
Sbjct  77    FASAVTDPLDVSALEALYGSLNAPPQLIGWKATGGDPCGEEQWRGVSCSGQSVVSIKIKG  136

Query  457   LGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLM  636
             LG+ G +G  L+ F SLKELDLS N I   IP  LPPN T +NLA N  + +IP+S+S +
Sbjct  137   LGVGGCLGSQLSTFLSLKELDLSKNNISGEIPLGLPPNATYINLAENIFSQNIPFSLSSL  196

Query  637   TSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQ  816
               L +LN S N+L  P+G++FT+  +L  LDLSFN+F+GDLP+S   L+NL  L ++NN 
Sbjct  197   RFLEHLNLSHNALFGPVGNVFTDMQNLEILDLSFNHFTGDLPSSFSSLTNLHALYLENNH  256

Query  817   LTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYS------GNSFSNSpappppp  978
                                   FSG++P +   I +   S      G +F          
Sbjct  257   ----------------------FSGYLPKQFEFIHQLRISGNLFQGGYAFPQPLRNRNSH  294

Query  979   ftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavv  1158
                    R        TP S         H+    G G     V AGAI G+VL +    
Sbjct  295   SPVSSADRNVSHRPKVTPSSFSFSSIQGGHNQKRVGLG-----VMAGAIGGLVLVALLAA  349

Query  1159  lsaivvivYCLRRCKKKEFAARTSTGS----LPLSTDK--EV-LDQRAKSTATVVDLKPP  1317
             +  +       RR  K +  +  S       LP++T    EV LDQ    +A +   +PP
Sbjct  350   VVLVNS-----RRAHKSDLDSSKSITDFFHVLPVTTSSVPEVNLDQCPWVSAHMTATRPP  404

Query  1318  PSEKVTIERMQGKNGSLRRSP--ITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADF  1491
                     RM  +  SLRRS   +TA  Y+ + + TATN++S+ENL+GEG +G VY+A+F
Sbjct  405   SVHHPRPHRMSKRKSSLRRSRNLLTAKLYSASEILTATNNYSEENLLGEGLIGHVYKAEF  464

Query  1492  PNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIG  1671
             P+G++LA+KK+D  AL++ EED FL+ + NMSRLRH NI  L+GY  EHG+ +LVY+Y  
Sbjct  465   PDGQMLAVKKIDLVALAVYEEDEFLDVVWNMSRLRHRNIAKLLGYSVEHGEHVLVYEYAC  524

Query  1672  NGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE  1851
             +GSLHD+L  A+   + L+W ARVR+ALG A ALEY+H +C P + H N K+ NILLD+E
Sbjct  525   SGSLHDVLFSANNMHKALSWKARVRIALGVAHALEYMHWICSPPMAHGNIKATNILLDDE  584

Query  1852  LNPHLSDCGLAALTPNTERQISSTHVVGSF-GYSAPEFALSGVYTVKSDVYSFGVVMLEL  2028
             L PH+SDCGL  L      +  ++ +   F GY+APE  + GV   K+DVY FGVV+LEL
Sbjct  585   LMPHISDCGLTVLRHLISTKPKASELSMGFNGYTAPELCIPGVDKTKTDVYGFGVVLLEL  644

Query  2029  LTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCV  2208
             LTG++  DSSR + EQ LV+WA+ +LHD  +L  M DP + G  P+K+LS+FADII LC+
Sbjct  645   LTGKRAFDSSRSKEEQYLVKWASSRLHDFSSLEGMTDPTIKGTIPSKALSQFADIILLCI  704

Query  2209  QPEPEFRPPMSEVVQALVRLVQR  2277
             QPEPEFRPPM+ + + L+RLV +
Sbjct  705   QPEPEFRPPMTGITEYLIRLVHK  727



>ref|XP_010534354.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2-like isoform 
X2 [Tarenaya hassleriana]
Length=722

 Score =   532 bits (1371),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 291/674 (43%), Positives = 428/674 (64%), Gaps = 28/674 (4%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TDP +++ L+ ++ +LN P +L GWK + GDPCGESW GV+C GS++V + IPGL ++
Sbjct  26    AYTDPLEVEVLQDVFKALNCPQRLKGWKLNSGDPCGESWMGVSCSGSSIVELRIPGLRIS  85

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             G++G  L+   +LK +D+S N +   IPY LPPN T +++A NN++ SIPYS++L+TSL 
Sbjct  86    GSLGSQLHHLHNLKIMDVSFNFLQGEIPYGLPPNATHIDMAYNNLSQSIPYSLALLTSLQ  145

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YLN S NSL+ P+G++F+    +  +DL+FNN +GDLP+S G L NL+ L +QNN+ TGS
Sbjct  146   YLNLSHNSLSGPLGNVFSGL-QIREMDLAFNNLTGDLPSSFGSLMNLTSLYLQNNRFTGS  204

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             +  L DLPL DLN+ +N+FSG  P+   +IP  +  GN+F   P   P  F         
Sbjct  205   VIYLADLPLIDLNIEDNQFSGIFPSHFQTIPHLQIWGNNFHIDPNYKPWRFPLDIIPMMQ  264

Query  1009  KRTNHSTPGSHKT---PGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvi  1179
               +   T  S      PG  + H +H+         + AG++V +V G + +     V  
Sbjct  265   NASGLPTTQSSAIKHFPG-QEKHWNHKKR-------MGAGSVVLLVGGMAFLGTFMAVFA  316

Query  1180  vYCLRRCKKKEFAART---STGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQ  1350
             + C  +  +   + R+   S  SLP+ T +   D + + +  ++ ++ PP   + IER  
Sbjct  317   IRCSHQRARNLTSHRSNFSSAHSLPVRTTR---DYQVEDSPQIMRVRHPP---IRIERTS  370

Query  1351  GKNG--SLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKV  1524
              +       + P     ++VA LQ ATN+FS+ENL+ EG LG VYRA  P+G+  A+K +
Sbjct  371   RRKSFSETCQVPAYGKQFSVAELQLATNNFSEENLLAEGPLGSVYRAKLPDGQFSAVKNI  430

Query  1525  DSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFA  1704
               A+LSL EE+ F+E +   S+LRHPNIV L+G+C E+G+ LL Y+Y+G+ SL+  +H  
Sbjct  431   PMASLSLHEEEQFMEVLQTASKLRHPNIVALLGFCIENGKHLLAYEYVGHLSLYKAMH--  488

Query  1705  DERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLA  1884
             DE  + L+W+ R+++A+G ARALEYLH    P + HR+ K+ NILLDEEL P ++DCGLA
Sbjct  489   DEGYKPLSWSLRLQIAIGVARALEYLHSSFSPPIAHRDLKAENILLDEELTPRIADCGLA  548

Query  1885  ALTP---NTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDS  2055
             +L P   N+ +Q +S   + + GY APE    G    KSDVY+FGV++LELLTGRKP DS
Sbjct  549   SLRPLTSNSVKQRASEIAIHNTGYIAPEHGQPGSSGTKSDVYAFGVLLLELLTGRKPFDS  608

Query  2056  SRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPP  2235
             SR R EQ LV+WA+ +LHD  +L KM+DP + G +     S+FADI++LC Q E EFRPP
Sbjct  609   SRPRDEQLLVKWASCRLHDRRSLEKMIDPGIAGTFSLGIASQFADIVSLCTQAEKEFRPP  668

Query  2236  MSEVVQALVRLVQR  2277
             +SE+V+AL  L+Q+
Sbjct  669   VSEIVKALTDLMQK  682



>gb|KDP24601.1| hypothetical protein JCGZ_25517 [Jatropha curcas]
Length=715

 Score =   530 bits (1366),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 310/700 (44%), Positives = 417/700 (60%), Gaps = 49/700 (7%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L+  ++   A L+S+     A TD ND+ ALE LY SLN P QL GW+  GGDPC ESW 
Sbjct  8     LYFTLIAFSAILVSQ---AWAFTDQNDVMALENLYASLNKPPQLKGWRTGGGDPCQESWT  64

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV C GS++  +++ GL L+G +G  L+   SLK LDLS N +   IPY LPPN T +NL
Sbjct  65    GVFCSGSSLRDLKLQGLNLSGYLGTQLHNLYSLKHLDLSYNYLQGEIPYGLPPNATRINL  124

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A N +  +IPYS+S +  L YLN S NSL  PIG++F    +L  +DLSFN F+GDLP S
Sbjct  125   ACNKLNQNIPYSLSTLKVLRYLNLSHNSLYGPIGNVFIAMKNLKEMDLSFNYFTGDLPTS  184

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
             +G L+NLS L +QNNQ TGS+  L DLPLTDLN+ +N FSG IP    SI      GN F
Sbjct  185   IGSLTNLSRLFLQNNQFTGSVIYLADLPLTDLNIQSNHFSGVIPAHFQSIQNLWIDGNEF  244

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
                  PP               ++  T  S  T    D   + E      K  +  G I 
Sbjct  245   MGGNYPPWNFPETKNVTVGKNFSDQPTTESSAT----DKSLNPEAFGHVKKRRLGPGGIA  300

Query  1129  givlgssavvlsaivvivYCLR-----RCKKKEF---AARTSTGSLPL----STDKEVLD  1272
              IV+ ++  V  A   +++  R       + ++F   A + S   LP+    + D   + 
Sbjct  301   CIVVATTLAVTCAATAVIFVKRPHVFPVIRTRDFSLLALKASPKFLPVKAPSTLDPNHIT  360

Query  1273  QRAKSTATVVDLKPPPSEKV-TIERMQGKNGSLRRSPITATPYTVAVLQTATNSFSQENL  1449
                ++T      K P S K+ T+  +Q                      +AT+SFS+EN+
Sbjct  361   STCRTTCFAEKFKAPESAKIYTVAELQ----------------------SATSSFSEENI  398

Query  1450  VGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYC  1629
             +GEGSLG VY+A+FP+G++ A+K +  A+LSLQEE+ F + + N SRLRHPNIV LVGYC
Sbjct  399   LGEGSLGCVYKAEFPDGQISAVKYIRMASLSLQEEEQFSDVLCNASRLRHPNIVTLVGYC  458

Query  1630  AEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVV  1809
              EHGQ LLVY+YI N +LHD+LH  +E  + L W  R+ +ALG A AL+YLH    P + 
Sbjct  459   IEHGQHLLVYEYIKNVTLHDVLH--NEEHKSLPWITRINIALGVAAALDYLHSCFSPPIT  516

Query  1810  HRNFKSANILLDEELNPHLSDCGLA---ALTPNTERQISSTHVVGSFGYSAPEFALSGVY  1980
             H N K++N+LLDEEL P L DCG A   +LT N+++  +S  V+   GY+APE    G  
Sbjct  517   HGNIKASNVLLDEELKPRLCDCGTAILRSLTSNSDKLKASEIVIDDIGYTAPEIG-EGAD  575

Query  1981  TVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALN-GM  2157
               KSDVY+FGV++LELLTGRK  DSSR   EQSLV+WA+ +LHD  +L  MVDP +N   
Sbjct  576   DTKSDVYAFGVLLLELLTGRKAFDSSRPSEEQSLVKWASCRLHDNASLELMVDPGINITT  635

Query  2158  YPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQR  2277
                K+LS+FAD+++LC+QPE  FRPPMSE+V +L  L+Q+
Sbjct  636   VSPKALSQFADVVSLCIQPEMLFRPPMSEIVVSLASLLQK  675



>ref|XP_010557935.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2-like isoform 
X1 [Tarenaya hassleriana]
Length=720

 Score =   529 bits (1363),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 297/696 (43%), Positives = 419/696 (60%), Gaps = 36/696 (5%)
 Frame = +1

Query  220   GAFLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGE  399
             G FLF  V+   A          A TDP ++  L+ L+ +LNSP QL GWK   GDPCGE
Sbjct  12    GTFLFVRVLFAQAE---------AYTDPLEVWVLQDLFKALNSPQQLKGWKLQSGDPCGE  62

Query  400   SWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTS  579
             SW GVTC GS++V   IPGL + G++G  LN   +LK LD+S N +   IPY LPPN T 
Sbjct  63    SWMGVTCSGSSIVEFRIPGLRIWGSLGSHLNHLHNLKILDVSFNFLQGEIPYGLPPNATH  122

Query  580   LNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDL  759
             LN+A NN++ SIPYS+SL+TSL YLN S NSL+ P+G++F+    L  +DLS NN +GDL
Sbjct  123   LNMAYNNLSQSIPYSLSLLTSLQYLNLSHNSLSGPLGNVFSGM-QLKEMDLSSNNLTGDL  181

Query  760   PASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSG  939
             P+S G L +L+ L +QNN+ TGS+  L DLPL DLN+ +N FSG +P+   SIP     G
Sbjct  182   PSSFGSLMSLTSLYLQNNRFTGSVVYLADLPLIDLNIEDNEFSGVLPSHFQSIPHLWIWG  241

Query  940   NSFSNSpapppppftppppgrpHKRTNHSTPGS---HKTPGSDDNHSDHEngngngkngV  1110
             N F       P  F           +   T  S    + PG +     H+     G   +
Sbjct  242   NKFQVDQNYKPWRFPLDVIPMMQNASGLPTTQSSAMKRFPGPE-KQGKHKKRVVAGSIVI  300

Query  1111  KAGAivgivlgssavvlsaivvivYCLRRCKK--KEFAARTSTGSLPLSTDKEVLDQRAK  1284
               G +  +    +   +       +  +R +K     +  ++T SLP+ST +   D   +
Sbjct  301   MVGGMALLGTFVAVFAVR------FSHKRARKLSSHRSDISTTYSLPISTTR---DFSVE  351

Query  1285  STATVVDLKPPPSEKVTIERMQGKNG--SLRRSPITATPYTVAVLQTATNSFSQENLVGE  1458
              +  ++ ++ PP   + IER   +       + P     ++ A LQ ATNSFS+ENL+ E
Sbjct  352   DSPQIMRVRHPP---IKIERTTSRKSFSGTCQFPAYVDQFSFAELQLATNSFSEENLLAE  408

Query  1459  GSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEH  1638
             G LG VYRA  P+G+  A+K +  A+LS QEE+ F++ +   S+LRHPNI+ L+G C E+
Sbjct  409   GPLGSVYRAKLPDGQFSAVKNIPIASLSFQEEEQFIQVLRTASKLRHPNIITLLGICIEN  468

Query  1639  GQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRN  1818
              Q LLVY+Y+GN SL+D +H  DE  + L+W+ R+R+A+G ARAL+YLH    P + HR+
Sbjct  469   RQHLLVYEYVGNLSLYDAMH--DEVYKPLSWSLRLRIAVGVARALDYLHSSFSPPIAHRD  526

Query  1819  FKSANILLDEELNPHLSDCGLAALTPNTERQI---SSTHVVGSFGYSAPEFALSGVYTVK  1989
              K+ NI+LDEEL P ++DCGLA+L P T   +   +S   + + GY  PE   S     K
Sbjct  527   LKAENIMLDEELMPRIADCGLASLRPLTSNSVKLRASEIALQNTGYIGPEHVQSRSNGTK  586

Query  1990  SDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAK  2169
             SDVY+FGV++LELLTGRKP D +R R EQ LV+WAT +LHD  +L +M+D  + G + ++
Sbjct  587   SDVYAFGVLLLELLTGRKPFDCARPREEQLLVKWATCRLHDRRSLEQMIDAGIAGTFSSR  646

Query  2170  SLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQR  2277
               S+FADI++LC Q E EFRPP+SE+V+AL  L+Q+
Sbjct  647   VASQFADIVSLCTQAE-EFRPPVSEIVEALTNLMQK  681



>ref|XP_010534352.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2-like isoform 
X1 [Tarenaya hassleriana]
Length=723

 Score =   528 bits (1359),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 291/675 (43%), Positives = 428/675 (63%), Gaps = 29/675 (4%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TDP +++ L+ ++ +LN P +L GWK + GDPCGESW GV+C GS++V + IPGL ++
Sbjct  26    AYTDPLEVEVLQDVFKALNCPQRLKGWKLNSGDPCGESWMGVSCSGSSIVELRIPGLRIS  85

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             G++G  L+   +LK +D+S N +   IPY LPPN T +++A NN++ SIPYS++L+TSL 
Sbjct  86    GSLGSQLHHLHNLKIMDVSFNFLQGEIPYGLPPNATHIDMAYNNLSQSIPYSLALLTSLQ  145

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             YLN S NSL+ P+G++F+    +  +DL+FNN +GDLP+S G L NL+ L +QNN+ TGS
Sbjct  146   YLNLSHNSLSGPLGNVFSGL-QIREMDLAFNNLTGDLPSSFGSLMNLTSLYLQNNRFTGS  204

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             +  L DLPL DLN+ +N+FSG  P+   +IP  +  GN+F   P   P  F         
Sbjct  205   VIYLADLPLIDLNIEDNQFSGIFPSHFQTIPHLQIWGNNFHIDPNYKPWRFPLDIIPMMQ  264

Query  1009  KRTNHSTPGSHKT---PGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvi  1179
               +   T  S      PG  + H +H+         + AG++V +V G + +     V  
Sbjct  265   NASGLPTTQSSAIKHFPG-QEKHWNHKKR-------MGAGSVVLLVGGMAFLGTFMAVFA  316

Query  1180  vYCLRRCKKKEFAART---STGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQ  1350
             + C  +  +   + R+   S  SLP+ T +   D + + +  ++ ++ PP   + IER  
Sbjct  317   IRCSHQRARNLTSHRSNFSSAHSLPVRTTR---DYQVEDSPQIMRVRHPP---IRIERTS  370

Query  1351  GKNG--SLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKV  1524
              +       + P     ++VA LQ ATN+FS+ENL+ EG LG VYRA  P+G+  A+K +
Sbjct  371   RRKSFSETCQVPAYGKQFSVAELQLATNNFSEENLLAEGPLGSVYRAKLPDGQFSAVKNI  430

Query  1525  DSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFA  1704
               A+LSL EE+ F+E +   S+LRHPNIV L+G+C E+G+ LL Y+Y+G+ SL+  +H  
Sbjct  431   PMASLSLHEEEQFMEVLQTASKLRHPNIVALLGFCIENGKHLLAYEYVGHLSLYKAMH--  488

Query  1705  DERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLA  1884
             DE  + L+W+ R+++A+G ARALEYLH    P + HR+ K+ NILLDEEL P ++DCGLA
Sbjct  489   DEGYKPLSWSLRLQIAIGVARALEYLHSSFSPPIAHRDLKAENILLDEELTPRIADCGLA  548

Query  1885  ALTP---NTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDS  2055
             +L P   N+ +Q +S   + + GY APE    G    KSDVY+FGV++LELLTGRKP DS
Sbjct  549   SLRPLTSNSVKQRASEIAIHNTGYIAPEHGQPGSSGTKSDVYAFGVLLLELLTGRKPFDS  608

Query  2056  SRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCV-QPEPEFRP  2232
             SR R EQ LV+WA+ +LHD  +L KM+DP + G +     S+FADI++LC  Q E EFRP
Sbjct  609   SRPRDEQLLVKWASCRLHDRRSLEKMIDPGIAGTFSLGIASQFADIVSLCTQQAEKEFRP  668

Query  2233  PMSEVVQALVRLVQR  2277
             P+SE+V+AL  L+Q+
Sbjct  669   PVSEIVKALTDLMQK  683



>gb|KDO50163.1| hypothetical protein CISIN_1g039558mg [Citrus sinensis]
Length=715

 Score =   526 bits (1354),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 301/695 (43%), Positives = 416/695 (60%), Gaps = 39/695 (6%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L+  V++  A+L S+     A TDP D+ AL  LY +LN+PSQL+ WK  GGDPC E W 
Sbjct  9     LYLTVLVFFASLGSQ---ALAFTDPLDVTALHDLYKALNNPSQLNKWKLDGGDPCAELWT  65

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV C  S+V+ ++IPGL L G +G  L+   SLK  D+SSN I   IP  LPPN+T +N+
Sbjct  66    GVYCSESSVIHLKIPGLQLTGHLGSRLHDLHSLKHFDVSSNSIGGEIPNGLPPNVTHINM  125

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A N +  +IP+S+  +  L +LN S N L+ PIG +FT   +L  LDLS+N+F+GDLP+S
Sbjct  126   AFNKLNQNIPHSLPNLKRLRHLNLSHNMLSGPIGSVFTGLENLKELDLSYNDFTGDLPSS  185

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
              G L NLS L +QNN  TGS+  L DLPL  LN+ +N+FSG IP +  SIP   + GN F
Sbjct  186   FGSLKNLSALFLQNNNFTGSVIYLADLPLIYLNIEDNQFSGVIPKQFESIPNLWFWGNKF  245

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKT------PGSDDNHSDHEngngngkngV  1110
             +     PP  F          R N S P + ++      P +D +    +  +  G   +
Sbjct  246   NVDRNSPPWSFPMDSLPI---RRNFSAPPTSQSSAVENYPSNDIDQKHKKGMSPGGIAFL  302

Query  1111  KAGAivgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKST  1290
               G  +     +  +            R  +     + ++  SLP+ST +E     A S+
Sbjct  303   VCGLALAATCAALFIAFRINQA-----RAARHNSLESTSTMHSLPISTARESPRILAVSS  357

Query  1291  ATVVDLKPPPSEKVTIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEG  1461
                +               QG   S  ++   P   T Y+VA LQ ATNSF+++NL+G+G
Sbjct  358   PLFL--------------AQGGRKSFSKNCKLPENVTVYSVAELQLATNSFNEDNLLGKG  403

Query  1462  SLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHG  1641
             SLG VY+A+FP+G+ LA+K ++  +LS  EE+ F++ I   S+ RHPNIV L+GYC +HG
Sbjct  404   SLGSVYKANFPDGQFLAVKNINMPSLSFDEEEQFMDVIRISSQFRHPNIVKLLGYCVDHG  463

Query  1642  QRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNF  1821
             Q LLVY+++ N SL D LH   E  + L+W  R+ +ALG ARAL YLH    P V H N 
Sbjct  464   QHLLVYEFVRNLSLADALH--KEIYKPLSWGIRLHIALGIARALHYLHSQFFPPVSHCNI  521

Query  1822  KSANILLDEELNPHLSDCGLAALTPNTERQI---SSTHVVGSFGYSAPEFALSGVYTVKS  1992
             K+ANILLDEEL P + D GLA L P T   +   +S   V + GY APE    G    K 
Sbjct  522   KAANILLDEELLPLICDSGLAVLRPLTSNSVKLKASEIAVSNAGYIAPEHWEPGSDNTKI  581

Query  1993  DVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKS  2172
             D+Y+FGV++LELLTG+ P+D SR R EQSLV+WA+ +LHD + L +MVDP + G + ++S
Sbjct  582   DIYAFGVLLLELLTGKTPVDGSRPRQEQSLVKWASSRLHDRECLERMVDPGIKGTFSSRS  641

Query  2173  LSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQR  2277
             LS+FADI++LC+QPE EFRPPMSE+V +L RLVQ+
Sbjct  642   LSQFADIVSLCIQPEKEFRPPMSEIVDSLTRLVQK  676



>dbj|BAJ87185.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=597

 Score =   521 bits (1342),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 305/603 (51%), Positives = 399/603 (66%), Gaps = 36/603 (6%)
 Frame = +1

Query  595   NNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLG  774
             N+ TG+ PYSIS M +L  LN + N L+  I DMF   ++LTT+D+SFN FSG++P S  
Sbjct  13    NHFTGTTPYSISQMVALKDLNLAHNQLST-ISDMFNQLTNLTTMDISFNTFSGNIPQSFN  71

Query  775   LLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN  954
              +++L  L +QNNQ +G+++VL +LPL DLNVANN+F+GW+P++L  I   + +GNSFSN
Sbjct  72    SITSLKTLYLQNNQFSGTIDVLANLPLADLNVANNQFTGWVPDKLKKIRNLQTTGNSFSN  131

Query  955   SpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgi  1134
              PAPPPPP T P      +R   + P S+   G  D+ S H    G       AG ++ +
Sbjct  132   GPAPPPPPSTTPTTTPTPQRP--ALPSSNGNNGPSDSGSKHSKLQGGAI----AGIVICL  185

Query  1135  vlgssavvlsaivvivYCLRRCK---KKEFAARTSTGSLPLSTDKEV----LDQRAKSTA  1293
             ++    V    I    + L R +   +KE  +  ++G   + + K +     DQ  K+ +
Sbjct  186   LVVVVMVAFFVIKRESWKLSRGRDPEQKEPLSPLASGFKQMKSIKIISTTGKDQFQKTVS  245

Query  1294  TVVDLKPPPSEKVTIERMQGKNG----SLRR----SPITATPYTVAVLQTATNSFSQENL  1449
               + LKPP   K+ + +   +N     S+ R    S I    YTVA LQ AT SFS ++ 
Sbjct  246   --MSLKPP--TKIDLHKSFDENDLTTKSVTRKISLSSIKIPAYTVADLQIATGSFSADHF  301

Query  1450  VGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYC  1629
             + EGS GRV+RA F + KVLA+KK++ +A      D F+E ++N+SRL HPN+  LVGYC
Sbjct  302   ISEGSFGRVFRAQFNDQKVLAVKKINFSAFPGYPSDLFIELVANISRLNHPNLAELVGYC  361

Query  1630  AEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVV  1809
             +EHGQ LLVY++  NGSL D+L+  D++S+ L+WN RV++ALG+ARALEYLHE C P VV
Sbjct  362   SEHGQCLLVYEFYQNGSLCDLLNLVDDQSKPLSWNDRVKIALGSARALEYLHETCSPFVV  421

Query  1810  HRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVK  1989
             H+NFKS+N+LLD ELNPHLSD G   L PN E Q S  +     GY APE A+SG Y++K
Sbjct  422   HKNFKSSNVLLDSELNPHLSDSGYGDLIPNQEFQESEENS----GYRAPEVAMSGQYSLK  477

Query  1990  SDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAK  2169
             SDVYSFGVVMLELLTGRKP D SR RSEQSLVRWA PQLHDIDAL +MVDPAL G+Y +K
Sbjct  478   SDVYSFGVVMLELLTGRKPFDRSRPRSEQSLVRWAAPQLHDIDALDQMVDPALQGLYHSK  537

Query  2170  SLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAA  2349
             SLSRFAD IALCVQ EPEFRPPMSEVVQ+LVRLVQRA++   R S    +A +    D  
Sbjct  538   SLSRFADAIALCVQAEPEFRPPMSEVVQSLVRLVQRANMT--RMSSCESYARR----DGE  591

Query  2350  SGD  2358
             SGD
Sbjct  592   SGD  594



>ref|XP_009797583.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797589.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2 isoform X1 [Nicotiana 
sylvestris]
Length=748

 Score =   525 bits (1352),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 311/703 (44%), Positives = 425/703 (60%), Gaps = 31/703 (4%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L T  +L+   L  +     A TD   +QAL  LY +LNSP++L  WK  GGDPC ESW 
Sbjct  14    LVTAAILLFGVLFFQ---AFARTDDLQVQALRDLYRALNSPTELKNWKLEGGDPCEESWT  70

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV+C  S+V+ I++ GL L G +G  L     LK LDLSSN+ H  IP  LP NLT LNL
Sbjct  71    GVSCYQSSVIEIKLQGLNLTGNIGDQLVSLQHLKHLDLSSNQFHGEIPNSLPHNLTDLNL  130

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A NN T SIP S+S M  L +LN S N L+ P+ D+F    +L  +DLS N FSGDLPAS
Sbjct  131   ACNNFTQSIPASVSSMKHLRHLNMSQNLLSGPLADVFGGLDNLIMMDLSHNKFSGDLPAS  190

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                L NL+ L +Q+N+ TGS+  L DL L DLN+ +N FSG IP    +I      GN F
Sbjct  191   FRALKNLTKLYLQSNEFTGSVIFLADLHLHDLNIEDNHFSGVIPGSFQNINNLWIGGNRF  250

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              +  A   P   P          N S+P + K+  + + +  HE G+   K    +G IV
Sbjct  251   HSGGADYLPWKFPTDVM-----PNISSPPTTKS-SAIEKYPSHETGDNRKKRP-GSGGIV  303

Query  1129  givlgssavvlsaivvivYCLRRCKKKEF----AARTSTGSLPLSTDKEVLDQRAKS---  1287
              +V+G+   V  A V I + +RR +K+       + +S  SLP+S  +      A     
Sbjct  304   IMVVGAVLTVFGAAVFITFRIRRSQKQTLDSIRGSISSLQSLPISAPQVTTGPLAAQYDS  363

Query  1288  --------TATVVDLKPPPSEKVTIERMQGKNGSLR-RSPITATPYTVAVLQTATNSFSQ  1440
                        +   + PP+  +T++  + ++ S + + PI A  YTVA LQ AT++FS 
Sbjct  364   PDSSSSDSPPLISSWQLPPAPTMTLKMSKRRSFSKKCKIPICAKHYTVAELQLATSNFSP  423

Query  1441  ENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLV  1620
              NL+GEG+LG VYRADFP+G++LA+K + + ALS+ EE+ F++ I   SRLRHPNIV L+
Sbjct  424   GNLLGEGTLGSVYRADFPDGQILAVKNIKTVALSITEEEQFMDVIRTASRLRHPNIVALI  483

Query  1621  GYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLP  1800
             GYC  HG  LLVY+YI N +L D LH        LTW+ R+R+A+G ARAL YLH  C+P
Sbjct  484   GYCVGHGNHLLVYEYIRNVTLDDALH--SVLCMPLTWSLRLRIAIGVARALNYLHTFCVP  541

Query  1801  SVVHRNFKSANILLDEELNPHLSDCGLAALTP---NTERQISSTHVVGSFGYSAPEFALS  1971
              + H N K+ANILLDE+LNP + DCGLA L P   N+ +  +S   +   GY APE    
Sbjct  542   PITHSNLKAANILLDEDLNPRICDCGLAVLRPLASNSVKIKASEMAIEDSGYVAPEHVKR  601

Query  1972  GVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALN  2151
             G    K+D+YSFGV++LELLTGR+P DSS+ + EQSLV WA+ +LHD ++L  MVDP + 
Sbjct  602   GSGNPKADIYSFGVLLLELLTGRRPFDSSKPKGEQSLVEWASSKLHDSESLLDMVDPTIK  661

Query  2152  GMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRA  2280
                 +++LS +ADII+ C+QPE EFRP M+EVV +LV ++Q++
Sbjct  662   RTISSRALSSYADIISQCIQPEKEFRPQMAEVVHSLVSVLQKS  704



>ref|XP_006429833.1| hypothetical protein CICLE_v10013344mg [Citrus clementina]
 gb|ESR43073.1| hypothetical protein CICLE_v10013344mg [Citrus clementina]
Length=737

 Score =   523 bits (1346),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 297/707 (42%), Positives = 421/707 (60%), Gaps = 33/707 (5%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L+  V++  A+L S+     A TDP D+ AL  LY +LN+PS L+ WK  GGDPC E W 
Sbjct  9     LYLTVLVFFASLGSQ---ALAFTDPLDVTALHDLYKALNNPSLLNKWKLDGGDPCAELWT  65

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV C  S+V+ ++IPGL L G +G  L+   SLK  D+SSN I   IP  LPPN+T +N+
Sbjct  66    GVYCSESSVIHLKIPGLQLTGHLGSRLHDLHSLKHFDVSSNSIGGEIPNGLPPNVTHINM  125

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A N +  +IP+S+  +  L +LN S N L+ PIG +FT   +L  LDLS+N+F+GDLP+S
Sbjct  126   AFNKLNQNIPHSLPNLKRLRHLNLSHNMLSGPIGSVFTGLENLKELDLSYNDFTGDLPSS  185

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
              G L NLS L +QNN  TGS+  L DLPL  LN+ +N+FSG IP +  SIP   + GN F
Sbjct  186   FGSLKNLSALFLQNNNFTGSVIYLADLPLIYLNIEDNQFSGVIPKQFESIPNLWFWGNKF  245

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKT------PGSDDNHSDHEngngngkngV  1110
             +     PP  F        H   N S P + ++      P +D +    +  +  G   +
Sbjct  246   NVDRNSPPWSFPMDSLPIRH---NFSAPPTSQSSAVENYPSNDIDQKHKKGMSPGGIAFL  302

Query  1111  KAGAivgivlgssavvlsaivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKST  1290
               G  +     +  +            R  +     + ++  SLPLST +E      + +
Sbjct  303   VCGLALAATCAALFIAFRINQA-----RAARHNSLESTSTMHSLPLSTAREFSSTGPEES  357

Query  1291  ATVVDLKPP----PSEKVTIERMQGKNGSLRRS-------PITATPYTVAVLQTATNSFS  1437
                + +  P    P     +  ++ ++   R+S       P   T Y+VA LQ ATNSF+
Sbjct  358   PRFLAVSAPLFLGPRRVPPVHAIKTESTIRRKSFSKNCKLPENVTVYSVAELQLATNSFN  417

Query  1438  QENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPL  1617
             ++NL+G+GSLG VY+A+FP+G+ LA+K ++  +LS  EE+ F++ I   S+ RHPNIV L
Sbjct  418   EDNLLGKGSLGSVYKANFPDGQFLAVKNINMPSLSFDEEEQFMDVIRISSQFRHPNIVKL  477

Query  1618  VGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCL  1797
             +GYC +HGQ LLVY+++ N SL D LH   E  + L+W  R+ +ALG ARAL YLH    
Sbjct  478   LGYCVDHGQHLLVYEFVRNLSLADALH--KEIYKPLSWGIRLHIALGIARALHYLHSQFF  535

Query  1798  PSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQI---SSTHVVGSFGYSAPEFAL  1968
             P V H N K+ANILLDEEL P + D GLA L P T   +   +S   + + GY APE   
Sbjct  536   PPVSHCNIKAANILLDEELLPLICDSGLAVLRPLTSNSVKLKASEIAISNAGYIAPEHWE  595

Query  1969  SGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPAL  2148
              G    K D+Y+FGV++LELLTG+ P+D SR R EQSLV+WA+ +LHD + L +MVDP +
Sbjct  596   PGSDNTKIDIYAFGVLLLELLTGKTPVDGSRPRQEQSLVKWASSRLHDRECLEQMVDPGI  655

Query  2149  NGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVV  2289
              G + ++SLS+FADI+++C+QPE EFRPPMSE+  +L RLVQ+  ++
Sbjct  656   KGTFSSRSLSQFADIVSVCIQPEKEFRPPMSEIADSLTRLVQKHCML  702



>ref|XP_001776313.1| predicted protein [Physcomitrella patens]
 gb|EDQ58812.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   501 bits (1290),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 242/366 (66%), Positives = 297/366 (81%), Gaps = 7/366 (2%)
 Frame = +1

Query  1255  DKEVLDQRA-KSTATVVDLKPPPSEK----VTIERMQGKNGSLRRSPITATPYTVAVLQT  1419
             DK   D+   K++  V  LK PPS K    +     +   G + +S I ATP++VA LQ 
Sbjct  14    DKGAADEPVVKASPPVKVLKAPPSFKGISGLGAGHSKATIGKVNKSNIAATPFSVADLQA  73

Query  1420  ATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRH  1599
             ATNSFSQ+NL+GEGS+GRVYRA+FPNG+VLA+KK+DS+A  +Q ED+FL  + +++RL+H
Sbjct  74    ATNSFSQDNLIGEGSMGRVYRAEFPNGQVLAVKKIDSSASMVQNEDDFLSVVDSLARLQH  133

Query  1600  PNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEY  1779
              N   LVGYC EH QRLLVY+Y+  G+L+++LHF+ E ++ L+WN R+++ALG+ARALEY
Sbjct  134   ANTAELVGYCIEHDQRLLVYEYVSRGTLNELLHFSGENTKALSWNVRIKIALGSARALEY  193

Query  1780  LHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPN-TERQISSTHVVGSFGYSAP  1956
             LHEVC P VVHRNFKSANILLD+ELNPH+SDCGLAAL P+ +ERQ+S+  ++GSFGYSAP
Sbjct  194   LHEVCAPPVVHRNFKSANILLDDELNPHVSDCGLAALAPSGSERQVSA-QMLGSFGYSAP  252

Query  1957  EFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMV  2136
             E+A+SG YTVKSDVYSFGVVMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDAL++MV
Sbjct  253   EYAMSGTYTVKSDVYSFGVVMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALARMV  312

Query  2137  DPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             DP+L G+YPAKSLSRFADI+ALCVQPEPEFRPPMSEVVQALVRL+QRAS+  RR     G
Sbjct  313   DPSLKGIYPAKSLSRFADIVALCVQPEPEFRPPMSEVVQALVRLMQRASLSKRRSESAVG  372

Query  2317  FAYKTP  2334
                  P
Sbjct  373   IESNEP  378



>emb|CDP20023.1| unnamed protein product [Coffea canephora]
Length=700

 Score =   509 bits (1312),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 296/668 (44%), Positives = 411/668 (62%), Gaps = 25/668 (4%)
 Frame = +1

Query  328   LYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSL  507
             +Y +LN P QL GWK+ GGDPC ESW+G++C GS+V+ + + GL L G +G  L    SL
Sbjct  1     MYNALNRPPQLKGWKSEGGDPCDESWEGISCTGSSVIFVNLHGLELTGNLGLELFNLRSL  60

Query  508   KELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPI  687
             K+LD+SSN I   IP  LP NLT LNLANNN + +IP S+S M  L +LN S N+L+  +
Sbjct  61    KQLDVSSNNIQGEIPLGLPINLTHLNLANNNFSQNIPVSLSYMRHLRHLNLSHNALSGVL  120

Query  688   GDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLN  867
             GD+FT+   L  +DLS+N FSGDLP+S G L+NL+ L +Q N+ TGS+  L DLPL+DLN
Sbjct  121   GDVFTDLEKLIEMDLSYNKFSGDLPSSFGSLANLTRLYLQGNEFTGSVVYLADLPLSDLN  180

Query  868   VANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKT  1047
             + +N FSG IP +  SI    + GN F +    P  P+  P    P++++    P    +
Sbjct  181   IEDNHFSGVIPEKFQSINNLWFGGNRFDSGKNYPYAPWKYPFEDLPNEQSITGPPTQESS  240

Query  1048  PGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEF----  1215
               + +++  H+ G    +  + +G I  +V G + V   A + +V  +RR + ++     
Sbjct  241   --AIESYPTHKVGGHKRRR-LGSGKIGFLVGGGTLVAFCAALALVVRIRRAQNQKLRSIG  297

Query  1216  AARTSTGSLPLSTDKEVLDQRAKST-----------ATVVDLKPPPSEKVTIERMQGKNG  1362
             ++R S  SL  ST  E     A+ +              + L P  S+ + + R      
Sbjct  298   SSRHSLNSLAFSTSGEFSSTAAEGSPHLSILSSSSGIKSLHLPPIRSKPMKVSRRSFSKT  357

Query  1363  SLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALS  1542
             S  + PI A  YTVA LQ ATNSFS+ENL+G GSLG V+ A  P+G++LA+K + +  LS
Sbjct  358   S--KVPICAKRYTVAELQLATNSFSEENLLGWGSLGSVHSAKLPDGELLAVKNISTVELS  415

Query  1543  LQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQL  1722
             L EE+ FL  + N SRLRHPNIV L+GYC EHGQ LLVY+Y+ N SL D LH  +     
Sbjct  416   LHEEEQFLNVVRNASRLRHPNIVTLLGYCMEHGQHLLVYEYVRNLSLDDALHCTEYTP--  473

Query  1723  LTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTP--  1896
             L+W+ R+R+ALG AR + YLH  C P V H N K+AN+LLDE+L P + D GLA L P  
Sbjct  474   LSWDLRLRIALGVARGVNYLHSSCEPPVAHSNLKAANVLLDEDLRPRICDSGLAILRPLS  533

Query  1897  -NTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSE  2073
              N+ +  +S   +   GY A E    G+  +K+DVY+FGV++LELLTGR   DSS+   E
Sbjct  534   SNSVKLKASEMAIADSGYIATEDVYIGMNNLKADVYAFGVLLLELLTGRPSFDSSKPTEE  593

Query  2074  QSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ  2253
             Q LV+WA+ +LHD D L+ MVDPA+      + LSRFADI++LCVQP  EFR  MSEVV+
Sbjct  594   QFLVQWASRRLHDSDYLAGMVDPAIKTSISPQDLSRFADIVSLCVQPVREFRATMSEVVE  653

Query  2254  ALVRLVQR  2277
             +L+  +Q+
Sbjct  654   SLLVFIQK  661



>ref|XP_010921975.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3-like [Elaeis 
guineensis]
Length=734

 Score =   509 bits (1311),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 303/702 (43%), Positives = 423/702 (60%), Gaps = 41/702 (6%)
 Frame = +1

Query  274   LGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIP  453
             + F    T+  D+ A+  LY +L SP  L GW ASGGDPC E W+GV C  S + +I + 
Sbjct  25    MAFPQGYTNEQDVYAINNLYAALGSPP-LPGWVASGGDPCFELWQGVQCVESNITAIVLN  83

Query  454   GLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISL  633
             G  L G +G  L  FTS+  +DLS+N I   IP  LP  +  L L+ N  TGSIP S+S 
Sbjct  84    GANLGGELGDKLANFTSIMTIDLSNNHIGGNIPENLPRTIMKLFLSANQFTGSIPDSLSE  143

Query  634   MTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNN  813
             +T L+ ++ + N L   +   F N + L  LDLS NN +G LPAS+  LS+L+ L +QNN
Sbjct  144   LTLLSDMSVNQNLLTGELPGAFQNLTGLINLDLSSNNLTGQLPASMQNLSSLTALHLQNN  203

Query  814   QLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppp  993
             QL+G+L+VL DL L DLN+ NN FSG IP +L+SIP F+  GN F N+ +   P  TPP 
Sbjct  204   QLSGTLDVLQDLSLKDLNIENNLFSGPIPEKLLSIPDFKKDGNPF-NTSSASSPMITPPA  262

Query  994   pgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaiv  1173
                   ++  + P +     S D+ S H+NG       V    I+G  + +  V++ A++
Sbjct  263   LPYSGAQSPETMPSN-----SSDSPSIHDNGTPRKDKNVSVVRIIGYAVVAVIVLIIAVL  317

Query  1174  vivYCL-----RRCKKKEFAAR----------------------TSTGSLPLSTDKEVLD  1272
             + ++C+     R+ K +E   R                        T  +P+  D++  +
Sbjct  318   LFIFCISKWRERKQKHEEIPKRQEIRAHGKSKEPQINAGLMEPEKETEKVPIVADEKHDE  377

Query  1273  QRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRRSPITATP------YTVAVLQTATNSF  1434
              +  +        PP  +KV +  +  +  + R SP    P      Y++A LQ  T+SF
Sbjct  378   VKINTAGRGTLALPPLVDKVIVNPIASRKKNPRTSPENLNPPAPVKSYSIASLQQYTDSF  437

Query  1435  SQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVP  1614
             S+E+L+ EG LGR+Y A+ P GK+LA+ K+D+   ++Q +D FLE + ++S LRHPNI+ 
Sbjct  438   SEESLIKEGRLGRIYLAEPPEGKLLAVLKLDNMNSNIQLDD-FLELVLSISELRHPNILE  496

Query  1615  LVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVC  1794
             LVGYCAE GQ LLVY Y  N +LHD+LH  D+    L+WNAR+++A   ARALEYLHE C
Sbjct  497   LVGYCAEFGQCLLVYKYFSNKTLHDILHGEDDHKIKLSWNARIQIAFEAARALEYLHESC  556

Query  1795  LPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSG  1974
              P V+H+NF+ +NI LD+ L   + +CGLA+L  +      S  +   F Y APE   SG
Sbjct  557   QPPVIHQNFEPSNIFLDDNLAVQVFECGLASLMSSNSVTQLSGRIHALFSYKAPEIGGSG  616

Query  1975  VYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNG  2154
              ++ +SDVYSFGVVMLELLTGRKP DSSR R+EQ LVRWA+ QLHDI+ LS+MVDP+++G
Sbjct  617   SHSEQSDVYSFGVVMLELLTGRKPYDSSRPRAEQHLVRWASSQLHDINTLSRMVDPSIDG  676

Query  2155  MYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRA  2280
              Y  KSLSRFADII+ C++  PEFRP MSEVVQ L R+++ A
Sbjct  677   KYSVKSLSRFADIISRCIRRTPEFRPSMSEVVQDLARVIEDA  718



>ref|XP_002965192.1| hypothetical protein SELMODRAFT_83158 [Selaginella moellendorffii]
 gb|EFJ34030.1| hypothetical protein SELMODRAFT_83158 [Selaginella moellendorffii]
Length=362

 Score =   490 bits (1261),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 234/350 (67%), Positives = 285/350 (81%), Gaps = 1/350 (0%)
 Frame = +1

Query  1267  LDQRAKSTATVVDLKPPPSEKVTIERMQGKNGSLRRSPITATPYTVAVLQTATNSFSQEN  1446
             ++Q+ + +     LKPPP +    ER   K+ + + S + AT Y+VA LQ ATNSF+QEN
Sbjct  1     MEQKTRLSPPEKVLKPPPLKTPAAERSPIKHKNSKAS-VAATSYSVADLQAATNSFAQEN  59

Query  1447  LVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGY  1626
             L+GEGSLGRVYRA+  NG  LA+KK+D++  ++Q  + FL  +S ++RLRH N+  LVGY
Sbjct  60    LLGEGSLGRVYRAELQNGTPLAVKKLDASGSTVQTNEEFLAFVSTIARLRHTNVTELVGY  119

Query  1627  CAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSV  1806
             CAEHGQRLLVY+Y   G+LH+MLH  DE S+ L+WN RV++ALG ARALEYLHEVC P+V
Sbjct  120   CAEHGQRLLVYEYFNRGTLHEMLHVLDETSKRLSWNQRVKIALGAARALEYLHEVCSPAV  179

Query  1807  VHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTV  1986
             VHRNFKSANILLD++++PHL+DCGLAAL+  +  +  +  ++GSFGYSAPEFA+SGVYTV
Sbjct  180   VHRNFKSANILLDDDMSPHLTDCGLAALSSTSSDRQVAAQMLGSFGYSAPEFAMSGVYTV  239

Query  1987  KSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPA  2166
             KSDVYSFGVVMLELLTGRKPLDSSR RSEQSLVRWATPQLHDIDALSKMVDPAL G+YPA
Sbjct  240   KSDVYSFGVVMLELLTGRKPLDSSRARSEQSLVRWATPQLHDIDALSKMVDPALKGIYPA  299

Query  2167  KSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             KSLSRFAD+I+ CVQPEPEFRPPMSEVVQ+LVRL+QRAS+  R   DE G
Sbjct  300   KSLSRFADVISSCVQPEPEFRPPMSEVVQSLVRLMQRASLSKRSSGDELG  349



>gb|KCW90298.1| hypothetical protein EUGRSUZ_A02440 [Eucalyptus grandis]
Length=730

 Score =   502 bits (1293),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 281/674 (42%), Positives = 415/674 (62%), Gaps = 17/674 (3%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TDP D   L  LY +LN P+QL GW++ GGDPC ESW GV C GS+V+ +++ GL L+
Sbjct  25    AFTDPLDATTLHGLYAALNYPAQLRGWRSDGGDPCEESWMGVACSGSSVIYLKLDGLNLS  84

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             G++G  L+ F +LK+LD+SSN I   IPY LPPN+T LNLA N +T SIP+S+  + +L 
Sbjct  85    GSLGDQLHNFHNLKQLDMSSNNIQGDIPYGLPPNITHLNLACNKLTQSIPHSLPSLKNLR  144

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             +LN S N L+ PIG++FT   +L  +DLS NNF+GDLP+S   LSNL+ L ++NN+ TG+
Sbjct  145   HLNLSHNLLSGPIGNVFTGLLNLKEMDLSDNNFTGDLPSSFQSLSNLTGLFLRNNRFTGA  204

Query  829   LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppppgrpH  1008
             + +L +LPL +L++ +N FSG IP    +IP     GN+F  + +PP             
Sbjct  205   VILLANLPLINLDIKDNHFSGVIPKSFQNIPNLWIGGNNFHGAESPPWNFPFQNMSL---  261

Query  1009  KRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYC  1188
              ++N S+P + ++   +++ S +   +  GK G    A +           + I+ I   
Sbjct  262   -QSNISSPPTTQSSAVENHPSLYARLHKRGKLGPGGIACMVGGGTLVVSCAALIIAIHIH  320

Query  1189  LRRCKKKEFAARTSTG--SLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQGKNG  1362
               R +K +   R+++   S+ + T +E+         + V  +P P   + +   +G   
Sbjct  321   WARAQKDKLLHRSNSSFHSMSVRTVREIPPNLPHILPSTVSARPVP---LALLAGRGNRK  377

Query  1363  SLRR---SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSA  1533
             S  R   +      Y  A LQ AT  FS+EN++ EGSLG VY A  P+G++LA++ V+ A
Sbjct  378   SFSRKCEALECVKIYNAAELQFATKGFSEENIICEGSLGPVYEAKLPDGQILAVENVNMA  437

Query  1534  ALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADER  1713
             +LSL EE+ FL+ I ++ RLRHPN++PL+GYC   G  LLVY+Y+   +L D LH    +
Sbjct  438   SLSLLEEEQFLDVICSVCRLRHPNVIPLLGYCTGLGLHLLVYEYMRYVTLDDALHSGKYK  497

Query  1714  SQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALT  1893
                L+W++RVR+ALG A+AL+Y+H    P V H N K+ NILLDEEL P + DCG++ L 
Sbjct  498   P--LSWSSRVRIALGVAQALDYMHSTFAPPVCHGNLKARNILLDEELKPRICDCGISVLR  555

Query  1894  PNTERQI---SSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRE  2064
             P T   +   +S   +G  GY APE    G+   K D+Y+FGV++LELLTGR+P DSSR 
Sbjct  556   PLTCSSVKLKASEIAIGDTGYIAPEHGQPGIDNTKCDIYAFGVLLLELLTGRRPFDSSRP  615

Query  2065  RSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSE  2244
             R E+ LV+WA+ QLHD D L +MVD  + G    ++LSR ADII++C + E EFRP M E
Sbjct  616   REEKYLVKWASSQLHDRDCLEQMVDKRVEGTLSFRALSRLADIISVCTRHEKEFRPAMHE  675

Query  2245  VVQALVRLVQRASV  2286
             VV++L+ +++R ++
Sbjct  676   VVESLLYMLERFNI  689



>ref|XP_010913799.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Elaeis guineensis]
Length=685

 Score =   497 bits (1280),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 295/677 (44%), Positives = 392/677 (58%), Gaps = 43/677 (6%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TD +D+ AL VL+ SLNSP QL+GW ++GGDPCG+ WKGV C  S+V  I + GLGL 
Sbjct  21    AETDQDDVSALNVLFKSLNSPPQLTGWSSTGGDPCGDDWKGVKCSDSSVTEISLSGLGLT  80

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             G +GY L+  TS+   D+S N +   IPYQLPP +  LNLA N  TG IPYSIS MT + 
Sbjct  81    GLLGYQLSSLTSVTYFDMSKNNLKGDIPYQLPPKVEHLNLAENAFTGGIPYSISQMTDIE  140

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             Y+N   N L   + D+F   S L+ + LSF                        NQL+G+
Sbjct  141   YINLQRNQLNGQLNDVFGKLSRLSEMYLSF------------------------NQLSGN  176

Query  829   LN-VLVDLP-LTDLNVANNRFSGWIPNELISIP--KFEYSGNSFSNSpapppppftpppp  996
             L   L  L  L  L++ NN+ SG I N L ++P        N F+               
Sbjct  177   LPPSLRSLKGLKTLHLQNNQLSGSI-NVLANLPLEDLNVENNQFNGWIPNKLKNIDTLQI  235

Query  997   grpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgs----savvls  1164
             G     +  + PG  K   ++ +    +         V AG ++ +++ S    + +   
Sbjct  236   GGNSWSSGPAPPGMDKASNTNSHTGGKKGMQSVVNGAVIAGTVIAVLVISLILLALIKRK  295

Query  1165  aivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTI--  1338
             +     Y      +   +    +  L L      +D +A  T   + L+PPP        
Sbjct  296   SSSSSHYIDDGSSQNISSTPLVSHELGLKESSSSIDIKALETPLSMGLRPPPEPYKVFSD  355

Query  1339  -ERMQGKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAI  1515
              E     N     + ++ T Y++  LQ AT SFS   L+G+G++G VY+  + +GKVLA+
Sbjct  356   NEFAVKLNPKHNTNAVSITAYSLVDLQAATGSFSASCLLGQGTIGSVYKTKYADGKVLAV  415

Query  1516  KKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDML  1695
             KK+D   LS     +F+E +S +S+LRHPNI  L+GYC+E    LL+Y++  NGSLHD L
Sbjct  416   KKIDLINLSGGTSYDFMELVSGISKLRHPNIAELLGYCSEPCYHLLIYEFQMNGSLHDFL  475

Query  1696  HFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDC  1875
             H +DE S+ LTW+ RVR+ALGTARALEYLH +C PSV+H+N KSANILLD ELNPHLSDC
Sbjct  476   HLSDEYSKPLTWDTRVRIALGTARALEYLHGICSPSVIHKNMKSANILLDAELNPHLSDC  535

Query  1876  GLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDS  2055
             G+A    +T   +         GY+APE      YT+KSDVYSFGVVMLELLTGRKP DS
Sbjct  536   GVAIFYEDTSENLGP-------GYNAPECTKPSAYTMKSDVYSFGVVMLELLTGRKPFDS  588

Query  2056  SRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPP  2235
             S+  +EQ+LVRWA PQLHDI +L +MVDPAL G+YP KSLSRFAD+IALC+QPEPEFRP 
Sbjct  589   SKSITEQTLVRWAAPQLHDITSLMQMVDPALRGLYPPKSLSRFADVIALCIQPEPEFRPS  648

Query  2236  MSEVVQALVRLVQRASV  2286
             MSEVVQ+L + V    +
Sbjct  649   MSEVVQSLYQCVHGTGI  665



>ref|XP_008775322.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008775323.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008775324.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3 isoform X1 [Phoenix 
dactylifera]
Length=734

 Score =   496 bits (1277),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 299/703 (43%), Positives = 413/703 (59%), Gaps = 43/703 (6%)
 Frame = +1

Query  274   LGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIP  453
             + F    T+  D+ A+  LY +L SP  L GW AS GDPC E W+GV C  S + +I + 
Sbjct  25    MPFSQGYTNEKDVYAINNLYTALGSPP-LPGWVASAGDPCFEVWQGVQCVESNITAIVLN  83

Query  454   GLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISL  633
                L G +G  L  FTS+  +DLS+N I   IP  LP  +    L+ N  TGSIP S+S 
Sbjct  84    DANLGGELGDKLANFTSITTIDLSNNHIGGNIPENLPRTMMQFFLSANQFTGSIPDSLSE  143

Query  634   MTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNN  813
             +T L+ ++ + N L   + D F + + L  LDLS NN +G LP S+  LS+L+ L +QNN
Sbjct  144   LTLLSDMSVNQNLLTGELPDAFQSLTGLINLDLSSNNLTGQLPPSMQNLSSLTALHLQNN  203

Query  814   QLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppp  993
             QL+G+L+VL DLPL DLN+ NN FSG IP +L+SIP F+  GN F+ S AP P     P 
Sbjct  204   QLSGTLDVLQDLPLKDLNIENNLFSGPIPEKLLSIPNFKKDGNPFNTSSAPSPMITPSPL  263

Query  994   pgrpHKRTNHSTPGSHKTPG-SDDNHSDHEngngngkngVKAGAivgivlgssavvlsai  1170
                     +   P     P  S +  S H+N     +  V    I+G  + +  V++ A+
Sbjct  264   -------PHSGAPSPETMPSNSSEGPSIHDNETPRKEKKVSVVRIIGYAVVAVIVLIMAV  316

Query  1171  vvivYCL--RRCKKK---------EFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLK--  1311
             ++ ++C+  RR +K+         E  A        ++ D    D+ A     V D K  
Sbjct  317   LLFMFCISKRRGRKQKHEEIPKRLEIRAHGKPKEPQINADLNEPDKEAGKVPIVADEKQD  376

Query  1312  --------------PPPSEKVTIERMQGKNGSLRRSPITATP------YTVAVLQTATNS  1431
                           PP  +KV +        + R  P    P      Y+ A LQ  T+S
Sbjct  377   EVKINMAGPGALALPPLVDKVIVNPSASSKKNPRTCPENLNPPAPVKSYSAASLQQYTDS  436

Query  1432  FSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIV  1611
             FS+E+L+ +G LGR+Y A+ P GK+LA+ K+D+   ++Q +D FLE + ++S LRHPNI+
Sbjct  437   FSEESLINDGCLGRIYLAEPPEGKLLAVLKLDNMNSNIQLDD-FLELVLSISELRHPNIL  495

Query  1612  PLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEV  1791
              LVGYCAE GQ LLVY+Y  + +LHD+LH  D+    L+W AR+++A   A+ALEYLHE 
Sbjct  496   ELVGYCAEFGQCLLVYNYFSSKTLHDILHSEDDHKIRLSWRARIQIAFEAAKALEYLHES  555

Query  1792  CLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALS  1971
             C P V+H+NF+ +NI LD++L   + +CGLA L  +      S  +   F Y APEF  S
Sbjct  556   CQPPVIHQNFEPSNIFLDDDLAVRVFECGLAPLMSSNSVTQLSGRIHALFSYEAPEFGES  615

Query  1972  GVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALN  2151
             G ++ +SDVYSFGVVMLELLTGRKP D SR R+EQ LVRWA+ QLHDI+ LS+MVDP+++
Sbjct  616   GSHSEQSDVYSFGVVMLELLTGRKPYDRSRPRAEQHLVRWASSQLHDINTLSRMVDPSID  675

Query  2152  GMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRA  2280
             G Y  KSLSRFADII+ C+Q  PEFRP MSEVVQ L R+++ A
Sbjct  676   GKYSVKSLSRFADIISRCIQRGPEFRPSMSEVVQDLARVIEDA  718



>ref|XP_001783845.1| predicted protein [Physcomitrella patens]
 gb|EDQ51335.1| predicted protein [Physcomitrella patens]
Length=700

 Score =   494 bits (1271),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 244/360 (68%), Positives = 292/360 (81%), Gaps = 9/360 (3%)
 Frame = +1

Query  1303  DLKPPPSEKVTIERMQGKNGSLR-------RSPITATPYTVAVLQTATNSFSQENLVGEG  1461
             +LK PPS K   E    K    R       ++ + A  Y+VA LQ ATNSF+QENL+GEG
Sbjct  339   ELKAPPSFKSNGENGPSKTPPSRPPPARSAKAIVPAIAYSVADLQAATNSFAQENLIGEG  398

Query  1462  SLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHG  1641
             SLGRVYR +F +G+V A+KK+DS++  +Q E +FL  +S M+RLRH NI  LVGYCAEHG
Sbjct  399   SLGRVYRGEFTDGQVHAVKKLDSSSPLVQNEQDFLGILSGMARLRHGNITELVGYCAEHG  458

Query  1642  QRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNF  1821
             QRLLVY YI  G+L+D+LH  DE ++ LTWNARV++ALG ARALEYLHEVCLP+VVHRNF
Sbjct  459   QRLLVYQYISRGTLNDILHTKDEDTKRLTWNARVKIALGAARALEYLHEVCLPAVVHRNF  518

Query  1822  KSANILLDEELNPHLSDCGLAALTP-NTERQISSTHVVGSFGYSAPEFALSGVYTVKSDV  1998
             KSAN+LLD+ELNPHL+DCG+AALTP  ++RQ+S T ++GSFGYSAPE+A+SG+YTVKSDV
Sbjct  519   KSANVLLDDELNPHLTDCGIAALTPLGSDRQVS-TQMLGSFGYSAPEYAMSGIYTVKSDV  577

Query  1999  YSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLS  2178
             YSFGVVMLELLTGRKPLDS+R R+EQSLVRWATPQLHDIDAL+KMVDPAL G+YPAKSLS
Sbjct  578   YSFGVVMLELLTGRKPLDSTRLRAEQSLVRWATPQLHDIDALAKMVDPALKGIYPAKSLS  637

Query  2179  RFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             RFADIIALCVQPEPEFRP MSEVVQALVRL+QRAS+  RR  D+ G + ++ D      D
Sbjct  638   RFADIIALCVQPEPEFRPVMSEVVQALVRLMQRASLNKRRSGDDLGASNRSMDRQYDPSD  697


 Score =   175 bits (443),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 131/215 (61%), Gaps = 3/215 (1%)
 Frame = +1

Query  316  ALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNG  495
            AL  LY SL  P+QL+ W +SGGDPCG  W GV C GS V  + +   GL+G +GY L  
Sbjct  2    ALNSLYISLEEPAQLTLWNSSGGDPCGGGWLGVICTGSNVTELHLNQKGLSGNLGYSLTA  61

Query  496  FTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSL  675
               L  LD+S N I   +P QLPP +  LNL  N ITG+IP+S+  +T+L  LN S N L
Sbjct  62   LQQLLILDVSGNNIQGNMPSQLPPLVRLLNLGGNVITGNIPHSLKELTNLTELNLSHNKL  121

Query  676  AQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVD--L  849
               + D++T  + L  LDLSFN  +G LP S+G LS L+ L V+NN LTG+L + +    
Sbjct  122  QNGVPDVWTQLTSLRLLDLSFNELTGSLPRSIGDLSALTSLNVENNHLTGNLPLSMSNLT  181

Query  850  PLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN  954
             L  LN+ NNRF+GW+P  L +      SGN+FSN
Sbjct  182  NLQYLNLQNNRFTGWLPPNL-NPRDVRISGNNFSN  215



>ref|XP_010534992.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 isoform X2 [Tarenaya 
hassleriana]
Length=641

 Score =   491 bits (1263),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 289/587 (49%), Positives = 390/587 (66%), Gaps = 37/587 (6%)
 Frame = +1

Query  595   NNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLG  774
             NN  G   YSISLM SL YL+ + N     +   FT  + LT LDLS N+FSG LP+S  
Sbjct  53    NNWNGQ--YSISLMASLKYLSLAHNQFKGQLAVDFTKLTSLTFLDLSSNSFSGSLPSSFT  110

Query  775   LLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN  954
              LS++  + +QNNQ TG++++L  LPL +LN+ANN+F+GWIP+ L  I   +  GNSF+ 
Sbjct  111   SLSSIKSMYLQNNQFTGTIDLLAGLPLENLNIANNKFTGWIPDSLKGINLLK-DGNSFN-  168

Query  955   SpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgi  1134
                  P P TPP      +  +H++ GS       +NHS  ++ + + +        +  
Sbjct  169   ---LGPAPPTPPGTSPIRRSPSHNSRGS-------ENHSSGDSSSSDSRKSGIGAGGIAG  218

Query  1135  vlgssavvlsaivvivYCLRRCKKKEF-AARTSTGSLPLSTDKEVLDQRAKSTATV----  1299
             ++ S  VV + +   ++  +R K+      RT      L++++   ++  + +++V    
Sbjct  219   IIISLLVVGAVVSFFLFKRKRSKRPSLDIERTDNQPFTLTSNEFQENKSIQGSSSVETKK  278

Query  1300  ------VDLKPPPSEKVTIERMQGKNGSLRRSPI----TATP-----YTVAVLQTATNSF  1434
                   ++L+PPP+++         + S+R+  I    T  P     Y+VA LQ AT SF
Sbjct  279   LDISLSINLRPPPADRHK-SFDDDDDDSMRKPVIMKKTTVVPSNVKAYSVADLQIATGSF  337

Query  1435  SQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVP  1614
             S EN +GEG+ GRVYRA F +GKVLA+KK+DS+AL   + D+F+E +SN++RL +PN+  
Sbjct  338   SLENFLGEGTFGRVYRAHFEDGKVLAVKKIDSSALPGDQVDDFIETVSNIARLDNPNVTK  397

Query  1615  LVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVC  1794
             LVGYC+EHGQ LLVY++  NGSLHD LH ++E ++ L WN+RV++ALGTARALEYLHEVC
Sbjct  398   LVGYCSEHGQHLLVYEFHKNGSLHDFLHLSEEENKPLIWNSRVKIALGTARALEYLHEVC  457

Query  1795  LPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSG  1974
              PS+VH+N KS+NILLD ELNPHLSD GL    P  +  ++ +      GYSAPE ++SG
Sbjct  458   SPSIVHKNIKSSNILLDSELNPHLSDSGLTCFLPMADELLNQSD--EGTGYSAPEVSMSG  515

Query  1975  VYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNG  2154
              Y+ KSDVYSFGVVMLELLTGRKP DS+R RSEQSLVRWATPQLHDI+AL KMVDP+L  
Sbjct  516   QYSTKSDVYSFGVVMLELLTGRKPFDSTRPRSEQSLVRWATPQLHDINALGKMVDPSLKR  575

Query  2155  MYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIR  2295
             +YP KSLSRFAD+IALCVQPEPEFRPPMSEVVQALV LVQRA++  R
Sbjct  576   LYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVVLVQRANMSKR  622



>ref|XP_010423291.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2 isoform X1 [Camelina 
sativa]
Length=734

 Score =   491 bits (1263),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 295/696 (42%), Positives = 421/696 (60%), Gaps = 37/696 (5%)
 Frame = +1

Query  262   LISRLGFV--GAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAV  435
             L++ L FV   A TDP ++ AL+ LY SL++P QL GW+  GGDPCGE+W GV+C GS++
Sbjct  14    LLTVLLFVLAKANTDPLEVLALQDLYKSLSNPEQLRGWRLEGGDPCGETWMGVSCSGSSI  73

Query  436   VSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSI  615
             V +++  L L G++G  L    +LK +D+S N +   IP+ LPPN T +N+A NN+T SI
Sbjct  74    VDLQLRELKLLGSLGNQLQHLHNLKTMDVSFNSLQGEIPFGLPPNATHINMACNNLTQSI  133

Query  616   PYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSM  795
             P+S+ L+TSL  LN S NSL+ P+G++F+    +  +DLSFNN +GDLP+S G L NL+ 
Sbjct  134   PFSLPLLTSLQSLNLSHNSLSGPLGNVFSGL-QIKEMDLSFNNLTGDLPSSFGTLMNLTS  192

Query  796   LRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppp  975
             L +QNN+LTGS+  L DLPL DLN+ +N+FSG IP+   SIP     GN F   P   P 
Sbjct  193   LYLQNNRLTGSVIYLADLPLADLNIEDNQFSGIIPSHFQSIPHLWIWGNKFHVEPNYKPW  252

Query  976   pftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgssav  1155
              F           T + T  S     +  N    +      K G+ AG+   +V G + +
Sbjct  253   KFPLDVRPLIQNATGYPTTES----SAIMNFPRPQTVVRKKKKGIGAGSTFLLVGGLALL  308

Query  1156  vlsaivvivYCLRRCKKKEFAARTSTGS----LPLSTDKEV-------LDQRAKSTATVV  1302
                  +  V    R  +   A+  S  S    LP+ST +E           R     T+ 
Sbjct  309   GTFFALFAVRMSHRRAQNLAASHISNNSTAYSLPVSTGREYPVATEDNPQMRRVQPPTIP  368

Query  1303  DLKPPPSEKVTIERMQGKNGSLRRSPITATP--------YTVAVLQTATNSFSQENLVGE  1458
              L+  PS  V I++      ++RR   +AT         ++ A LQ ATNSFS+ENL+GE
Sbjct  369   QLRHLPSPPVRIDK------AVRRKSFSATCQYPSFAKLFSAAELQLATNSFSEENLLGE  422

Query  1459  GSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEH  1638
             G LG VYRA  P+G+   ++ +  ++LSL EE+ F E +   S+LRHPNIV L+G+C E+
Sbjct  423   GPLGSVYRAILPDGQFAVVRNIPMSSLSLHEEEQFTEVLQIASKLRHPNIVTLLGFCIEN  482

Query  1639  GQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRN  1818
             G+ LLVY+Y+G+ SL++ +H  DE  + L+W  R+R+A+G ARAL+YLH    P + H +
Sbjct  483   GEHLLVYEYVGHLSLYNAMH--DEVYKPLSWGLRLRIAIGVARALDYLHSSFCPPIAHSD  540

Query  1819  FKSANILLDEELNPHLSDCGLAALTPNTERQI---SSTHVVGSFGYSAPEFALSGVYTVK  1989
              K+ NILLDEEL P ++DCGLA+L P T   +   +S   + + GY APE    G    K
Sbjct  541   LKATNILLDEELTPRIADCGLASLRPLTSNSVKLRASEIAIQNTGYIAPEHGQPGSSGTK  600

Query  1990  SDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAK  2169
             SD Y+ GV++LELLTGRK  DSSR R EQ LV+WA+ +LHD  +L +M+D  + G + ++
Sbjct  601   SDTYALGVLLLELLTGRKAFDSSRPRGEQLLVKWASTRLHDRRSLEQMIDGGIAGTFSSR  660

Query  2170  SLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQR  2277
               S++ADII+LC Q E EFRP +SE+V+AL  L+Q+
Sbjct  661   VASQYADIISLCTQVEKEFRPAVSEIVEALTALIQK  696



>ref|XP_009797595.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2 isoform X2 [Nicotiana 
sylvestris]
Length=726

 Score =   487 bits (1254),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 297/703 (42%), Positives = 410/703 (58%), Gaps = 53/703 (8%)
 Frame = +1

Query  229   LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
             L T  +L+   L  +     A TD   +QAL  LY +LNSP++L  WK  GGDPC ESW 
Sbjct  14    LVTAAILLFGVLFFQ---AFARTDDLQVQALRDLYRALNSPTELKNWKLEGGDPCEESWT  70

Query  409   GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
             GV+C  S+V+ I++ GL L G +G  L     LK L                      NL
Sbjct  71    GVSCYQSSVIEIKLQGLNLTGNIGDQLVSLQHLKHL----------------------NL  108

Query  589   ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
             A NN T SIP S+S M  L +LN S N L+ P+ D+F    +L  +DLS N FSGDLPAS
Sbjct  109   ACNNFTQSIPASVSSMKHLRHLNMSQNLLSGPLADVFGGLDNLIMMDLSHNKFSGDLPAS  168

Query  769   LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                L NL+ L +Q+N+ TGS+  L DL L DLN+ +N FSG IP    +I      GN F
Sbjct  169   FRALKNLTKLYLQSNEFTGSVIFLADLHLHDLNIEDNHFSGVIPGSFQNINNLWIGGNRF  228

Query  949   SNSpapppppftppppgrpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAiv  1128
              +  A   P   P          N S+P + K+  + + +  HE G+   K    +G IV
Sbjct  229   HSGGADYLPWKFPTDVM-----PNISSPPTTKS-SAIEKYPSHETGDNRKKRP-GSGGIV  281

Query  1129  givlgssavvlsaivvivYCLRRCKKKEF----AARTSTGSLPLSTDKEVLDQRAKS---  1287
              +V+G+   V  A V I + +RR +K+       + +S  SLP+S  +      A     
Sbjct  282   IMVVGAVLTVFGAAVFITFRIRRSQKQTLDSIRGSISSLQSLPISAPQVTTGPLAAQYDS  341

Query  1288  --------TATVVDLKPPPSEKVTIERMQGKNGSLR-RSPITATPYTVAVLQTATNSFSQ  1440
                        +   + PP+  +T++  + ++ S + + PI A  YTVA LQ AT++FS 
Sbjct  342   PDSSSSDSPPLISSWQLPPAPTMTLKMSKRRSFSKKCKIPICAKHYTVAELQLATSNFSP  401

Query  1441  ENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLV  1620
              NL+GEG+LG VYRADFP+G++LA+K + + ALS+ EE+ F++ I   SRLRHPNIV L+
Sbjct  402   GNLLGEGTLGSVYRADFPDGQILAVKNIKTVALSITEEEQFMDVIRTASRLRHPNIVALI  461

Query  1621  GYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLP  1800
             GYC  HG  LLVY+YI N +L D LH        LTW+ R+R+A+G ARAL YLH  C+P
Sbjct  462   GYCVGHGNHLLVYEYIRNVTLDDALH--SVLCMPLTWSLRLRIAIGVARALNYLHTFCVP  519

Query  1801  SVVHRNFKSANILLDEELNPHLSDCGLAALTP---NTERQISSTHVVGSFGYSAPEFALS  1971
              + H N K+ANILLDE+LNP + DCGLA L P   N+ +  +S   +   GY APE    
Sbjct  520   PITHSNLKAANILLDEDLNPRICDCGLAVLRPLASNSVKIKASEMAIEDSGYVAPEHVKR  579

Query  1972  GVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALN  2151
             G    K+D+YSFGV++LELLTGR+P DSS+ + EQSLV WA+ +LHD ++L  MVDP + 
Sbjct  580   GSGNPKADIYSFGVLLLELLTGRRPFDSSKPKGEQSLVEWASSKLHDSESLLDMVDPTIK  639

Query  2152  GMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRA  2280
                 +++LS +ADII+ C+QPE EFRP M+EVV +LV ++Q++
Sbjct  640   RTISSRALSSYADIISQCIQPEKEFRPQMAEVVHSLVSVLQKS  682



>ref|XP_010557936.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2-like isoform 
X2 [Tarenaya hassleriana]
Length=696

 Score =   485 bits (1248),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 280/696 (40%), Positives = 401/696 (58%), Gaps = 60/696 (9%)
 Frame = +1

Query  220   GAFLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGE  399
             G FLF  V+   A          A TDP ++  L+ L+ +LNSP QL GWK   GDPCGE
Sbjct  12    GTFLFVRVLFAQAE---------AYTDPLEVWVLQDLFKALNSPQQLKGWKLQSGDPCGE  62

Query  400   SWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTS  579
             SW GVTC GS++V   IPGL + G++G  LN   +LK LD+S N +   IPY LPPN T 
Sbjct  63    SWMGVTCSGSSIVEFRIPGLRIWGSLGSHLNHLHNLKILDVSFNFLQGEIPYGLPPNATH  122

Query  580   LNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDL  759
             LNL++N+++G                        P+G++F+    L  +DLS NN +GDL
Sbjct  123   LNLSHNSLSG------------------------PLGNVFSGM-QLKEMDLSSNNLTGDL  157

Query  760   PASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSG  939
             P+S G L +L+ L +QNN+ TGS+  L DLPL DLN+ +N FSG +P+   SIP     G
Sbjct  158   PSSFGSLMSLTSLYLQNNRFTGSVVYLADLPLIDLNIEDNEFSGVLPSHFQSIPHLWIWG  217

Query  940   NSFSNSpapppppftppppgrpHKRTNHSTPGS---HKTPGSDDNHSDHEngngngkngV  1110
             N F       P  F           +   T  S    + PG +     H+     G   +
Sbjct  218   NKFQVDQNYKPWRFPLDVIPMMQNASGLPTTQSSAMKRFPGPE-KQGKHKKRVVAGSIVI  276

Query  1111  KAGAivgivlgssavvlsaivvivYCLRRCKK--KEFAARTSTGSLPLSTDKEVLDQRAK  1284
               G +  +    +   +       +  +R +K     +  ++T SLP+ST +   D   +
Sbjct  277   MVGGMALLGTFVAVFAVR------FSHKRARKLSSHRSDISTTYSLPISTTR---DFSVE  327

Query  1285  STATVVDLKPPPSEKVTIERMQGKNG--SLRRSPITATPYTVAVLQTATNSFSQENLVGE  1458
              +  ++ ++ PP   + IER   +       + P     ++ A LQ ATNSFS+ENL+ E
Sbjct  328   DSPQIMRVRHPP---IKIERTTSRKSFSGTCQFPAYVDQFSFAELQLATNSFSEENLLAE  384

Query  1459  GSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEH  1638
             G LG VYRA  P+G+  A+K +  A+LS QEE+ F++ +   S+LRHPNI+ L+G C E+
Sbjct  385   GPLGSVYRAKLPDGQFSAVKNIPIASLSFQEEEQFIQVLRTASKLRHPNIITLLGICIEN  444

Query  1639  GQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRN  1818
              Q LLVY+Y+GN SL+D +H  DE  + L+W+ R+R+A+G ARAL+YLH    P + HR+
Sbjct  445   RQHLLVYEYVGNLSLYDAMH--DEVYKPLSWSLRLRIAVGVARALDYLHSSFSPPIAHRD  502

Query  1819  FKSANILLDEELNPHLSDCGLAALTPNTERQI---SSTHVVGSFGYSAPEFALSGVYTVK  1989
              K+ NI+LDEEL P ++DCGLA+L P T   +   +S   + + GY  PE   S     K
Sbjct  503   LKAENIMLDEELMPRIADCGLASLRPLTSNSVKLRASEIALQNTGYIGPEHVQSRSNGTK  562

Query  1990  SDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAK  2169
             SDVY+FGV++LELLTGRKP D +R R EQ LV+WAT +LHD  +L +M+D  + G + ++
Sbjct  563   SDVYAFGVLLLELLTGRKPFDCARPREEQLLVKWATCRLHDRRSLEQMIDAGIAGTFSSR  622

Query  2170  SLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQR  2277
               S+FADI++LC Q E EFRPP+SE+V+AL  L+Q+
Sbjct  623   VASQFADIVSLCTQAE-EFRPPVSEIVEALTNLMQK  657



>ref|XP_009416083.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=725

 Score =   484 bits (1247),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 301/716 (42%), Positives = 410/716 (57%), Gaps = 50/716 (7%)
 Frame = +1

Query  226   FLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESW  405
             FL+  ++L++      L +  A T+  D+ A+   Y +L SP  L GW  SGGDPC E W
Sbjct  14    FLWVGLMLILG-----LPYCCAYTNELDVSAINSFYAALGSPP-LPGWVPSGGDPCMEGW  67

Query  406   KGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLN  585
             +GV C  S +  I I G  L G +G  L  F+S+  +DLS+N I   IP  LP  L    
Sbjct  68    QGVQCVDSNITGIVINGANLGGQLGDGLGIFSSITTIDLSNNNIGSGIPENLPLTLQKFF  127

Query  586   LANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPA  765
             L+ N  TGSIP S+S +T L  ++ + N L   + D F++ + L  LDLS NN SG LP 
Sbjct  128   LSANQFTGSIPSSLSKLTLLTDMSVNNNHLTGVLPDAFSSLTGLINLDLSVNNISGQLPP  187

Query  766   SLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNS  945
             S+G LS+L+ L VQNNQ +G L+VL DLPL DLN+ NN FSG +P +L++IP F+  GN 
Sbjct  188   SMGSLSSLTTLHVQNNQFSGILDVLEDLPLKDLNIENNLFSGPVPEKLLNIPNFKKDGNP  247

Query  946   FSNSpapppppftppppgrpHKRTNHSTPGSHKTP-----GSDDNHSDHEngngngkngV  1110
             F+ S  P   P         H+    ++P     P      S D  S  E+ +      +
Sbjct  248   FNTSITPSSAP---------HQSPPRASPSGSPIPDTMHTNSSDGPSSQESPHKLSTVKI  298

Query  1111  KAGAivgivlgssavvlsaivvivYCLRRCKKKEF----AARTSTG-SLPLSTDK-----  1260
                 +V + L    V++    +  Y  R+ K  E       RT  G   P S +      
Sbjct  299   VGYVVVAVFLVIVIVLMVIFCLSKYQERKSKHDELFRSQVGRTEMGYKKPRSEEHFAETK  358

Query  1261  ----EVLDQRAKSTATVVDLKP--------PPSEKVTIERMQGKNGSLRRSP--ITATP-  1395
                 EV+    K    ++D+          PP E  T+  +  +   +  SP  +  TP 
Sbjct  359   NEVPEVVKDSEKEREHIIDMNETADIVMPQPPVENDTVTPIVLRKNVVGHSPEMMNTTPT  418

Query  1396  ----YTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNF  1563
                 ++V  LQ  T++F +ENL+ +  LG+ Y A   +GK+L + K+D+   S    D+F
Sbjct  419   SVRSFSVGDLQQYTDNFCEENLIRDDRLGKAYLAQSSDGKLLEVMKLDNVN-SRVPADDF  477

Query  1564  LEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARV  1743
             LE +  +S LRHPNI+ LVGYCAE  QRLLVY Y    +LHD+LH  D+ +  L+W AR+
Sbjct  478   LELVLAVSELRHPNILELVGYCAEFDQRLLVYRYFSQKTLHDILHVGDDLNTRLSWTARL  537

Query  1744  RVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISST  1923
              VALG A+ALEYLHE C PS VH+NF  AN+LL++EL   +++CGL++L         S 
Sbjct  538   EVALGAAKALEYLHENCQPSFVHQNFGPANLLLNDELAVCVTECGLSSLMSTNSVMQLSG  597

Query  1924  HVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQ  2103
              +   + Y APE   SG +T +SDVYSFGVVMLELLTGRKP DS+R  SEQ LVRWA+ Q
Sbjct  598   RMRAMYNYEAPEVNESGKFTDRSDVYSFGVVMLELLTGRKPYDSARPHSEQHLVRWASSQ  657

Query  2104  LHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLV  2271
             L+DI+ALSKMVDP ++G YP KSLS FADII+ C+Q EPEFRPP+SEVV  L+R+V
Sbjct  658   LYDINALSKMVDPLISGSYPEKSLSCFADIISRCIQQEPEFRPPISEVVHDLIRMV  713



>gb|ACN58180.1| leucine-rich repeat protein [Dasypyrum villosum]
Length=260

 Score =   462 bits (1190),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 219/258 (85%), Positives = 237/258 (92%), Gaps = 1/258 (0%)
 Frame = +1

Query  1585  SRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTA  1764
             SRLRHPNIVPL GYC EH QRLLVY+YIGN +LHDMLHF+DE S+ LTWN RVR+ALGTA
Sbjct  1     SRLRHPNIVPLTGYCVEHAQRLLVYEYIGNATLHDMLHFSDEMSRRLTWNIRVRIALGTA  60

Query  1765  RALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFG  1944
             RALEYLHEVCLPSVVHRNFKSANILLDEE N HLSDCGLAALTPNTERQ+S T VVGSFG
Sbjct  61    RALEYLHEVCLPSVVHRNFKSANILLDEEHNAHLSDCGLAALTPNTERQVS-TEVVGSFG  119

Query  1945  YSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDAL  2124
             YSAPEF++SG+YTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDAL
Sbjct  120   YSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDAL  179

Query  2125  SKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYS  2304
             SKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ LVRL+QRAS+V R+  
Sbjct  180   SKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSG  239

Query  2305  DESGFAYKTPDHDAASGD  2358
             +E GF+Y+ P+ +  + D
Sbjct  240   EELGFSYRAPEREGDARD  257



>gb|ABQ53156.1| leucine-rich repeat protein [Triticum aestivum]
Length=263

 Score =   462 bits (1188),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 219/260 (84%), Positives = 239/260 (92%), Gaps = 1/260 (0%)
 Frame = +1

Query  1579  NMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALG  1758
             ++SRLRHPNIVPL GYC EH QRLLVY+YIGN +LHD+LHF+DE S+ LTWN RVRVALG
Sbjct  2     DLSRLRHPNIVPLTGYCVEHAQRLLVYEYIGNATLHDVLHFSDEMSRRLTWNIRVRVALG  61

Query  1759  TARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGS  1938
             TARALEYLHEVCLPSVVHRNFKSANILLDEE N HLSDCGLAALTPNTERQ+S T VVGS
Sbjct  62    TARALEYLHEVCLPSVVHRNFKSANILLDEEHNAHLSDCGLAALTPNTERQVS-TEVVGS  120

Query  1939  FGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDID  2118
             FGYSAPEF++SG+YTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDID
Sbjct  121   FGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDID  180

Query  2119  ALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRR  2298
             ALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ LVRL+QRAS+V R+
Sbjct  181   ALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQ  240

Query  2299  YSDESGFAYKTPDHDAASGD  2358
               +E GF+Y+ P+ +  + D
Sbjct  241   SGEELGFSYRAPEREGDTRD  260



>ref|XP_008775327.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3 isoform X3 [Phoenix 
dactylifera]
Length=710

 Score =   478 bits (1230),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 293/703 (42%), Positives = 402/703 (57%), Gaps = 67/703 (10%)
 Frame = +1

Query  274   LGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIP  453
             + F    T+  D+ A+  LY +L SP  L GW AS GDPC E W+GV C  S + +I + 
Sbjct  25    MPFSQGYTNEKDVYAINNLYTALGSPP-LPGWVASAGDPCFEVWQGVQCVESNITAIVLN  83

Query  454   GLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISL  633
                L G +G  L  FTS+  +DLS+N I   IP  LP  +    L+ N  TGSIP S+S 
Sbjct  84    DANLGGELGDKLANFTSITTIDLSNNHIGGNIPENLPRTMMQFFLSANQFTGSIPDSLSE  143

Query  634   MTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNN  813
             +T L                        + +DLS NN +G LP S+  LS+L+ L +QNN
Sbjct  144   LTLL------------------------SDMDLSSNNLTGQLPPSMQNLSSLTALHLQNN  179

Query  814   QLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSNSpapppppftppp  993
             QL+G+L+VL DLPL DLN+ NN FSG IP +L+SIP F+  GN F+ S AP P     P 
Sbjct  180   QLSGTLDVLQDLPLKDLNIENNLFSGPIPEKLLSIPNFKKDGNPFNTSSAPSPMITPSPL  239

Query  994   pgrpHKRTNHSTPGSHKTPG-SDDNHSDHEngngngkngVKAGAivgivlgssavvlsai  1170
                     +   P     P  S +  S H+N     +  V    I+G  + +  V++ A+
Sbjct  240   -------PHSGAPSPETMPSNSSEGPSIHDNETPRKEKKVSVVRIIGYAVVAVIVLIMAV  292

Query  1171  vvivYCL--RRCKKK---------EFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLK--  1311
             ++ ++C+  RR +K+         E  A        ++ D    D+ A     V D K  
Sbjct  293   LLFMFCISKRRGRKQKHEEIPKRLEIRAHGKPKEPQINADLNEPDKEAGKVPIVADEKQD  352

Query  1312  --------------PPPSEKVTIERMQGKNGSLRRSPITATP------YTVAVLQTATNS  1431
                           PP  +KV +        + R  P    P      Y+ A LQ  T+S
Sbjct  353   EVKINMAGPGALALPPLVDKVIVNPSASSKKNPRTCPENLNPPAPVKSYSAASLQQYTDS  412

Query  1432  FSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIV  1611
             FS+E+L+ +G LGR+Y A+ P GK+LA+ K+D+   ++Q +D FLE + ++S LRHPNI+
Sbjct  413   FSEESLINDGCLGRIYLAEPPEGKLLAVLKLDNMNSNIQLDD-FLELVLSISELRHPNIL  471

Query  1612  PLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEV  1791
              LVGYCAE GQ LLVY+Y  + +LHD+LH  D+    L+W AR+++A   A+ALEYLHE 
Sbjct  472   ELVGYCAEFGQCLLVYNYFSSKTLHDILHSEDDHKIRLSWRARIQIAFEAAKALEYLHES  531

Query  1792  CLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALS  1971
             C P V+H+NF+ +NI LD++L   + +CGLA L  +      S  +   F Y APEF  S
Sbjct  532   CQPPVIHQNFEPSNIFLDDDLAVRVFECGLAPLMSSNSVTQLSGRIHALFSYEAPEFGES  591

Query  1972  GVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALN  2151
             G ++ +SDVYSFGVVMLELLTGRKP D SR R+EQ LVRWA+ QLHDI+ LS+MVDP+++
Sbjct  592   GSHSEQSDVYSFGVVMLELLTGRKPYDRSRPRAEQHLVRWASSQLHDINTLSRMVDPSID  651

Query  2152  GMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRA  2280
             G Y  KSLSRFADII+ C+Q  PEFRP MSEVVQ L R+++ A
Sbjct  652   GKYSVKSLSRFADIISRCIQRGPEFRPSMSEVVQDLARVIEDA  694



>emb|CBI35784.3| unnamed protein product [Vitis vinifera]
Length=708

 Score =   477 bits (1227),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 231/345 (67%), Positives = 279/345 (81%), Gaps = 9/345 (3%)
 Frame = +1

Query  1300  VDLKPPPSEK---VTIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEG  1461
             ++L+PPP ++      E +  K    +++   PI A  Y++A LQ AT SFS ENL+GEG
Sbjct  352   INLRPPPIDRHKSFDEEDLPKKPIITKKANTAPINAISYSIADLQMATGSFSVENLIGEG  411

Query  1462  SLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHG  1641
             S GRVY+A F +GKV+A+KK+DS+AL  Q  ++F E +SN+S+L HPN+  LVGYC+EHG
Sbjct  412   SFGRVYQAQFDDGKVVAVKKIDSSALPDQFSEDFTEIVSNISQLHHPNVTELVGYCSEHG  471

Query  1642  QRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNF  1821
             Q LLVY++  NGSLHD LH +DE S+ LTWN RV++ALGTARALEYLHEVC PS+VH+NF
Sbjct  472   QHLLVYEFHKNGSLHDFLHLSDEYSKPLTWNTRVKIALGTARALEYLHEVCSPSIVHKNF  531

Query  1822  KSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVY  2001
             KSANILLD ELNPHL+DCGLA+  PN ++ ++  H  GS GYSAPE A+SG YT+KSDVY
Sbjct  532   KSANILLDTELNPHLTDCGLASFIPNADQVLN--HNAGS-GYSAPEVAMSGQYTLKSDVY  588

Query  2002  SFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSR  2181
             SFGVVMLELL+GRKP DSSR RSEQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSR
Sbjct  589   SFGVVMLELLSGRKPFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSR  648

Query  2182  FADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             FAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R  S+E G
Sbjct  649   FADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTISNEQG  693


 Score =   265 bits (678),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 165/237 (70%), Gaps = 1/237 (0%)
 Frame = +1

Query  241  VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
            ++++I  L     F+  ATDP D  AL V++ SLNSPSQL+ W ++GGDPCGESW+G+TC
Sbjct  1    MLVLICVLRWGPSFINGATDPQDASALRVMFSSLNSPSQLAKWSSNGGDPCGESWQGITC  60

Query  421  QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
            +GS V  IE+ GL L G+MGY L   TS+  LD+S+N + + IPYQLPPNL  LNLA N 
Sbjct  61   KGSRVTEIELSGLRLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLPPNLQRLNLAGNG  120

Query  601  ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
              G IPYSISLM SL YLN S N L   +GDMF+  S LTTLD S N+ +GDLP S   L
Sbjct  121  FNGGIPYSISLMISLKYLNISHNQLQGQLGDMFSQLSSLTTLDFSLNSLTGDLPESFSSL  180

Query  781  SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            S+++ + +QNNQ TGS+NVL  LPL  LNVANN F+GWIP  L +I   +  GNS+S
Sbjct  181  SSITTMFLQNNQFTGSINVLASLPLETLNVANNHFTGWIPESLKNI-NLQKDGNSWS  236



>ref|XP_008775325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008775326.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3 isoform X2 [Phoenix 
dactylifera]
Length=711

 Score =   477 bits (1227),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 285/667 (43%), Positives = 394/667 (59%), Gaps = 42/667 (6%)
 Frame = +1

Query  382   GDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQL  561
             GDPC E W+GV C  S + +I +    L G +G  L  FTS+  +DLS+N I   IP  L
Sbjct  37    GDPCFEVWQGVQCVESNITAIVLNDANLGGELGDKLANFTSITTIDLSNNHIGGNIPENL  96

Query  562   PPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFN  741
             P  +    L+ N  TGSIP S+S +T L+ ++ + N L   + D F + + L  LDLS N
Sbjct  97    PRTMMQFFLSANQFTGSIPDSLSELTLLSDMSVNQNLLTGELPDAFQSLTGLINLDLSSN  156

Query  742   NFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIP  921
             N +G LP S+  LS+L+ L +QNNQL+G+L+VL DLPL DLN+ NN FSG IP +L+SIP
Sbjct  157   NLTGQLPPSMQNLSSLTALHLQNNQLSGTLDVLQDLPLKDLNIENNLFSGPIPEKLLSIP  216

Query  922   KFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSHKTPG-SDDNHSDHEngngng  1098
              F+  GN F+ S AP P     P         +   P     P  S +  S H+N     
Sbjct  217   NFKKDGNPFNTSSAPSPMITPSPL-------PHSGAPSPETMPSNSSEGPSIHDNETPRK  269

Query  1099  kngVKAGAivgivlgssavvlsaivvivYCL--RRCKKK---------EFAARTSTGSLP  1245
             +  V    I+G  + +  V++ A+++ ++C+  RR +K+         E  A        
Sbjct  270   EKKVSVVRIIGYAVVAVIVLIMAVLLFMFCISKRRGRKQKHEEIPKRLEIRAHGKPKEPQ  329

Query  1246  LSTDKEVLDQRAKSTATVVDLK----------------PPPSEKVTIERMQGKNGSLRRS  1377
             ++ D    D+ A     V D K                PP  +KV +        + R  
Sbjct  330   INADLNEPDKEAGKVPIVADEKQDEVKINMAGPGALALPPLVDKVIVNPSASSKKNPRTC  389

Query  1378  PITATP------YTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAAL  1539
             P    P      Y+ A LQ  T+SFS+E+L+ +G LGR+Y A+ P GK+LA+ K+D+   
Sbjct  390   PENLNPPAPVKSYSAASLQQYTDSFSEESLINDGCLGRIYLAEPPEGKLLAVLKLDNMNS  449

Query  1540  SLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQ  1719
             ++Q +D FLE + ++S LRHPNI+ LVGYCAE GQ LLVY+Y  + +LHD+LH  D+   
Sbjct  450   NIQLDD-FLELVLSISELRHPNILELVGYCAEFGQCLLVYNYFSSKTLHDILHSEDDHKI  508

Query  1720  LLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPN  1899
              L+W AR+++A   A+ALEYLHE C P V+H+NF+ +NI LD++L   + +CGLA L  +
Sbjct  509   RLSWRARIQIAFEAAKALEYLHESCQPPVIHQNFEPSNIFLDDDLAVRVFECGLAPLMSS  568

Query  1900  TERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQS  2079
                   S  +   F Y APEF  SG ++ +SDVYSFGVVMLELLTGRKP D SR R+EQ 
Sbjct  569   NSVTQLSGRIHALFSYEAPEFGESGSHSEQSDVYSFGVVMLELLTGRKPYDRSRPRAEQH  628

Query  2080  LVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQAL  2259
             LVRWA+ QLHDI+ LS+MVDP+++G Y  KSLSRFADII+ C+Q  PEFRP MSEVVQ L
Sbjct  629   LVRWASSQLHDINTLSRMVDPSIDGKYSVKSLSRFADIISRCIQRGPEFRPSMSEVVQDL  688

Query  2260  VRLVQRA  2280
              R+++ A
Sbjct  689   ARVIEDA  695



>ref|XP_010654359.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Vitis vinifera]
Length=714

 Score =   477 bits (1227),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 231/345 (67%), Positives = 279/345 (81%), Gaps = 9/345 (3%)
 Frame = +1

Query  1300  VDLKPPPSEK---VTIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEG  1461
             ++L+PPP ++      E +  K    +++   PI A  Y++A LQ AT SFS ENL+GEG
Sbjct  358   INLRPPPIDRHKSFDEEDLPKKPIITKKANTAPINAISYSIADLQMATGSFSVENLIGEG  417

Query  1462  SLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHG  1641
             S GRVY+A F +GKV+A+KK+DS+AL  Q  ++F E +SN+S+L HPN+  LVGYC+EHG
Sbjct  418   SFGRVYQAQFDDGKVVAVKKIDSSALPDQFSEDFTEIVSNISQLHHPNVTELVGYCSEHG  477

Query  1642  QRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNF  1821
             Q LLVY++  NGSLHD LH +DE S+ LTWN RV++ALGTARALEYLHEVC PS+VH+NF
Sbjct  478   QHLLVYEFHKNGSLHDFLHLSDEYSKPLTWNTRVKIALGTARALEYLHEVCSPSIVHKNF  537

Query  1822  KSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVY  2001
             KSANILLD ELNPHL+DCGLA+  PN ++ ++  H  GS GYSAPE A+SG YT+KSDVY
Sbjct  538   KSANILLDTELNPHLTDCGLASFIPNADQVLN--HNAGS-GYSAPEVAMSGQYTLKSDVY  594

Query  2002  SFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSR  2181
             SFGVVMLELL+GRKP DSSR RSEQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSR
Sbjct  595   SFGVVMLELLSGRKPFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSR  654

Query  2182  FADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             FAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R  S+E G
Sbjct  655   FADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTISNEQG  699


 Score =   265 bits (678),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 165/237 (70%), Gaps = 1/237 (0%)
 Frame = +1

Query  241  VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
            ++++I  L     F+  ATDP D  AL V++ SLNSPSQL+ W ++GGDPCGESW+G+TC
Sbjct  7    MLVLICVLRWGPSFINGATDPQDASALRVMFSSLNSPSQLAKWSSNGGDPCGESWQGITC  66

Query  421  QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
            +GS V  IE+ GL L G+MGY L   TS+  LD+S+N + + IPYQLPPNL  LNLA N 
Sbjct  67   KGSRVTEIELSGLRLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLPPNLQRLNLAGNG  126

Query  601  ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
              G IPYSISLM SL YLN S N L   +GDMF+  S LTTLD S N+ +GDLP S   L
Sbjct  127  FNGGIPYSISLMISLKYLNISHNQLQGQLGDMFSQLSSLTTLDFSLNSLTGDLPESFSSL  186

Query  781  SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            S+++ + +QNNQ TGS+NVL  LPL  LNVANN F+GWIP  L +I   +  GNS+S
Sbjct  187  SSITTMFLQNNQFTGSINVLASLPLETLNVANNHFTGWIPESLKNI-NLQKDGNSWS  242



>ref|XP_002979973.1| hypothetical protein SELMODRAFT_112070 [Selaginella moellendorffii]
 ref|XP_002991949.1| hypothetical protein SELMODRAFT_186440 [Selaginella moellendorffii]
 gb|EFJ07060.1| hypothetical protein SELMODRAFT_186440 [Selaginella moellendorffii]
 gb|EFJ18843.1| hypothetical protein SELMODRAFT_112070 [Selaginella moellendorffii]
Length=343

 Score =   462 bits (1188),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 228/331 (69%), Positives = 273/331 (82%), Gaps = 7/331 (2%)
 Frame = +1

Query  1351  GKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDS  1530
             GK   L+   I     ++A LQ ATNSFSQENLVGEG+LGRVYRA+  + K++A+KK+D+
Sbjct  9     GKASKLQ---IAVPAISIAELQAATNSFSQENLVGEGALGRVYRAEI-DDKIVAVKKLDT  64

Query  1531  AALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADE  1710
             +A  +Q ED F++ +SN++RLRH NI  LVGYC EH QRLLVYD++  G+L ++LH +DE
Sbjct  65    SAPMVQNEDEFIKVVSNLARLRHSNITELVGYCTEHSQRLLVYDFVEYGTLFEVLHCSDE  124

Query  1711  RSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAAL  1890
              S+ L+WN RV++ALG ARALEYLHEV  P++VHRNFKS NILLDEELNP +SDCGLAAL
Sbjct  125   SSRRLSWNQRVKIALGAARALEYLHEVYHPAIVHRNFKSVNILLDEELNPRVSDCGLAAL  184

Query  1891  TP-NTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRER  2067
              P   ERQ+SS  +V SFGYSAPEFA+SGVYTVKSDVYSFGVVMLELLTGRK LDSSR R
Sbjct  185   APYGAERQVSSQMLV-SFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLTGRKSLDSSRSR  243

Query  2068  SEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEV  2247
             +EQSLVRWA PQLHDIDALS+MVDPAL G+YPAKSLSRFADII+ CVQPEPEFRPPMSEV
Sbjct  244   AEQSLVRWAVPQLHDIDALSRMVDPALKGIYPAKSLSRFADIISSCVQPEPEFRPPMSEV  303

Query  2248  VQALVRLVQRASVVIRRYS-DESGFAYKTPD  2337
             VQALVRL+QRAS+  RR + D+ G + ++ D
Sbjct  304   VQALVRLMQRASLSKRRLTADDLGSSQRSLD  334



>ref|XP_010273793.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nelumbo nucifera]
Length=725

 Score =   475 bits (1223),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 236/358 (66%), Positives = 283/358 (79%), Gaps = 10/358 (3%)
 Frame = +1

Query  1288  TATVVDLKPPPSEK---VTIERMQGKNGSLRR---SPITATPYTVAVLQTATNSFSQENL  1449
             T+T ++LKPPP ++      +    K   +++    PI+AT Y+VA LQ AT SFS ENL
Sbjct  366   TSTPINLKPPPIDRHKSFDDDDFSNKPVIVKKGNTDPISATVYSVADLQMATGSFSIENL  425

Query  1450  VGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYC  1629
             +GEGS+GRVYRA F +G+VLA+KK+DS+ L  Q  ++F+E +SN+SRL HPN+  LVGYC
Sbjct  426   IGEGSIGRVYRAQFDDGRVLAVKKIDSSVLPNQSSEDFIEVVSNISRLHHPNVTELVGYC  485

Query  1630  AEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVV  1809
             +EHGQ LLVY++  NGSLHD LH +DE S+ LTWN RV++ALG ARALEYLHEVC PS+V
Sbjct  486   SEHGQHLLVYEFHRNGSLHDFLHLSDEYSKPLTWNTRVKIALGAARALEYLHEVCSPSIV  545

Query  1810  HRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVK  1989
              +NFKS NILLD ELNPHLSDCGLA+   N ++ ++  H  GS GY APE A+SG YT+K
Sbjct  546   LKNFKSVNILLDIELNPHLSDCGLASFI-NADQALN--HNAGS-GYDAPEVAMSGQYTLK  601

Query  1990  SDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAK  2169
             SDVYSFGVVMLELLTGRKP DSSR+RSEQSLVRWATPQLHDIDAL KMVDPAL G+YPAK
Sbjct  602   SDVYSFGVVMLELLTGRKPFDSSRQRSEQSLVRWATPQLHDIDALDKMVDPALKGLYPAK  661

Query  2170  SLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             SLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRA++  R   DE G + +  + D
Sbjct  662   SLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTTGDEQGGSRRADEPD  719


 Score =   252 bits (643),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 163/225 (72%), Gaps = 0/225 (0%)
 Frame = +1

Query  277  GFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPG  456
            GFV  AT+  D  AL ++Y SLNS +QL+GW ++GGDPCG SWKG+TC G AV  I++ G
Sbjct  29   GFVNGATNETDASALRIMYSSLNSAAQLTGWSSAGGDPCGNSWKGITCSGQAVTEIKLSG  88

Query  457  LGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLM  636
            LGL G+MGY L+  TSL  LD+S+N + + IPYQLPPN+  LNLA N+  G IPYSIS M
Sbjct  89   LGLTGSMGYQLSSLTSLTTLDISNNFLGNQIPYQLPPNVQQLNLAGNSFNGGIPYSISQM  148

Query  637  TSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQ  816
            TSL YLN S N L   + DMF   S LTTLDLSFN+F+G+LP S   LS+L+ + ++NNQ
Sbjct  149  TSLKYLNISHNQLQGQLNDMFGQLSALTTLDLSFNSFTGNLPESFSSLSSLNTMYLENNQ  208

Query  817  LTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
             TG ++VL +LPL +LNVANN F+GWIP +L +I   +  GNS++
Sbjct  209  FTGPIDVLANLPLDNLNVANNHFNGWIPEQLKNIKNLQTQGNSWN  253



>ref|XP_008783422.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Phoenix 
dactylifera]
Length=724

 Score =   473 bits (1216),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 239/384 (62%), Positives = 293/384 (76%), Gaps = 20/384 (5%)
 Frame = +1

Query  1192  RRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVD-----------LKPPPSEK-VT  1335
             +R  +KE   +    + PL+  KEV + ++  T++ +D           LKPPP ++  +
Sbjct  323   QRSSRKEILEQDQPFT-PLAP-KEVREMKSIQTSSAIDAATFPSSAPISLKPPPIDRHKS  380

Query  1336  IERMQGKNGSLRR----SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGK  1503
              +     N  + +    +PI AT Y+VA LQ AT+SFS ENL+GEGS GRVYRA F +GK
Sbjct  381   FDEDDFSNKPVVKKANTAPIKATVYSVADLQMATDSFSIENLIGEGSFGRVYRAQFSDGK  440

Query  1504  VLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSL  1683
             VLA+KK++S+AL  Q   +F+E +SN+SRL HPN+  LVGYC+EHGQ LLVY++  NGSL
Sbjct  441   VLAVKKINSSALPNQSAGDFIELVSNISRLHHPNLTELVGYCSEHGQYLLVYEFHKNGSL  500

Query  1684  HDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPH  1863
             HD+LH +DE S+ L+W+ RV++ALG ARALEYLHEVC PSVVH+NFKS+NILLD ELNPH
Sbjct  501   HDLLHLSDEYSKPLSWSTRVKIALGAARALEYLHEVCSPSVVHKNFKSSNILLDTELNPH  560

Query  1864  LSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRK  2043
             LSDCGLA L P+ E Q S  ++  S GY APE A+SG YT+KSDVYSFGVVMLELLTGR 
Sbjct  561   LSDCGLANLIPDAEFQASDQNM--SSGYGAPEVAMSGQYTLKSDVYSFGVVMLELLTGRM  618

Query  2044  PLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPE  2223
             P DSSR R+EQSLVRWATPQLHDIDAL +MVDPAL G+YPAKSLSRFAD+IALCVQPEPE
Sbjct  619   PFDSSRSRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPE  678

Query  2224  FRPPMSEVVQALVRLVQRASVVIR  2295
             FRPPMSEVVQALVRLVQRA++  R
Sbjct  679   FRPPMSEVVQALVRLVQRANMSKR  702


 Score =   226 bits (577),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 167/238 (70%), Gaps = 2/238 (1%)
 Frame = +1

Query  244  VLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQ  423
            +L++   I    FV   T  +D+ AL VLY SLNSPSQL+GW ++ GDPCG+SW GVTC 
Sbjct  16   LLLVCIWIWNASFVNGDTKSDDVSALNVLYSSLNSPSQLTGWTSNAGDPCGQSWLGVTCS  75

Query  424  GSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIH--DLIPYQLPPNLTSLNLANN  597
            G AV +I++ GLGL+G++GY ++G TSL ELD+S+N +     IPY LPPNL  LNLA N
Sbjct  76   GQAVTTIKLSGLGLSGSLGYQMSGMTSLTELDMSNNNLGGGQQIPYNLPPNLEKLNLAGN  135

Query  598  NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
              TG++PYSIS M  L YLN S N L   + DMF   ++LTT+DLS N  +GDLP S   
Sbjct  136  QFTGNVPYSISQMIPLKYLNLSHNQLQGNLSDMFGQLTNLTTMDLSSNALTGDLPQSFSS  195

Query  778  LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            LS+L+ L +QNNQ TGS++VL  LPL DLNVANNRF+GWIP++L  I   +  GNS+S
Sbjct  196  LSSLTTLHLQNNQFTGSIDVLASLPLNDLNVANNRFTGWIPDKLRGINNLQTGGNSWS  253



>ref|XP_008783430.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Phoenix 
dactylifera]
Length=700

 Score =   471 bits (1213),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 239/384 (62%), Positives = 293/384 (76%), Gaps = 20/384 (5%)
 Frame = +1

Query  1192  RRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVD-----------LKPPPSEK-VT  1335
             +R  +KE   +    + PL+  KEV + ++  T++ +D           LKPPP ++  +
Sbjct  299   QRSSRKEILEQDQPFT-PLAP-KEVREMKSIQTSSAIDAATFPSSAPISLKPPPIDRHKS  356

Query  1336  IERMQGKNGSLRR----SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGK  1503
              +     N  + +    +PI AT Y+VA LQ AT+SFS ENL+GEGS GRVYRA F +GK
Sbjct  357   FDEDDFSNKPVVKKANTAPIKATVYSVADLQMATDSFSIENLIGEGSFGRVYRAQFSDGK  416

Query  1504  VLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSL  1683
             VLA+KK++S+AL  Q   +F+E +SN+SRL HPN+  LVGYC+EHGQ LLVY++  NGSL
Sbjct  417   VLAVKKINSSALPNQSAGDFIELVSNISRLHHPNLTELVGYCSEHGQYLLVYEFHKNGSL  476

Query  1684  HDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPH  1863
             HD+LH +DE S+ L+W+ RV++ALG ARALEYLHEVC PSVVH+NFKS+NILLD ELNPH
Sbjct  477   HDLLHLSDEYSKPLSWSTRVKIALGAARALEYLHEVCSPSVVHKNFKSSNILLDTELNPH  536

Query  1864  LSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRK  2043
             LSDCGLA L P+ E Q S  ++  S GY APE A+SG YT+KSDVYSFGVVMLELLTGR 
Sbjct  537   LSDCGLANLIPDAEFQASDQNM--SSGYGAPEVAMSGQYTLKSDVYSFGVVMLELLTGRM  594

Query  2044  PLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPE  2223
             P DSSR R+EQSLVRWATPQLHDIDAL +MVDPAL G+YPAKSLSRFAD+IALCVQPEPE
Sbjct  595   PFDSSRSRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPE  654

Query  2224  FRPPMSEVVQALVRLVQRASVVIR  2295
             FRPPMSEVVQALVRLVQRA++  R
Sbjct  655   FRPPMSEVVQALVRLVQRANMSKR  678


 Score =   196 bits (497),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 154/239 (64%), Gaps = 26/239 (11%)
 Frame = +1

Query  244  VLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQ  423
            +L++   I    FV   T  +D+ AL VLY SLNSPSQL+GW ++ GDPCG+SW GVTC 
Sbjct  16   LLLVCIWIWNASFVNGDTKSDDVSALNVLYSSLNSPSQLTGWTSNAGDPCGQSWLGVTCS  75

Query  424  GSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEI--HDLIPYQLPPNLTSLNLANN  597
            G AV +I++ GLGL+G++GY ++G TSL ELD+S+N +     IPY LPPNL  LNLA N
Sbjct  76   GQAVTTIKLSGLGLSGSLGYQMSGMTSLTELDMSNNNLGGGQQIPYNLPPNLEKLNLAGN  135

Query  598  NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
              TG++PYSIS M  L Y                        LDLS N  +GDLP S   
Sbjct  136  QFTGNVPYSISQMIPLKY------------------------LDLSSNALTGDLPQSFSS  171

Query  778  LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN  954
            LS+L+ L +QNNQ TGS++VL  LPL DLNVANNRF+GWIP++L  I   +  GNS+S+
Sbjct  172  LSSLTTLHLQNNQFTGSIDVLASLPLNDLNVANNRFTGWIPDKLRGINNLQTGGNSWSS  230



>ref|XP_001780717.1| predicted protein [Physcomitrella patens]
 gb|EDQ54501.1| predicted protein, partial [Physcomitrella patens]
Length=316

 Score =   455 bits (1170),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 210/300 (70%), Positives = 255/300 (85%), Gaps = 4/300 (1%)
 Frame = +1

Query  1396  YTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAI  1575
             ++VA LQ ATNSFSQ+NL+GEG++G VYRA+ P+G+ LA+KK++S A  +Q ED+FL  +
Sbjct  1     FSVADLQAATNSFSQDNLIGEGNMGEVYRAESPDGQFLAVKKLNSNACMVQHEDDFLRVV  60

Query  1576  SNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVAL  1755
               ++RL+H + V LVGYCAEH QRLLVY+Y G GSLHD LHF++E S+ L+WN R+++AL
Sbjct  61    EGLARLQHSSAVALVGYCAEHDQRLLVYEYFGRGSLHDKLHFSNENSKGLSWNVRIKIAL  120

Query  1756  GTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVG  1935
             G+ARAL+YLHEVC P VVHRNF SANILLD+ELNPH+SDCGLA L  +     S + +  
Sbjct  121   GSARALKYLHEVCAPPVVHRNFSSANILLDDELNPHISDCGLAILASSG----SESELTT  176

Query  1936  SFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDI  2115
             SFGYSAPE+A+ G YTVKSD+YSFGVVMLELLTGRKP DS+R RSEQSLVRWATPQLHDI
Sbjct  177   SFGYSAPEYAMFGTYTVKSDIYSFGVVMLELLTGRKPFDSTRPRSEQSLVRWATPQLHDI  236

Query  2116  DALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIR  2295
             DAL++MVDPAL GMYPAKSLSRFAD++ALCVQPEPEFRPPMSEVVQ+LVRL+QRAS+  R
Sbjct  237   DALARMVDPALKGMYPAKSLSRFADVVALCVQPEPEFRPPMSEVVQSLVRLIQRASMSKR  296



>ref|NP_001241934.1| protein STRUBBELIG-RECEPTOR FAMILY 6-like [Glycine max]
 gb|ACM89564.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
Length=603

 Score =   464 bits (1195),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 309/703 (44%), Positives = 396/703 (56%), Gaps = 131/703 (19%)
 Frame = +1

Query  340   LNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELD  519
             +NSPSQL+ W  +G DPCG+SW+G+TC G+ V                            
Sbjct  1     MNSPSQLN-W--NGDDPCGQSWQGITCSGNRV----------------------------  29

Query  520   LSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMF  699
                               T + L   +++GS+ Y +  ++S+  L F           M+
Sbjct  30    ------------------TEIKLPGRSLSGSLGYQLEPLSSVTNLQFY----------MY  61

Query  700   TNRS-DLTTL--DLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNV  870
                S DL     DLS NN  G +P                 QL  +L  L        N+
Sbjct  62    CYYSYDLVKFCRDLSNNNIGGTIPY----------------QLPPNLQYL--------NL  97

Query  871   ANNRFSGWIP---NELISIPKFEYSGNSFSNSpapppppftppppgrpHKRTNHSTPGSH  1041
             ANN F+G IP   +E  S+   +  GN +S+ PAPPPPP TPP      +  NH + G  
Sbjct  98    ANNNFNGAIPYSLSEKTSLVILK-DGNEWSSGPAPPPPPGTPPVVS---RNRNHKSGG--  151

Query  1042  KTPGSDDNHSDHEngngngkngVKAGAivgivlgssavvlsaivvivYCLRRCKKKEFAA  1221
                     HS  + G+ +G          GI     ++++   +V  + ++R  KK F  
Sbjct  152   --------HSPSDAGSSDGGGKKSGIGGGGIAGIVISILVVGAIVAFFLVKRRSKKSFND  203

Query  1222  RTSTGSLPLSTDKEVLDQRAKSTATVVD------------LKPPP------------SEK  1329
                  + PL+   EV +  +  T++V D            LKPPP            S K
Sbjct  204   VEKLDNQPLAQ-HEVHEMNSMQTSSVTDFKTFDTSAAPISLKPPPFDRRKSFDEDEFSNK  262

Query  1330  VTIERMQGKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVL  1509
               I     K      +P     Y++A LQ AT SFS E L+GEGS GRVYRA F +GKVL
Sbjct  263   PVIVNKPTKVKKTVTAPANVKSYSIADLQIATGSFSVEQLLGEGSFGRVYRAQFDDGKVL  322

Query  1510  AIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHD  1689
             A+KK+DS+ L     D+F+E +SN+S+L  PN+  LVGYC+EHGQ LLVY++  NGSLHD
Sbjct  323   AVKKIDSSVLPNDMSDDFVELVSNISQLHDPNVTELVGYCSEHGQHLLVYEFHKNGSLHD  382

Query  1690  MLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLS  1869
              LH  DE S+ L WN+RV++ALG ARALEYLHEVC PSVVH+N KSANILLD + NPHLS
Sbjct  383   FLHLPDECSKPLIWNSRVKIALGIARALEYLHEVCSPSVVHKNIKSANILLDTDFNPHLS  442

Query  1870  DCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPL  2049
             D GLA+  PN  + +++    GS GY APE  LSG YT+KSDVYSFGVVMLELL+GRKP 
Sbjct  443   DSGLASYIPNANQVLNNN--AGS-GYEAPEVGLSGHYTLKSDVYSFGVVMLELLSGRKPF  499

Query  2050  DSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFR  2229
             DSSR RSEQ+LVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPEPEFR
Sbjct  500   DSSRPRSEQALVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFR  559

Query  2230  PPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASGD  2358
             PPMSEVVQALVRLVQR ++  R +  + G + +  D +  + D
Sbjct  560   PPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDNQDTQD  602



>emb|CAN80221.1| hypothetical protein VITISV_027894 [Vitis vinifera]
Length=672

 Score =   465 bits (1196),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 231/366 (63%), Positives = 279/366 (76%), Gaps = 30/366 (8%)
 Frame = +1

Query  1300  VDLKPPPSEK---VTIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEG  1461
             ++L+PPP ++      E +  K    +++   PI A  Y++A LQ AT SFS ENL+GEG
Sbjct  295   INLRPPPIDRHKSFDEEDLPKKPIITKKANTAPINAISYSIADLQMATGSFSVENLIGEG  354

Query  1462  SLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHG  1641
             S GRVY+A F +GKV+A+KK+DS+AL  Q  ++F E +SN+S+L HPN+  LVGYC+EHG
Sbjct  355   SFGRVYQAQFDDGKVVAVKKIDSSALPDQFSEDFTEIVSNISQLHHPNVTELVGYCSEHG  414

Query  1642  QRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNF  1821
             Q LLVY++  NGSLHD LH +DE S+ LTWN RV++ALGTARALEYLHEVC PS+VH+NF
Sbjct  415   QHLLVYEFHKNGSLHDFLHLSDEYSKPLTWNTRVKIALGTARALEYLHEVCSPSIVHKNF  474

Query  1822  KSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVY  2001
             KSANILLD ELNPHL+DCGLA+  PN ++ ++  H  GS GYSAPE A+SG YT+KSDVY
Sbjct  475   KSANILLDTELNPHLTDCGLASFIPNADQVLN--HNAGS-GYSAPEVAMSGQYTLKSDVY  531

Query  2002  SFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSR  2181
             SFGVVMLELL+GRKP DSSR RSEQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSR
Sbjct  532   SFGVVMLELLSGRKPFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSR  591

Query  2182  FADIIALCVQ---------------------PEPEFRPPMSEVVQALVRLVQRASVVIRR  2298
             FAD+IALCVQ                     PEPEFRPPMSEVVQALVRLVQRA++  R 
Sbjct  592   FADVIALCVQVRCLVKVKSADGFIILFQLLMPEPEFRPPMSEVVQALVRLVQRANMSKRT  651

Query  2299  YSDESG  2316
              S+E G
Sbjct  652   ISNEQG  657


 Score =   179 bits (454),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 124/213 (58%), Gaps = 47/213 (22%)
 Frame = +1

Query  316  ALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNG  495
            AL V++ SLNSPSQL+ W ++GGDPCGESW+G+TC+GS V  IE+ GL L G+MGY L  
Sbjct  15   ALRVMFSSLNSPSQLAKWSSNGGDPCGESWQGITCKGSRVTEIELSGLRLTGSMGYQLTS  74

Query  496  FTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSL  675
             TS                      + +LNLA N   G IPYSISLM SL YL+FS NSL
Sbjct  75   LTS----------------------VVNLNLAGNGFNGGIPYSISLMISLKYLDFSLNSL  112

Query  676  AQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPL  855
                                    +GDLP S   LS+++ + +QNNQ TGS+NVL  LPL
Sbjct  113  ------------------------TGDLPESFSSLSSITTMFLQNNQFTGSINVLASLPL  148

Query  856  TDLNVANNRFSGWIPNELISIPKFEYSGNSFSN  954
              LNVANN F+GWIP  L +I   +  GNS+S+
Sbjct  149  ETLNVANNHFTGWIPESLKNI-NLQKDGNSWSS  180



>gb|AAC27894.1| leucine-rich repeat transmembrane protein kinase 1 [Zea mays]
Length=684

 Score =   463 bits (1192),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 234/392 (60%), Positives = 280/392 (71%), Gaps = 37/392 (9%)
 Frame = +1

Query  1192  RRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVD-----------LKPPPSEKVTI  1338
             +   K+ F       S P     EV D +    AT VD           LKPPP     I
Sbjct  288   KAAMKEHFEQHQPFTSFP---SNEVKDMKPVCEATTVDIESLASPASVNLKPPPK----I  340

Query  1339  ER-------------MQGKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVY  1479
             ER             +  K  ++  +PI AT Y+VA LQ AT+SFS +NLVGEG+ GRVY
Sbjct  341   ERNKSFDDDDDFSNKLVAKKSNI--TPINATVYSVADLQMATDSFSFDNLVGEGTFGRVY  398

Query  1480  RADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVY  1659
             RA F +GKVLAIKK+DS  +  Q  D+F E +SN+S+L HPN+  LVGYC EHGQ LLVY
Sbjct  399   RAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVY  458

Query  1660  DYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  1839
             D+  NGSLHD+LH +DE S+ L+WN R+++ALG+ARALEYLHE+C PS++H+NFKS+NIL
Sbjct  459   DFHRNGSLHDLLHLSDEYSKPLSWNTRIKIALGSARALEYLHEICSPSIIHKNFKSSNIL  518

Query  1840  LDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVM  2019
             LD E NPHLSD GLA+  P+ E Q +      S GY+APE  ++G YT KSDVYSFGVVM
Sbjct  519   LDSEFNPHLSDAGLASFIPDAEFQAAEQ----SAGYTAPEVDMTGQYTFKSDVYSFGVVM  574

Query  2020  LELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIA  2199
             LELLTGR+P DSSR RSEQSLVRWATPQLHDIDAL +MVDPAL G+YPAKSLSRFAD++A
Sbjct  575   LELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLA  634

Query  2200  LCVQPEPEFRPPMSEVVQALVRLVQRASVVIR  2295
             LCVQPEPEFRPPMSEVVQALVRLVQRA++  R
Sbjct  635   LCVQPEPEFRPPMSEVVQALVRLVQRANMTKR  666


 Score =   229 bits (584),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 149/221 (67%), Gaps = 3/221 (1%)
 Frame = +1

Query  298  DPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTM  477
            DPNDL  L  L+ SLNSP QL+GW+A+GGDPCG+SWKG+TC GS V  I++P L L G +
Sbjct  1    DPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLTGNL  60

Query  478  GYMLNGFTSLKELDLSSNEIHD--LIPYQLPP-NLTSLNLANNNITGSIPYSISLMTSLN  648
             Y +N   SL ELD+S N +     + Y LP   L  LNLA N   G++PYSIS M +L 
Sbjct  61   AYNMNNLGSLVELDMSQNNLGGGGQVQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLK  120

Query  649  YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
            YLN + N L   I D+F+N   L+ LDLSFN+ +GDLP S   LS+L  + +QNNQ TG+
Sbjct  121  YLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNNQFTGN  180

Query  829  LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            +NVL +LPL  LNVANN F+GWIP++L  I   +  GNS+S
Sbjct  181  INVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWS  221



>ref|XP_002533323.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus 
communis]
 gb|EEF29059.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus 
communis]
Length=607

 Score =   460 bits (1184),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 225/359 (63%), Positives = 274/359 (76%), Gaps = 9/359 (3%)
 Frame = +1

Query  1288  TATVVDLKPPPSEKVT------IERMQGKNGSLRRSPITATPYTVAVLQTATNSFSQENL  1449
             T+  ++L+PPP ++          +          +P+  T Y++A LQ AT SFS ++L
Sbjct  248   TSASINLRPPPIDRHKSFDEDDFSKKPVVVKKPVTAPLDVTTYSIADLQIATGSFSIDHL  307

Query  1450  VGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYC  1629
             +GEGS GRVYRA F  GKVLA+KK+DS+ LS    D+F+E IS +S L HPN+  L+GYC
Sbjct  308   LGEGSFGRVYRAQFDGGKVLAVKKIDSSTLSSNMSDDFIEMISKISELHHPNVTELMGYC  367

Query  1630  AEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVV  1809
             +EHGQ LLVY++  +GSLHD LH +DE S+ L WN RV++ALGTARALEYLHEVC PS++
Sbjct  368   SEHGQHLLVYEFHKSGSLHDFLHLSDEDSKPLIWNTRVKIALGTARALEYLHEVCSPSII  427

Query  1810  HRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVK  1989
             H+N KSANILLD ELNPHLSD GLA+  PN E+ +++    GS GY APE A+SG YT+K
Sbjct  428   HKNIKSANILLDTELNPHLSDSGLASFLPNAEQALNNN--AGS-GYGAPEVAMSGQYTLK  484

Query  1990  SDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAK  2169
             SDVYSFGVVMLELLTGRKP DSSR RSEQSLVRWATPQLHDIDALSKMVDPAL G+YP K
Sbjct  485   SDVYSFGVVMLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVK  544

Query  2170  SLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             SLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R   ++ G + +  + DA
Sbjct  545   SLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTVGNDQGASRQVDNADA  603


 Score = 89.4 bits (220),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +1

Query  328  LYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSL  507
            +Y SLNSP QL+ W ++GGDPCGESWKGVTC GS V  I++ GL L+G++GY LN  T+L
Sbjct  1    MYTSLNSPPQLTKWTSNGGDPCGESWKGVTCSGSRVTEIKLSGLSLSGSLGYQLNLLTAL  60

Query  508  KELDLSSNEIHDLIPYQLP--PNLTSLNLANNNITGSI  615
              LD+S N++   +P+      ++TS+ L NN  TG+I
Sbjct  61   INLDVSFNQLPGNLPWSFRNLSSMTSMYLQNNRFTGTI  98


 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 59/80 (74%), Gaps = 3/80 (4%)
 Frame = +1

Query  715  LTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGW  894
            L  LD+SFN   G+LP S   LS+++ + +QNN+ TG+++VL DLPL +LNVANN+F+GW
Sbjct  60   LINLDVSFNQLPGNLPWSFRNLSSMTSMYLQNNRFTGTIDVLADLPLKNLNVANNQFTGW  119

Query  895  IPNELISI-PKFEYSGNSFS  951
            IP +L  I P+ +  GN++S
Sbjct  120  IPQQLKEIHPQMD--GNNWS  137



>ref|XP_008651696.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Zea 
mays]
Length=712

 Score =   463 bits (1191),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 234/392 (60%), Positives = 281/392 (72%), Gaps = 37/392 (9%)
 Frame = +1

Query  1192  RRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVD-----------LKPPPSEKVTI  1338
             +   K+ F       S P     EV D +    AT VD           LKPPP     I
Sbjct  316   KAAMKEHFEQHQPFTSFP---SNEVKDMKPVYEATTVDIESLASPASVNLKPPPK----I  368

Query  1339  ER-------------MQGKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVY  1479
             ER             +  K  ++  +PI AT Y+VA LQ AT+SFS +NLVGEG+ GRVY
Sbjct  369   ERNKSFDDDDDFSNKLVAKKSNI--TPINATVYSVADLQMATDSFSFDNLVGEGTFGRVY  426

Query  1480  RADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVY  1659
             RA F +GKVLAIKK+DS  +  Q  D+F E +SN+S+L HPN+  LVGYC EHGQ LLVY
Sbjct  427   RAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVY  486

Query  1660  DYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  1839
             D+  NGSLHD+LH +DE S+ L+WN R+++ALG+ARALEYLHE+C PS++H+NFKS+NIL
Sbjct  487   DFHRNGSLHDLLHLSDEYSKPLSWNTRIKIALGSARALEYLHEICSPSIIHKNFKSSNIL  546

Query  1840  LDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVM  2019
             LD E NPHLSD GLA+  P+ E Q +      S GY+APE  ++G YT+KSDVYSFGVVM
Sbjct  547   LDSEFNPHLSDAGLASFIPDAEFQAAEQ----SAGYTAPEVDMTGQYTLKSDVYSFGVVM  602

Query  2020  LELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIA  2199
             LELLTGR+P DSSR RSEQSLVRWATPQLHDIDAL +MVDPAL G+YPAKSLSRFAD++A
Sbjct  603   LELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLA  662

Query  2200  LCVQPEPEFRPPMSEVVQALVRLVQRASVVIR  2295
             LCVQPEPEFRPPMSEVVQALVRLVQRA++  R
Sbjct  663   LCVQPEPEFRPPMSEVVQALVRLVQRANMTKR  694


 Score =   203 bits (517),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 137/225 (61%), Gaps = 23/225 (10%)
 Frame = +1

Query  280  FVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGL  459
            F  A TDPNDL  L  L+ SLNSP QL+GW+A+GGDPCG+SWKG+TC GS V  I++   
Sbjct  47   FAAADTDPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIDMSQN  106

Query  460  GLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPP-NLTSLNLANNNITGSIPYSISLM  636
             L G                         I Y LP   L  LNLA N   G++PYSIS M
Sbjct  107  NLGGG----------------------GQIQYNLPNMKLEKLNLAGNQFGGNLPYSISTM  144

Query  637  TSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQ  816
             +L YLN + N L   I D+F+N   L+ LDLSFN+ +GDLP S   LS+L  + +QNNQ
Sbjct  145  PNLKYLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNNQ  204

Query  817  LTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
             TG++NVL +LPL  LNVANN F+GWIP++L  I   +  GNS+S
Sbjct  205  FTGNINVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWS  249



>ref|XP_008651693.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Zea 
mays]
 tpg|DAA43732.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=736

 Score =   464 bits (1193),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 234/392 (60%), Positives = 281/392 (72%), Gaps = 37/392 (9%)
 Frame = +1

Query  1192  RRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVD-----------LKPPPSEKVTI  1338
             +   K+ F       S P     EV D +    AT VD           LKPPP     I
Sbjct  340   KAAMKEHFEQHQPFTSFP---SNEVKDMKPVYEATTVDIESLASPASVNLKPPPK----I  392

Query  1339  ER-------------MQGKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVY  1479
             ER             +  K  ++  +PI AT Y+VA LQ AT+SFS +NLVGEG+ GRVY
Sbjct  393   ERNKSFDDDDDFSNKLVAKKSNI--TPINATVYSVADLQMATDSFSFDNLVGEGTFGRVY  450

Query  1480  RADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVY  1659
             RA F +GKVLAIKK+DS  +  Q  D+F E +SN+S+L HPN+  LVGYC EHGQ LLVY
Sbjct  451   RAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVY  510

Query  1660  DYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  1839
             D+  NGSLHD+LH +DE S+ L+WN R+++ALG+ARALEYLHE+C PS++H+NFKS+NIL
Sbjct  511   DFHRNGSLHDLLHLSDEYSKPLSWNTRIKIALGSARALEYLHEICSPSIIHKNFKSSNIL  570

Query  1840  LDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVM  2019
             LD E NPHLSD GLA+  P+ E Q +      S GY+APE  ++G YT+KSDVYSFGVVM
Sbjct  571   LDSEFNPHLSDAGLASFIPDAEFQAAEQ----SAGYTAPEVDMTGQYTLKSDVYSFGVVM  626

Query  2020  LELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIA  2199
             LELLTGR+P DSSR RSEQSLVRWATPQLHDIDAL +MVDPAL G+YPAKSLSRFAD++A
Sbjct  627   LELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLA  686

Query  2200  LCVQPEPEFRPPMSEVVQALVRLVQRASVVIR  2295
             LCVQPEPEFRPPMSEVVQALVRLVQRA++  R
Sbjct  687   LCVQPEPEFRPPMSEVVQALVRLVQRANMTKR  718


 Score =   235 bits (600),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 152/227 (67%), Gaps = 3/227 (1%)
 Frame = +1

Query  280  FVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGL  459
            F  A TDPNDL  L  L+ SLNSP QL+GW+A+GGDPCG+SWKG+TC GS V  I++P L
Sbjct  47   FAAADTDPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNL  106

Query  460  GLNGTMGYMLNGFTSLKELDLSSNEIHD--LIPYQLPP-NLTSLNLANNNITGSIPYSIS  630
             L G + Y +N   SL ELD+S N +     I Y LP   L  LNLA N   G++PYSIS
Sbjct  107  SLTGNLAYNMNNLGSLVELDMSQNNLGGGGQIQYNLPNMKLEKLNLAGNQFGGNLPYSIS  166

Query  631  LMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQN  810
             M +L YLN + N L   I D+F+N   L+ LDLSFN+ +GDLP S   LS+L  + +QN
Sbjct  167  TMPNLKYLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQN  226

Query  811  NQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            NQ TG++NVL +LPL  LNVANN F+GWIP++L  I   +  GNS+S
Sbjct  227  NQFTGNINVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWS  273



>emb|CDO97777.1| unnamed protein product [Coffea canephora]
Length=712

 Score =   462 bits (1190),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 227/361 (63%), Positives = 284/361 (79%), Gaps = 16/361 (4%)
 Frame = +1

Query  1288  TATVVDLKPPPSEKVTIERMQGKNGSLR---------RSPITATPYTVAVLQTATNSFSQ  1440
             T T ++LKPPP ++   +     + S++          +PI A  Y+VA LQ AT+SFS 
Sbjct  355   TPTSINLKPPPVDRN--KSFDEDDTSMKPIIPAKKAVTTPIEAKQYSVADLQMATDSFSV  412

Query  1441  ENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLV  1620
             ENL+GEGS+GRVYRA+F +GKVLA+KK+ S+ L   E+  FLE ++ +SRL HPN+  LV
Sbjct  413   ENLIGEGSIGRVYRAEFDDGKVLAVKKIKSSVLPHAED--FLEIVAEISRLHHPNVTELV  470

Query  1621  GYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLP  1800
             GYC+EHGQ LL Y++  NGSL+++LH +DE S+ LTWN+RV++ALGTARALEYLHEVC P
Sbjct  471   GYCSEHGQHLLAYEFHKNGSLNELLHLSDEYSKPLTWNSRVKIALGTARALEYLHEVCSP  530

Query  1801  SVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVY  1980
             SV+H+NFKSANILLD ELNPHLSDCGLA+L  + ++ ++     GS GY APE ++SG Y
Sbjct  531   SVIHKNFKSANILLDMELNPHLSDCGLASLVHDIDQALNQN--AGS-GYGAPEVSMSGQY  587

Query  1981  TVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMY  2160
             T+KSDVYSFGVVMLELLTGR+P DSSR RSEQSLVRWATPQLHDIDAL+KMVDPAL G+Y
Sbjct  588   TIKSDVYSFGVVMLELLTGRQPFDSSRARSEQSLVRWATPQLHDIDALAKMVDPALKGLY  647

Query  2161  PAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDH  2340
             P KSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R   ++ G + ++ + 
Sbjct  648   PVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMSRRTLGNDQGSSVRSNNS  707

Query  2341  D  2343
             D
Sbjct  708   D  708


 Score =   236 bits (603),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 157/240 (65%), Gaps = 1/240 (0%)
 Frame = +1

Query  229  LFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
            L   V L+   L+    F  A TDPND   L  LY SLNSPSQL+ W  +GGDPC E+WK
Sbjct  6    LAAAVALLGCILLLGPSFTNADTDPNDAAVLFDLYKSLNSPSQLTKWNPNGGDPCNENWK  65

Query  409  GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
            G+TC GS V  I++ GLGL G+MG+ L+   S+   D+S+N + + +P+QLP N+  LNL
Sbjct  66   GITCSGSRVTEIKLSGLGLTGSMGFELDKLKSVTNFDISNNNLGNQLPFQLPQNVQQLNL  125

Query  589  ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
            A N   G +PYS+S MTSL YLN S N     + DMF + + L+TLD SFN  SGDLP S
Sbjct  126  AGNGFNGGLPYSVSQMTSLKYLNVSHNQFQGQLSDMFASLTSLSTLDFSFNVMSGDLPKS  185

Query  769  LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
                ++++ + +QNNQ TG+++VL +LPL +LNV NN FSGWIP++L  I   +  GNS+
Sbjct  186  FSSCTSMTDMNLQNNQFTGTIDVLANLPLDNLNVENNHFSGWIPDQLKDI-NLQTGGNSW  244



>ref|XP_008465039.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 isoform X5 [Cucumis 
melo]
Length=584

 Score =   458 bits (1178),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 221/370 (60%), Positives = 281/370 (76%), Gaps = 15/370 (4%)
 Frame = +1

Query  1267  LDQRAKSTATVVDLKPPPSEK---------VTIERMQGKNGSLRRSPITATPYTVAVLQT  1419
              D +   +  +++LKPPP ++           I  ++  N +   +P++   Y++A LQ 
Sbjct  218   FDAKELESPALINLKPPPIDRHKSFDDNDTSKIPVVKKTNVT---APLSVKSYSIADLQM  274

Query  1420  ATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRH  1599
             AT SF+ ENL+ EGSLGRVYRA F +GKVL +KK+DSAA   +  ++F E ++N+S+L H
Sbjct  275   ATGSFNVENLLDEGSLGRVYRAQFNDGKVLVVKKIDSAAFRRELLEDFTEIVANISQLHH  334

Query  1600  PNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEY  1779
             PN+  L+GYC+EH   LL+Y++  NGSLHD LH +DE S+ LTWN+RV++ALGTARALEY
Sbjct  335   PNVTELMGYCSEHSLHLLIYEFHKNGSLHDFLHISDEYSKPLTWNSRVKIALGTARALEY  394

Query  1780  LHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPE  1959
             LHEVC PSVVHRN KSANILLD E+NPHLSDCGLA+   N ++ +      GS GYSAPE
Sbjct  395   LHEVCSPSVVHRNIKSANILLDAEMNPHLSDCGLASFITNLDQALDQQ--TGS-GYSAPE  451

Query  1960  FALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVD  2139
               +SG YT+KSDVYSFGVVMLELL+GRKP DSSR R+EQSLVRWATPQLHDIDAL+KMVD
Sbjct  452   VTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTKMVD  511

Query  2140  PALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGF  2319
             PAL G+YP KSLSRFAD++ALCVQPEPEFRPPMSEVV+ALVRLVQR+++  R +  + G 
Sbjct  512   PALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSDHGS  571

Query  2320  AYKTPDHDAA  2349
             +++T D DA 
Sbjct  572   SFRTDDLDAC  581


 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = +1

Query  634  MTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNN  813
            M+ L  LN S N L   + DMF   S L  LD+SFN  SG LP S   L++L+ + +QNN
Sbjct  1    MSLLISLNMSHNQLQNQVNDMFWKLSSLAMLDISFNFLSGALPQSFSNLTSLNAMFLQNN  60

Query  814  QLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            Q +G+++VL +LPL +LNV NN F+GW+P  L +I   +  GNS+S
Sbjct  61   QFSGTIDVLANLPLQNLNVENNHFTGWVPERLKNI-NIQEGGNSWS  105



>ref|XP_007217016.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
 gb|EMJ18215.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
Length=717

 Score =   462 bits (1189),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 223/356 (63%), Positives = 278/356 (78%), Gaps = 9/356 (3%)
 Frame = +1

Query  1267  LDQRAKSTATVVDLKPPPSEK---VTIERMQGKNGSLRRS---PITATPYTVAVLQTATN  1428
             LD +   T   ++L+PPP ++      E    K   ++++   P+  T Y++A LQ AT 
Sbjct  350   LDMKTFDTPATINLRPPPVDRHKSFDEEDFSKKPIVVKKTSTAPLNVTSYSIADLQIATG  409

Query  1429  SFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNI  1608
             SF+ ENL+GEGS GRVYRA F +GKVLA+KK+DS+ L  +  ++F E +SN+S L HPN+
Sbjct  410   SFNVENLLGEGSFGRVYRAQFDDGKVLAVKKIDSSVLPSELSEDFTEIVSNISLLHHPNV  469

Query  1609  VPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHE  1788
               LVGYC+EHGQ LLVY++  +GSLHD LH +D+ ++ LTWN+RV++ALGTARALEYLHE
Sbjct  470   TELVGYCSEHGQHLLVYEFHKSGSLHDFLHLSDDYNKPLTWNSRVKIALGTARALEYLHE  529

Query  1789  VCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFAL  1968
             VC PS++H+N KSANILLD ELNPHLSD GLA+  PN ++ +   H VGS GYSAPE A+
Sbjct  530   VCSPSIIHKNIKSANILLDVELNPHLSDTGLASFIPNADQALE--HNVGS-GYSAPEVAM  586

Query  1969  SGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPAL  2148
             SG YT+KSDVY FGVVMLEL++GRKP DSS+ RSEQSLVRWATPQLHDIDALSKMVDPAL
Sbjct  587   SGQYTLKSDVYGFGVVMLELISGRKPFDSSKPRSEQSLVRWATPQLHDIDALSKMVDPAL  646

Query  2149  NGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
              G+YP KSLSRFAD+IALCVQPEPEFRPPMSEVV+ALVRLVQRA++  R   ++ G
Sbjct  647   KGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTVGNDQG  702


 Score =   223 bits (569),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 164/237 (69%), Gaps = 1/237 (0%)
 Frame = +1

Query  241  VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
            +VL I  L    G + AATDP D+ AL+ LY SLNSPSQL+ W ASG DPCG+SWKGV C
Sbjct  10   LVLSICILGWSPGSINAATDPADVSALKTLYSSLNSPSQLTQWSASGDDPCGQSWKGVKC  69

Query  421  QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
             GS V  I++  L L+G++   L   T+L  LD+S N +   IPY LPPN+T LNLA NN
Sbjct  70   SGSRVTEIDVSNLQLSGSLWSSLQSLTALTNLDMSHNNLAGSIPYSLPPNMTRLNLAANN  129

Query  601  ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
                IPYSISL+TSL YLN S N L   + D+F   S L+TLDLSFN+ SG+LP SL  L
Sbjct  130  FNQGIPYSISLITSLEYLNISHNQLQNQVDDIFGKLSSLSTLDLSFNSLSGNLPESLSSL  189

Query  781  SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            S+++ + +QNNQLTG +NVL +LPL +LN+ NN+F+GWIP +L +I   E  GN+++
Sbjct  190  SSMTTMNLQNNQLTGPINVLANLPLENLNIQNNQFTGWIPEQLKNI-NLEKDGNTWN  245



>ref|XP_008228094.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Prunus mume]
Length=717

 Score =   461 bits (1186),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 222/357 (62%), Positives = 277/357 (78%), Gaps = 9/357 (3%)
 Frame = +1

Query  1264  VLDQRAKSTATVVDLKPPPSEK---VTIERMQGKNGSLRRS---PITATPYTVAVLQTAT  1425
              LD +   T   ++L+PPP ++      E    K   ++++   P+  T Y++A LQ AT
Sbjct  349   TLDMKTFDTPATINLRPPPVDRHKSFDEEDFSKKPIVVKKTSTAPLNVTSYSIADLQIAT  408

Query  1426  NSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPN  1605
              SF+ ENL+GEGS GRVYRA F +GKVLA+KK+DS+ L  +  ++F E +SN+S L HPN
Sbjct  409   GSFNVENLLGEGSFGRVYRAQFDDGKVLAVKKIDSSVLPSELSEDFTEIVSNISLLHHPN  468

Query  1606  IVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLH  1785
             +  LVGYC+EHGQ LLVY++  +GSLHD LH +D+ ++ LTWN+RV++ALGTARALEYLH
Sbjct  469   VTELVGYCSEHGQHLLVYEFHKSGSLHDFLHLSDDYNKPLTWNSRVKIALGTARALEYLH  528

Query  1786  EVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFA  1965
             EVC PS++H+N KSANILLD ELNPHLSD GLA+  PN ++ +   H  GS GYSAPE A
Sbjct  529   EVCSPSIIHKNIKSANILLDVELNPHLSDTGLASFIPNADQALE--HNAGS-GYSAPEVA  585

Query  1966  LSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPA  2145
             +SG YT+KSDVY FGVVMLEL++GRKP DSS+ RSEQSLVRWATPQLHDIDALSKMVDPA
Sbjct  586   MSGQYTLKSDVYGFGVVMLELISGRKPFDSSKPRSEQSLVRWATPQLHDIDALSKMVDPA  645

Query  2146  LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             L G+YP KSLSRFAD+IALCVQPEPEFRPPMSEVV+ALVRLVQRA++  R   ++ G
Sbjct  646   LKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTIGNDQG  702


 Score =   222 bits (566),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 127/241 (53%), Positives = 167/241 (69%), Gaps = 7/241 (3%)
 Frame = +1

Query  241  VVLVIAALISRLGF----VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
            V+LV +  I  LG+    + AATDP D+ AL+ LY SLNSPSQL+ W A+G DPCG+SWK
Sbjct  8    VLLVFSICI--LGWSPSSINAATDPADVSALKALYSSLNSPSQLTQWSANGDDPCGQSWK  65

Query  409  GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
            GV C GS V  I++  L L+G++   L   TSL  LD+S N +   IPY LPPN+T LNL
Sbjct  66   GVKCSGSRVTEIDVSNLQLSGSLWSSLQSLTSLTNLDMSHNNLAGSIPYSLPPNMTRLNL  125

Query  589  ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
            A NN    IPYSIS +TSL YLN S N L   + D+F   S L+TLDLSFN+ SG+LP S
Sbjct  126  AANNFNQGIPYSISQITSLEYLNISHNQLQNQVDDIFGKLSSLSTLDLSFNSLSGNLPES  185

Query  769  LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
            L  LS+++ + +QNNQLTG++NVL +LPL +LN+ NN+F+GWIP +L +I   E  GN++
Sbjct  186  LSSLSSMTRMNLQNNQLTGNINVLANLPLENLNIQNNQFTGWIPEQLKNI-NLEKDGNTW  244

Query  949  S  951
            +
Sbjct  245  N  245



>ref|XP_008465038.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 isoform X4 [Cucumis 
melo]
Length=637

 Score =   458 bits (1178),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 221/370 (60%), Positives = 281/370 (76%), Gaps = 15/370 (4%)
 Frame = +1

Query  1267  LDQRAKSTATVVDLKPPPSEK---------VTIERMQGKNGSLRRSPITATPYTVAVLQT  1419
              D +   +  +++LKPPP ++           I  ++  N +   +P++   Y++A LQ 
Sbjct  271   FDAKELESPALINLKPPPIDRHKSFDDNDTSKIPVVKKTNVT---APLSVKSYSIADLQM  327

Query  1420  ATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRH  1599
             AT SF+ ENL+ EGSLGRVYRA F +GKVL +KK+DSAA   +  ++F E ++N+S+L H
Sbjct  328   ATGSFNVENLLDEGSLGRVYRAQFNDGKVLVVKKIDSAAFRRELLEDFTEIVANISQLHH  387

Query  1600  PNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEY  1779
             PN+  L+GYC+EH   LL+Y++  NGSLHD LH +DE S+ LTWN+RV++ALGTARALEY
Sbjct  388   PNVTELMGYCSEHSLHLLIYEFHKNGSLHDFLHISDEYSKPLTWNSRVKIALGTARALEY  447

Query  1780  LHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPE  1959
             LHEVC PSVVHRN KSANILLD E+NPHLSDCGLA+   N ++ +      GS GYSAPE
Sbjct  448   LHEVCSPSVVHRNIKSANILLDAEMNPHLSDCGLASFITNLDQALDQQ--TGS-GYSAPE  504

Query  1960  FALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVD  2139
               +SG YT+KSDVYSFGVVMLELL+GRKP DSSR R+EQSLVRWATPQLHDIDAL+KMVD
Sbjct  505   VTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTKMVD  564

Query  2140  PALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGF  2319
             PAL G+YP KSLSRFAD++ALCVQPEPEFRPPMSEVV+ALVRLVQR+++  R +  + G 
Sbjct  565   PALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSDHGS  624

Query  2320  AYKTPDHDAA  2349
             +++T D DA 
Sbjct  625   SFRTDDLDAC  634


 Score =   150 bits (380),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 105/159 (66%), Gaps = 1/159 (1%)
 Frame = +1

Query  475  MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYL  654
            MGY L+  TSL  LD+S+N +   IPYQLP NL  LNL  NN +GSIPYSIS M+ L  L
Sbjct  1    MGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISL  60

Query  655  NFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLN  834
            N S N L   + DMF   S L  LD+SFN  SG LP S   L++L+ + +QNNQ +G+++
Sbjct  61   NMSHNQLQNQVNDMFWKLSSLAMLDISFNFLSGALPQSFSNLTSLNAMFLQNNQFSGTID  120

Query  835  VLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            VL +LPL +LNV NN F+GW+P  L +I   +  GNS+S
Sbjct  121  VLANLPLQNLNVENNHFTGWVPERLKNI-NIQEGGNSWS  158



>ref|XP_010937238.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Elaeis 
guineensis]
Length=676

 Score =   459 bits (1181),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 244/391 (62%), Positives = 298/391 (76%), Gaps = 22/391 (6%)
 Frame = +1

Query  1189  LRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEK-VTIERMQGKNGS  1365
             ++  K  + ++  ST +LP              +A  + LKPPP ++  + +     N  
Sbjct  297   VKEMKSIQTSSTISTATLP--------------SAAPISLKPPPIDRHKSFDEDDFSNKP  342

Query  1366  LRR----SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSA  1533
             + +    +PI AT Y+VA LQ AT+SFS ENL+GEGS GRVYRA F +GKVLA+KK++S+
Sbjct  343   VVKKANTAPIKATVYSVADLQMATDSFSVENLIGEGSFGRVYRAQFSDGKVLAVKKINSS  402

Query  1534  ALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADER  1713
             AL  Q  D+F+E +SN+SRL HPN+  LVGYC+EHGQ LLVY++  NGSLHD+LH +DE 
Sbjct  403   ALPNQSADDFIELVSNISRLHHPNLTELVGYCSEHGQYLLVYEFHKNGSLHDLLHLSDEY  462

Query  1714  SQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALT  1893
             S+ L+W+ RV++ALG+ARALEYLHEVC PSVVH+NFKS+NILLD ELNPHLSDCGLA LT
Sbjct  463   SKPLSWSTRVKIALGSARALEYLHEVCSPSVVHKNFKSSNILLDMELNPHLSDCGLANLT  522

Query  1894  PNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSE  2073
             P+ E Q S  + +GS GYSAPE A+SG YT+KSDVY FGVVMLELLTGRKP +SSR RSE
Sbjct  523   PDAEFQASDQN-MGS-GYSAPEVAMSGQYTLKSDVYGFGVVMLELLTGRKPFESSRSRSE  580

Query  2074  QSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ  2253
             QSLVRWATPQLHDIDAL +MVDPAL G+YPAKSLSRFAD+IALCVQPEPEFRPPMSEVVQ
Sbjct  581   QSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMSEVVQ  640

Query  2254  ALVRLVQRASVVIRRYS-DESGFAYKTPDHD  2343
             ALVRLVQRA++  R  S D    A ++ D D
Sbjct  641   ALVRLVQRANMSKRVLSGDTQETARRSDDPD  671


 Score =   145 bits (367),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 136/239 (57%), Gaps = 50/239 (21%)
 Frame = +1

Query  244  VLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQ  423
            +L++   I    FV  AT+  D+ AL VLY SLNSP QL+GW ++GGDPCG+SW GVTC 
Sbjct  16   LLLVCIWIWNPSFVHGATNSADVSALNVLYSSLNSPGQLTGWTSNGGDPCGQSWLGVTCS  75

Query  424  GSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNI  603
            G AV +I++ GLGL+G++GY +    SL ELD+S                      NNN+
Sbjct  76   GQAVTTIKLSGLGLSGSLGYQMASMASLTELDIS----------------------NNNL  113

Query  604  TG--SIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
             G   IPY++                            +L  LDLS N+ +GDLP S   
Sbjct  114  GGGQQIPYNLP--------------------------PNLERLDLSSNSLTGDLPQSFSS  147

Query  778  LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN  954
            LS+L+ L +QNNQ TGS++VL  LPL DLNVANN F+GWIP++L  I   +  GNS+S+
Sbjct  148  LSSLTTLYLQNNQFTGSIDVLASLPLNDLNVANNHFTGWIPDKLRGINNLQTGGNSWSS  206



>ref|XP_007024796.1| Strubbelig-receptor family 6 [Theobroma cacao]
 gb|EOY27418.1| Strubbelig-receptor family 6 [Theobroma cacao]
Length=721

 Score =   460 bits (1184),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 228/366 (62%), Positives = 278/366 (76%), Gaps = 8/366 (2%)
 Frame = +1

Query  1267  LDQRAKSTATVVDLKPPPSEK------VTIERMQGKNGSLRRSPITATPYTVAVLQTATN  1428
             +D +   T   ++L+PPP ++          +          +P   T Y++A LQ AT 
Sbjct  352   IDTKTFDTPASINLRPPPIDRHKSFDEEDFSKKPVVVKKAVPAPTNVTSYSIADLQMATG  411

Query  1429  SFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNI  1608
             SFS ENL+GEG  GRVYRA F +GKVLA+KK+DS+AL  +  D+F+E +SN+S+L H N+
Sbjct  412   SFSVENLLGEGCFGRVYRAQFDDGKVLAVKKIDSSALPSEISDDFIEIVSNISQLHHTNV  471

Query  1609  VPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHE  1788
               LVGYC+EHGQ LLVY++  NGSLHD LH +DE S+ L WN+RV++ALGTARALEYLHE
Sbjct  472   TELVGYCSEHGQHLLVYEFHKNGSLHDFLHVSDEYSKPLIWNSRVKIALGTARALEYLHE  531

Query  1789  VCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFAL  1968
             VC PS+VH+N KSANILLD ELNPHLSD GLA   P+ + Q+ +   VGS GYSAPE A+
Sbjct  532   VCSPSIVHKNIKSANILLDAELNPHLSDSGLATFIPDAD-QVLNRDDVGS-GYSAPEVAM  589

Query  1969  SGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPAL  2148
             SG+Y++KSDVYSFGVVMLELLTGRKP DS+R R EQSLVRWATPQLHDIDALSKMVDPAL
Sbjct  590   SGLYSLKSDVYSFGVVMLELLTGRKPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDPAL  649

Query  2149  NGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYK  2328
              G+YP KSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R    + G + +
Sbjct  650   KGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTIGTDQGASQR  709

Query  2329  TPDHDA  2346
             T + DA
Sbjct  710   TDNPDA  715


 Score =   221 bits (564),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 159/241 (66%), Gaps = 8/241 (3%)
 Frame = +1

Query  241  VVLVIAALISRLGF----VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWK  408
            V+L+    I  LGF       ATD  D  AL  ++ SLNSP QL+GW +S GDPCG+SWK
Sbjct  10   VLLLFTVCI--LGFKPRCANGATDQGDASALGGMFSSLNSPQQLTGWTSSNGDPCGQSWK  67

Query  409  GVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNL  588
            GVTC G  V  I++  LGL+G++ Y L   TSLKELD+S N I   IPY LPPNL  LNL
Sbjct  68   GVTCSGQRVTEIKLSNLGLSGSI-YNLQSLTSLKELDMSQNNIAGEIPYNLPPNLQQLNL  126

Query  589  ANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPAS  768
            A N  TGS+PY    M SL YLN   N L   + DMF   S L+TLDLSFN  +GDLP S
Sbjct  127  AFNQFTGSVPYVFHDMPSLQYLNLGHNQLQNQLNDMFAPLSSLSTLDLSFNALTGDLPES  186

Query  769  LGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSF  948
               LS+++ + +QNNQ TG+++VL +LPL +L V+NNRF+GWIP++L SI   +  GNS+
Sbjct  187  FKNLSSVNSMYLQNNQFTGTIDVLANLPLDNLYVSNNRFTGWIPDQLKSI-NLQKDGNSW  245

Query  949  S  951
            S
Sbjct  246  S  246



>ref|XP_010937237.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Elaeis 
guineensis]
Length=724

 Score =   459 bits (1182),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 244/391 (62%), Positives = 298/391 (76%), Gaps = 22/391 (6%)
 Frame = +1

Query  1189  LRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEK-VTIERMQGKNGS  1365
             ++  K  + ++  ST +LP              +A  + LKPPP ++  + +     N  
Sbjct  345   VKEMKSIQTSSTISTATLP--------------SAAPISLKPPPIDRHKSFDEDDFSNKP  390

Query  1366  LRR----SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSA  1533
             + +    +PI AT Y+VA LQ AT+SFS ENL+GEGS GRVYRA F +GKVLA+KK++S+
Sbjct  391   VVKKANTAPIKATVYSVADLQMATDSFSVENLIGEGSFGRVYRAQFSDGKVLAVKKINSS  450

Query  1534  ALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADER  1713
             AL  Q  D+F+E +SN+SRL HPN+  LVGYC+EHGQ LLVY++  NGSLHD+LH +DE 
Sbjct  451   ALPNQSADDFIELVSNISRLHHPNLTELVGYCSEHGQYLLVYEFHKNGSLHDLLHLSDEY  510

Query  1714  SQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALT  1893
             S+ L+W+ RV++ALG+ARALEYLHEVC PSVVH+NFKS+NILLD ELNPHLSDCGLA LT
Sbjct  511   SKPLSWSTRVKIALGSARALEYLHEVCSPSVVHKNFKSSNILLDMELNPHLSDCGLANLT  570

Query  1894  PNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSE  2073
             P+ E Q S  + +GS GYSAPE A+SG YT+KSDVY FGVVMLELLTGRKP +SSR RSE
Sbjct  571   PDAEFQASDQN-MGS-GYSAPEVAMSGQYTLKSDVYGFGVVMLELLTGRKPFESSRSRSE  628

Query  2074  QSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQ  2253
             QSLVRWATPQLHDIDAL +MVDPAL G+YPAKSLSRFAD+IALCVQPEPEFRPPMSEVVQ
Sbjct  629   QSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMSEVVQ  688

Query  2254  ALVRLVQRASVVIRRYS-DESGFAYKTPDHD  2343
             ALVRLVQRA++  R  S D    A ++ D D
Sbjct  689   ALVRLVQRANMSKRVLSGDTQETARRSDDPD  719


 Score =   216 bits (551),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 126/238 (53%), Positives = 164/238 (69%), Gaps = 2/238 (1%)
 Frame = +1

Query  244  VLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQ  423
            +L++   I    FV  AT+  D+ AL VLY SLNSP QL+GW ++GGDPCG+SW GVTC 
Sbjct  16   LLLVCIWIWNPSFVHGATNSADVSALNVLYSSLNSPGQLTGWTSNGGDPCGQSWLGVTCS  75

Query  424  GSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIH--DLIPYQLPPNLTSLNLANN  597
            G AV +I++ GLGL+G++GY +    SL ELD+S+N +     IPY LPPNL  LNLA N
Sbjct  76   GQAVTTIKLSGLGLSGSLGYQMASMASLTELDISNNNLGGGQQIPYNLPPNLERLNLAGN  135

Query  598  NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
               G++PYSISLM  L YLN   N L   + D+F   ++LTT+DLS N+ +GDLP S   
Sbjct  136  QFNGNVPYSISLMFPLKYLNLGHNQLQGNLSDIFGKLTNLTTMDLSSNSLTGDLPQSFSS  195

Query  778  LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            LS+L+ L +QNNQ TGS++VL  LPL DLNVANN F+GWIP++L  I   +  GNS+S
Sbjct  196  LSSLTTLYLQNNQFTGSIDVLASLPLNDLNVANNHFTGWIPDKLRGINNLQTGGNSWS  253



>ref|XP_004985465.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Setaria italica]
Length=722

 Score =   459 bits (1181),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 223/354 (63%), Positives = 274/354 (77%), Gaps = 18/354 (5%)
 Frame = +1

Query  1264  VLDQRAKSTATVVDLKPPPSEKVTIERMQG------KNGSLRR----SPITATPYTVAVL  1413
              +D  + ++   + LKPPP     IER +        N  + +    +PI AT Y+VA L
Sbjct  359   TVDIESLASPASISLKPPPK----IERHKSFDDDDFSNRPVAKKSNITPIKATVYSVADL  414

Query  1414  QTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRL  1593
             Q AT+SFS +NLVGEG+ GRVYRA F +GKVLAIKK+DS  +  Q  D+F E +SN+S+L
Sbjct  415   QVATDSFSFDNLVGEGTFGRVYRAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKL  474

Query  1594  RHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARAL  1773
              HPN+  LVGYC EHGQ LLVYD+  NGSLHD+LH +D+ S+ L+WN+RV++ALG+ARAL
Sbjct  475   HHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLLHLSDDYSKPLSWNSRVKIALGSARAL  534

Query  1774  EYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSA  1953
             EYLHE+C PS++H+NFKS+NILLD E NPH+SD GLA+  P+ E Q +      S GY+A
Sbjct  535   EYLHEICSPSIIHKNFKSSNILLDSEFNPHVSDAGLASFIPDAEFQAAEQ----SAGYTA  590

Query  1954  PEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKM  2133
             PE  ++G YT+KSDVYSFGVVMLELLTGR+P DSSR RSEQSLVRWATPQLHDIDAL +M
Sbjct  591   PEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRM  650

Query  2134  VDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIR  2295
             VDPAL G+YPAKSLSRFAD++ALCVQPEPEFRPPMSEVVQALVRLVQRA++  R
Sbjct  651   VDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANMTKR  704


 Score =   232 bits (592),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 153/227 (67%), Gaps = 3/227 (1%)
 Frame = +1

Query  280  FVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGL  459
            F  A TDP+DL  L  L+ SLNSP QL+GW+A+GGDPCG+SWKG+TC GS V  I +  L
Sbjct  37   FAAADTDPSDLNVLNTLFTSLNSPGQLNGWQANGGDPCGQSWKGITCSGSGVTKILLSNL  96

Query  460  GLNGTMGYMLNGFTSLKELDLSSNEIH--DLIPYQLP-PNLTSLNLANNNITGSIPYSIS  630
            GL+G + Y +N   SL ELD+S N +     I Y LP   L  LNLA N   G++PYSIS
Sbjct  97   GLSGNLAYNMNNLGSLVELDMSQNSLGGGSQIQYNLPYMKLERLNLAGNQFGGNLPYSIS  156

Query  631  LMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQN  810
             MT+L YLN + N L   I D+F++   LT +DLSFN+ +GDLP S   LS+L  L +QN
Sbjct  157  TMTNLKYLNLNHNQLQGNISDVFSSLYSLTDVDLSFNSLTGDLPQSFTGLSSLKHLYLQN  216

Query  811  NQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            NQ TG +NVL +LPL  LNVANNRF+GWIP++L  I   +  GNS+S
Sbjct  217  NQFTGYINVLANLPLEALNVANNRFTGWIPSQLKKINSIQTDGNSWS  263



>ref|XP_006661732.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=717

 Score =   459 bits (1180),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 229/370 (62%), Positives = 276/370 (75%), Gaps = 22/370 (6%)
 Frame = +1

Query  1240  LPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTIERMQG--KNGSLRRSPIT---------  1386
             +P ST  EV       +   + LKPPP     IER Q    +  L   P+          
Sbjct  347   IPESTKIEV---EPLPSPAAISLKPPPK----IERNQSFDDDDDLSNKPVAKKNNSASVK  399

Query  1387  ATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFL  1566
             A  Y+VA LQ AT+SFS +NLVGEG+ GRVYRA F +GKVLA+KK++S  L  Q  D+F 
Sbjct  400   AAVYSVADLQMATDSFSMDNLVGEGTFGRVYRAQFSDGKVLAVKKLNSTVLPSQSSDDFF  459

Query  1567  EAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVR  1746
             + +SN+S+L HPN+  LVGYC EHGQ LL YD+  NGSLHDMLH  D+ S+ L+WN+RV+
Sbjct  460   DLVSNISKLHHPNLNELVGYCMEHGQHLLAYDFQRNGSLHDMLHLPDDYSKPLSWNSRVK  519

Query  1747  VALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTH  1926
             +ALG+ARALEYLHE+C PS++H+NFKS+NILLD E NPH+SD GLA+  P++E Q S   
Sbjct  520   IALGSARALEYLHEICSPSIIHKNFKSSNILLDTEFNPHVSDAGLASFVPDSEFQASDQ-  578

Query  1927  VVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQL  2106
               GS GYSAPE  ++G YT+KSDVYSFGVVMLELLTGRKP DSSR+R+EQSLVRWATPQL
Sbjct  579   --GS-GYSAPEVDMTGQYTLKSDVYSFGVVMLELLTGRKPFDSSRQRTEQSLVRWATPQL  635

Query  2107  HDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASV  2286
             HDIDAL +MVDPAL G+YPAKSLSRFAD++ALCVQPEPEFRPPMSEVVQALVRLVQRA++
Sbjct  636   HDIDALDRMVDPALKGLYPAKSLSRFADVVALCVQPEPEFRPPMSEVVQALVRLVQRANM  695

Query  2287  VIRRYSDESG  2316
               R    E G
Sbjct  696   TRRMIDGEEG  705


 Score =   224 bits (570),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 161/247 (65%), Gaps = 3/247 (1%)
 Frame = +1

Query  220  GAFLFTEVVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGE  399
             A+ +  + L+  +   R   V A TD ND+  L  L+ SLNSP QL GW+ +GGDPCG 
Sbjct  3    AAWAWPVLFLLCCSWTRRQILVAATTDANDVTVLNALFTSLNSPGQLRGWQVNGGDPCGA  62

Query  400  SWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIH--DLIPYQLP-PN  570
            SW+G+TC GS+V +I++P +GL+G + Y +N   SL ELD+S N +     I Y LP   
Sbjct  63   SWQGITCSGSSVTAIKLPSMGLSGNLAYNMNTMESLVELDMSQNNLGGGQNIQYNLPNKK  122

Query  571  LTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFS  750
            L  LNLA N   G++PYSIS M  L YLN + N L   + D+F+N   L TLDLSFN+ +
Sbjct  123  LERLNLAGNQFAGNVPYSISTMPKLKYLNLNHNQLQGNMTDVFSNLPSLETLDLSFNSLT  182

Query  751  GDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFE  930
            G+LP S   LS+L  L +QNNQ TGS+NVL +LPL +LNVANNRF+GWIPNEL  I   +
Sbjct  183  GNLPQSFSSLSSLKTLSLQNNQFTGSINVLANLPLDNLNVANNRFTGWIPNELKKINGLQ  242

Query  931  YSGNSFS  951
              GNS+S
Sbjct  243  TDGNSWS  249



>ref|XP_002468389.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
 gb|EER95387.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
Length=730

 Score =   459 bits (1181),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 229/392 (58%), Positives = 284/392 (72%), Gaps = 25/392 (6%)
 Frame = +1

Query  1183  YCLRRCKKKEFAARTSTGSLPLST--DKEVLDQRAKSTATVVD-----------LKPPP-  1320
             + ++R K+K           P ++    EV D +    +T VD           LKPPP 
Sbjct  325   FLIKRRKRKAAMEEHFEQHQPFTSFPSNEVKDMKPIYESTAVDIESLASPASINLKPPPK  384

Query  1321  ---SEKVTIERMQGKNGSLRR----SPITATPYTVAVLQTATNSFSQENLVGEGSLGRVY  1479
                ++    +     N  + +    +PI AT Y+VA LQ AT+SFS +NLVGEG+ GRVY
Sbjct  385   IEQNKSFDDDDDDFSNKPVAKKSNITPIKATVYSVADLQMATDSFSFDNLVGEGTFGRVY  444

Query  1480  RADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVY  1659
             RA F +GKVLAIKK+DS  +  Q  D+F E +SN+S+L HPN+  LVGYC EHGQ LLVY
Sbjct  445   RAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVY  504

Query  1660  DYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  1839
             D+  NGSLHD+LH +DE S+ L+WN+R+++ALG+ARALEYLHE+C PS++H+NFKS+NIL
Sbjct  505   DFHRNGSLHDLLHLSDEYSKPLSWNSRIKIALGSARALEYLHEICSPSIIHKNFKSSNIL  564

Query  1840  LDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVM  2019
             LD E NPHLSD GLA+  P+ E Q +      S GY+APE  ++G Y +KSDVYSFGVVM
Sbjct  565   LDSEFNPHLSDAGLASFIPDAEFQAAEQ----SAGYTAPEVDMTGQYNLKSDVYSFGVVM  620

Query  2020  LELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIA  2199
             LELLTGR+P DSSR RSEQSLVRWATPQLHDIDAL +MVDPAL G+YPAKSLSRFAD++A
Sbjct  621   LELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLA  680

Query  2200  LCVQPEPEFRPPMSEVVQALVRLVQRASVVIR  2295
             LCVQPEPEFRPPMSEVVQALVRLVQRA++  R
Sbjct  681   LCVQPEPEFRPPMSEVVQALVRLVQRANMTKR  712


 Score =   238 bits (606),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 152/227 (67%), Gaps = 3/227 (1%)
 Frame = +1

Query  280  FVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGL  459
            F  A TDPNDL  L  L+ SLNSP QL+GW+A+GGDPCG+SWKG+TC GS V  I +P L
Sbjct  38   FAAADTDPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIILPNL  97

Query  460  GLNGTMGYMLNGFTSLKELDLSSNEIHD--LIPYQLPP-NLTSLNLANNNITGSIPYSIS  630
             L GT+ Y +N   SL ELD+S N +     IPY LP   L  LNLA N   G++PYSIS
Sbjct  98   SLTGTLAYNMNNLGSLVELDMSQNNLGSGAQIPYNLPNMKLEKLNLAGNQFGGNLPYSIS  157

Query  631  LMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQN  810
             M +L YLN + N L   I D+F++   L+ LDLSFN+ SGDLP S   LS+L  + +QN
Sbjct  158  TMPNLKYLNLNHNQLQGNISDVFSSLYSLSELDLSFNSLSGDLPQSFTGLSSLKKIYLQN  217

Query  811  NQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            NQ TG +NVL +LPL  LNVANN F+GWIP++L  I   +  GNS+S
Sbjct  218  NQFTGYINVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWS  264



>ref|XP_008465036.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
 ref|XP_008465037.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
Length=686

 Score =   457 bits (1176),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 221/370 (60%), Positives = 281/370 (76%), Gaps = 15/370 (4%)
 Frame = +1

Query  1267  LDQRAKSTATVVDLKPPPSEK---------VTIERMQGKNGSLRRSPITATPYTVAVLQT  1419
              D +   +  +++LKPPP ++           I  ++  N +   +P++   Y++A LQ 
Sbjct  320   FDAKELESPALINLKPPPIDRHKSFDDNDTSKIPVVKKTNVT---APLSVKSYSIADLQM  376

Query  1420  ATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRH  1599
             AT SF+ ENL+ EGSLGRVYRA F +GKVL +KK+DSAA   +  ++F E ++N+S+L H
Sbjct  377   ATGSFNVENLLDEGSLGRVYRAQFNDGKVLVVKKIDSAAFRRELLEDFTEIVANISQLHH  436

Query  1600  PNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEY  1779
             PN+  L+GYC+EH   LL+Y++  NGSLHD LH +DE S+ LTWN+RV++ALGTARALEY
Sbjct  437   PNVTELMGYCSEHSLHLLIYEFHKNGSLHDFLHISDEYSKPLTWNSRVKIALGTARALEY  496

Query  1780  LHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPE  1959
             LHEVC PSVVHRN KSANILLD E+NPHLSDCGLA+   N ++ +      GS GYSAPE
Sbjct  497   LHEVCSPSVVHRNIKSANILLDAEMNPHLSDCGLASFITNLDQALDQQ--TGS-GYSAPE  553

Query  1960  FALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVD  2139
               +SG YT+KSDVYSFGVVMLELL+GRKP DSSR R+EQSLVRWATPQLHDIDAL+KMVD
Sbjct  554   VTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTKMVD  613

Query  2140  PALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGF  2319
             PAL G+YP KSLSRFAD++ALCVQPEPEFRPPMSEVV+ALVRLVQR+++  R +  + G 
Sbjct  614   PALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSDHGS  673

Query  2320  AYKTPDHDAA  2349
             +++T D DA 
Sbjct  674   SFRTDDLDAC  683


 Score =   216 bits (551),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 141/208 (68%), Gaps = 1/208 (0%)
 Frame = +1

Query  328  LYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSL  507
            +Y SLNSP  L+ W +SGGDPCG+ WKG+TC G  V  I + GLGL+GTMGY L+  TSL
Sbjct  1    MYSSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGTMGYQLSSLTSL  60

Query  508  KELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPI  687
              LD+S+N +   IPYQLP NL  LNL  NN +GSIPYSIS M+ L  LN S N L   +
Sbjct  61   TNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISLNMSHNQLQNQV  120

Query  688  GDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLN  867
             DMF   S L  LD+SFN  SG LP S   L++L+ + +QNNQ +G+++VL +LPL +LN
Sbjct  121  NDMFWKLSSLAMLDISFNFLSGALPQSFSNLTSLNAMFLQNNQFSGTIDVLANLPLQNLN  180

Query  868  VANNRFSGWIPNELISIPKFEYSGNSFS  951
            V NN F+GW+P  L +I   +  GNS+S
Sbjct  181  VENNHFTGWVPERLKNI-NIQEGGNSWS  207



>gb|ABO31100.1| ovule receptor-like kinase 28 [Solanum chacoense]
Length=711

 Score =   458 bits (1178),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 225/352 (64%), Positives = 277/352 (79%), Gaps = 22/352 (6%)
 Frame = +1

Query  1297  VVDLKPPPSEKVTIERMQGKN------------GSLRRSPITATPYTVAVLQTATNSFSQ  1440
             VV+L+PPP     IER +  +              +  + I A  Y++A LQ AT+SF+ 
Sbjct  357   VVNLRPPP-----IERHKSFDEVDIAAKPIVPPKKVNTAKIDARQYSIADLQMATDSFNV  411

Query  1441  ENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLV  1620
             +NL+GEGS GRVYRA F +GKVLA+KK++S+AL  Q  ++FL+ +S +SRL HPN+  LV
Sbjct  412   DNLIGEGSFGRVYRAQFDDGKVLAVKKINSSAL--QNPEDFLDIVSEISRLHHPNVTELV  469

Query  1621  GYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLP  1800
             GYC+EHGQ LLVY++  NGSLHD LH +DE S+ LTWN+RV++ALGTARALEYLHEVC P
Sbjct  470   GYCSEHGQHLLVYEFHKNGSLHDFLHLSDEESKPLTWNSRVKIALGTARALEYLHEVCSP  529

Query  1801  SVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVY  1980
             S+VH+N KSANI+LD ELNPHLSDCGLA+L  + ++ ++  H  GS GY APE A+SG+ 
Sbjct  530   SLVHKNIKSANIVLDAELNPHLSDCGLASLIADADQALN--HNTGS-GYGAPEVAMSGLC  586

Query  1981  TVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMY  2160
             T+KSDVYSFGVVMLELLTGRKP DS+R RSEQSLVRWATPQLHDIDAL+KMVDPAL G+Y
Sbjct  587   TIKSDVYSFGVVMLELLTGRKPFDSARTRSEQSLVRWATPQLHDIDALAKMVDPALEGLY  646

Query  2161  PAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             P KSLSRFAD+IALCVQPEPEFRPPMSEVV+ALVRLVQRA++  R +  + G
Sbjct  647   PVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFGADQG  698


 Score =   228 bits (580),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 157/224 (70%), Gaps = 2/224 (1%)
 Frame = +1

Query  280  FVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGL  459
            +  A TDPND  AL VLY SLNSP QL+ W A+GG+PCGESW G+TC G+ V  I+I GL
Sbjct  20   YAIADTDPNDASALRVLYSSLNSPGQLTKWNANGGNPCGESWTGITCSGNRVTEIKISGL  79

Query  460  GLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMT  639
            GL+G++GY L   TS+   D+S+N + + +PYQLPPN+  LNLA N   G++PYS+S MT
Sbjct  80   GLSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAANGFNGALPYSVSQMT  139

Query  640  SLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQL  819
            SL YLN S N +   +   F + S L TLD SFN  +GDLP S   L++++ + +QNNQ 
Sbjct  140  SLRYLNVSHNQIQGQVTVAFDSLSSLDTLDFSFNAMTGDLPQSFKALTSMNKMYLQNNQF  199

Query  820  TGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            TG++++L +LPL DLNV NNRF+GW+PN L  I K   +GNS++
Sbjct  200  TGTIDILANLPLDDLNVENNRFTGWVPNHLKGITK--SNGNSWN  241



>ref|XP_010033635.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Eucalyptus 
grandis]
 gb|KCW53334.1| hypothetical protein EUGRSUZ_J02582 [Eucalyptus grandis]
Length=728

 Score =   458 bits (1178),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 226/355 (64%), Positives = 276/355 (78%), Gaps = 9/355 (3%)
 Frame = +1

Query  1300  VDLKPPPSEK---VTIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEG  1461
             ++LKPPP ++      E    K   ++++   P   T Y++A LQ  T SFS +NL+GEG
Sbjct  372   INLKPPPIDRHKSFDEEDFAKKPVPVKKAIKLPTNLTSYSIADLQMTTGSFSVDNLLGEG  431

Query  1462  SLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHG  1641
             S GRVYRA F +GKVLA+KK+DS AL  +  + FLE +SN+S++ HPN+  LVGYCAE G
Sbjct  432   SFGRVYRAQFDDGKVLAVKKLDSTALPNELSEEFLEIVSNISQMHHPNVTDLVGYCAELG  491

Query  1642  QRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNF  1821
             Q LL+Y++  +GSLH+ LH +DE S+ LTWN RV++ALGTARALEYLHEVC PS+VH+N 
Sbjct  492   QHLLIYEFHKSGSLHEFLHLSDEDSKPLTWNTRVKIALGTARALEYLHEVCSPSIVHKNI  551

Query  1822  KSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVY  2001
             KSANILLD ELNPHLSDCGLA+  PN E+ ++    +GS GYSAPE A+SG YT+KSDVY
Sbjct  552   KSANILLDAELNPHLSDCGLASYLPNAEQILNQN--MGS-GYSAPEVAMSGQYTLKSDVY  608

Query  2002  SFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSR  2181
              FGVVMLELLTGR+P DSS+ RSEQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSR
Sbjct  609   GFGVVMLELLTGRQPFDSSKGRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSR  668

Query  2182  FADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDA  2346
             FAD+IALCVQ EPEFRPPMSEVVQALVRLVQRA++  R + +E   + K  D DA
Sbjct  669   FADVIALCVQAEPEFRPPMSEVVQALVRLVQRANMSKRTFGNEHRASQKFDDADA  723


 Score =   244 bits (622),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 165/238 (69%), Gaps = 2/238 (1%)
 Frame = +1

Query  241  VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
            ++L I  L S    + A TDP+D  AL+ +Y  LN PSQL+ W +SGGDPCG+SWKG+TC
Sbjct  17   IMLEICILGSTFTSINADTDPSDAAALQDMYSFLNQPSQLTQWSSSGGDPCGQSWKGITC  76

Query  421  QGSAVVSIEIPGLGLNGT-MGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANN  597
             GS V  I++PGLGL+G+ +GY L   TS+  LDLS+N +   +PY +PPN+  LNLANN
Sbjct  77   SGSRVTEIKLPGLGLSGSSIGYKLQSLTSVTNLDLSNNNLGGQLPYGVPPNVQRLNLANN  136

Query  598  NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
              TG IP+SI+ ++SL YLN   N L   + DMF   S L TLDLS N  SG+LP ++  
Sbjct  137  QFTGQIPWSIAQLSSLKYLNLGHNQLQGALNDMFGQLSSLDTLDLSSNQLSGNLPQTISS  196

Query  778  LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            LS+++ + +QNNQ TG +NVL +LPL +LNVANN+F+GW+P +L +I   +  GNS+S
Sbjct  197  LSSITTMYLQNNQFTGDINVLANLPLENLNVANNQFTGWVPAQLKNI-NLQKDGNSWS  253



>ref|XP_011072711.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Sesamum indicum]
Length=712

 Score =   457 bits (1176),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 226/356 (63%), Positives = 278/356 (78%), Gaps = 18/356 (5%)
 Frame = +1

Query  1276  RAKSTATVVDLKPPPSEK---VTIERMQGKN----GSLRRSPITATPYTVAVLQTATNSF  1434
             +A  T  +++L+PPP+++      + +  K       +  +PI A  Y+VA LQ AT+SF
Sbjct  358   KAFETPAMINLRPPPADRHKSFDEDDVSAKPIVPPKKVNTAPINAKSYSVADLQIATDSF  417

Query  1435  SQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVP  1614
             + +NL+GEGS+GRVY+A   +G++LA+KK++S+ LS  EE  FL+ +S +S L HPNI  
Sbjct  418   NVDNLMGEGSIGRVYQAQTDDGQILAVKKINSSVLSNSEE--FLDIVSEISSLHHPNITE  475

Query  1615  LVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVC  1794
             LVGYC+EHGQ LLVY++  NGSLHD LH +DE S+ LTWN+RV++ALGTARALEYLHEVC
Sbjct  476   LVGYCSEHGQHLLVYEFHRNGSLHDFLHLSDEYSKPLTWNSRVKIALGTARALEYLHEVC  535

Query  1795  LPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSG  1974
              PSV+H+NFKSANILLD ELNPHLSDCGLA L    ++         + GYSAPE A+SG
Sbjct  536   SPSVIHKNFKSANILLDMELNPHLSDCGLANLVREPDQ---------ASGYSAPEVAMSG  586

Query  1975  VYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNG  2154
              YT+KSD+YSFGVVMLELLTGRKP DSSR RSEQSLVRWATPQLHDIDALSKMVDPAL G
Sbjct  587   QYTIKSDLYSFGVVMLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALKG  646

Query  2155  MYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFA  2322
             +YP KSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R + +E+  A
Sbjct  647   LYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTFGNEASRA  702


 Score =   246 bits (628),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 157/232 (68%), Gaps = 1/232 (0%)
 Frame = +1

Query  256  AALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAV  435
            A LI       A TDP D   L ++Y SLNSP  L+ WK +GGDPCGESWKGV+C GS V
Sbjct  18   ALLIGIPSSTNADTDPTDASTLNIMYTSLNSPPLLTNWKPNGGDPCGESWKGVSCSGSKV  77

Query  436  VSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSI  615
              I+IPGLGL G MGY L+  TS+   D+S+N + + IP+QLPPN+  LNLA N   G +
Sbjct  78   TEIKIPGLGLTGNMGYQLDRLTSVTTFDISNNNLGNQIPFQLPPNVQRLNLAGNGFNGGL  137

Query  616  PYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSM  795
            PYSISLMTSL YLN S N +   +   F + + L+TLD SFN+ + +LP S   L+N++ 
Sbjct  138  PYSISLMTSLRYLNVSHNQIQGQVNVQFNSLTSLSTLDFSFNSLTDNLPQSFQSLTNIND  197

Query  796  LRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            + +QNNQ TGSL+VL +LPL +LNV NN F+GWIP +L  I   + SGNSF+
Sbjct  198  MYLQNNQFTGSLDVLANLPLQNLNVENNHFTGWIPEQLKGI-NLKTSGNSFN  248



>ref|XP_004985464.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Setaria italica]
Length=752

 Score =   458 bits (1179),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 223/357 (62%), Positives = 275/357 (77%), Gaps = 18/357 (5%)
 Frame = +1

Query  1255  DKEVLDQRAKSTATVVDLKPPPSEKVTIERMQG------KNGSLRR----SPITATPYTV  1404
             +   +D  + ++   + LKPPP     IER +        N  + +    +PI AT Y+V
Sbjct  386   ESTTVDIESLASPASISLKPPPK----IERHKSFDDDDFSNRPVAKKSNITPIKATVYSV  441

Query  1405  AVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNM  1584
             A LQ AT+SFS +NLVGEG+ GRVYRA F +GKVLAIKK+DS  +  Q  D+F E +SN+
Sbjct  442   ADLQVATDSFSFDNLVGEGTFGRVYRAQFNDGKVLAIKKLDSTVMPFQSSDDFAELVSNI  501

Query  1585  SRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTA  1764
             S+L HPN+  LVGYC EHGQ LLVYD+  NGSLHD+LH +D+ S+ L+WN+RV++ALG+A
Sbjct  502   SKLHHPNLNELVGYCMEHGQHLLVYDFHRNGSLHDLLHLSDDYSKPLSWNSRVKIALGSA  561

Query  1765  RALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFG  1944
             RALEYLHE+C PS++H+NFKS+NILLD E NPH+SD GLA+  P+ E Q +      S G
Sbjct  562   RALEYLHEICSPSIIHKNFKSSNILLDSEFNPHVSDAGLASFIPDAEFQAAEQ----SAG  617

Query  1945  YSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDAL  2124
             Y+APE  ++G YT+KSDVYSFGVVMLELLTGR+P DSSR RSEQSLVRWATPQLHDIDAL
Sbjct  618   YTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDAL  677

Query  2125  SKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIR  2295
              +MVDPAL G+YPAKSLSRFAD++ALCVQPEPEFRPPMSEVVQALVRLVQRA++  R
Sbjct  678   DRMVDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANMTKR  734


 Score =   216 bits (551),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 121/257 (47%), Positives = 153/257 (60%), Gaps = 33/257 (13%)
 Frame = +1

Query  280  FVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGL  459
            F  A TDP+DL  L  L+ SLNSP QL+GW+A+GGDPCG+SWKG+TC GS V  I +  L
Sbjct  37   FAAADTDPSDLNVLNTLFTSLNSPGQLNGWQANGGDPCGQSWKGITCSGSGVTKILLSNL  96

Query  460  GLNGTMGYMLNGFTSLKELDLSSNEI--HDLIPYQLP-PNLTSLNLANNNITGSIPYSIS  630
            GL+G + Y +N   SL ELD+S N +     I Y LP   L  LNLA N   G++PYSIS
Sbjct  97   GLSGNLAYNMNNLGSLVELDMSQNSLGGGSQIQYNLPYMKLERLNLAGNQFGGNLPYSIS  156

Query  631  LMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSML----  798
             MT+L YLN + N L   I D+F++   LT +DLSFN+ +GDLP S   LS+L  L    
Sbjct  157  TMTNLKYLNLNHNQLQGNISDVFSSLYSLTDVDLSFNSLTGDLPQSFTGLSSLKHLYERM  216

Query  799  --------------------------RVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIP  900
                                       +QNNQ TG +NVL +LPL  LNVANNRF+GWIP
Sbjct  217  PVHLFSSPIHISLELFCINPFLFFLRYLQNNQFTGYINVLANLPLEALNVANNRFTGWIP  276

Query  901  NELISIPKFEYSGNSFS  951
            ++L  I   +  GNS+S
Sbjct  277  SQLKKINSIQTDGNSWS  293



>ref|XP_008465033.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
 ref|XP_008465034.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
Length=726

 Score =   457 bits (1177),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 221/370 (60%), Positives = 281/370 (76%), Gaps = 15/370 (4%)
 Frame = +1

Query  1267  LDQRAKSTATVVDLKPPPSEK---------VTIERMQGKNGSLRRSPITATPYTVAVLQT  1419
              D +   +  +++LKPPP ++           I  ++  N +   +P++   Y++A LQ 
Sbjct  360   FDAKELESPALINLKPPPIDRHKSFDDNDTSKIPVVKKTNVT---APLSVKSYSIADLQM  416

Query  1420  ATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRH  1599
             AT SF+ ENL+ EGSLGRVYRA F +GKVL +KK+DSAA   +  ++F E ++N+S+L H
Sbjct  417   ATGSFNVENLLDEGSLGRVYRAQFNDGKVLVVKKIDSAAFRRELLEDFTEIVANISQLHH  476

Query  1600  PNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEY  1779
             PN+  L+GYC+EH   LL+Y++  NGSLHD LH +DE S+ LTWN+RV++ALGTARALEY
Sbjct  477   PNVTELMGYCSEHSLHLLIYEFHKNGSLHDFLHISDEYSKPLTWNSRVKIALGTARALEY  536

Query  1780  LHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPE  1959
             LHEVC PSVVHRN KSANILLD E+NPHLSDCGLA+   N ++ +      GS GYSAPE
Sbjct  537   LHEVCSPSVVHRNIKSANILLDAEMNPHLSDCGLASFITNLDQALDQQ--TGS-GYSAPE  593

Query  1960  FALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVD  2139
               +SG YT+KSDVYSFGVVMLELL+GRKP DSSR R+EQSLVRWATPQLHDIDAL+KMVD
Sbjct  594   VTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTKMVD  653

Query  2140  PALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGF  2319
             PAL G+YP KSLSRFAD++ALCVQPEPEFRPPMSEVV+ALVRLVQR+++  R +  + G 
Sbjct  654   PALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSDHGS  713

Query  2320  AYKTPDHDAA  2349
             +++T D DA 
Sbjct  714   SFRTDDLDAC  723


 Score =   238 bits (606),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 158/237 (67%), Gaps = 1/237 (0%)
 Frame = +1

Query  241  VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
            +++ I  L  R+ F+  ATDP D+ AL  +Y SLNSP  L+ W +SGGDPCG+ WKG+TC
Sbjct  12   LLVSICILGWRISFINGATDPGDVSALNAMYSSLNSPPILTQWSSSGGDPCGQIWKGITC  71

Query  421  QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
             G  V  I + GLGL+GTMGY L+  TSL  LD+S+N +   IPYQLP NL  LNL  NN
Sbjct  72   LGLRVTEISLSGLGLSGTMGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNN  131

Query  601  ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
             +GSIPYSIS M+ L  LN S N L   + DMF   S L  LD+SFN  SG LP S   L
Sbjct  132  FSGSIPYSISQMSLLISLNMSHNQLQNQVNDMFWKLSSLAMLDISFNFLSGALPQSFSNL  191

Query  781  SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            ++L+ + +QNNQ +G+++VL +LPL +LNV NN F+GW+P  L +I   +  GNS+S
Sbjct  192  TSLNAMFLQNNQFSGTIDVLANLPLQNLNVENNHFTGWVPERLKNI-NIQEGGNSWS  247



>ref|XP_006342885.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Solanum 
tuberosum]
Length=711

 Score =   457 bits (1175),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 225/352 (64%), Positives = 276/352 (78%), Gaps = 22/352 (6%)
 Frame = +1

Query  1297  VVDLKPPPSEKVTIERMQGKN------------GSLRRSPITATPYTVAVLQTATNSFSQ  1440
             VV+L+PPP     IER +  +              +  + I A  Y++A LQ AT+SF+ 
Sbjct  357   VVNLRPPP-----IERHKSFDEVDIAAKPIVPPKKVNTAKIDARQYSIADLQMATDSFNV  411

Query  1441  ENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLV  1620
             +NL+GEGS GRVYRA F +GKVLA+KK++S+AL  Q  ++FL+ +S +SRL HPN+  LV
Sbjct  412   DNLIGEGSFGRVYRAQFDDGKVLAVKKINSSAL--QNPEDFLDIVSEISRLHHPNVTELV  469

Query  1621  GYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLP  1800
             GYC+EHGQ LLVY++  NGSLHD LH  DE S+ LTWN+RV++ALGTARALEYLHEVC P
Sbjct  470   GYCSEHGQHLLVYEFHKNGSLHDFLHLLDEESKPLTWNSRVKIALGTARALEYLHEVCSP  529

Query  1801  SVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVY  1980
             S+VH+N KSANI+LD ELNPHLSDCGLA+L  + ++ ++  H  GS GY APE A+SG+ 
Sbjct  530   SLVHKNIKSANIVLDAELNPHLSDCGLASLIADADQALN--HNTGS-GYGAPEVAMSGLC  586

Query  1981  TVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMY  2160
             T+KSDVYSFGVVMLELLTGRKP DS+R RSEQSLVRWATPQLHDIDAL+KMVDPAL G+Y
Sbjct  587   TIKSDVYSFGVVMLELLTGRKPFDSARTRSEQSLVRWATPQLHDIDALAKMVDPALEGLY  646

Query  2161  PAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             P KSLSRFAD+IALCVQPEPEFRPPMSEVV+ALVRLVQRA++  R +  + G
Sbjct  647   PVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFGADQG  698


 Score =   228 bits (581),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 156/221 (71%), Gaps = 2/221 (1%)
 Frame = +1

Query  289  AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
            A TDPND  AL VLY SLNSP QL+ W A+GGDPCGESW G+TC G+ V  I+I GLGL+
Sbjct  23   ADTDPNDASALRVLYSSLNSPGQLTKWNANGGDPCGESWTGITCSGNRVTEIKISGLGLS  82

Query  469  GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
            G++GY L   TS+   D+S+N + + +PYQLPPN+  LNLA N   G++PYS+S MTSL 
Sbjct  83   GSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAANGFNGALPYSVSQMTSLR  142

Query  649  YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
            YLN S N +   +   F + S L TLD SFN  +GDLP S   L++++ + +QNNQ TG+
Sbjct  143  YLNVSHNQIQGQVTVAFDSLSSLNTLDFSFNAMTGDLPQSFKALTSMNKMYLQNNQFTGT  202

Query  829  LNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            +++L +LPL DLNV NNRF+GW+P+ L  I K   +GNS++
Sbjct  203  IDILANLPLDDLNVENNRFTGWVPDHLKGITK--SNGNSWN  241



>ref|XP_008465035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Cucumis 
melo]
Length=722

 Score =   457 bits (1175),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 221/370 (60%), Positives = 281/370 (76%), Gaps = 15/370 (4%)
 Frame = +1

Query  1267  LDQRAKSTATVVDLKPPPSEK---------VTIERMQGKNGSLRRSPITATPYTVAVLQT  1419
              D +   +  +++LKPPP ++           I  ++  N +   +P++   Y++A LQ 
Sbjct  356   FDAKELESPALINLKPPPIDRHKSFDDNDTSKIPVVKKTNVT---APLSVKSYSIADLQM  412

Query  1420  ATNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRH  1599
             AT SF+ ENL+ EGSLGRVYRA F +GKVL +KK+DSAA   +  ++F E ++N+S+L H
Sbjct  413   ATGSFNVENLLDEGSLGRVYRAQFNDGKVLVVKKIDSAAFRRELLEDFTEIVANISQLHH  472

Query  1600  PNIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEY  1779
             PN+  L+GYC+EH   LL+Y++  NGSLHD LH +DE S+ LTWN+RV++ALGTARALEY
Sbjct  473   PNVTELMGYCSEHSLHLLIYEFHKNGSLHDFLHISDEYSKPLTWNSRVKIALGTARALEY  532

Query  1780  LHEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPE  1959
             LHEVC PSVVHRN KSANILLD E+NPHLSDCGLA+   N ++ +      GS GYSAPE
Sbjct  533   LHEVCSPSVVHRNIKSANILLDAEMNPHLSDCGLASFITNLDQALDQQ--TGS-GYSAPE  589

Query  1960  FALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVD  2139
               +SG YT+KSDVYSFGVVMLELL+GRKP DSSR R+EQSLVRWATPQLHDIDAL+KMVD
Sbjct  590   VTMSGQYTLKSDVYSFGVVMLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTKMVD  649

Query  2140  PALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGF  2319
             PAL G+YP KSLSRFAD++ALCVQPEPEFRPPMSEVV+ALVRLVQR+++  R +  + G 
Sbjct  650   PALKGLYPVKSLSRFADVVALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSDHGS  709

Query  2320  AYKTPDHDAA  2349
             +++T D DA 
Sbjct  710   SFRTDDLDAC  719


 Score =   237 bits (605),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 158/237 (67%), Gaps = 1/237 (0%)
 Frame = +1

Query  241  VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
            +++ I  L  R+ F+  ATDP D+ AL  +Y SLNSP  L+ W +SGGDPCG+ WKG+TC
Sbjct  12   LLVSICILGWRISFINGATDPGDVSALNAMYSSLNSPPILTQWSSSGGDPCGQIWKGITC  71

Query  421  QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
             G  V  I + GLGL+GTMGY L+  TSL  LD+S+N +   IPYQLP NL  LNL  NN
Sbjct  72   LGLRVTEISLSGLGLSGTMGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNN  131

Query  601  ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
             +GSIPYSIS M+ L  LN S N L   + DMF   S L  LD+SFN  SG LP S   L
Sbjct  132  FSGSIPYSISQMSLLISLNMSHNQLQNQVNDMFWKLSSLAMLDISFNFLSGALPQSFSNL  191

Query  781  SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            ++L+ + +QNNQ +G+++VL +LPL +LNV NN F+GW+P  L +I   +  GNS+S
Sbjct  192  TSLNAMFLQNNQFSGTIDVLANLPLQNLNVENNHFTGWVPERLKNI-NIQEGGNSWS  247



>ref|XP_008372915.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
 ref|XP_008372916.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
Length=714

 Score =   457 bits (1175),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 223/366 (61%), Positives = 281/366 (77%), Gaps = 9/366 (2%)
 Frame = +1

Query  1267  LDQRAKSTATVVDLKPPPSEK---VTIERMQGKNGSLRRS---PITATPYTVAVLQTATN  1428
             LD +   T  V++L+PPP ++      +    K   ++++   P+  T Y++A LQ AT 
Sbjct  347   LDLKTFDTPAVLNLRPPPVDRNKSFDEDEFAKKPIVVKKTVTAPLNVTSYSIADLQMATG  406

Query  1429  SFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNI  1608
             SFS +NL+GEGS GRVYRA F +GKVLA+KK+DS+ L  +  + F E +S++S+L HPN+
Sbjct  407   SFSIDNLLGEGSFGRVYRAQFDDGKVLAVKKLDSSVLPSELSEEFTEIVSSISQLHHPNV  466

Query  1609  VPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHE  1788
               LVGYC+EHGQ LLVY++  NGSLHD LH +DE ++ LTWN+RV++ALGTARALEYLHE
Sbjct  467   TELVGYCSEHGQHLLVYEFHKNGSLHDFLHLSDEYNKPLTWNSRVKIALGTARALEYLHE  526

Query  1789  VCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFAL  1968
             VC PS++H+N KS NILLD ELNPHLSD GLA+  PN ++ +   H  GS GYSAPE A+
Sbjct  527   VCSPSIIHKNIKSTNILLDVELNPHLSDSGLASSIPNADQALD--HNAGS-GYSAPEVAM  583

Query  1969  SGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPAL  2148
             SG YT+KSDVY FGVVMLELL+GRKP D+S+ RSEQSLVRWATPQLHDIDALSKMVDP L
Sbjct  584   SGQYTLKSDVYCFGVVMLELLSGRKPFDNSKPRSEQSLVRWATPQLHDIDALSKMVDPEL  643

Query  2149  NGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYK  2328
              G+YP KSLSRFAD+IALCVQPEPEFRPPMSEVV+ALVRLVQRA++  R   ++ G ++ 
Sbjct  644   KGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTVGNDQGSSHG  703

Query  2329  TPDHDA  2346
               + DA
Sbjct  704   GGNADA  709


 Score =   238 bits (607),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 159/223 (71%), Gaps = 1/223 (0%)
 Frame = +1

Query  283  VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLG  462
            + AATDP D+ AL+VLY SLNSPSQL+ W  +G DPCG+SWKGV C GS V  I++ GL 
Sbjct  24   INAATDPTDVSALKVLYSSLNSPSQLTQWIQNGDDPCGQSWKGVKCSGSRVTEIDLSGLQ  83

Query  463  LNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTS  642
            L+GT+GY L   T+L  LD+S+N +   IPYQLPPN+T LNL  NN    IPYSIS +TS
Sbjct  84   LSGTLGYQLQTLTALTNLDMSNNNLAGTIPYQLPPNMTRLNLGGNNFNQDIPYSISQITS  143

Query  643  LNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLT  822
            L YLN S N +   +GDMF   S L+ LDLSFN+ SG+LP S   LS+++ + +QNNQLT
Sbjct  144  LTYLNISHNQIQNQLGDMFGKLSSLSVLDLSFNSLSGNLPESFSSLSSMTTMFLQNNQLT  203

Query  823  GSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            G+++VL +LPL +LN+ NN F+GWIP +L +I   E  GN ++
Sbjct  204  GTIDVLANLPLDNLNIENNHFTGWIPEQLKNI-NLEKDGNMWN  245



>ref|XP_006426818.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
 gb|ESR40058.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
Length=723

 Score =   457 bits (1175),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 224/356 (63%), Positives = 276/356 (78%), Gaps = 9/356 (3%)
 Frame = +1

Query  1267  LDQRAKSTATVVDLKPPPSEK---VTIERMQGKNGSLRRS---PITATPYTVAVLQTATN  1428
             +D +   TA  ++L+PPP ++      E    K   ++++   P   T Y++A LQ AT 
Sbjct  356   IDTKTFDTAVSINLRPPPIDRHKSFDEEDFSKKPIVVKKAVKAPTNVTSYSIADLQMATG  415

Query  1429  SFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNI  1608
             SF+ ENL+G G+ GRVYRA F +GKVLA+KK+DS+AL  +  D+F+E +SN+S+L HPNI
Sbjct  416   SFNVENLLGGGTFGRVYRAQFADGKVLAVKKIDSSALPSEMCDDFIEMVSNISQLHHPNI  475

Query  1609  VPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHE  1788
             + LVGYC+E+GQ LLVY++  NGSLHD LH +DE ++ L WN+RV++ALGTARALEYLHE
Sbjct  476   MELVGYCSEYGQHLLVYEFRKNGSLHDFLHLSDEDNKPLIWNSRVKIALGTARALEYLHE  535

Query  1789  VCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFAL  1968
             VC  SVVH+N KSANILLD ELNP LSDCGLA+  PN +  +++    GS GY APE A+
Sbjct  536   VCSLSVVHKNIKSANILLDNELNPQLSDCGLASNMPNADEALNND--AGS-GYGAPEVAM  592

Query  1969  SGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPAL  2148
             SG Y +KSDVYSFGVVMLELLTGRKP DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL
Sbjct  593   SGQYNIKSDVYSFGVVMLELLTGRKPFDSSRPRLEQSLVRWATPQLHDIDALAKMVDPAL  652

Query  2149  NGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
              G+YP KSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R   ++ G
Sbjct  653   KGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTIGNDQG  708


 Score =   238 bits (607),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 168/240 (70%), Gaps = 5/240 (2%)
 Frame = +1

Query  244  VLVIAALISRLGF----VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKG  411
            VL++   +  LG+    + AATDP+D  AL+++Y SLNSPSQLS W A+G DPCG+SWKG
Sbjct  11   VLLVLFKVCILGWKTSCINAATDPSDASALKIMYSSLNSPSQLSQWSATGDDPCGQSWKG  70

Query  412  VTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLA  591
            V C G  V  +++ GLGL+G++GY L+  T+L  LDLS+N     IPY +PPNL  L+L 
Sbjct  71   VICSGQRVTELKLSGLGLSGSVGYQLSSLTALTNLDLSNNNFGGDIPYNIPPNLERLDLE  130

Query  592  NNNITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASL  771
            NN  TG++PYSIS M +L Y+N + N L   + DMF     L+TLDLSFN  SG+LP S 
Sbjct  131  NNKFTGNVPYSISQMKTLKYVNIAHNQLQGQLNDMFGQLPSLSTLDLSFNTLSGNLPQSF  190

Query  772  GLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
              LS+LS L +QNNQ +G+++VL +LPL +LN+ANNRF+GW+P +L +I   +  GNS+S
Sbjct  191  SSLSSLSSLYLQNNQFSGTIDVLANLPLDNLNIANNRFTGWVPEQLKNI-NLQKDGNSWS  249



>gb|EYU21255.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=705

 Score =   456 bits (1173),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 226/355 (64%), Positives = 279/355 (79%), Gaps = 23/355 (6%)
 Frame = +1

Query  1276  RAKSTATVVDLKPPPSEKVTIERMQGKNG----------SLRRSPITATPYTVAVLQTAT  1425
             +A  T  +++L+PPP ++    +   +N            +  +PI +  YTVA LQ AT
Sbjct  349   KAFETPAMLNLRPPPFDR---HKSFDENDDSAKPIVPVKKVNTAPINSKLYTVADLQIAT  405

Query  1426  NSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPN  1605
             +SFS ENL+GEGS+GRVYRA   +GKV+A+KK++S+A+S  E+  FLE +S +SRL HPN
Sbjct  406   DSFSVENLIGEGSIGRVYRAQLDDGKVVAVKKINSSAVSNSED--FLEIVSEISRLHHPN  463

Query  1606  IVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLH  1785
             +  LVGYC+EHGQ LL+Y++  NGSL++ LH +DE S+ LTWN RV++ALGTARALEYLH
Sbjct  464   VTELVGYCSEHGQHLLIYEFHKNGSLNEFLHVSDEFSKPLTWNTRVKIALGTARALEYLH  523

Query  1786  EVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFA  1965
             EVC PSV+H+NFKSANILLD ELNPHLSDC LA+L  + + Q++S       GYSAPE A
Sbjct  524   EVCSPSVIHKNFKSANILLDIELNPHLSDCVLASLVRDPD-QVAS-------GYSAPEVA  575

Query  1966  LSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPA  2145
             +SG YT+KSDVYSFGVVMLELLTGR P DS+R+RSEQSLVRWATPQLHDIDALSKMVDPA
Sbjct  576   MSGQYTIKSDVYSFGVVMLELLTGRTPFDSARQRSEQSLVRWATPQLHDIDALSKMVDPA  635

Query  2146  LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDE  2310
             L G+YP KSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R + +E
Sbjct  636   LKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTFGNE  690


 Score =   258 bits (659),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 157/226 (69%), Gaps = 0/226 (0%)
 Frame = +1

Query  241  VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
            VV  +A LI  L F GA TDP D   L VLY SLNSP QL+ WK SGGDPC ESWKG+TC
Sbjct  3    VVAAVALLIGILSFTGADTDPTDASTLNVLYTSLNSPQQLTNWKPSGGDPCAESWKGITC  62

Query  421  QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
             GS V  I IPGLGLNG MG+ L+  TS+   D+S+N + + IPYQLPPN+  LNLA N 
Sbjct  63   SGSKVTEINIPGLGLNGNMGFQLDKLTSVTTFDISNNNLGNQIPYQLPPNVERLNLAGNG  122

Query  601  ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
                +PYSISLM +L YLN S N +   +   FT+ + LTTLD SFN+F+ +LP S   L
Sbjct  123  FNAGLPYSISLMGALKYLNLSHNQIQGQVTVQFTSLTGLTTLDFSFNSFTDNLPQSFQSL  182

Query  781  SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISI  918
            ++++ + +QNNQ TG+L+VL  LPL +LNV NNRF+GWIP++L  I
Sbjct  183  TSINDMYLQNNQFTGTLDVLALLPLQNLNVENNRFTGWIPSQLKGI  228



>ref|XP_008659003.1| PREDICTED: leucine-rich repeat transmembrane protein kinase 2 
isoform X1 [Zea mays]
Length=684

 Score =   454 bits (1169),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 230/405 (57%), Positives = 284/405 (70%), Gaps = 26/405 (6%)
 Frame = +1

Query  1183  YCLRRCKKKEFAARTSTGSLPLST--DKEVLDQRAKSTATVVD-----------LKPPPS  1323
             + ++R K K           P ++    EV D +    +T VD           LKPPP 
Sbjct  279   FLIKRRKHKAIMEEQFEQHQPFTSFPSNEVNDMKPIYESTTVDIESLASPASINLKPPPK  338

Query  1324  ----EKVTIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYR  1482
                 +    +       +  RS   P+ AT Y+VA LQ AT+SFS +NLVGEG+ GRVYR
Sbjct  339   IEQNKSFDDDDDFSNKTAANRSNITPMKATVYSVADLQMATDSFSFDNLVGEGTFGRVYR  398

Query  1483  ADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYD  1662
             A F  GKVLAIKK+D   +  Q  D+F E +SN+S+L HPN+  LVGYC EHGQ LLVYD
Sbjct  399   AQFNGGKVLAIKKLDITVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYD  458

Query  1663  YIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILL  1842
             +  NGSLHD+LH +DE S+ L+WN+R+++ALG+ARALEYLHE+C PS++H+NFK++NILL
Sbjct  459   FHRNGSLHDLLHLSDEYSKALSWNSRIKIALGSARALEYLHEICSPSIIHKNFKASNILL  518

Query  1843  DEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVML  2022
             D E NPHLSD GLA+  P+ E Q +      S GY+APE  ++G YT+KSDVYSFGVVML
Sbjct  519   DSEFNPHLSDTGLASFIPDAEFQAAEQ----SAGYTAPEVDMTGQYTLKSDVYSFGVVML  574

Query  2023  ELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIAL  2202
             ELLTGR+P DSSR RSEQSLVRWA PQLHDIDAL +MVDPAL G+YPAKSLSRFAD++AL
Sbjct  575   ELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLAL  634

Query  2203  CVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPD  2337
             CVQPEPEFRPPMSEVVQALVRLVQRA++  R    + G   + PD
Sbjct  635   CVQPEPEFRPPMSEVVQALVRLVQRANMTKRML--DGGDTSRGPD  677


 Score =   211 bits (536),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 140/217 (65%), Gaps = 3/217 (1%)
 Frame = +1

Query  310  LQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYML  489
            +  L  L+ SLNSP QL  W+A+GGDPCG+SW+G+TC GS V  I +P L L G + Y +
Sbjct  3    VNVLNTLFTSLNSPGQLRAWQANGGDPCGQSWQGITCSGSGVTKILLPNLSLTGNLAYNM  62

Query  490  NGFTSLKELDLSSNEIHD--LIPYQLPP-NLTSLNLANNNITGSIPYSISLMTSLNYLNF  660
            N   SL ELDLS N +     I Y LP   L  LNLA N   G++PYSIS M +L YLN 
Sbjct  63   NNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTMPNLKYLNL  122

Query  661  SGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVL  840
            + N L   I D+F+N   L+ LDLSFN+ +GDLP S   LS+L  + +QNNQ TG +NVL
Sbjct  123  NHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKRMYLQNNQFTGYINVL  182

Query  841  VDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
             +LPL  LNV NN F+GWIP++L  I   +  GNS+S
Sbjct  183  ANLPLETLNVGNNHFTGWIPSQLKKINNLQTDGNSWS  219



>ref|XP_004235517.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=710

 Score =   455 bits (1171),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 224/352 (64%), Positives = 276/352 (78%), Gaps = 22/352 (6%)
 Frame = +1

Query  1297  VVDLKPPPSEKVTIERMQGKNGS------------LRRSPITATPYTVAVLQTATNSFSQ  1440
             VV+L+PPP     IER +  + +            +  + I A  Y++A LQ AT SF+ 
Sbjct  356   VVNLRPPP-----IERHKSFDEADIAAKPIVPPKKVNTAKIDARQYSIADLQMATESFNV  410

Query  1441  ENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLV  1620
             +NL+GEGS GRVYRA F +GKVLA+KK++S+AL  Q  ++FL+ +S +SRL HPN+  LV
Sbjct  411   DNLIGEGSFGRVYRAQFDDGKVLAVKKINSSAL--QNPEDFLDIVSEISRLNHPNVTELV  468

Query  1621  GYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLP  1800
             GYC+EHGQ LLVY++  NGSLHD LH +DE S+ LTWN+RV++ALGTARALEYLHEVC P
Sbjct  469   GYCSEHGQHLLVYEFHKNGSLHDFLHLSDEESKPLTWNSRVKIALGTARALEYLHEVCSP  528

Query  1801  SVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVY  1980
             S+VH+N KSANI+LD ELNPHLSDCGLA+L  + ++ ++  H  GS GY APE A+SG+ 
Sbjct  529   SLVHKNIKSANIVLDAELNPHLSDCGLASLIADADQALN--HNTGS-GYGAPEVAMSGLC  585

Query  1981  TVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMY  2160
             T+KSDVYSFGVVMLELLTGRKP DS+R RSEQ LVRWATPQLHDIDAL+KMVDPAL G+Y
Sbjct  586   TIKSDVYSFGVVMLELLTGRKPFDSARTRSEQDLVRWATPQLHDIDALAKMVDPALEGLY  645

Query  2161  PAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESG  2316
             P KSLSRFAD+IALCVQPEPEFRPPMSEVV+ALVRLVQRA++  R +  + G
Sbjct  646   PVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFGADQG  697


 Score =   226 bits (576),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 160/235 (68%), Gaps = 2/235 (1%)
 Frame = +1

Query  247  LVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQG  426
            L+I  L+       A TDPND  AL VLY SLNSP QL+ W A+GGDPCGESW G+TC G
Sbjct  8    LLIGILLYCAYCAIADTDPNDASALRVLYSSLNSPGQLTKWNANGGDPCGESWTGITCSG  67

Query  427  SAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNIT  606
            + V  I+I GLGL+G++GY L   TS+   D+S+N + + +P+QLPPN+  LNLA N   
Sbjct  68   NRVTEIKISGLGLSGSLGYQLTSLTSVTNFDISNNNLGNQLPFQLPPNVQRLNLAANGFN  127

Query  607  GSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSN  786
            G +PYSIS MTSL YLN S N +   +  MF + S L TLD SFN+ +GDLP S   L++
Sbjct  128  GGLPYSISQMTSLRYLNVSHNQIQGQVTVMFDSLSSLDTLDFSFNSMTGDLPQSFKALTS  187

Query  787  LSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            ++ + +QNNQ TG+++VL +LPL DLNV  N F+GW+P+ L  I K   +GNS++
Sbjct  188  MNKMYLQNNQFTGTIDVLANLPLDDLNVEKNHFTGWVPDHLKGITK--SNGNSWN  240



>ref|XP_009614011.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nicotiana tomentosiformis]
Length=717

 Score =   455 bits (1171),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 223/342 (65%), Positives = 272/342 (80%), Gaps = 12/342 (4%)
 Frame = +1

Query  1297  VVDLKPPPSEK---VTIERMQGKN----GSLRRSPITATPYTVAVLQTATNSFSQENLVG  1455
             VV+L+PPP E+      + +  K       +  + I A  Y++A LQ AT+SFS +NL+G
Sbjct  363   VVNLRPPPIERHKSFDEDDIAAKPIVPPKKVNTAKINARQYSIADLQMATDSFSVDNLIG  422

Query  1456  EGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAE  1635
             EGS GRVYRA F +GKVLA+KK++S+AL  Q  ++FL+ +S +S L HPN+  LVGYC+E
Sbjct  423   EGSFGRVYRAQFDDGKVLAVKKINSSAL--QNPEDFLDIVSEISGLHHPNVTELVGYCSE  480

Query  1636  HGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHR  1815
             HGQ LLVY++  NG+LHD LH +DE S+ LTWN+RV++ALGTARALEYLHEVC PSVVH+
Sbjct  481   HGQHLLVYEFHKNGALHDFLHLSDEESKPLTWNSRVKIALGTARALEYLHEVCSPSVVHK  540

Query  1816  NFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSD  1995
             N KSANILLD ELNPHLSDCGLA+L  + ++ ++  H  GS GY APE A+SG +T+KSD
Sbjct  541   NIKSANILLDAELNPHLSDCGLASLIADVDQALN--HNTGS-GYGAPEVAMSGQFTIKSD  597

Query  1996  VYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSL  2175
             VYSFGVVMLELLTGRKP D  R RSEQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSL
Sbjct  598   VYSFGVVMLELLTGRKPFDGGRTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSL  657

Query  2176  SRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRY  2301
             SRFAD+IALCVQPEPEFRPPMSEVV+ALVRLVQRA++  R +
Sbjct  658   SRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTF  699


 Score =   235 bits (599),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 155/222 (70%), Gaps = 3/222 (1%)
 Frame = +1

Query  289  AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGS-AVVSIEIPGLGL  465
            A TDPND  AL V+YG+LNSP QL+ W A+GGDPCGESWKG+TC G+  V  I++ GL L
Sbjct  27   ADTDPNDASALRVMYGALNSPGQLTKWTANGGDPCGESWKGITCSGNNRVTEIKLSGLQL  86

Query  466  NGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSL  645
            +G++GY L   TS+   D+S+N + + +PYQLPPN+  LNLA N   G +PYSIS MTSL
Sbjct  87   SGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAGNGFNGGLPYSISQMTSL  146

Query  646  NYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTG  825
             YLN S N +   +   F + S L TLD SFN  + +LP S   L++++ + +QNNQ TG
Sbjct  147  RYLNVSHNQIQGQVTVAFDSLSSLNTLDFSFNAMTDNLPQSFKALTSMNKMYLQNNQFTG  206

Query  826  SLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            +++VL +LPL DLNV NNRF+GW+P++L    K   +GNS++
Sbjct  207  TIDVLANLPLDDLNVENNRFTGWVPDQLKGFVK--SNGNSWN  246



>gb|EYU21256.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=704

 Score =   454 bits (1169),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 224/355 (63%), Positives = 277/355 (78%), Gaps = 24/355 (7%)
 Frame = +1

Query  1276  RAKSTATVVDLKPPPSEKVTIERMQGKNG----------SLRRSPITATPYTVAVLQTAT  1425
             +A  T  +++L+PPP ++    +   +N            +  +PI +  YTVA LQ AT
Sbjct  349   KAFETPAMLNLRPPPFDR---HKSFDENDDSAKPIVPVKKVNTAPINSKLYTVADLQIAT  405

Query  1426  NSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPN  1605
             +SFS ENL+GEGS+GRVYRA   +GKV+A+KK++S+A+S  E+  FLE +S +SRL HPN
Sbjct  406   DSFSVENLIGEGSIGRVYRAQLDDGKVVAVKKINSSAVSNSED--FLEIVSEISRLHHPN  463

Query  1606  IVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLH  1785
             +  LVGYC+EHGQ LL+Y++  NGSL++ LH +DE S+ LTWN RV++ALGTARALEYLH
Sbjct  464   VTELVGYCSEHGQHLLIYEFHKNGSLNEFLHVSDEFSKPLTWNTRVKIALGTARALEYLH  523

Query  1786  EVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFA  1965
             EVC PSV+H+NFKSANILLD ELNPHLSDC LA+L  + ++         + GYSAPE A
Sbjct  524   EVCSPSVIHKNFKSANILLDIELNPHLSDCVLASLVRDPDQ---------ASGYSAPEVA  574

Query  1966  LSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPA  2145
             +SG YT+KSDVYSFGVVMLELLTGR P DS+R+RSEQSLVRWATPQLHDIDALSKMVDPA
Sbjct  575   MSGQYTIKSDVYSFGVVMLELLTGRTPFDSARQRSEQSLVRWATPQLHDIDALSKMVDPA  634

Query  2146  LNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDE  2310
             L G+YP KSLSRFAD+IALCVQPEPEFRPPMSEVVQALVRLVQRA++  R + +E
Sbjct  635   LKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTFGNE  689


 Score =   258 bits (659),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 157/226 (69%), Gaps = 0/226 (0%)
 Frame = +1

Query  241  VVLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTC  420
            VV  +A LI  L F GA TDP D   L VLY SLNSP QL+ WK SGGDPC ESWKG+TC
Sbjct  3    VVAAVALLIGILSFTGADTDPTDASTLNVLYTSLNSPQQLTNWKPSGGDPCAESWKGITC  62

Query  421  QGSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNN  600
             GS V  I IPGLGLNG MG+ L+  TS+   D+S+N + + IPYQLPPN+  LNLA N 
Sbjct  63   SGSKVTEINIPGLGLNGNMGFQLDKLTSVTTFDISNNNLGNQIPYQLPPNVERLNLAGNG  122

Query  601  ITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLL  780
                +PYSISLM +L YLN S N +   +   FT+ + LTTLD SFN+F+ +LP S   L
Sbjct  123  FNAGLPYSISLMGALKYLNLSHNQIQGQVTVQFTSLTGLTTLDFSFNSFTDNLPQSFQSL  182

Query  781  SNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISI  918
            ++++ + +QNNQ TG+L+VL  LPL +LNV NNRF+GWIP++L  I
Sbjct  183  TSINDMYLQNNQFTGTLDVLALLPLQNLNVENNRFTGWIPSQLKGI  228



>gb|KEH18524.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=685

 Score =   454 bits (1167),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 290/406 (71%), Gaps = 24/406 (6%)
 Frame = +1

Query  1192  RRCKKKEFAARTSTGSLPLS--TDKEVLDQRAKSTATVVDLK------------PPPSEK  1329
             +R KKK F       + PL+  T  EV  + +  T++V+DLK            PPP ++
Sbjct  280   KRSKKKSFGDVEKLDNQPLAPLTSNEVHGRNSTQTSSVIDLKTFDTSAAAISLKPPPFDR  339

Query  1330  ---VTIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADF  1491
                   + +  K   ++++   P     Y++A LQ AT SFS ++L+GEGS GRVYRA F
Sbjct  340   NKSFDEDELPKKPIVVKKTVAPPANLKSYSIADLQIATGSFSVDHLLGEGSFGRVYRAQF  399

Query  1492  PNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIG  1671
              +G+VLA+KK+DS+ L     D+F+E +SN+SRL HPN+  L+GYC+EHGQ LLVY+Y  
Sbjct  400   DDGQVLAVKKIDSSVLPNNLSDDFMEIVSNLSRLHHPNVTELIGYCSEHGQHLLVYEYHK  459

Query  1672  NGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE  1851
             NGSLHD LH  D+  + L WN+RV+VALG ARALEYLHE+C PSVVH+N K+ANILLD +
Sbjct  460   NGSLHDFLHLPDDYIKPLIWNSRVKVALGIARALEYLHEICSPSVVHKNIKAANILLDAD  519

Query  1852  LNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELL  2031
             LNPHLSD GLA+  PNT + +++    GS GY APE  L+G YT+KSDVYSFGVVMLELL
Sbjct  520   LNPHLSDSGLASYIPNTNQVLNNNS--GS-GYDAPEVGLTGQYTLKSDVYSFGVVMLELL  576

Query  2032  TGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQ  2211
             +GRKP DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL GMYP KSLSRFAD+IALCVQ
Sbjct  577   SGRKPFDSSRSRFEQSLVRWATPQLHDIDALAKMVDPALEGMYPVKSLSRFADVIALCVQ  636

Query  2212  PEPEFRPPMSEVVQALVRLVQRASVVIRRY-SDESGFAYKTPDHDA  2346
              EPEFRPPMSEVVQALVRLVQR ++  R + +D+ G      D D+
Sbjct  637   SEPEFRPPMSEVVQALVRLVQRTNMSKRTFGADQGGSNRGGDDQDS  682


 Score =   211 bits (537),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 145/214 (68%), Gaps = 4/214 (2%)
 Frame = +1

Query  310  LQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYML  489
            + AL  L+ S+NSPSQL+ W  +G DPCG+SW G+TC G+ +  I++PG  L GT+G+ L
Sbjct  1    MSALMALFQSMNSPSQLN-W--NGNDPCGQSWTGITCSGNRITEIKLPGRQLTGTLGFQL  57

Query  490  NGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGN  669
               +S+  LDLS+N +   +PYQ PPNL  LNLANNN  G IPYS S   SL  LNF  N
Sbjct  58   QSLSSVTNLDLSNNNLAGTLPYQFPPNLQHLNLANNNFNGGIPYSFSDTPSLISLNFGHN  117

Query  670  SLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDL  849
               Q +   F   + LTT D+SFN+ +GDLP ++  LS++S + +QNNQ TG++++L DL
Sbjct  118  QFQQALNLNFQKLTSLTTFDVSFNSLTGDLPQTMNSLSSISTMNLQNNQFTGTIDILADL  177

Query  850  PLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            PL +LN+ NN F+GWIP +L +I   + +GNS+S
Sbjct  178  PLDNLNIENNHFTGWIPEQLKNI-NLQKNGNSWS  210



>ref|XP_009796493.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
sylvestris]
Length=718

 Score =   455 bits (1170),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 227/361 (63%), Positives = 278/361 (77%), Gaps = 16/361 (4%)
 Frame = +1

Query  1297  VVDLKPPPSEK---VTIERMQGKN----GSLRRSPITATPYTVAVLQTATNSFSQENLVG  1455
             VV+L+PPP E+      + +  K       +  + I A  Y++A LQ AT+SFS +NL+G
Sbjct  364   VVNLRPPPIERHKSFDEDDIAAKPIVPPKKVNTAKINARQYSIADLQMATDSFSVDNLIG  423

Query  1456  EGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAE  1635
             EGS GRVYRA F +GKVLA+KK++S+AL  Q  ++FL+ +S +S L HPN+  LVGYC+E
Sbjct  424   EGSFGRVYRAQFDDGKVLAVKKINSSAL--QNPEDFLDIVSEISGLHHPNVTELVGYCSE  481

Query  1636  HGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHR  1815
             HGQ LLVY++  NG+LHD LH +DE S+ LTWN RV++ALGTARALEYLHEVC PSVVH+
Sbjct  482   HGQHLLVYEFHKNGALHDFLHLSDEESKPLTWNNRVKIALGTARALEYLHEVCSPSVVHK  541

Query  1816  NFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSD  1995
             N KSANILLD ELNPHLSDCGLA+L  + ++ ++  H  GS GY APE A+SG +T+KSD
Sbjct  542   NIKSANILLDAELNPHLSDCGLASLIADVDQALN--HNTGS-GYGAPEVAMSGQFTIKSD  598

Query  1996  VYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSL  2175
             VYSFGVVMLELLTGRKP D  R RSEQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSL
Sbjct  599   VYSFGVVMLELLTGRKPFDGGRSRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSL  658

Query  2176  SRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHDAASG  2355
             SRFAD+IALCVQPEPEFRPPMSEVV+ALVRLVQRA++  R +    G    +P  +A + 
Sbjct  659   SRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTF----GVDQASPRGEADAQ  714

Query  2356  D  2358
             D
Sbjct  715   D  715


 Score =   235 bits (599),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 158/234 (68%), Gaps = 3/234 (1%)
 Frame = +1

Query  253  IAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGS-  429
            I  L     +  A TDPND  AL V+YG+LNSP QL+ W A+GGDPCGESWKG+TC G+ 
Sbjct  15   IGILFYGPSYAIADTDPNDASALRVMYGALNSPGQLTKWTANGGDPCGESWKGITCSGNN  74

Query  430  AVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITG  609
             V  I++ GL L+G++GY L   TS+   D+S+N + + +PYQLPPN+  LNLA N   G
Sbjct  75   RVTEIKLSGLQLSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAGNGFNG  134

Query  610  SIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNL  789
             +PYSIS MTSL YLN S N +   +   F + S L TLD SFN  + +LP S   L+++
Sbjct  135  GLPYSISQMTSLRYLNVSHNQIQGQVTVAFDSLSSLNTLDFSFNAMTDNLPQSFKALTSM  194

Query  790  SMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            + + +QNNQ TG+++VL +LPL DLNV NNRF+GW+P++L    K   +GNS++
Sbjct  195  NKMYLQNNQFTGTIDVLANLPLDDLNVENNRFTGWVPDQLKGFVK--SNGNSWN  246



>ref|XP_003627481.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula]
 gb|AET01957.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=716

 Score =   454 bits (1168),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 290/406 (71%), Gaps = 24/406 (6%)
 Frame = +1

Query  1192  RRCKKKEFAARTSTGSLPLS--TDKEVLDQRAKSTATVVDLK------------PPPSEK  1329
             +R KKK F       + PL+  T  EV  + +  T++V+DLK            PPP ++
Sbjct  311   KRSKKKSFGDVEKLDNQPLAPLTSNEVHGRNSTQTSSVIDLKTFDTSAAAISLKPPPFDR  370

Query  1330  ---VTIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADF  1491
                   + +  K   ++++   P     Y++A LQ AT SFS ++L+GEGS GRVYRA F
Sbjct  371   NKSFDEDELPKKPIVVKKTVAPPANLKSYSIADLQIATGSFSVDHLLGEGSFGRVYRAQF  430

Query  1492  PNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIG  1671
              +G+VLA+KK+DS+ L     D+F+E +SN+SRL HPN+  L+GYC+EHGQ LLVY+Y  
Sbjct  431   DDGQVLAVKKIDSSVLPNNLSDDFMEIVSNLSRLHHPNVTELIGYCSEHGQHLLVYEYHK  490

Query  1672  NGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEE  1851
             NGSLHD LH  D+  + L WN+RV+VALG ARALEYLHE+C PSVVH+N K+ANILLD +
Sbjct  491   NGSLHDFLHLPDDYIKPLIWNSRVKVALGIARALEYLHEICSPSVVHKNIKAANILLDAD  550

Query  1852  LNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELL  2031
             LNPHLSD GLA+  PNT + +++    GS GY APE  L+G YT+KSDVYSFGVVMLELL
Sbjct  551   LNPHLSDSGLASYIPNTNQVLNNNS--GS-GYDAPEVGLTGQYTLKSDVYSFGVVMLELL  607

Query  2032  TGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQ  2211
             +GRKP DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL GMYP KSLSRFAD+IALCVQ
Sbjct  608   SGRKPFDSSRSRFEQSLVRWATPQLHDIDALAKMVDPALEGMYPVKSLSRFADVIALCVQ  667

Query  2212  PEPEFRPPMSEVVQALVRLVQRASVVIRRY-SDESGFAYKTPDHDA  2346
              EPEFRPPMSEVVQALVRLVQR ++  R + +D+ G      D D+
Sbjct  668   SEPEFRPPMSEVVQALVRLVQRTNMSKRTFGADQGGSNRGGDDQDS  713


 Score =   222 bits (566),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 151/223 (68%), Gaps = 4/223 (2%)
 Frame = +1

Query  283  VGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLG  462
            +   TDPND+ AL  L+ S+NSPSQL+ W  +G DPCG+SW G+TC G+ +  I++PG  
Sbjct  23   INGDTDPNDVSALMALFQSMNSPSQLN-W--NGNDPCGQSWTGITCSGNRITEIKLPGRQ  79

Query  463  LNGTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTS  642
            L GT+G+ L   +S+  LDLS+N +   +PYQ PPNL  LNLANNN  G IPYS S   S
Sbjct  80   LTGTLGFQLQSLSSVTNLDLSNNNLAGTLPYQFPPNLQHLNLANNNFNGGIPYSFSDTPS  139

Query  643  LNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLT  822
            L  LNF  N   Q +   F   + LTT D+SFN+ +GDLP ++  LS++S + +QNNQ T
Sbjct  140  LISLNFGHNQFQQALNLNFQKLTSLTTFDVSFNSLTGDLPQTMNSLSSISTMNLQNNQFT  199

Query  823  GSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            G++++L DLPL +LN+ NN F+GWIP +L +I   + +GNS+S
Sbjct  200  GTIDILADLPLDNLNIENNHFTGWIPEQLKNI-NLQKNGNSWS  241



>gb|AFW89442.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=725

 Score =   454 bits (1167),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 230/405 (57%), Positives = 284/405 (70%), Gaps = 26/405 (6%)
 Frame = +1

Query  1183  YCLRRCKKKEFAARTSTGSLPLST--DKEVLDQRAKSTATVVD-----------LKPPPS  1323
             + ++R K K           P ++    EV D +    +T VD           LKPPP 
Sbjct  320   FLIKRRKHKAIMEEQFEQHQPFTSFPSNEVNDMKPIYESTTVDIESLASPASINLKPPPK  379

Query  1324  ----EKVTIERMQGKNGSLRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVYR  1482
                 +    +       +  RS   P+ AT Y+VA LQ AT+SFS +NLVGEG+ GRVYR
Sbjct  380   IEQNKSFDDDDDFSNKTAANRSNITPMKATVYSVADLQMATDSFSFDNLVGEGTFGRVYR  439

Query  1483  ADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYD  1662
             A F  GKVLAIKK+D   +  Q  D+F E +SN+S+L HPN+  LVGYC EHGQ LLVYD
Sbjct  440   AQFNGGKVLAIKKLDITVMPFQSSDDFAELVSNISKLHHPNLNELVGYCMEHGQHLLVYD  499

Query  1663  YIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILL  1842
             +  NGSLHD+LH +DE S+ L+WN+R+++ALG+ARALEYLHE+C PS++H+NFK++NILL
Sbjct  500   FHRNGSLHDLLHLSDEYSKALSWNSRIKIALGSARALEYLHEICSPSIIHKNFKASNILL  559

Query  1843  DEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVML  2022
             D E NPHLSD GLA+  P+ E Q +      S GY+APE  ++G YT+KSDVYSFGVVML
Sbjct  560   DSEFNPHLSDTGLASFIPDAEFQAAEQ----SAGYTAPEVDMTGQYTLKSDVYSFGVVML  615

Query  2023  ELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIAL  2202
             ELLTGR+P DSSR RSEQSLVRWA PQLHDIDAL +MVDPAL G+YPAKSLSRFAD++AL
Sbjct  616   ELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLAL  675

Query  2203  CVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPD  2337
             CVQPEPEFRPPMSEVVQALVRLVQRA++  R    + G   + PD
Sbjct  676   CVQPEPEFRPPMSEVVQALVRLVQRANMTKRML--DGGDTSRGPD  718


 Score =   227 bits (579),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 147/227 (65%), Gaps = 3/227 (1%)
 Frame = +1

Query  280  FVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGL  459
            F  A TDPNDL  L  L+ SLNSP QL  W+A+GGDPCG+SW+G+TC GS V  I +P L
Sbjct  34   FTAADTDPNDLNVLNTLFTSLNSPGQLRAWQANGGDPCGQSWQGITCSGSGVTKILLPNL  93

Query  460  GLNGTMGYMLNGFTSLKELDLSSNEIHD--LIPYQLPP-NLTSLNLANNNITGSIPYSIS  630
             L G + Y +N   SL ELDLS N +     I Y LP   L  LNLA N   G++PYSIS
Sbjct  94   SLTGNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSIS  153

Query  631  LMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQN  810
             M +L YLN + N L   I D+F+N   L+ LDLSFN+ +GDLP S   LS+L  + +QN
Sbjct  154  TMPNLKYLNLNHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKRMYLQN  213

Query  811  NQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            NQ TG +NVL +LPL  LNV NN F+GWIP++L  I   +  GNS+S
Sbjct  214  NQFTGYINVLANLPLETLNVGNNHFTGWIPSQLKKINNLQTDGNSWS  260



>gb|KHG12210.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=689

 Score =   451 bits (1160),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 225/367 (61%), Positives = 275/367 (75%), Gaps = 12/367 (3%)
 Frame = +1

Query  1267  LDQRAKSTATVVDLKPPPSEK--------VTIERMQGKNGSLRRSPITATPYTVAVLQTA  1422
             LD ++      ++L+PPP ++         +++ ++ K      +P   T Y++A LQ A
Sbjct  320   LDTKSFEIPASINLRPPPVDRHKSFDEDDFSVKPVEVKKAV--TAPTNVTTYSIADLQMA  377

Query  1423  TNSFSQENLVGEGSLGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHP  1602
             T SFS ENL+GEG+ GRVYRA F +GKVLA+KK+DS  LS +  D F+E +SN+S+L H 
Sbjct  378   TGSFSFENLLGEGTFGRVYRAQFDDGKVLAVKKIDSTVLSSEMSDEFIEMVSNISQLHHT  437

Query  1603  NIVPLVGYCAEHGQRLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYL  1782
             N+  LVGYC+ HGQ LLVY++  NGSLHD LH +DE S+ L WN+RV++ALGTARALEYL
Sbjct  438   NVTELVGYCSVHGQHLLVYEFHKNGSLHDFLHISDEFSKPLIWNSRVKIALGTARALEYL  497

Query  1783  HEVCLPSVVHRNFKSANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEF  1962
             HEVC PSVVH+N KSANILLD ELNPHLSD GLA   PN + Q+ +   VGS GY APE 
Sbjct  498   HEVCSPSVVHKNIKSANILLDAELNPHLSDSGLATFIPNAD-QLLNRDDVGS-GYCAPEV  555

Query  1963  ALSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDP  2142
              +S  Y++KSDVYSFGVVMLELLTGRKP DS+R R EQSLVRWATPQLHDIDALSKMVDP
Sbjct  556   TMSSQYSLKSDVYSFGVVMLELLTGRKPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDP  615

Query  2143  ALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFA  2322
             AL G+YP KSLSRFAD+IALCVQ EPEFRPPMSEVVQALVRLVQRA++  R    + G +
Sbjct  616   ALKGLYPIKSLSRFADVIALCVQSEPEFRPPMSEVVQALVRLVQRANMSKRTIGTDQGAS  675

Query  2323  YKTPDHD  2343
              +T + D
Sbjct  676   PRTNNTD  682


 Score =   212 bits (539),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 145/208 (70%), Gaps = 1/208 (0%)
 Frame = +1

Query  328  LYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLNGTMGYMLNGFTSL  507
            ++ SLNSP QL+GW A+ GDPCG+ WKGVTC G  V  I++  LGL+G+MGY L   TSL
Sbjct  1    MFSSLNSPQQLTGWTANNGDPCGQPWKGVTCSGQRVTEIKLSNLGLSGSMGYSLQSLTSL  60

Query  508  KELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLNYLNFSGNSLAQPI  687
            KELDLS N +   IPY +P NLT  NLA N  TGS+PYSI+ M SL YLN S N L   +
Sbjct  61   KELDLSHNNLAGGIPYNIPLNLTRFNLAYNQFTGSVPYSINQMHSLQYLNLSHNQLQYQL  120

Query  688  GDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGSLNVLVDLPLTDLN  867
             DMF   S L+TLDLSFN+ +  LP S   L+++  + +QNNQ TG+++VL +LPL +L 
Sbjct  121  NDMFGPLSSLSTLDLSFNSLTDALPQSFKNLTSMKSMYLQNNQFTGTIDVLANLPLDNLY  180

Query  868  VANNRFSGWIPNELISIPKFEYSGNSFS  951
            V+NN F+GWIP++L SI   +  GNS+S
Sbjct  181  VSNNHFTGWIPDQLKSI-DLQLDGNSWS  207



>ref|XP_009388759.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=703

 Score =   451 bits (1159),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 220/334 (66%), Positives = 265/334 (79%), Gaps = 12/334 (4%)
 Frame = +1

Query  1300  VDLKPPPSEKV-TIERMQGKNGSLRR----SPITATPYTVAVLQTATNSFSQENLVGEGS  1464
             V LKPPP ++  + +  +  N  + +    + I A  Y+VA LQ AT+SFS++NLVGEGS
Sbjct  353   VSLKPPPIDRYKSFDEDEFSNKPIAKKVNTTSIKAIIYSVADLQIATDSFSEDNLVGEGS  412

Query  1465  LGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQ  1644
              GRVYRA F +GKVLA+KK++  AL  +  D F+E + N+SRL HPN+  LVGYC+EHGQ
Sbjct  413   FGRVYRAQFSDGKVLAVKKLNLTALPSRSSDEFIEIVGNISRLHHPNLTELVGYCSEHGQ  472

Query  1645  RLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFK  1824
             RLLVY++  NG+L+D+L  +DE    L+WN RV++ALGTARALEYLHEVC PSV+H+NFK
Sbjct  473   RLLVYEFQKNGALYDLLQLSDEP---LSWNDRVKIALGTARALEYLHEVCSPSVIHKNFK  529

Query  1825  SANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYS  2004
             S+NILLD ELNPHLSDCGL  L PN E Q S  ++    GYSAPE A+SG YT+KSDVYS
Sbjct  530   SSNILLDMELNPHLSDCGLEGLVPNAEFQASELNM----GYSAPEVAMSGQYTMKSDVYS  585

Query  2005  FGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRF  2184
             FGVVMLEL+TGRKP DSSR RSEQSLV+WATPQLHDIDAL +MVDPAL G+YPAKSLSRF
Sbjct  586   FGVVMLELMTGRKPFDSSRPRSEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRF  645

Query  2185  ADIIALCVQPEPEFRPPMSEVVQALVRLVQRASV  2286
             AD+IALCVQ EPEFRPPMSEVVQALVRLV+R  +
Sbjct  646   ADVIALCVQSEPEFRPPMSEVVQALVRLVKRVKM  679


 Score =   246 bits (629),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 164/238 (69%), Gaps = 2/238 (1%)
 Frame = +1

Query  244  VLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQ  423
            VL+        GFV   TD ND  AL VL+ SLNS SQL+GWK SGGDPCGESW G+TC 
Sbjct  14   VLLACTWAWNPGFVNGDTDSNDASALSVLFSSLNSASQLTGWKQSGGDPCGESWLGITCS  73

Query  424  GSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDL--IPYQLPPNLTSLNLANN  597
            GS+V +I++ GLGL GT+GY +N  +SL ELDLS N + +   IPY LPPNL  L+L+NN
Sbjct  74   GSSVTAIKLSGLGLTGTLGYNMNQLSSLTELDLSKNNLGNKSSIPYNLPPNLHRLDLSNN  133

Query  598  NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
               GS+PYSIS M +L YLN + N L   +GDMF + S+L T+DLS N+ +GDLP S   
Sbjct  134  QYGGSLPYSISPMVTLEYLNLAHNQLQGNLGDMFGSLSNLATIDLSSNSLTGDLPQSFSS  193

Query  778  LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            L++L+ L ++NNQ TG ++VL  LPL +LNVANNRF+GWIPN+L  I       N +S
Sbjct  194  LTSLTSLYLENNQFTGHIDVLAGLPLQNLNVANNRFTGWIPNQLKGINNLHTENNQWS  251



>ref|XP_009388758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=705

 Score =   451 bits (1159),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 220/334 (66%), Positives = 265/334 (79%), Gaps = 12/334 (4%)
 Frame = +1

Query  1300  VDLKPPPSEKV-TIERMQGKNGSLRR----SPITATPYTVAVLQTATNSFSQENLVGEGS  1464
             V LKPPP ++  + +  +  N  + +    + I A  Y+VA LQ AT+SFS++NLVGEGS
Sbjct  355   VSLKPPPIDRYKSFDEDEFSNKPIAKKVNTTSIKAIIYSVADLQIATDSFSEDNLVGEGS  414

Query  1465  LGRVYRADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQ  1644
              GRVYRA F +GKVLA+KK++  AL  +  D F+E + N+SRL HPN+  LVGYC+EHGQ
Sbjct  415   FGRVYRAQFSDGKVLAVKKLNLTALPSRSSDEFIEIVGNISRLHHPNLTELVGYCSEHGQ  474

Query  1645  RLLVYDYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFK  1824
             RLLVY++  NG+L+D+L  +DE    L+WN RV++ALGTARALEYLHEVC PSV+H+NFK
Sbjct  475   RLLVYEFQKNGALYDLLQLSDEP---LSWNDRVKIALGTARALEYLHEVCSPSVIHKNFK  531

Query  1825  SANILLDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYS  2004
             S+NILLD ELNPHLSDCGL  L PN E Q S  ++    GYSAPE A+SG YT+KSDVYS
Sbjct  532   SSNILLDMELNPHLSDCGLEGLVPNAEFQASELNM----GYSAPEVAMSGQYTMKSDVYS  587

Query  2005  FGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRF  2184
             FGVVMLEL+TGRKP DSSR RSEQSLV+WATPQLHDIDAL +MVDPAL G+YPAKSLSRF
Sbjct  588   FGVVMLELMTGRKPFDSSRPRSEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRF  647

Query  2185  ADIIALCVQPEPEFRPPMSEVVQALVRLVQRASV  2286
             AD+IALCVQ EPEFRPPMSEVVQALVRLV+R  +
Sbjct  648   ADVIALCVQSEPEFRPPMSEVVQALVRLVKRVKM  681


 Score =   246 bits (629),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 164/238 (69%), Gaps = 2/238 (1%)
 Frame = +1

Query  244  VLVIAALISRLGFVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQ  423
            VL+        GFV   TD ND  AL VL+ SLNS SQL+GWK SGGDPCGESW G+TC 
Sbjct  14   VLLACTWAWNPGFVNGDTDSNDASALSVLFSSLNSASQLTGWKQSGGDPCGESWLGITCS  73

Query  424  GSAVVSIEIPGLGLNGTMGYMLNGFTSLKELDLSSNEIHDL--IPYQLPPNLTSLNLANN  597
            GS+V +I++ GLGL GT+GY +N  +SL ELDLS N + +   IPY LPPNL  L+L+NN
Sbjct  74   GSSVTAIKLSGLGLTGTLGYNMNQLSSLTELDLSKNNLGNKSSIPYNLPPNLHRLDLSNN  133

Query  598  NITGSIPYSISLMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGL  777
               GS+PYSIS M +L YLN + N L   +GDMF + S+L T+DLS N+ +GDLP S   
Sbjct  134  QYGGSLPYSISPMVTLEYLNLAHNQLQGNLGDMFGSLSNLATIDLSSNSLTGDLPQSFSS  193

Query  778  LSNLSMLRVQNNQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFS  951
            L++L+ L ++NNQ TG ++VL  LPL +LNVANNRF+GWIPN+L  I       N +S
Sbjct  194  LTSLTSLYLENNQFTGHIDVLAGLPLQNLNVANNRFTGWIPNQLKGINNLHTENNQWS  251



>ref|XP_010913800.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X2 [Elaeis guineensis]
Length=661

 Score =   449 bits (1154),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 279/677 (41%), Positives = 375/677 (55%), Gaps = 67/677 (10%)
 Frame = +1

Query  289   AATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGLGLN  468
             A TD +D+ AL VL+ SLNSP QL+GW ++GGDPCG+ WKGV C  S+V  I + GLGL 
Sbjct  21    AETDQDDVSALNVLFKSLNSPPQLTGWSSTGGDPCGDDWKGVKCSDSSVTEISLSGLGLT  80

Query  469   GTMGYMLNGFTSLKELDLSSNEIHDLIPYQLPPNLTSLNLANNNITGSIPYSISLMTSLN  648
             G +GY L+  TS+   D+S                       NN+ G IPY   L   + 
Sbjct  81    GLLGYQLSSLTSVTYFDMS----------------------KNNLKGDIPYQ--LPPKVE  116

Query  649   YLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQNNQLTGS  828
             +LN   N L   + D+F   S L+ + LSF                        NQL+G+
Sbjct  117   HLNLQRNQLNGQLNDVFGKLSRLSEMYLSF------------------------NQLSGN  152

Query  829   LN-VLVDLP-LTDLNVANNRFSGWIPNELISIP--KFEYSGNSFSNSpapppppftpppp  996
             L   L  L  L  L++ NN+ SG I N L ++P        N F+               
Sbjct  153   LPPSLRSLKGLKTLHLQNNQLSGSI-NVLANLPLEDLNVENNQFNGWIPNKLKNIDTLQI  211

Query  997   grpHKRTNHSTPGSHKTPGSDDNHSDHEngngngkngVKAGAivgivlgs----savvls  1164
             G     +  + PG  K   ++ +    +         V AG ++ +++ S    + +   
Sbjct  212   GGNSWSSGPAPPGMDKASNTNSHTGGKKGMQSVVNGAVIAGTVIAVLVISLILLALIKRK  271

Query  1165  aivvivYCLRRCKKKEFAARTSTGSLPLSTDKEVLDQRAKSTATVVDLKPPPSEKVTI--  1338
             +     Y      +   +    +  L L      +D +A  T   + L+PPP        
Sbjct  272   SSSSSHYIDDGSSQNISSTPLVSHELGLKESSSSIDIKALETPLSMGLRPPPEPYKVFSD  331

Query  1339  -ERMQGKNGSLRRSPITATPYTVAVLQTATNSFSQENLVGEGSLGRVYRADFPNGKVLAI  1515
              E     N     + ++ T Y++  LQ AT SFS   L+G+G++G VY+  + +GKVLA+
Sbjct  332   NEFAVKLNPKHNTNAVSITAYSLVDLQAATGSFSASCLLGQGTIGSVYKTKYADGKVLAV  391

Query  1516  KKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVYDYIGNGSLHDML  1695
             KK+D   LS     +F+E +S +S+LRHPNI  L+GYC+E    LL+Y++  NGSLHD L
Sbjct  392   KKIDLINLSGGTSYDFMELVSGISKLRHPNIAELLGYCSEPCYHLLIYEFQMNGSLHDFL  451

Query  1696  HFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANILLDEELNPHLSDC  1875
             H +DE S+ LTW+ RVR+ALGTARALEYLH +C PSV+H+N KSANILLD ELNPHLSDC
Sbjct  452   HLSDEYSKPLTWDTRVRIALGTARALEYLHGICSPSVIHKNMKSANILLDAELNPHLSDC  511

Query  1876  GLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRKPLDS  2055
             G+A    +T   +         GY+APE      YT+KSDVYSFGVVMLELLTGRKP DS
Sbjct  512   GVAIFYEDTSENLGP-------GYNAPECTKPSAYTMKSDVYSFGVVMLELLTGRKPFDS  564

Query  2056  SRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPP  2235
             S+  +EQ+LVRWA PQLHDI +L +MVDPAL G+YP KSLSRFAD+IALC+QPEPEFRP 
Sbjct  565   SKSITEQTLVRWAAPQLHDITSLMQMVDPALRGLYPPKSLSRFADVIALCIQPEPEFRPS  624

Query  2236  MSEVVQALVRLVQRASV  2286
             MSEVVQ+L + V    +
Sbjct  625   MSEVVQSLYQCVHGTGI  641



>ref|NP_001049184.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|AAK92627.1|AC079633_7 Putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
 gb|ABF94338.1| leucine-rich repeat transmembrane protein kinase 1, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11098.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|EAY88809.1| hypothetical protein OsI_10282 [Oryza sativa Indica Group]
 gb|EAZ25839.1| hypothetical protein OsJ_09681 [Oryza sativa Japonica Group]
 dbj|BAG94684.1| unnamed protein product [Oryza sativa Japonica Group]
Length=718

 Score =   450 bits (1158),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 229/408 (56%), Positives = 288/408 (71%), Gaps = 32/408 (8%)
 Frame = +1

Query  1189  LRRCKKKEFAARTSTGSLPLST--DKEVLDQRAKSTATVVD-----------LKPPPSEK  1329
             +RR K++           P ++    EV D +    +T +D           LKPPP   
Sbjct  316   IRRRKRRAALEEHFEQHQPFTSFPSNEVKDMKPIEESTTIDVESLPSPASFSLKPPPK--  373

Query  1330  VTIERMQGKNGS-------LRRS---PITATPYTVAVLQTATNSFSQENLVGEGSLGRVY  1479
               IER +  +         L+++   PI AT Y+VA LQ AT SFS +NLVGEG+ GRVY
Sbjct  374   --IERHKSFDDDDLSNKPVLKKTNVAPIKATVYSVADLQMATESFSMDNLVGEGTFGRVY  431

Query  1480  RADFPNGKVLAIKKVDSAALSLQEEDNFLEAISNMSRLRHPNIVPLVGYCAEHGQRLLVY  1659
             RA F  GKVLA+KK+DS  +     D+F E +S++S+L HPN+  LVGYC EHGQ LLVY
Sbjct  432   RAQFTGGKVLAVKKLDSTVMPFHSSDDFAELVSDISKLHHPNLNELVGYCMEHGQHLLVY  491

Query  1660  DYIGNGSLHDMLHFADERSQLLTWNARVRVALGTARALEYLHEVCLPSVVHRNFKSANIL  1839
             D+  NGSLHD+LH +DE S+ L+WN+RV++ALG+ARALEYLHE+C PS++H+NFKS+N+L
Sbjct  492   DFHRNGSLHDLLHLSDEYSKPLSWNSRVKIALGSARALEYLHEICSPSIIHKNFKSSNLL  551

Query  1840  LDEELNPHLSDCGLAALTPNTERQISSTHVVGSFGYSAPEFALSGVYTVKSDVYSFGVVM  2019
             LD E NPHLSD GLA+   + E Q +      S G +APE  ++G YT+KSDVYSFGVVM
Sbjct  552   LDSEFNPHLSDAGLASFISDAEFQAAQQ----SAGCTAPEVDMTGQYTLKSDVYSFGVVM  607

Query  2020  LELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIA  2199
             LELLTGR+P DS+R RSEQSLVRWATPQLHDIDAL +MVDPAL G+YPAKSLSRFAD++A
Sbjct  608   LELLTGRRPFDSTRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLA  667

Query  2200  LCVQPEPEFRPPMSEVVQALVRLVQRASVVIRRYSDESGFAYKTPDHD  2343
             LCVQPEPEFRPPMSEVVQALVRLVQRA++  +R  D    + +T D +
Sbjct  668   LCVQPEPEFRPPMSEVVQALVRLVQRANMT-KRMLDGDTSSRRTDDQE  714


 Score =   243 bits (621),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 158/228 (69%), Gaps = 3/228 (1%)
 Frame = +1

Query  280  FVGAATDPNDLQALEVLYGSLNSPSQLSGWKASGGDPCGESWKGVTCQGSAVVSIEIPGL  459
             V A TDPND+  L  L+ SLNSP QL GW+ASGGDPCG+SW+G+TC GS+V +I++P L
Sbjct  29   LVAADTDPNDVTVLNTLFTSLNSPGQLKGWQASGGDPCGQSWQGITCSGSSVTAIKLPSL  88

Query  460  GLNGTMGYMLNGFTSLKELDLSSNEIH--DLIPYQLPPN-LTSLNLANNNITGSIPYSIS  630
            GL+G + Y +N   SL E+D+S N +     I Y LP N L  LNLA N  TG++PYSI 
Sbjct  89   GLSGNLAYNMNTMGSLIEIDMSQNNLGGGQQIQYNLPTNKLERLNLAGNQFTGNLPYSIF  148

Query  631  LMTSLNYLNFSGNSLAQPIGDMFTNRSDLTTLDLSFNNFSGDLPASLGLLSNLSMLRVQN  810
             M++L YLN + N L   I D+F++   LTTLDLSFN+ +GDLP     LS+L  L +QN
Sbjct  149  SMSNLKYLNLNHNQLQGNITDVFSSLYSLTTLDLSFNSLAGDLPQGFTSLSSLKKLYLQN  208

Query  811  NQLTGSLNVLVDLPLTDLNVANNRFSGWIPNELISIPKFEYSGNSFSN  954
            NQ TG +NVL +LPL DLNVANN F+GWIP++L  I   +  GNS+SN
Sbjct  209  NQFTGYINVLANLPLDDLNVANNHFTGWIPSQLKKINNLQTDGNSWSN  256



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8212475441472