BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21150_g1_i3 len=1881 path=[1:0-1003 1005:1004-1007 1009:1008-1216
1218:1217-1880]

Length=1881
                                                                      Score     E

ref|XP_009602921.1|  PREDICTED: probable ADP-ribosylation factor ...    506   1e-171   
ref|XP_009780254.1|  PREDICTED: probable ADP-ribosylation factor ...    504   8e-171   
ref|XP_004244953.1|  PREDICTED: probable ADP-ribosylation factor ...    493   1e-166   
ref|XP_006355263.1|  PREDICTED: probable ADP-ribosylation factor ...    491   2e-165   
gb|EYU38275.1|  hypothetical protein MIMGU_mgv1a007749mg                475   3e-159   
ref|XP_010324884.1|  PREDICTED: probable ADP-ribosylation factor ...    470   7e-158   
ref|XP_011091846.1|  PREDICTED: probable ADP-ribosylation factor ...    463   1e-154   
emb|CDP18917.1|  unnamed protein product                                460   9e-154   
emb|CBI40178.3|  unnamed protein product                                454   6e-151   
ref|XP_011088498.1|  PREDICTED: probable ADP-ribosylation factor ...    449   6e-149   
ref|XP_010645647.1|  PREDICTED: probable ADP-ribosylation factor ...    448   7e-149   
ref|XP_010645646.1|  PREDICTED: probable ADP-ribosylation factor ...    446   7e-148   
gb|EYU42946.1|  hypothetical protein MIMGU_mgv1a024311mg                439   7e-146   
gb|EYU21108.1|  hypothetical protein MIMGU_mgv1a021557mg                438   2e-145   
ref|XP_007011070.1|  Calcium-dependent ARF-type GTPase activating...    434   3e-143   
ref|XP_004514475.1|  PREDICTED: probable ADP-ribosylation factor ...    429   1e-141   
ref|XP_008348317.1|  PREDICTED: probable ADP-ribosylation factor ...    428   3e-141   
ref|XP_004514473.1|  PREDICTED: probable ADP-ribosylation factor ...    427   1e-140   
ref|XP_009354464.1|  PREDICTED: probable ADP-ribosylation factor ...    424   1e-139   
gb|KHG26778.1|  hypothetical protein F383_04656                         421   8e-138   
ref|XP_008375312.1|  PREDICTED: probable ADP-ribosylation factor ...    418   4e-137   
ref|XP_009361970.1|  PREDICTED: probable ADP-ribosylation factor ...    417   6e-137   
ref|XP_003539244.2|  PREDICTED: probable ADP-ribosylation factor ...    417   7e-137   
ref|XP_009361971.1|  PREDICTED: probable ADP-ribosylation factor ...    417   8e-137   
ref|XP_002299211.2|  zinc finger family protein                         416   1e-136   Populus trichocarpa [western balsam poplar]
ref|XP_010460091.1|  PREDICTED: probable ADP-ribosylation factor ...    415   3e-136   
ref|XP_011000555.1|  PREDICTED: probable ADP-ribosylation factor ...    414   6e-136   
ref|XP_010486369.1|  PREDICTED: probable ADP-ribosylation factor ...    414   8e-136   
ref|XP_003598626.1|  ADP-ribosylation factor GTPase-activating pr...    414   1e-135   
ref|XP_008811224.1|  PREDICTED: probable ADP-ribosylation factor ...    412   2e-135   
ref|XP_009124033.1|  PREDICTED: probable ADP-ribosylation factor ...    413   2e-135   
ref|XP_011000554.1|  PREDICTED: probable ADP-ribosylation factor ...    414   7e-135   
gb|KDP40520.1|  hypothetical protein JCGZ_24519                         412   7e-135   
ref|XP_011000552.1|  PREDICTED: probable ADP-ribosylation factor ...    414   7e-135   
ref|XP_010032309.1|  PREDICTED: probable ADP-ribosylation factor ...    412   9e-135   
ref|XP_010938593.1|  PREDICTED: probable ADP-ribosylation factor ...    410   1e-134   
ref|XP_004307119.1|  PREDICTED: probable ADP-ribosylation factor ...    412   1e-134   
ref|XP_010464440.1|  PREDICTED: probable ADP-ribosylation factor ...    411   2e-134   
ref|XP_006407779.1|  hypothetical protein EUTSA_v10020854mg             411   2e-134   
gb|KHG04159.1|  hypothetical protein F383_28664                         412   3e-134   
ref|XP_008813423.1|  PREDICTED: probable ADP-ribosylation factor ...    411   3e-134   
ref|XP_011000553.1|  PREDICTED: probable ADP-ribosylation factor ...    412   5e-134   
ref|XP_002882559.1|  hypothetical protein ARALYDRAFT_478135             409   7e-134   
ref|XP_006297895.1|  hypothetical protein CARUB_v10013935mg             409   7e-134   
ref|XP_008813422.1|  PREDICTED: probable ADP-ribosylation factor ...    410   9e-134   
ref|XP_002513070.1|  DNA binding protein, putative                      409   1e-133   Ricinus communis
gb|KEH33048.1|  calcium-dependent ARF-type GTPase activating fami...    408   2e-133   
ref|XP_006385992.1|  hypothetical protein POPTR_0003s19790g             411   2e-133   
ref|XP_006385991.1|  hypothetical protein POPTR_0003s19790g             410   3e-133   
ref|XP_006470849.1|  PREDICTED: probable ADP-ribosylation factor ...    405   1e-132   
ref|XP_006420736.1|  hypothetical protein CICLE_v10005234mg             405   1e-132   
ref|XP_004511023.1|  PREDICTED: probable ADP-ribosylation factor ...    405   1e-132   
ref|XP_010557858.1|  PREDICTED: probable ADP-ribosylation factor ...    405   3e-132   
ref|XP_010670464.1|  PREDICTED: probable ADP-ribosylation factor ...    406   6e-132   
gb|KHN21302.1|  Putative ADP-ribosylation factor GTPase-activatin...    402   1e-131   
ref|NP_187451.2|  putative ADP-ribosylation factor GTPase-activat...    403   2e-131   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35974.1|  BnaA05g29760D                                          404   2e-131   
ref|XP_011020380.1|  PREDICTED: probable ADP-ribosylation factor ...    405   3e-131   
gb|AAF21204.1|AC013483_28  putative GTPase activating protein           402   3e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009401045.1|  PREDICTED: probable ADP-ribosylation factor ...    401   6e-131   
ref|XP_009147013.1|  PREDICTED: probable ADP-ribosylation factor ...    402   7e-131   
ref|XP_010032310.1|  PREDICTED: probable ADP-ribosylation factor ...    401   7e-131   
ref|XP_011020379.1|  PREDICTED: probable ADP-ribosylation factor ...    404   7e-131   
ref|XP_011020374.1|  PREDICTED: probable ADP-ribosylation factor ...    404   1e-130   
ref|XP_006579229.1|  PREDICTED: probable ADP-ribosylation factor ...    401   2e-130   
ref|XP_010095962.1|  putative ADP-ribosylation factor GTPase-acti...    399   3e-130   
ref|XP_008446945.1|  PREDICTED: probable ADP-ribosylation factor ...    398   6e-130   
emb|CDY28007.1|  BnaC05g44090D                                          400   8e-130   
ref|XP_008446942.1|  PREDICTED: probable ADP-ribosylation factor ...    399   8e-130   
ref|XP_008446944.1|  PREDICTED: probable ADP-ribosylation factor ...    399   9e-130   
ref|XP_010246871.1|  PREDICTED: probable ADP-ribosylation factor ...    397   1e-129   
ref|XP_007218074.1|  hypothetical protein PRUPE_ppa006844mg             397   6e-129   
ref|XP_010273190.1|  PREDICTED: probable ADP-ribosylation factor ...    396   8e-129   
gb|KGN52311.1|  hypothetical protein Csa_5G623740                       396   9e-129   
ref|XP_006854752.1|  hypothetical protein AMTR_s00063p00013660          394   3e-128   
ref|XP_003541598.1|  PREDICTED: probable ADP-ribosylation factor ...    394   4e-128   
ref|XP_010556250.1|  PREDICTED: probable ADP-ribosylation factor ...    392   5e-127   
ref|XP_010556251.1|  PREDICTED: probable ADP-ribosylation factor ...    391   1e-126   
gb|AET02273.2|  ADP-ribosylation factor GTPase-activating protein...    390   1e-126   
ref|XP_009135010.1|  PREDICTED: probable ADP-ribosylation factor ...    390   3e-126   
emb|CDX74022.1|  BnaA03g30250D                                          390   3e-126   
ref|XP_007133773.1|  hypothetical protein PHAVU_011G207700g             389   5e-126   
ref|XP_006598113.1|  PREDICTED: probable ADP-ribosylation factor ...    387   1e-125   
ref|XP_008465595.1|  PREDICTED: probable ADP-ribosylation factor ...    387   9e-125   
ref|XP_007148958.1|  hypothetical protein PHAVU_005G028800g             384   6e-124   
gb|ADN34207.1|  DNA binding protein                                     383   7e-124   
ref|XP_009411745.1|  PREDICTED: probable ADP-ribosylation factor ...    380   6e-123   
ref|XP_007148959.1|  hypothetical protein PHAVU_005G028800g             381   9e-123   
ref|XP_004142404.1|  PREDICTED: probable ADP-ribosylation factor ...    380   9e-123   
gb|EAY77240.1|  hypothetical protein OsI_05214                          379   5e-122   Oryza sativa Indica Group [Indian rice]
ref|NP_001045411.1|  Os01g0951100                                       379   6e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004962220.1|  PREDICTED: probable ADP-ribosylation factor ...    377   2e-121   
ref|XP_004143816.1|  PREDICTED: probable ADP-ribosylation factor ...    378   3e-121   
gb|AFW77826.1|  putative calcium-dependent lipid-binding (CaLB do...    374   6e-121   
ref|XP_008647442.1|  PREDICTED: uncharacterized protein LOC100216...    374   2e-120   
ref|NP_001136616.1|  uncharacterized protein LOC100216740               372   4e-120   Zea mays [maize]
ref|XP_002439716.1|  hypothetical protein SORBIDRAFT_09g018900          366   4e-117   Sorghum bicolor [broomcorn]
ref|XP_008655157.1|  PREDICTED: uncharacterized protein LOC100381...    371   1e-116   
ref|NP_001167733.1|  uncharacterized protein LOC100381421               370   1e-116   Zea mays [maize]
gb|AFW83952.1|  hypothetical protein ZEAMMB73_491534                    370   3e-116   
ref|XP_004166399.1|  PREDICTED: probable ADP-ribosylation factor ...    364   8e-116   
dbj|BAK03763.1|  predicted protein                                      363   9e-116   
ref|XP_010233247.1|  PREDICTED: LOW QUALITY PROTEIN: probable ADP...    365   1e-115   
gb|KGN51121.1|  hypothetical protein Csa_5G457230                       365   1e-115   
emb|CDM86580.1|  unnamed protein product                                365   2e-115   
gb|ABR16527.1|  unknown                                                 360   7e-115   Picea sitchensis
dbj|BAJ87597.1|  predicted protein                                      364   1e-114   
ref|XP_004971278.1|  PREDICTED: probable ADP-ribosylation factor ...    363   7e-114   
ref|NP_001055403.1|  Os05g0382000                                       358   9e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003567481.1|  PREDICTED: probable ADP-ribosylation factor ...    358   2e-113   
ref|XP_010232831.1|  PREDICTED: probable ADP-ribosylation factor ...    357   3e-113   
ref|XP_006646683.1|  PREDICTED: uridine 5'-monophosphate synthase...    369   4e-112   
ref|XP_006655266.1|  PREDICTED: uncharacterized protein LOC102722400    359   2e-106   
ref|XP_008813425.1|  PREDICTED: probable ADP-ribosylation factor ...    336   3e-106   
ref|XP_006297894.1|  hypothetical protein CARUB_v10013935mg             335   3e-106   
ref|XP_010938595.1|  PREDICTED: probable ADP-ribosylation factor ...    335   3e-106   
gb|AFW83951.1|  UMP synthase                                            355   2e-105   
ref|XP_010938594.1|  PREDICTED: probable ADP-ribosylation factor ...    328   4e-103   
gb|EMS51197.1|  putative ADP-ribosylation factor GTPase-activatin...    325   4e-102   
ref|XP_011020381.1|  PREDICTED: probable ADP-ribosylation factor ...    327   5e-102   
gb|KDO39445.1|  hypothetical protein CISIN_1g0212941mg                  312   8e-98    
gb|KDO39444.1|  hypothetical protein CISIN_1g0212941mg                  312   9e-98    
ref|XP_010098566.1|  ADP-ribosylation factor GTPase-activating pr...    312   5e-97    
ref|XP_008383402.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    309   1e-95    
ref|NP_001149756.1|  LOC100283383                                       308   2e-95    Zea mays [maize]
ref|XP_009344408.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    308   3e-95    
gb|KHN15239.1|  Putative ADP-ribosylation factor GTPase-activatin...    310   5e-95    
ref|XP_010051951.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    307   5e-95    
ref|XP_010245699.1|  PREDICTED: probable ADP-ribosylation factor ...    306   9e-95    
ref|XP_006846006.1|  hypothetical protein AMTR_s00155p00064070          306   9e-95    
ref|XP_010051947.1|  PREDICTED: probable ADP-ribosylation factor ...    306   1e-94    
ref|XP_010051949.1|  PREDICTED: probable ADP-ribosylation factor ...    306   1e-94    
gb|AFW76344.1|  putative calcium-dependent lipid-binding (CaLB do...    305   1e-94    
ref|XP_002437267.1|  hypothetical protein SORBIDRAFT_10g023880          305   2e-94    Sorghum bicolor [broomcorn]
ref|XP_009362231.1|  PREDICTED: probable ADP-ribosylation factor ...    305   4e-94    
ref|XP_004965911.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    304   5e-94    
ref|XP_002523190.1|  ARF GTPase activator, putative                     304   6e-94    Ricinus communis
ref|XP_008246096.1|  PREDICTED: probable ADP-ribosylation factor ...    302   8e-94    
ref|XP_006377669.1|  hypothetical protein POPTR_0011s10090g             304   8e-94    
ref|XP_011012078.1|  PREDICTED: probable ADP-ribosylation factor ...    304   9e-94    
gb|EMT24360.1|  Putative ADP-ribosylation factor GTPase-activatin...    302   2e-93    
gb|AET04392.2|  ADP-ribosylation factor GTPase-activating protein...    302   2e-93    
ref|XP_008794724.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    302   4e-93    
ref|XP_010245698.1|  PREDICTED: probable ADP-ribosylation factor ...    302   5e-93    
gb|EPS72744.1|  hypothetical protein M569_02012                         297   9e-93    
ref|XP_008794720.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    301   1e-92    
ref|XP_004504220.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    300   2e-92    
ref|XP_007011071.1|  Calcium-dependent ARF-type GTPase activating...    298   3e-92    
ref|XP_009362235.1|  PREDICTED: probable ADP-ribosylation factor ...    300   3e-92    
ref|XP_008647900.1|  PREDICTED: LOC100283383 isoform X3                 299   5e-92    
gb|EYU43231.1|  hypothetical protein MIMGU_mgv1a009769mg                299   5e-92    
ref|XP_007022879.1|  Calcium-dependent ARF-type GTPase activating...    298   7e-92    
gb|ADQ00629.1|  ARF-GAP protein                                         299   7e-92    
gb|ACN85270.1|  ZAC                                                     298   1e-91    Oryza alta
ref|XP_010942503.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    298   2e-91    
ref|XP_004293985.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    298   2e-91    
ref|XP_001758688.1|  predicted protein                                  296   2e-91    
ref|XP_007211569.1|  hypothetical protein PRUPE_ppa008355mg             298   3e-91    
gb|ACN85257.1|  ZAC                                                     296   4e-91    Oryza alta
ref|XP_002263067.2|  PREDICTED: ADP-ribosylation factor GTPase-ac...    296   5e-91    Vitis vinifera
dbj|BAD35631.1|  putative zinc finger and C2 domain protein             295   9e-91    Oryza sativa Japonica Group [Japonica rice]
gb|KHN06470.1|  ADP-ribosylation factor GTPase-activating protein...    295   1e-90    
ref|XP_009394693.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    295   1e-90    
gb|ACN85316.1|  ZAC                                                     295   2e-90    Oryza brachyantha
gb|ACN85166.1|  ZAC                                                     294   3e-90    Oryza sativa f. spontanea
ref|XP_002298890.1|  zinc finger family protein                         295   3e-90    Populus trichocarpa [western balsam poplar]
gb|ACN85244.1|  ZAC                                                     294   4e-90    Oryza officinalis
gb|ACN85216.1|  ZAC                                                     294   4e-90    Oryza punctata
ref|XP_006413813.1|  hypothetical protein EUTSA_v10025660mg             294   8e-90    
ref|XP_006656236.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    294   1e-89    
ref|XP_006448905.1|  hypothetical protein CICLE_v10015859mg             293   2e-89    
ref|XP_003535088.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    292   3e-89    
ref|XP_010687080.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    292   3e-89    
ref|XP_006580209.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    291   3e-89    
ref|XP_002869903.1|  zac                                                291   4e-89    
gb|EYU19118.1|  hypothetical protein MIMGU_mgv1a009770mg                291   5e-89    
dbj|BAF01268.1|  hypothetical protein                                   291   5e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002981669.1|  hypothetical protein SELMODRAFT_115211             291   6e-89    
ref|XP_010455861.1|  PREDICTED: probable ADP-ribosylation factor ...    291   8e-89    
ref|XP_004231566.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    291   8e-89    
ref|XP_010422422.1|  PREDICTED: probable ADP-ribosylation factor ...    291   1e-88    
ref|XP_008445220.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    291   1e-88    
ref|XP_009418489.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    290   1e-88    
gb|AAM65970.1|  putative GTPase activating protein                      290   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038875.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    290   2e-88    
gb|KHN23004.1|  ADP-ribosylation factor GTPase-activating protein...    290   2e-88    
ref|NP_567620.1|  ADP-ribosylation factor GTPase-activating prote...    290   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006363654.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    290   3e-88    
ref|XP_003629916.1|  ADP-ribosylation factor GTPase-activating pr...    290   3e-88    
ref|XP_006580210.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    289   3e-88    
gb|KHG02798.1|  hypothetical protein F383_08812                         289   3e-88    
ref|XP_006396607.1|  hypothetical protein EUTSA_v10028788mg             289   4e-88    
ref|XP_003546262.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    289   4e-88    
emb|CDP17304.1|  unnamed protein product                                288   7e-88    
ref|XP_010431511.1|  PREDICTED: probable ADP-ribosylation factor ...    288   7e-88    
emb|CAB81075.1|  putative protein                                       288   1e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010910384.1|  PREDICTED: probable ADP-ribosylation factor ...    285   2e-87    
ref|XP_004134589.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    287   2e-87    
ref|XP_010913280.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    287   2e-87    
ref|XP_002967849.1|  hypothetical protein SELMODRAFT_169243             286   3e-87    
ref|XP_008805540.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    286   4e-87    
gb|KHN48068.1|  ADP-ribosylation factor GTPase-activating protein...    286   5e-87    
ref|XP_010455859.1|  PREDICTED: probable ADP-ribosylation factor ...    286   6e-87    
emb|CDY62002.1|  BnaA03g57220D                                          286   7e-87    
ref|XP_008805539.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    286   9e-87    
ref|XP_006585208.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    285   9e-87    
ref|XP_010422420.1|  PREDICTED: probable ADP-ribosylation factor ...    285   1e-86    
emb|CDY21329.1|  BnaC03g30130D                                          285   1e-86    
ref|XP_011096685.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    285   1e-86    
ref|XP_009114487.1|  PREDICTED: probable ADP-ribosylation factor ...    285   2e-86    
ref|XP_009137170.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    284   4e-86    
emb|CDY58481.1|  BnaA03g58510D                                          284   4e-86    
ref|XP_001775397.1|  predicted protein                                  284   4e-86    
ref|XP_006396608.1|  hypothetical protein EUTSA_v10028788mg             284   4e-86    
ref|XP_010431492.1|  PREDICTED: probable ADP-ribosylation factor ...    283   6e-86    
emb|CDX94026.1|  BnaC07g36600D                                          283   7e-86    
gb|KDP34932.1|  hypothetical protein JCGZ_09220                         283   7e-86    
ref|XP_010529365.1|  PREDICTED: probable ADP-ribosylation factor ...    283   7e-86    
ref|XP_010529368.1|  PREDICTED: probable ADP-ribosylation factor ...    283   8e-86    
ref|XP_002874839.1|  ARF-GAP domain 13                                  283   9e-86    
ref|NP_567292.1|  putative ADP-ribosylation factor GTPase-activat...    283   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134332.1|  PREDICTED: probable ADP-ribosylation factor ...    283   1e-85    
ref|XP_010537894.1|  PREDICTED: probable ADP-ribosylation factor ...    282   2e-85    
ref|XP_003594529.1|  ZAC                                                282   2e-85    
ref|XP_010537911.1|  PREDICTED: probable ADP-ribosylation factor ...    282   2e-85    
ref|NP_001168952.1|  uncharacterized protein LOC100382772               281   3e-85    Zea mays [maize]
ref|XP_004158071.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    281   4e-85    
gb|EPS58515.1|  hypothetical protein M569_16298                         281   4e-85    
ref|XP_004951559.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    280   6e-85    
ref|XP_006289871.1|  hypothetical protein CARUB_v10003483mg             280   8e-85    
ref|XP_010434225.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    280   1e-84    
ref|XP_011085202.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    280   2e-84    
gb|EEE66000.1|  hypothetical protein OsJ_21940                          296   2e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010449110.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    279   3e-84    
gb|EEC80955.1|  hypothetical protein OsI_23669                          296   6e-84    Oryza sativa Indica Group [Indian rice]
emb|CDY46364.1|  BnaA09g19780D                                          278   6e-84    
ref|XP_006284072.1|  hypothetical protein CARUB_v10005198mg             277   1e-83    
ref|XP_007147482.1|  hypothetical protein PHAVU_006G128200g             277   1e-83    
ref|XP_010233985.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    276   2e-83    
ref|XP_010434228.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    276   3e-83    
ref|XP_009802941.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    276   5e-83    
gb|AFK36973.1|  unknown                                                 275   7e-83    
ref|XP_004486456.1|  PREDICTED: probable ADP-ribosylation factor ...    274   2e-82    
gb|EAY84886.1|  hypothetical protein OsI_06251                          274   2e-82    Oryza sativa Indica Group [Indian rice]
ref|NP_001046206.2|  Os02g0198300                                       274   2e-82    Oryza sativa Japonica Group [Japonica rice]
gb|EMT13535.1|  Putative ADP-ribosylation factor GTPase-activatin...    274   4e-82    
emb|CDY39164.1|  BnaC09g21800D                                          273   4e-82    
ref|XP_009108508.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    273   5e-82    
ref|XP_006647030.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    272   1e-81    
ref|XP_007159543.1|  hypothetical protein PHAVU_002G246400g             271   2e-81    
emb|CDX76421.1|  BnaA08g09790D                                          271   2e-81    
emb|CAA17535.1|  putative protein                                       273   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009419200.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    271   3e-81    
emb|CDY65341.1|  BnaC03g64360D                                          272   4e-81    
ref|XP_009108507.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    272   7e-81    
ref|XP_009410311.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    270   8e-81    
gb|AAQ63183.1|  zinc finger protein F35                                 270   9e-81    Oryza sativa Japonica Group [Japonica rice]
gb|ACU17685.1|  unknown                                                 265   5e-80    Glycine max [soybeans]
ref|XP_009419201.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    267   1e-79    
gb|EPS70992.1|  hypothetical protein M569_03763                         267   1e-79    
ref|XP_004135551.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    264   2e-78    
ref|XP_008647899.1|  PREDICTED: LOC100283383 isoform X2                 263   6e-78    
ref|XP_009417345.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    262   6e-78    
ref|XP_010245700.1|  PREDICTED: probable ADP-ribosylation factor ...    258   1e-77    
ref|XP_007211568.1|  hypothetical protein PRUPE_ppa008355mg             260   2e-77    
ref|XP_010246975.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    261   1e-75    
ref|XP_008647898.1|  PREDICTED: LOC100283383 isoform X1                 257   1e-75    
emb|CDX82807.1|  BnaC01g12570D                                          256   1e-75    
ref|XP_002452635.1|  hypothetical protein SORBIDRAFT_04g029530          255   5e-75    Sorghum bicolor [broomcorn]
ref|XP_003570479.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    254   6e-75    
ref|XP_010455862.1|  PREDICTED: probable ADP-ribosylation factor ...    252   2e-74    
ref|XP_010422423.1|  PREDICTED: probable ADP-ribosylation factor ...    251   4e-74    
ref|XP_004953737.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    251   2e-73    
gb|KGN65924.1|  hypothetical protein Csa_1G538220                       250   2e-73    
ref|XP_009134478.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    249   2e-73    
ref|XP_010431518.1|  PREDICTED: probable ADP-ribosylation factor ...    249   4e-73    
ref|XP_008676787.1|  PREDICTED: putative calcium-dependent lipid-...    249   8e-73    
gb|KGN49461.1|  hypothetical protein Csa_6G525470                       249   1e-72    
ref|XP_008681448.1|  PREDICTED: putative calcium-dependent lipid-...    246   8e-72    
ref|XP_006647813.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    246   9e-72    
emb|CDX79040.1|  BnaA01g11070D                                          253   2e-70    
ref|XP_008344604.1|  PREDICTED: LOW QUALITY PROTEIN: probable ADP...    238   4e-70    
gb|EEE57710.1|  hypothetical protein OsJ_08191                          236   3e-68    
ref|NP_001047967.1|  Os02g0722500                                       236   4e-68    
gb|EMT21141.1|  ADP-ribosylation factor GTPase-activating protein...    236   7e-68    
ref|XP_001780255.1|  predicted protein                                  234   2e-67    
gb|KHN37658.1|  Putative ADP-ribosylation factor GTPase-activatin...    223   2e-64    
ref|XP_008794726.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    223   4e-64    
ref|XP_010942507.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    217   9e-62    
gb|ACN85330.1|  ZAC                                                     216   3e-61    
gb|EMT05476.1|  ADP-ribosylation factor GTPase-activating protein...    219   1e-59    
ref|XP_006586837.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    209   8e-59    
gb|KCW75779.1|  hypothetical protein EUGRSUZ_D00176                     206   7e-58    
gb|AFW73194.1|  putative calcium-dependent lipid-binding (CaLB do...    207   2e-57    
gb|AFW73195.1|  putative calcium-dependent lipid-binding (CaLB do...    204   2e-57    
ref|NP_001141407.1|  putative calcium-dependent lipid-binding (Ca...    204   5e-57    
emb|CAN79725.1|  hypothetical protein VITISV_014535                     199   1e-56    
ref|XP_003627798.1|  hypothetical protein MTR_8g038420                  199   3e-56    
ref|XP_007022881.1|  ARF-GAP domain 13 isoform 3                        200   9e-56    
ref|XP_004504221.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    198   5e-55    
ref|XP_010233987.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    198   9e-55    
ref|NP_001140912.1|  putative calcium-dependent lipid-binding (Ca...    198   4e-54    
gb|KDO75262.1|  hypothetical protein CISIN_1g019726mg                   194   1e-53    
ref|XP_008681450.1|  PREDICTED: putative calcium-dependent lipid-...    196   2e-53    
gb|EMS65840.1|  ADP-ribosylation factor GTPase-activating protein...    197   2e-53    
dbj|BAK05663.1|  predicted protein                                      192   1e-52    
ref|XP_008659088.1|  PREDICTED: probable ADP-ribosylation factor ...    193   2e-52    
gb|ABE87612.1|  Arf GTPase activating protein                           190   5e-52    
ref|XP_002961876.1|  hypothetical protein SELMODRAFT_403270             192   7e-52    
gb|AFW80844.1|  putative calcium-dependent lipid-binding (CaLB do...    190   1e-51    
ref|XP_003627797.1|  ADP-ribosylation factor GTPase-activating pr...    187   3e-51    
gb|KHN27328.1|  Putative ADP-ribosylation factor GTPase-activatin...    184   6e-51    
ref|XP_002984105.1|  hypothetical protein SELMODRAFT_423312             189   8e-51    
gb|AFW70723.1|  putative calcium-dependent lipid-binding (CaLB do...    182   5e-49    
gb|AFW85234.1|  putative calcium-dependent lipid-binding (CaLB do...    192   6e-49    
ref|XP_008657466.1|  PREDICTED: uncharacterized protein LOC103636947    191   1e-48    
gb|AFW63669.1|  putative calcium-dependent lipid-binding (CaLB do...    177   3e-47    
ref|XP_002456935.1|  hypothetical protein SORBIDRAFT_03g045920          171   2e-46    
gb|AFW63666.1|  putative calcium-dependent lipid-binding (CaLB do...    172   7e-46    
gb|AFW70724.1|  putative calcium-dependent lipid-binding (CaLB do...    169   4e-45    
ref|XP_008439551.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    163   3e-43    
gb|AFK37883.1|  unknown                                                 159   1e-41    
ref|XP_007022880.1|  ARF-GAP domain 13 isoform 2                        158   4e-40    
gb|AFW76343.1|  putative calcium-dependent lipid-binding (CaLB do...    152   2e-39    
ref|XP_009625251.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    147   6e-36    
ref|XP_010913281.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    145   9e-36    
ref|XP_002905068.1|  ADP-ribosylation factor GTPase-activating pr...    147   2e-35    
ref|XP_010246971.1|  PREDICTED: probable ADP-ribosylation factor ...    140   4e-35    
gb|ACN27533.1|  unknown                                                 137   3e-33    
ref|XP_008465622.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    133   6e-33    
gb|ETI35739.1|  hypothetical protein F443_17959                         139   9e-33    
ref|XP_008896471.1|  hypothetical protein PPTG_04332                    139   2e-32    
gb|ABR17953.1|  unknown                                                 130   1e-31    
ref|XP_003548818.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    128   4e-31    
dbj|GAM19930.1|  hypothetical protein SAMD00019534_031050               138   5e-31    
emb|CDY69110.1|  BnaCnng61930D                                          126   8e-31    
pdb|2IQJ|A  Chain A, Crystal Structure Of The Gap Domain Of Smap1...    125   4e-30    
gb|AFK40077.1|  unknown                                                 125   6e-30    
ref|XP_001625191.1|  predicted protein                                  124   8e-30    
ref|XP_005949522.1|  PREDICTED: stromal membrane-associated prote...    125   1e-29    
ref|XP_004328059.1|  PREDICTED: stromal membrane-associated prote...    125   1e-29    
ref|XP_001365672.1|  PREDICTED: stromal membrane-associated prote...    131   1e-29    
ref|XP_003765460.1|  PREDICTED: stromal membrane-associated prote...    131   2e-29    
ref|XP_001507351.1|  PREDICTED: stromal membrane-associated prote...    130   3e-29    
ref|XP_005529828.1|  PREDICTED: stromal membrane-associated prote...    130   3e-29    
dbj|BAE31472.1|  unnamed protein product                                126   4e-29    
ref|XP_009469117.1|  PREDICTED: stromal membrane-associated prote...    129   5e-29    
ref|XP_010574301.1|  PREDICTED: stromal membrane-associated prote...    129   5e-29    
ref|XP_009469118.1|  PREDICTED: stromal membrane-associated prote...    129   5e-29    
ref|XP_006031298.1|  PREDICTED: stromal membrane-associated prote...    129   5e-29    
ref|XP_006259854.1|  PREDICTED: stromal membrane-associated prote...    129   5e-29    
ref|XP_006503443.1|  PREDICTED: stromal membrane-associated prote...    125   6e-29    
ref|NP_001026073.1|  stromal membrane-associated protein 2              129   6e-29    
ref|XP_643465.3|  hypothetical protein DDB_G0275843                     132   8e-29    
ref|XP_009013806.1|  hypothetical protein HELRODRAFT_75346              122   9e-29    
ref|XP_004665223.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
gb|AAH73437.1|  LOC443647 protein                                       121   1e-28    
ref|XP_006737584.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_005083886.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
gb|ERE83122.1|  stromal membrane-associated protein 2                   128   1e-28    
ref|XP_004450694.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_004704991.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
gb|EDL30411.1|  stromal membrane-associated protein 1-like              128   1e-28    
ref|XP_002586731.1|  hypothetical protein BRAFLDRAFT_141545             121   1e-28    
ref|XP_006987309.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_005353370.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|NP_598477.2|  stromal membrane-associated protein 2                 128   1e-28    
gb|EDL80353.1|  stromal membrane-associated protein 1-like              128   1e-28    
ref|XP_006165002.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_003462327.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_004646024.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_007950888.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_005868720.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_004426073.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_004450693.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_005410613.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_004371948.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|NP_001094139.1|  stromal membrane-associated protein 2              128   1e-28    
ref|XP_004591589.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_006758039.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_007536152.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_007119913.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_008522394.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_004678905.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_006886569.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_006867651.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_010352522.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|NP_073570.1|  stromal membrane-associated protein 2 isoform 1       128   1e-28    
ref|XP_005410612.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_002811031.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_004614272.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_007977459.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|NP_001253659.1|  stromal membrane-associated protein 2              128   1e-28    
ref|XP_002750701.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_010958106.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_008063693.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_006215918.1|  PREDICTED: stromal membrane-associated prote...    128   1e-28    
ref|XP_008966636.1|  PREDICTED: LOW QUALITY PROTEIN: stromal memb...    128   2e-28    
ref|XP_004086220.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_005665577.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|NP_001121936.1|  stromal membrane-associated protein 2              128   2e-28    
ref|XP_002715232.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_008710214.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_010995253.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_004266440.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_004910062.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_003989948.1|  PREDICTED: LOW QUALITY PROTEIN: stromal memb...    128   2e-28    
ref|XP_002927609.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_007453814.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_006061991.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_007164760.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_004782998.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_003799023.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|NP_001069138.1|  stromal membrane-associated protein 2              128   2e-28    
ref|XP_005898691.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_005735209.1|  PREDICTED: stromal membrane-associated prote...    124   2e-28    
ref|XP_005970532.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_004001890.1|  PREDICTED: stromal membrane-associated prote...    128   2e-28    
ref|XP_007893160.1|  PREDICTED: stromal membrane-associated prote...    127   2e-28    
ref|XP_009534583.1|  hypothetical protein PHYSODRAFT_288477             121   2e-28    
ref|XP_005735208.1|  PREDICTED: stromal membrane-associated prote...    124   2e-28    
ref|XP_004415411.1|  PREDICTED: stromal membrane-associated prote...    127   2e-28    
ref|XP_003415575.1|  PREDICTED: stromal membrane-associated prote...    127   2e-28    
ref|XP_005317924.1|  PREDICTED: stromal membrane-associated prote...    127   2e-28    
ref|XP_009048684.1|  hypothetical protein LOTGIDRAFT_98657              120   3e-28    
ref|XP_006904036.1|  PREDICTED: stromal membrane-associated prote...    127   3e-28    
ref|XP_008149412.1|  PREDICTED: stromal membrane-associated prote...    127   3e-28    
dbj|BAE26202.1|  unnamed protein product                                120   3e-28    
ref|XP_003225582.1|  PREDICTED: stromal membrane-associated prote...    127   3e-28    
ref|XP_007420345.1|  PREDICTED: stromal membrane-associated prote...    127   3e-28    
ref|XP_008274754.1|  PREDICTED: stromal membrane-associated prote...    122   4e-28    
ref|XP_008165354.1|  PREDICTED: stromal membrane-associated prote...    127   4e-28    
ref|XP_008319572.1|  PREDICTED: stromal membrane-associated prote...    126   4e-28    
gb|AAI15150.1|  Smap1 protein                                           121   5e-28    
gb|EJW83040.1|  hypothetical protein WUBG_06048                         122   5e-28    
emb|CAB70912.1|  hypothetical protein                                   126   5e-28    
ref|XP_007943377.1|  PREDICTED: stromal membrane-associated prote...    126   6e-28    
gb|AAH71454.1|  Smap1 protein                                           121   6e-28    
ref|XP_007943376.1|  PREDICTED: stromal membrane-associated prote...    126   7e-28    
ref|XP_004554666.1|  PREDICTED: stromal membrane-associated prote...    125   8e-28    
ref|XP_004554669.1|  PREDICTED: stromal membrane-associated prote...    125   9e-28    
ref|XP_006808139.1|  PREDICTED: stromal membrane-associated prote...    125   9e-28    
ref|XP_004554668.1|  PREDICTED: stromal membrane-associated prote...    125   9e-28    
ref|XP_006808138.1|  PREDICTED: stromal membrane-associated prote...    125   1e-27    
ref|XP_004554667.1|  PREDICTED: stromal membrane-associated prote...    125   1e-27    
ref|XP_006808137.1|  PREDICTED: stromal membrane-associated prote...    125   1e-27    
ref|XP_008184975.1|  PREDICTED: stromal membrane-associated prote...    126   1e-27    
gb|ERL93659.1|  hypothetical protein D910_10947                         122   1e-27    
gb|ELV12382.1|  Stromal membrane-associated protein 2                   127   1e-27    
emb|CBK25531.2|  unnamed protein product                                122   1e-27    
ref|XP_005998677.1|  PREDICTED: stromal membrane-associated prote...    125   1e-27    
ref|XP_005457134.1|  PREDICTED: stromal membrane-associated prote...    125   1e-27    
ref|XP_008184974.1|  PREDICTED: stromal membrane-associated prote...    126   1e-27    
ref|XP_005998676.1|  PREDICTED: stromal membrane-associated prote...    125   1e-27    
ref|XP_005998675.1|  PREDICTED: stromal membrane-associated prote...    125   1e-27    
emb|CBN76789.1|  conserved unknown protein                              124   1e-27    
gb|AFW63667.1|  putative calcium-dependent lipid-binding (CaLB do...    119   2e-27    
ref|XP_005998674.1|  PREDICTED: stromal membrane-associated prote...    125   2e-27    
tpg|DAA41991.1|  TPA: hypothetical protein ZEAMMB73_892579              124   2e-27    
ref|XP_005997296.1|  PREDICTED: stromal membrane-associated prote...    124   2e-27    
gb|ABK24539.1|  unknown                                                 119   3e-27    
ref|XP_974103.2|  PREDICTED: stromal membrane-associated protein ...    124   3e-27    
gb|ENN74524.1|  hypothetical protein YQE_08848                          122   3e-27    
ref|XP_009381107.1|  PREDICTED: probable ADP-ribosylation factor ...    118   3e-27    
gb|AAX24661.2|  SJCHGC04830 protein                                     120   4e-27    
ref|XP_002405659.1|  centaurin alpha, putative                          123   4e-27    
ref|XP_010868390.1|  PREDICTED: stromal membrane-associated prote...    124   4e-27    
ref|XP_010868389.1|  PREDICTED: stromal membrane-associated prote...    124   4e-27    
emb|CDI96324.1|  Stromal membrane associated protein 1                  118   4e-27    
ref|XP_010868387.1|  PREDICTED: stromal membrane-associated prote...    124   5e-27    
gb|KFH69957.1|  hypothetical protein MVEG_04760                         124   5e-27    
ref|XP_010868388.1|  PREDICTED: stromal membrane-associated prote...    124   5e-27    
gb|AAI00538.1|  Smap1 protein                                           117   5e-27    
ref|NP_001087046.1|  small ArfGAP 1                                     122   5e-27    
gb|AAI26836.1|  LOC516032 protein                                       117   6e-27    
pdb|2CRR|A  Chain A, Solution Structure Of Arfgap Domain From Hum...    117   6e-27    
ref|NP_001120382.1|  small ArfGAP 1                                     124   7e-27    
ref|XP_002413752.1|  GTPase-activating protein, putative                121   8e-27    
ref|XP_010746346.1|  PREDICTED: stromal membrane-associated prote...    120   8e-27    
gb|EFW40130.2|  stromal membrane-associated GTPase-activating pro...    126   9e-27    
ref|XP_004365526.1|  stromal membrane-associated GTPase-activatin...    126   9e-27    
ref|XP_004231984.1|  PREDICTED: probable ADP-ribosylation factor ...    117   9e-27    
ref|XP_005101540.1|  PREDICTED: stromal membrane-associated prote...    124   1e-26    
emb|CCH46479.1|  ADP-ribosylation factor GTPase-activating protein 3    121   1e-26    
gb|ETN83183.1|  putative GTP-ase activating protein                     117   1e-26    
ref|XP_003667664.1|  hypothetical protein NDAI_0A02630                  121   1e-26    
ref|XP_009381108.1|  PREDICTED: probable ADP-ribosylation factor ...    117   1e-26    
ref|XP_010871456.1|  PREDICTED: stromal membrane-associated prote...    123   2e-26    
dbj|GAA51012.1|  Arf-GAP GTPase ANK repeat and PH domain-containi...    125   2e-26    
ref|XP_008809823.1|  PREDICTED: probable ADP-ribosylation factor ...    116   2e-26    
emb|CCK69924.1|  hypothetical protein KNAG_0D01730                      119   2e-26    
gb|EHJ67556.1|  hypothetical protein KGM_20080                          122   2e-26    
ref|XP_003972620.1|  PREDICTED: stromal membrane-associated prote...    122   2e-26    
ref|XP_003963959.1|  PREDICTED: stromal membrane-associated prote...    121   2e-26    
ref|XP_002731621.1|  PREDICTED: stromal membrane-associated prote...    117   2e-26    
ref|XP_003385504.1|  PREDICTED: arf-GAP with dual PH domain-conta...    120   3e-26    
ref|XP_007374318.1|  hypothetical protein SPAPADRAFT_136340             119   3e-26    
ref|XP_009305630.1|  PREDICTED: stromal membrane-associated prote...    122   3e-26    
ref|NP_001071246.1|  stromal membrane-associated protein 1              122   3e-26    
ref|XP_001108244.2|  PREDICTED: stromal membrane-associated prote...    118   3e-26    



>ref|XP_009602921.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nicotiana tomentosiformis]
Length=395

 Score =   506 bits (1304),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 270/405 (67%), Positives = 324/405 (80%), Gaps = 30/405 (7%)
 Frame = +1

Query  367   GNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADCG  546
             GN + NNVSG+ LY+LLQM++S S+    +P  + +S SPR RL+ L+ ESGN+FCADCG
Sbjct  7     GNADSNNVSGSCLYELLQMESS-SNCSGPQPDRRKHSSSPRHRLQRLLSESGNRFCADCG  65

Query  547   SPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANL  726
             SPDPKWVSLSLGVFICIKCSGVHRSLGVHISKV+SVKLDEWT +QVD L EMGGNN ANL
Sbjct  66    SPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVLSVKLDEWTDDQVDSLIEMGGNNAANL  125

Query  727   KYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLP----------tts  876
             KYEA+ P++Y+K +PD+S EER DFIRRKYELQQF+NSD+ ++CP P          + S
Sbjct  126   KYEASIPDSYRKPRPDASIEERTDFIRRKYELQQFLNSDVQMICPFPPSSSSRCNSLSLS  185

Query  877   ssstsEKKH----SGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVN  1044
              S   +K+H    S GHRIHG+G AFRNSWR+KES+  ++T+KSNSMAGMVEFIGLIKVN
Sbjct  186   CSLALDKRHYEKQSTGHRIHGIGHAFRNSWRRKESE-HRSTKKSNSMAGMVEFIGLIKVN  244

Query  1045  VVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHV  1224
             VVRGTNLA+RD+V+SDPYVIL+LG+QSVKTRVIKNNLNPVWNE+LMLSIPENVPPLKV V
Sbjct  245   VVRGTNLAVRDVVTSDPYVILSLGSQSVKTRVIKNNLNPVWNEKLMLSIPENVPPLKVLV  304

Query  1225  fdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplpl  1404
             +DKDTFTTDDFMGEAEIDIQPL+ AA+ASENST ++ +        KA  EN +      
Sbjct  305   YDKDTFTTDDFMGEAEIDIQPLVTAAKASENSTLSESMLLGKW---KASKENTL------  355

Query  1405  pppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                    DG I+L +G V+Q+I +KLQNVERG+LE+ELECV L+Q
Sbjct  356   -----VKDGIISLIDGKVKQDITVKLQNVERGILEIELECVPLTQ  395



>ref|XP_009780254.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nicotiana sylvestris]
 ref|XP_009780255.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nicotiana sylvestris]
 ref|XP_009780256.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nicotiana sylvestris]
 ref|XP_009780257.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nicotiana sylvestris]
Length=395

 Score =   504 bits (1299),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 270/405 (67%), Positives = 321/405 (79%), Gaps = 30/405 (7%)
 Frame = +1

Query  367   GNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADCG  546
             GN + NNVSG+ LY+LLQM++S S+    +P  +  S SPR RL+ L+ ESGN+FCADCG
Sbjct  7     GNADSNNVSGSCLYELLQMESS-SNCSGPQPDRRKRSSSPRHRLQRLLSESGNRFCADCG  65

Query  547   SPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANL  726
             SPDPKWVSLSLGVFICIKCSGVHRSLGVHISKV+SVKLDEWT +QVD L EMGGNN ANL
Sbjct  66    SPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVLSVKLDEWTDDQVDSLIEMGGNNAANL  125

Query  727   KYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLP----------tts  876
             KYEA+ P++Y+K +P++S EER DFIRRKYELQQF+NSD+ ++CP P          + S
Sbjct  126   KYEASIPDSYRKPRPEASIEERTDFIRRKYELQQFLNSDVQMICPFPPSSSSRCNSLSLS  185

Query  877   ssstsEKKH----SGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVN  1044
              S   +K+H    S GHRIHG+G AFRNSWR+KES+  ++T+KSNSMAGMVEFIGLIKVN
Sbjct  186   CSLALDKRHYEKQSTGHRIHGIGHAFRNSWRRKESE-HRSTKKSNSMAGMVEFIGLIKVN  244

Query  1045  VVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHV  1224
             VVRGTNLA+RD+V+SDPYVIL+LG+QSVKTRVIKNNLNPVWNE+LMLSIPENVP LKV V
Sbjct  245   VVRGTNLAVRDVVTSDPYVILSLGSQSVKTRVIKNNLNPVWNEKLMLSIPENVPSLKVLV  304

Query  1225  fdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplpl  1404
             +DKDTFTTDDFMGEAEIDIQPL+ AA+ASENST     +  P    KA  EN +      
Sbjct  305   YDKDTFTTDDFMGEAEIDIQPLVTAAKASENSTLG---ESMPLGKLKASKENTL------  355

Query  1405  pppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                    DG I+L +G V+Q+I +KLQNVERGVLE+ELECV L+Q
Sbjct  356   -----VKDGIISLIDGKVKQDITVKLQNVERGVLEIELECVPLTQ  395



>ref|XP_004244953.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Solanum lycopersicum]
Length=395

 Score =   493 bits (1270),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 259/405 (64%), Positives = 321/405 (79%), Gaps = 30/405 (7%)
 Frame = +1

Query  367   GNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADCG  546
             GN + NNV+G+ LY+LLQM++S + S   +P+ ++ S SPR RL+ L+ ESGN+FCADCG
Sbjct  7     GNVDSNNVTGSCLYELLQMESSANCSGH-QPERRNRSSSPRHRLQRLLSESGNRFCADCG  65

Query  547   SPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANL  726
             SPDPKWVS++LG+FICIKCSGVHRSLGVHISKV+SVKLDEWT +QVD + EMGGN+ AN+
Sbjct  66    SPDPKWVSINLGIFICIKCSGVHRSLGVHISKVLSVKLDEWTDDQVDSMIEMGGNSAANM  125

Query  727   KYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLP-------------  867
             KYEAA P++Y+K +P++  E R DFIRRKYELQQF+NSD  ++CP P             
Sbjct  126   KYEAAIPDSYRKPRPEALIEVRTDFIRRKYELQQFLNSDEQMICPYPPSSSSHCNSLSLT  185

Query  868   -ttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVN  1044
              + +    + +K S GHRIHG+G AFRNSWR+KES+  ++T+KSNSMAGMVEFIGLIKVN
Sbjct  186   CSLALDKRNYEKQSTGHRIHGIGHAFRNSWRRKESE-HRSTKKSNSMAGMVEFIGLIKVN  244

Query  1045  VVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHV  1224
             VVRGTNLA+RD+V+SDPYVIL+LG+QSVKTRVIKNNLNPVWNE+LMLSIPENVPPLK+ V
Sbjct  245   VVRGTNLAVRDVVTSDPYVILSLGSQSVKTRVIKNNLNPVWNEKLMLSIPENVPPLKMLV  304

Query  1225  fdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplpl  1404
             +DKDTFTTDDFMGEAEIDIQPL+ AA+ASENST ++ +Q       KA  +N +      
Sbjct  305   YDKDTFTTDDFMGEAEIDIQPLVTAAKASENSTLSESIQL---GKWKASKDNTL------  355

Query  1405  pppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                    DG I+L +G V+QEI +KLQNVERGVLE+ELECV L+Q
Sbjct  356   -----VKDGMISLIDGKVKQEISVKLQNVERGVLEIELECVPLTQ  395



>ref|XP_006355263.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Solanum tuberosum]
Length=395

 Score =   491 bits (1263),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 258/405 (64%), Positives = 320/405 (79%), Gaps = 30/405 (7%)
 Frame = +1

Query  367   GNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADCG  546
             GN + NNV+G+ LY+LLQM++S + S   +P+ ++ S SPR RL+ L+ ESGN+FCADCG
Sbjct  7     GNVDSNNVTGSCLYELLQMESSANCSGH-QPERRNRSSSPRHRLQRLLSESGNRFCADCG  65

Query  547   SPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANL  726
             SPDPKWVS++LGVFICIKCSGVHRSLGVHISKV+SVKLDEWT +QVD + EMGGN+ AN+
Sbjct  66    SPDPKWVSINLGVFICIKCSGVHRSLGVHISKVLSVKLDEWTDDQVDSMIEMGGNSAANM  125

Query  727   KYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLP-------------  867
             KYEA  P++Y+K +P++  E R DFIRRKYELQQF+NSD  ++CP P             
Sbjct  126   KYEAVIPDSYRKPRPEALIEVRTDFIRRKYELQQFLNSDEQMICPFPPSSSSHYNSLSLT  185

Query  868   -ttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVN  1044
              + +    + +K S GHRIHG+G AFRNSWR+KES+  ++T+KSNSMAGMVEFIGLIKVN
Sbjct  186   CSLALDKRNYEKQSTGHRIHGIGHAFRNSWRRKESE-HRSTKKSNSMAGMVEFIGLIKVN  244

Query  1045  VVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHV  1224
             VVRGTNLA+RD+V+SDPYVIL+LG+QSVKTRVIKNNLNPVWNE+LMLSIPENVPPLK+ V
Sbjct  245   VVRGTNLAVRDVVTSDPYVILSLGSQSVKTRVIKNNLNPVWNEKLMLSIPENVPPLKMLV  304

Query  1225  fdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplpl  1404
             +DKDTFTTDDFMGEAEIDI+PL+ AA+ASENST ++ +   P    KA  +N +      
Sbjct  305   YDKDTFTTDDFMGEAEIDIEPLVTAAKASENSTLSESM---PLGKWKASKDNTL------  355

Query  1405  pppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                    DG I+L +G V+QEI +KLQNVERGVLE+ELECV L+Q
Sbjct  356   -----VKDGMISLIDGKVKQEISVKLQNVERGVLEIELECVPLTQ  395



>gb|EYU38275.1| hypothetical protein MIMGU_mgv1a007749mg [Erythranthe guttata]
Length=396

 Score =   475 bits (1222),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 258/407 (63%), Positives = 306/407 (75%), Gaps = 32/407 (8%)
 Frame = +1

Query  367   GNTEGNNVSGARLYDLLQMDTSPSDSDQMEP-QMQDYSLSPRCRLKALMKESGNQFCADC  543
             GN E  N SG+ L DLL+++TS    D   P + +D S SP+ RLK+L+ E+GN FCADC
Sbjct  6     GNGETENTSGS-LLDLLRLETSSDWGDDESPNEKRDSSSSPKKRLKSLLSEAGNGFCADC  64

Query  544   GSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVAN  723
             GSPDPKWVSLS+G FICIKCSGVHRSLGVHI+KV+S+ LDEWT EQVD L EMGGNN  N
Sbjct  65    GSPDPKWVSLSIGAFICIKCSGVHRSLGVHITKVLSMNLDEWTDEQVDALIEMGGNNAVN  124

Query  724   LKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsE---  894
             LK+EA  PENY K KPDSST+ER DFIR+KYE QQF+N+DL   CP P+ S+S  S    
Sbjct  125   LKFEAQIPENYSKPKPDSSTDERADFIRKKYEHQQFMNNDLQFYCPFPSPSTSHYSNPSC  184

Query  895   -----------KKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKV  1041
                        KK SGG RIHG+G  FRNSWR+ E    K  RK+NSM GMVEF+GLI V
Sbjct  185   YSQSLPEKKNTKKQSGGTRIHGIGHVFRNSWRRSERSESKP-RKTNSMEGMVEFVGLINV  243

Query  1042  NVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVH  1221
             N+VRGTNLA+RDMVSSDPYVIL+LGNQS KTRVIKNNLNPVWNE+LMLSIPE+VPPLK+ 
Sbjct  244   NIVRGTNLAVRDMVSSDPYVILSLGNQSTKTRVIKNNLNPVWNERLMLSIPESVPPLKLF  303

Query  1222  VfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQ-QQPRTPKKAETENAMpppl  1398
             V+DKDTF+TDDFMG+AEIDIQPLL AA+ASE S+ ++P++    +T K++          
Sbjct  304   VYDKDTFSTDDFMGDAEIDIQPLLSAAKASECSSISEPIRFGNFKTDKESNV--------  355

Query  1399  plpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                   L  DGTI L +G V+QEI +KLQNVERGVLE+ELECV L+Q
Sbjct  356   ------LVKDGTITLEDGRVKQEIAIKLQNVERGVLEIELECVLLTQ  396



>ref|XP_010324884.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Solanum lycopersicum]
 ref|XP_010324885.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Solanum lycopersicum]
Length=371

 Score =   470 bits (1210),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 245/376 (65%), Positives = 300/376 (80%), Gaps = 29/376 (8%)
 Frame = +1

Query  454   EPQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVH  633
             +P+ ++ S SPR RL+ L+ ESGN+FCADCGSPDPKWVS++LG+FICIKCSGVHRSLGVH
Sbjct  11    QPERRNRSSSPRHRLQRLLSESGNRFCADCGSPDPKWVSINLGIFICIKCSGVHRSLGVH  70

Query  634   ISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRK  813
             ISKV+SVKLDEWT +QVD + EMGGN+ AN+KYEAA P++Y+K +P++  E R DFIRRK
Sbjct  71    ISKVLSVKLDEWTDDQVDSMIEMGGNSAANMKYEAAIPDSYRKPRPEALIEVRTDFIRRK  130

Query  814   YELQQFVNSDLHLMCPLP--------------ttsssstsEKKHSGGHRIHGLGFAFRNS  951
             YELQQF+NSD  ++CP P              + +    + +K S GHRIHG+G AFRNS
Sbjct  131   YELQQFLNSDEQMICPYPPSSSSHCNSLSLTCSLALDKRNYEKQSTGHRIHGIGHAFRNS  190

Query  952   WRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVK  1131
             WR+KES+  ++T+KSNSMAGMVEFIGLIKVNVVRGTNLA+RD+V+SDPYVIL+LG+QSVK
Sbjct  191   WRRKESE-HRSTKKSNSMAGMVEFIGLIKVNVVRGTNLAVRDVVTSDPYVILSLGSQSVK  249

Query  1132  TRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARAS  1311
             TRVIKNNLNPVWNE+LMLSIPENVPPLK+ V+DKDTFTTDDFMGEAEIDIQPL+ AA+AS
Sbjct  250   TRVIKNNLNPVWNEKLMLSIPENVPPLKMLVYDKDTFTTDDFMGEAEIDIQPLVTAAKAS  309

Query  1312  ENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNV  1491
             ENST ++ +Q       KA  +N +             DG I+L +G V+QEI +KLQNV
Sbjct  310   ENSTLSESIQL---GKWKASKDNTL-----------VKDGMISLIDGKVKQEISVKLQNV  355

Query  1492  ERGVLEVELECVSLSQ  1539
             ERGVLE+ELECV L+Q
Sbjct  356   ERGVLEIELECVPLTQ  371



>ref|XP_011091846.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Sesamum indicum]
Length=392

 Score =   463 bits (1191),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 258/417 (62%), Positives = 302/417 (72%), Gaps = 38/417 (9%)
 Frame = +1

Query  328   MSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKAL  507
             MS+QQ        G  E  +V G  LY+LL+M+TS +        +   S SPR RL+++
Sbjct  1     MSIQQ--------GKAETKDVPGFSLYELLRMETSSNWGLCSREWIHSKSSSPRQRLESV  52

Query  508   MKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVD  687
             + E+GN+ CADCGSPDPKWVSLS+G FICIKCSGVHRSLGVHISKV SVKLDEWT EQVD
Sbjct  53    LSEAGNRTCADCGSPDPKWVSLSIGAFICIKCSGVHRSLGVHISKVFSVKLDEWTDEQVD  112

Query  688   ILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLP  867
              L EMGGNNV N KYEA  P+ ++K KPDSST ER DFIRRKYEL QF++ DL L C  P
Sbjct  113   ALIEMGGNNVVNSKYEACIPDYFRKPKPDSSTVERTDFIRRKYELLQFLDRDLELNCRFP  172

Query  868   ----------ttsssstsEKKH---SGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMA  1008
                       +  S S  EK++   +  HRI GLG  FRNSWRK E    KA +K+NSMA
Sbjct  173   PPLTSNSNSSSCCSPSPPEKRYDKQTTAHRIQGLGLVFRNSWRKTE---YKAAKKNNSMA  229

Query  1009  GMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLS  1188
             GMVEF+GLIKVN+VRGTNLAIRD+VSSDPYVIL+LGNQS+KTRVIKNNLNPVWNE LMLS
Sbjct  230   GMVEFVGLIKVNIVRGTNLAIRDVVSSDPYVILSLGNQSMKTRVIKNNLNPVWNESLMLS  289

Query  1189  IPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKA  1368
             IPENVPPLK+ V+DKDTF+TDDFMG+AEIDIQPLL AA+ASE S+ ++  Q       KA
Sbjct  290   IPENVPPLKLLVYDKDTFSTDDFMGDAEIDIQPLLSAAKASECSSISESTQLGKW---KA  346

Query  1369  ETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
               EN +             DG I L +G V+QEI +KLQNVERGVLE+ELECV L+Q
Sbjct  347   SKENTL-----------VSDGVITLEDGRVKQEISIKLQNVERGVLEIELECVPLTQ  392



>emb|CDP18917.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   460 bits (1183),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 254/385 (66%), Positives = 296/385 (77%), Gaps = 29/385 (8%)
 Frame = +1

Query  421   MDTSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIK  600
             M+TSPS S  +  +  + S SP+ RL++L+ E GN+FCADCGSP+PKWVS + G FICIK
Sbjct  1     METSPSYS-CLSNERHNLSSSPQRRLESLLVERGNRFCADCGSPEPKWVSFNFGAFICIK  59

Query  601   CSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSS  780
             CSGVHRSLGVHI+KV+S+KLDEWT+EQVD L  MGGN   NLKYEA  PENYKK K DSS
Sbjct  60    CSGVHRSLGVHITKVLSMKLDEWTNEQVDTLISMGGNTAVNLKYEALLPENYKKPKLDSS  119

Query  781   TEERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsE------------KKHSGGHRIH  924
              EER+DFIRRKYELQQF N D  + C LP+ SSS  +             +K +  +RIH
Sbjct  120   IEERSDFIRRKYELQQFSNCDELMYCTLPSPSSSYCNSVSCNYTLEKRQYEKQTTSNRIH  179

Query  925   GLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVI  1104
             GLG AFRNSWR+  S  Q++T+KSNSMAGMVEFIGLIKVNVVRGTNLAIRDMV+SDPYVI
Sbjct  180   GLGQAFRNSWRR--SSEQRSTKKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVTSDPYVI  237

Query  1105  LTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQ  1284
             L+LGNQSVKTRVIKNNLNPVWNE+LMLSIPENVPPLK+ V+DKDTFTTDDFMGEAEIDIQ
Sbjct  238   LSLGNQSVKTRVIKNNLNPVWNEKLMLSIPENVPPLKLLVYDKDTFTTDDFMGEAEIDIQ  297

Query  1285  PLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQ  1464
             PL+ AA+A E+S  ++P+Q       KA  EN +             DG I+L EG V+Q
Sbjct  298   PLVSAAKAFESSILHEPMQLGKW---KASRENTL-----------VRDGIISLDEGKVKQ  343

Query  1465  EIVLKLQNVERGVLEVELECVSLSQ  1539
             EI LKLQNVERGVLE+ELECV L+Q
Sbjct  344   EIALKLQNVERGVLEIELECVPLTQ  368



>emb|CBI40178.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   454 bits (1168),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 248/411 (60%), Positives = 298/411 (73%), Gaps = 36/411 (9%)
 Frame = +1

Query  319   G*KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRL  498
             G KM  +QDNT  N    T      G+ L DLL+ D   +   + +      S  PR RL
Sbjct  36    GLKMPTRQDNTDSNNGSGT------GSSLLDLLRSDIYWNCRKEGQT-----SSGPRGRL  84

Query  499   KALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHE  678
             + L+ +SGN  CADCGSPDPKWVS+SLGVFICIKCSGVHRSLG H+SKV+S+KLDEWT E
Sbjct  85    ENLLCQSGNNICADCGSPDPKWVSVSLGVFICIKCSGVHRSLGAHVSKVLSIKLDEWTDE  144

Query  679   QVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMC  858
             QVD LT MGGN+ AN+KYEA+ P+  +K +PDSSTEER+DFIRRKYE+QQF NSD  + C
Sbjct  145   QVDTLTGMGGNSEANMKYEASIPDYIRKPRPDSSTEERSDFIRRKYEMQQFFNSDEQMFC  204

Query  859   PLPttsssstsEKKH----SGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFI  1026
             P P        EKKH    +  HR+HGLG AFRNSWR+KE +  K  +KS+S AGM+EF+
Sbjct  205   PFP------PQEKKHYEKQTTTHRLHGLGLAFRNSWRRKEPE-HKPVKKSSSSAGMIEFV  257

Query  1027  GLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVP  1206
             GLIKVNVV+GTNLA+RD+++SDPYV+L LG QSVKTRVIKNNLNPVWNE+LMLSIPE +P
Sbjct  258   GLIKVNVVKGTNLAVRDVMTSDPYVLLALGQQSVKTRVIKNNLNPVWNERLMLSIPEQIP  317

Query  1207  PLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAM  1386
             PL+V V+DKDTF+TDDFMGEAEIDIQPL+ AA A ENST N+P++       K  T    
Sbjct  318   PLRVFVYDKDTFSTDDFMGEAEIDIQPLVSAAIAHENSTLNEPMEFGKLVASKENT----  373

Query  1387  ppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                       L  D  I+L +G V Q++ LKLQNVERGVLE+ELECV LSQ
Sbjct  374   ----------LVKDSVISLTDGKVMQDVSLKLQNVERGVLEIELECVPLSQ  414



>ref|XP_011088498.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Sesamum indicum]
Length=398

 Score =   449 bits (1154),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 244/406 (60%), Positives = 301/406 (74%), Gaps = 34/406 (8%)
 Frame = +1

Query  328   MSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKAL  507
             MS++Q N +  + G++ G+  S +RLY+LL M+TS SD D      Q+   SP  RL++L
Sbjct  1     MSIEQGNREGES-GHSRGSG-SRSRLYELLDMETS-SDCDDSPRNWQNLFCSPEMRLESL  57

Query  508   MKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVD  687
             + E+GN FCADCGSPDPKWVSL++G FICIKCSG+HRSLGVHISKVVSV LDEWT+EQVD
Sbjct  58    LSEAGNGFCADCGSPDPKWVSLNIGAFICIKCSGIHRSLGVHISKVVSVNLDEWTNEQVD  117

Query  688   ILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLP  867
              L EMGGNN  NLKYE+  PENY K KPD+S EER DFIR+KYE  QF+NS LHL CP P
Sbjct  118   ALIEMGGNNAVNLKYESHLPENYTKPKPDASAEERADFIRKKYEQHQFMNSTLHLACPFP  177

Query  868   ----------ttsssstsEKKHS----GGHRIHGLGFAFRNSWRKKESDTQKATRKSNSM  1005
                       ++ S S  E+KH+     G RIHGLG AFR SWR+ E    K+T+KS+SM
Sbjct  178   LPSSSDCSSSSSYSESALERKHNEKYFPGGRIHGLGHAFRYSWRRPE---HKSTKKSHSM  234

Query  1006  AGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLML  1185
             AGMVEF+GLI VN++RGTNLA+RDMVSSDPYVIL+LGNQS KTRVIKNNLNPVWNE+LML
Sbjct  235   AGMVEFVGLITVNILRGTNLAVRDMVSSDPYVILSLGNQSTKTRVIKNNLNPVWNEKLML  294

Query  1186  SIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK  1365
             SIP++VPPLK+ V+DKDTF+TDDFMG+AEIDIQPLL AA+  E+S+ ++P+Q +     +
Sbjct  295   SIPDSVPPLKLLVYDKDTFSTDDFMGDAEIDIQPLLSAAKGLESSSNSEPMQHESH---Q  351

Query  1366  AETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGV  1503
             A  +N +                I L +G V+QE+ +KLQNVERGV
Sbjct  352   ASEDNML-----------VKGSIITLEDGRVKQEVAIKLQNVERGV  386



>ref|XP_010645647.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Vitis vinifera]
Length=394

 Score =   448 bits (1153),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 245/408 (60%), Positives = 297/408 (73%), Gaps = 38/408 (9%)
 Frame = +1

Query  370   NTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADCGS  549
             NT+ NN SG+ L DLL+ D   +   + +      S  PR RL+ L+ +SGN  CADCGS
Sbjct  7     NTDSNNGSGSSLLDLLRSDIYWNCRKEGQ-----TSSGPRGRLENLLCQSGNNICADCGS  61

Query  550   PDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLK  729
             PDPKWVS+SLGVFICIKCSGVHRSLG H+SKV+S+KLDEWT EQVD LT MGGN+ AN+K
Sbjct  62    PDPKWVSVSLGVFICIKCSGVHRSLGAHVSKVLSIKLDEWTDEQVDTLTGMGGNSEANMK  121

Query  730   YEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLP--------------  867
             YEA+ P+  +K +PDSSTEER+DFIRRKYE+QQF NSD  + CP P              
Sbjct  122   YEASIPDYIRKPRPDSSTEERSDFIRRKYEMQQFFNSDEQMFCPFPPQGLCSPSSQGGSS  181

Query  868   ttsssstsEKKH----SGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLI  1035
             +  S    EKKH    +  HR+HGLG AFRNSWR+KE +  K  +KS+S AGM+EF+GLI
Sbjct  182   SNQSGLPPEKKHYEKQTTTHRLHGLGLAFRNSWRRKEPE-HKPVKKSSSSAGMIEFVGLI  240

Query  1036  KVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLK  1215
             KVNVV+GTNLA+RD+++SDPYV+L LG QSVKTRVIKNNLNPVWNE+LMLSIPE +PPL+
Sbjct  241   KVNVVKGTNLAVRDVMTSDPYVLLALGQQSVKTRVIKNNLNPVWNERLMLSIPEQIPPLR  300

Query  1216  VHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppp  1395
             V V+DKDTF+TDDFMGEAEIDIQPL+ AA A ENST N+P++        A  EN +   
Sbjct  301   VFVYDKDTFSTDDFMGEAEIDIQPLVSAAIAHENSTLNEPMEFGKLV---ASKENTL---  354

Query  1396  lplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                       D  I+L +G V Q++ LKLQNVERGVLE+ELECV LSQ
Sbjct  355   --------VKDSVISLTDGKVMQDVSLKLQNVERGVLEIELECVPLSQ  394



>ref|XP_010645646.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Vitis vinifera]
Length=396

 Score =   446 bits (1147),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 247/422 (59%), Positives = 299/422 (71%), Gaps = 44/422 (10%)
 Frame = +1

Query  328   MSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKAL  507
             M  +QDNT  N    T      G+ L DLL+ D   +   + +      S  PR RL+ L
Sbjct  1     MPTRQDNTDSNNGSGT------GSSLLDLLRSDIYWNCRKEGQ-----TSSGPRGRLENL  49

Query  508   MKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVD  687
             + +SGN  CADCGSPDPKWVS+SLGVFICIKCSGVHRSLG H+SKV+S+KLDEWT EQVD
Sbjct  50    LCQSGNNICADCGSPDPKWVSVSLGVFICIKCSGVHRSLGAHVSKVLSIKLDEWTDEQVD  109

Query  688   ILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLP  867
              LT MGGN+ AN+KYEA+ P+  +K +PDSSTEER+DFIRRKYE+QQF NSD  + CP P
Sbjct  110   TLTGMGGNSEANMKYEASIPDYIRKPRPDSSTEERSDFIRRKYEMQQFFNSDEQMFCPFP  169

Query  868   --------------ttsssstsEKKH----SGGHRIHGLGFAFRNSWRKKESDTQKATRK  993
                           +  S    EKKH    +  HR+HGLG AFRNSWR+KE +  K  +K
Sbjct  170   PQGLCSPSSQGGSSSNQSGLPPEKKHYEKQTTTHRLHGLGLAFRNSWRRKEPE-HKPVKK  228

Query  994   SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNE  1173
             S+S AGM+EF+GLIKVNVV+GTNLA+RD+++SDPYV+L LG QSVKTRVIKNNLNPVWNE
Sbjct  229   SSSSAGMIEFVGLIKVNVVKGTNLAVRDVMTSDPYVLLALGQQSVKTRVIKNNLNPVWNE  288

Query  1174  QLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPR  1353
             +LMLSIPE +PPL+V V+DKDTF+TDDFMGEAEIDIQPL+ AA A ENST N+P++    
Sbjct  289   RLMLSIPEQIPPLRVFVYDKDTFSTDDFMGEAEIDIQPLVSAAIAHENSTLNEPMEFGKL  348

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                 A  EN +             D  I+L +G V Q++ LKLQNVERGVLE+ELECV L
Sbjct  349   V---ASKENTL-----------VKDSVISLTDGKVMQDVSLKLQNVERGVLEIELECVPL  394

Query  1534  SQ  1539
             SQ
Sbjct  395   SQ  396



>gb|EYU42946.1| hypothetical protein MIMGU_mgv1a024311mg, partial [Erythranthe 
guttata]
Length=351

 Score =   439 bits (1129),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 281/368 (76%), Gaps = 33/368 (9%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             PR RL++L+ ESGN+ CADCGSPDPKWVSLS+G FICIKCSGVHRSLGVHISKV SVKLD
Sbjct  1     PRGRLESLLSESGNRVCADCGSPDPKWVSLSIGAFICIKCSGVHRSLGVHISKVYSVKLD  60

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             EWT++QVD L EMGGN   NLKYEA  P++Y+K +PDSS EER DFIRRKYEL QF+N D
Sbjct  61    EWTNDQVDALIEMGGNVAVNLKYEARIPDHYRKPRPDSSAEERTDFIRRKYELHQFLNCD  120

Query  844   LHLMCPLPttsss----------------stsEKKHSGGHRIHGLGFAFRNSWRKKESDT  975
             L L CP PT  SS                  S +K +  H+ HGLG AFRNSWR+ E   
Sbjct  121   LQLYCPFPTLPSSQCSPSGSCSLSLLPLDKKSYEKQTTSHKSHGLGHAFRNSWRRPEP--  178

Query  976   QKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNL  1155
              K T+KSNSMAGMVEF+GLIKVN+VRGTNLA+RDMV+SDPYVIL+LGNQS+KTRVIKNNL
Sbjct  179   -KITKKSNSMAGMVEFVGLIKVNIVRGTNLAVRDMVTSDPYVILSLGNQSMKTRVIKNNL  237

Query  1156  NPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDP  1335
             NPVWNE LMLSIPEN+PPLK+ V+DKDTF+TDDFMG+AEIDIQPLL AA+ASE+S+ N+ 
Sbjct  238   NPVWNESLMLSIPENIPPLKLLVYDKDTFSTDDFMGDAEIDIQPLLSAAKASESSSINES  297

Query  1336  VQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVE  1515
              Q       KA  EN +             DG I L +G V+QEI +KLQNVERGVLE+E
Sbjct  298   TQLGKW---KASHENTL-----------VKDGVITLEDGKVKQEISIKLQNVERGVLEIE  343

Query  1516  LECVSLSQ  1539
             LECV L+Q
Sbjct  344   LECVPLTQ  351



>gb|EYU21108.1| hypothetical protein MIMGU_mgv1a021557mg [Erythranthe guttata]
Length=367

 Score =   438 bits (1127),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 242/368 (66%), Positives = 280/368 (76%), Gaps = 33/368 (9%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             PR RL++L+ ESGN+ CADCGSPDPKWVSLS+G F CIKCSGVHRSLGVHISKV SVKLD
Sbjct  17    PRGRLESLLSESGNRVCADCGSPDPKWVSLSIGAFFCIKCSGVHRSLGVHISKVYSVKLD  76

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             EWT++QVD L EMGGN   NLKYEA  P++Y+K +PDSS EER DFIRRKYEL QF+N D
Sbjct  77    EWTNDQVDALIEMGGNVAVNLKYEARIPDHYRKPRPDSSAEERTDFIRRKYELHQFLNCD  136

Query  844   LHLMCPLPttsss----------------stsEKKHSGGHRIHGLGFAFRNSWRKKESDT  975
             L L CP PT  SS                  S +K +  H+ HGLG AFRNSWR+ E   
Sbjct  137   LQLYCPFPTLPSSQCSPSGSCPLSLLPLDKKSYEKQTTAHKSHGLGHAFRNSWRRPEP--  194

Query  976   QKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNL  1155
              K T+KSNSMAGMVEF+GLIKVN+VRGTNLA+RDMV+SDPYVIL+LGNQS+KTRVIKNNL
Sbjct  195   -KITKKSNSMAGMVEFVGLIKVNIVRGTNLAVRDMVTSDPYVILSLGNQSMKTRVIKNNL  253

Query  1156  NPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDP  1335
             NPVWNE LMLSIPEN+PPLK+ V+DKDTF+TDDFMG+AEIDIQPLL AA+ASE+S+ N+ 
Sbjct  254   NPVWNESLMLSIPENIPPLKLLVYDKDTFSTDDFMGDAEIDIQPLLSAAKASESSSINES  313

Query  1336  VQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVE  1515
              Q       KA  EN +             DG I L +G V+QEI +KLQNVERGVLE+E
Sbjct  314   TQLGKW---KASHENTL-----------VKDGVITLEDGKVKQEISIKLQNVERGVLEIE  359

Query  1516  LECVSLSQ  1539
             LECV L+Q
Sbjct  360   LECVPLTQ  367



>ref|XP_007011070.1| Calcium-dependent ARF-type GTPase activating protein family isoform 
1 [Theobroma cacao]
 gb|EOY19880.1| Calcium-dependent ARF-type GTPase activating protein family isoform 
1 [Theobroma cacao]
Length=403

 Score =   434 bits (1116),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 246/424 (58%), Positives = 301/424 (71%), Gaps = 41/424 (10%)
 Frame = +1

Query  328   MSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSP----SDSDQMEP-QMQDY--SLSP  486
             MS Q  N+      + + ++ SG+ LYDLL  +T      SD++     Q +D   S  P
Sbjct  1     MSAQHGNS------DPKSSSGSGSCLYDLLCSETPSWNRVSDAETSSSIQRKDTLKSTGP  54

Query  487   RCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDE  666
             R RL++L+ ESGN  CADCGSPDPKWVS+SLGVFICIKCSGVHRSLGVHISKV+SVKLDE
Sbjct  55    RRRLESLLHESGNGVCADCGSPDPKWVSVSLGVFICIKCSGVHRSLGVHISKVLSVKLDE  114

Query  667   WTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDL  846
             WT +QVD L  +GGN VAN KYEA  P+N KK +PDSS EER+DFI+RKYE+ QF++ + 
Sbjct  115   WTDDQVDSLVNLGGNIVANNKYEACLPDNLKKPRPDSSIEERSDFIKRKYEVLQFLDGND  174

Query  847   HLMCPLPttsssstsEKKHSGGHRI-------------HGLGFAFRNSWRKKESDTQKAT  987
              ++CP P     S+S  + S GH               H +G  FRNSW +K+S+  K+T
Sbjct  175   QIICPYPPHQKPSSSTPQCSAGHHFAQDKKQCEKQPTRHRIGHKFRNSWGRKDSE-HKST  233

Query  988   RKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVW  1167
             +K+NS+AGMVEFIGL+KVNVV+GTNLA+RDM++SDPYVIL LG QSVKTRVIKNNLNPVW
Sbjct  234   KKTNSLAGMVEFIGLVKVNVVKGTNLAVRDMMTSDPYVILALGQQSVKTRVIKNNLNPVW  293

Query  1168  NEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQ  1347
             NE LMLSIPEN+PPLKV V+DKDTF+TDDFMG+AEIDIQPL+ AA+A ENS   + +Q  
Sbjct  294   NESLMLSIPENIPPLKVLVYDKDTFSTDDFMGDAEIDIQPLVAAAKACENSELRESMQLG  353

Query  1348  PRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECV  1527
                  K  T              L  DG I L +G V+QEI L+LQNVERGVLE+ELECV
Sbjct  354   KWVASKDNT--------------LVKDGIITLVDGKVKQEISLRLQNVERGVLEIELECV  399

Query  1528  SLSQ  1539
              L+Q
Sbjct  400   PLTQ  403



>ref|XP_004514475.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like isoform X3 [Cicer arietinum]
Length=397

 Score =   429 bits (1104),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 243/419 (58%), Positives = 304/419 (73%), Gaps = 37/419 (9%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKA  504
             +MS+QQ+N+   ++        SG+ LYDL   +T   +S     Q   Y   P+ RL  
Sbjct  2     EMSMQQENSDIKSISG------SGSCLYDLFCCETPSLNSQSQREQWMLYG--PQERLDN  53

Query  505   LMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQV  684
             LM+++GN+FCADCGS DPKWVS SLGVFICIKCSG+HRSLGVHISKV+S+ LD+WT EQV
Sbjct  54    LMRQAGNKFCADCGSSDPKWVSSSLGVFICIKCSGIHRSLGVHISKVLSLNLDDWTDEQV  113

Query  685   DILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCP-  861
             D L  +GGN V N KYEA  P   KK KP SS EER+DFIRRKYELQQFV+S+ +L CP 
Sbjct  114   DALVNLGGNTVINKKYEACLPSYIKKPKPTSSIEERSDFIRRKYELQQFVDSEENLTCPF  173

Query  862   LPttssssts-------------EKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNS  1002
             +P+ + SS+S             +K++      + +G +FRNSW +KES++ K+T+KSNS
Sbjct  174   IPSHARSSSSSHSSSSYNNPPQDKKRYDKQTTKNRIGLSFRNSWGRKESES-KSTKKSNS  232

Query  1003  MAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLM  1182
             +AGMVEFIGLIKVNVV+GTNLAIRD+++SDPYVIL+LG+QSVKTRVIK+NLNPVWNE LM
Sbjct  233   LAGMVEFIGLIKVNVVKGTNLAIRDLMTSDPYVILSLGHQSVKTRVIKSNLNPVWNESLM  292

Query  1183  LSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPK  1362
             LSIPE++PPLKV V+DKD+F TDDFMGEAEIDIQPL+ AA+A E S+ N+ +Q       
Sbjct  293   LSIPESIPPLKVIVYDKDSFKTDDFMGEAEIDIQPLVSAAKAYEKSSINESMQLGKWV--  350

Query  1363  KAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              A  +N +             DG I+L EG VRQEI L+LQNVERGVLE+ELECV L+Q
Sbjct  351   -ASGDNTL-----------VKDGIISLEEGKVRQEISLRLQNVERGVLEIELECVPLTQ  397



>ref|XP_008348317.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
 ref|XP_008348320.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
 ref|XP_008348327.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
Length=390

 Score =   428 bits (1101),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 246/417 (59%), Positives = 291/417 (70%), Gaps = 40/417 (10%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDT----SPSDSDQMEPQMQDYSLSPRC  492
             +MS QQDN+  N V        SG+ LYDLL  DT     PSD   +          P+ 
Sbjct  2     EMSTQQDNSVPNKVSG------SGSCLYDLLCSDTPVWRCPSDRRTLS--------GPQE  47

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL+ L+ +S N+ CADCG+ DPKWVSL+ GVFICIKCSGVHRSLGVHISKVVSVKLDEWT
Sbjct  48    RLEILLHQSANRSCADCGALDPKWVSLTFGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  107

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++V+IL  MGGN   N KYEA  PEN  K KPDSS EER  FIRRKYEL  F+NSD  +
Sbjct  108   DDEVEILASMGGNTTVNKKYEARLPENVSKPKPDSSIEERFYFIRRKYELLDFLNSDEQM  167

Query  853   MCPLP-------ttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATR-KSNSMA  1008
              CP P       +T SS+  +K++      H +G AFRNSW +K+S+ + A +  S  MA
Sbjct  168   SCPFPPNKKSNNSTVSSTQDKKQYEKQPTKHRIGQAFRNSWGRKDSEXKTAKKGYSMPMA  227

Query  1009  GMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLS  1188
             GMVEF+GLIKVNVVRGTNL +RDMV+SDPYVIL LG+QSVKTRVIKNNLNPVWNE LMLS
Sbjct  228   GMVEFVGLIKVNVVRGTNLVVRDMVTSDPYVILALGHQSVKTRVIKNNLNPVWNESLMLS  287

Query  1189  IPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKA  1368
             IP+++PPLKV V+DKDTF  DDFMGEAEIDIQPL+ AA A E S+ N+PVQ        A
Sbjct  288   IPDHIPPLKVLVYDKDTFKADDFMGEAEIDIQPLVSAAIAYEKSSINEPVQLGKWV---A  344

Query  1369  ETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
               ENA+             DG INL +G VRQ+I L+LQNVERG+LE+ELECV L+Q
Sbjct  345   SKENAL-----------VKDGVINLVDGGVRQQISLRLQNVERGILEIELECVPLNQ  390



>ref|XP_004514473.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like isoform X1 [Cicer arietinum]
 ref|XP_004514474.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like isoform X2 [Cicer arietinum]
Length=410

 Score =   427 bits (1099),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 244/426 (57%), Positives = 304/426 (71%), Gaps = 38/426 (9%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGAR-------LYDLLQMDTSPSDSDQMEPQMQDYSLS  483
             +MS+QQ+N+   ++        SG R       LYDL   +T   +S     Q   Y   
Sbjct  2     EMSMQQENSDIKSISGERRFENSGVRPGGSGSCLYDLFCCETPSLNSQSQREQWMLYG--  59

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             P+ RL  LM+++GN+FCADCGS DPKWVS SLGVFICIKCSG+HRSLGVHISKV+S+ LD
Sbjct  60    PQERLDNLMRQAGNKFCADCGSSDPKWVSSSLGVFICIKCSGIHRSLGVHISKVLSLNLD  119

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             +WT EQVD L  +GGN V N KYEA  P   KK KP SS EER+DFIRRKYELQQFV+S+
Sbjct  120   DWTDEQVDALVNLGGNTVINKKYEACLPSYIKKPKPTSSIEERSDFIRRKYELQQFVDSE  179

Query  844   LHLMCP-LPttssssts-------------EKKHSGGHRIHGLGFAFRNSWRKKESDTQK  981
              +L CP +P+ + SS+S             +K++      + +G +FRNSW +KES++ K
Sbjct  180   ENLTCPFIPSHARSSSSSHSSSSYNNPPQDKKRYDKQTTKNRIGLSFRNSWGRKESES-K  238

Query  982   ATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNP  1161
             +T+KSNS+AGMVEFIGLIKVNVV+GTNLAIRD+++SDPYVIL+LG+QSVKTRVIK+NLNP
Sbjct  239   STKKSNSLAGMVEFIGLIKVNVVKGTNLAIRDLMTSDPYVILSLGHQSVKTRVIKSNLNP  298

Query  1162  VWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQ  1341
             VWNE LMLSIPE++PPLKV V+DKD+F TDDFMGEAEIDIQPL+ AA+A E S+ N+ +Q
Sbjct  299   VWNESLMLSIPESIPPLKVIVYDKDSFKTDDFMGEAEIDIQPLVSAAKAYEKSSINESMQ  358

Query  1342  QQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELE  1521
                     A  +N +             DG I+L EG VRQEI L+LQNVERGVLE+ELE
Sbjct  359   LGKWV---ASGDNTL-----------VKDGIISLEEGKVRQEISLRLQNVERGVLEIELE  404

Query  1522  CVSLSQ  1539
             CV L+Q
Sbjct  405   CVPLTQ  410



>ref|XP_009354464.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
 ref|XP_009354465.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
 ref|XP_009354466.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
 ref|XP_009354467.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
 ref|XP_009354468.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=390

 Score =   424 bits (1090),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 243/417 (58%), Positives = 289/417 (69%), Gaps = 40/417 (10%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDT----SPSDSDQMEPQMQDYSLSPRC  492
             +MS QQDN+  N V        SG+ LYDLL  D      PSD   +          P+ 
Sbjct  2     EMSTQQDNSVPNKVSG------SGSCLYDLLCSDAPVWRCPSDRRTLS--------GPQE  47

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL+ L+ +S N+ CADCG+ DPKWVSL+ GVFICIKCSGVHRSLGVHISKVVSVKLDEWT
Sbjct  48    RLEILLHQSANRSCADCGALDPKWVSLTFGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  107

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++V+IL  MGGN   N KYEA  PEN  K KPDSS EER  FIRRKYEL  F+NSD  +
Sbjct  108   DDEVEILASMGGNTTVNKKYEAHLPENVSKPKPDSSIEERFYFIRRKYELLDFLNSDEQM  167

Query  853   MCPLP-------ttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATR-KSNSMA  1008
              CP P       +T SS+  +K++      H +G AFRNSW +K+S+ + A +  S  MA
Sbjct  168   SCPFPPNKKSSNSTVSSTQDKKQYEKQPTKHRIGQAFRNSWGRKDSEHKTAKKGYSMPMA  227

Query  1009  GMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLS  1188
             GMVEF+GLIKVNVVRGTNL +RDMV+SDPYVIL LG+QSVKTRVIKNNLNPVWNE LMLS
Sbjct  228   GMVEFVGLIKVNVVRGTNLVVRDMVTSDPYVILALGHQSVKTRVIKNNLNPVWNESLMLS  287

Query  1189  IPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKA  1368
             IP+++PPLKV V+DKDTF  DDFMGEAEIDIQPL+ AA A E S+ N+P+Q        A
Sbjct  288   IPDHIPPLKVLVYDKDTFKADDFMGEAEIDIQPLVSAAIAYEKSSINEPMQLGKWV---A  344

Query  1369  ETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
               EN +             DG INL +G VRQ+I L+LQNVERG+LE+ELECV L+Q
Sbjct  345   SKENTL-----------VKDGVINLVDGRVRQQITLRLQNVERGILEIELECVPLNQ  390



>gb|KHG26778.1| hypothetical protein F383_04656 [Gossypium arboreum]
Length=412

 Score =   421 bits (1081),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 235/403 (58%), Positives = 285/403 (71%), Gaps = 34/403 (8%)
 Frame = +1

Query  391   SGAR--LYDLLQMDT----SPSDSDQMEPQMQD---YSLSPRCRLKALMKESGNQFCADC  543
             +G+R  LYDLL  DT     PSD+D     ++     S  P+ RL+ +++++GN+ CADC
Sbjct  24    TGSRSCLYDLLCSDTPRWDRPSDADTTSWLLRKETWRSFGPQARLERMLEDTGNRVCADC  83

Query  544   GSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVAN  723
             GSPDPKWVSLS+GVFICIKCSGVHRSLG HISKV+SVKLDEWT +QVD L  +GGN V N
Sbjct  84    GSPDPKWVSLSIGVFICIKCSGVHRSLGSHISKVLSVKLDEWTEDQVDGLVNLGGNIVVN  143

Query  724   LKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDL-------HLMCP----LPt  870
              KYEA  P N KK +PDSS EER+DFI+RKYE+QQF+  +        H   P       
Sbjct  144   NKYEAFLPNNLKKPRPDSSIEERSDFIKRKYEMQQFLEGEQTSCRLQPHHRTPSSTLPLP  203

Query  871   tsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVV  1050
                   +EKKHS     H +G  FRNSW +K+SD  K ++KSNS+AGMVEF+GLIKVNVV
Sbjct  204   PGYPLLNEKKHSEKQSRHRIGNRFRNSWGRKDSDHLKISKKSNSLAGMVEFVGLIKVNVV  263

Query  1051  RGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfd  1230
             +GTNLA+RDM+SSDPYVIL LG+QSVKTRVIKNNLNPVWNE LMLSIPEN+PPL+V V+D
Sbjct  264   KGTNLAVRDMLSSDPYVILALGHQSVKTRVIKNNLNPVWNESLMLSIPENIPPLRVIVYD  323

Query  1231  kdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpp  1410
             KDTFTTDDFMG+AEIDIQPL+ AA+A E S   + +Q              +   +    
Sbjct  324   KDTFTTDDFMGDAEIDIQPLVAAAKAYEKSKIQESMQ--------------LGKCVANRD  369

Query  1411  pplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                  DG INLA+G V+QEI  +LQNVERG LE+ELECV L+Q
Sbjct  370   NNFLKDGIINLADGKVKQEISFRLQNVERGTLEIELECVPLTQ  412



>ref|XP_008375312.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
 ref|XP_008375313.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
Length=392

 Score =   418 bits (1074),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 239/419 (57%), Positives = 290/419 (69%), Gaps = 42/419 (10%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDT----SPSDSDQMEPQMQDYSLSPRC  492
             +MS QQDN+  N V        SG+ LYDLL  D      PSD   +          P+ 
Sbjct  2     EMSTQQDNSVPNKVSG------SGSCLYDLLCSDAPAWRCPSDQRSLS--------GPQE  47

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL+ L+++S N+ CADCG+ DPKWVSLS GVFICIKCSGVHRSLGVHISKVVSVKLDEW+
Sbjct  48    RLEILLRQSANRSCADCGALDPKWVSLSFGVFICIKCSGVHRSLGVHISKVVSVKLDEWS  107

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++VDIL  MGGN   N KYEA  PEN+ K KPDSS EER  FIRRKYEL  F+N +  L
Sbjct  108   DDEVDILASMGGNTTVNKKYEACLPENFCKPKPDSSIEERFYFIRRKYELLDFLNPNEPL  167

Query  853   MCPLP---------ttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATR-KSNS  1002
              CP P         +T SS+  +K++      + +G AFRNSW +K+S+ + A +  S  
Sbjct  168   SCPFPPNKKSPPSNSTISSTQDKKQYEKQPTKNRIGQAFRNSWGRKDSEHKTAKKGYSMP  227

Query  1003  MAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLM  1182
             MAGM+EF+GLIKVNVV+GTNL +RDM++SDPYVIL LG+QSVKTRVIKNNLNPVWNE LM
Sbjct  228   MAGMIEFVGLIKVNVVKGTNLVVRDMMTSDPYVILALGHQSVKTRVIKNNLNPVWNESLM  287

Query  1183  LSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPK  1362
             LSIP+++PPLKV V+DKDTF  DD+MGEAEIDIQPL+ AA A E ST N+P+Q       
Sbjct  288   LSIPDHIPPLKVLVYDKDTFKADDYMGEAEIDIQPLVSAAIAYEKSTINEPMQLGKWV--  345

Query  1363  KAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              A  EN +             DG INL +G VRQ+I L+LQNVERG+LE+ELECV L+Q
Sbjct  346   -ASKENTL-----------VKDGVINLVDGRVRQQISLRLQNVERGILEIELECVPLNQ  392



>ref|XP_009361970.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Pyrus x bretschneideri]
Length=392

 Score =   417 bits (1073),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 239/419 (57%), Positives = 290/419 (69%), Gaps = 42/419 (10%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDT----SPSDSDQMEPQMQDYSLSPRC  492
             +MS QQDN+  N V        SG+ LYDLL  D      PSD   +          P+ 
Sbjct  2     EMSTQQDNSVPNKVSG------SGSCLYDLLCSDAPAWRCPSDQRSLS--------GPQE  47

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL+ L+++S N+ CADCG+ DPKWVSLS GVFICIKCSGVHRSLGVHISKVVSVKLDEW+
Sbjct  48    RLEILLRQSANRSCADCGALDPKWVSLSFGVFICIKCSGVHRSLGVHISKVVSVKLDEWS  107

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++VDIL  MGGN   N KYEA  PEN+ K KPDSS EER  FIRRKYEL  F+N +  L
Sbjct  108   DDEVDILASMGGNTTVNKKYEACLPENFCKPKPDSSIEERFYFIRRKYELLDFLNPNEPL  167

Query  853   MCPLP---------ttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATR-KSNS  1002
              CP P         +T SS+  +K++      + +G AFRNSW +K+S+ + A +  S  
Sbjct  168   SCPFPPNKRSPPSNSTFSSTQDKKQYEKQPTKNRIGQAFRNSWGRKDSEHKTAKKGYSMP  227

Query  1003  MAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLM  1182
             MAGM+EF+GLIKVNVV+GTNL +RDM++SDPYVIL LG+QSVKTRVIKNNLNPVWNE LM
Sbjct  228   MAGMIEFVGLIKVNVVKGTNLVVRDMMTSDPYVILALGHQSVKTRVIKNNLNPVWNESLM  287

Query  1183  LSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPK  1362
             LSIP+++PPLKV V+DKDTF  DD+MGEAEIDIQPL+ AA A E ST N+P+Q       
Sbjct  288   LSIPDHIPPLKVLVYDKDTFKADDYMGEAEIDIQPLVSAAIAYEKSTINEPMQLGKWI--  345

Query  1363  KAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              A  EN +             DG INL +G VRQ+I L+LQNVERG+LE+ELECV L+Q
Sbjct  346   -ASKENTL-----------VKDGVINLVDGRVRQQISLRLQNVERGILEIELECVPLNQ  392



>ref|XP_003539244.2| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Glycine max]
Length=391

 Score =   417 bits (1073),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 238/414 (57%), Positives = 303/414 (73%), Gaps = 34/414 (8%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLS--PRCRL  498
             +MSVQ +N+  N V        SG+ LYDLL  +T PS + Q+   ++D  +S  P+ RL
Sbjct  3     EMSVQHENSDANGVSG------SGSCLYDLLCSET-PSLNSQV---LRDRWMSSGPQKRL  52

Query  499   KALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHE  678
               LM+++GN++CADCGS DPKWVS + GVFICIKCSGVHRSLGVHISKV+S+KLDEWT E
Sbjct  53    DNLMRQAGNKYCADCGSSDPKWVSSNNGVFICIKCSGVHRSLGVHISKVLSLKLDEWTDE  112

Query  679   QVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMC  858
             QVD L  +GGN V N+KYEA  P N KK KP+SS EER DFIRRKYE  QF+N + +L C
Sbjct  113   QVDALVNLGGNTVINMKYEACLPSNIKKPKPNSSIEERYDFIRRKYEFLQFLNIEENLSC  172

Query  859   PL------PttsssstsEKKHSGGHRIHG-LGFAFRNSWRKKESDTQKATRKSNSMAGMV  1017
             P        ++S+    +KKH         +G AFRNSW +K+S+  K+++KSNS+AGMV
Sbjct  173   PFVPSHARSSSSNKFPQDKKHYDKQATKSRIGSAFRNSWGRKDSE-HKSSKKSNSLAGMV  231

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIGLIKVNVV+GTNLAIRD++SSDPYVI++LG+QSVKTRVIK++LNP+WNE LMLSIP+
Sbjct  232   EFIGLIKVNVVKGTNLAIRDVMSSDPYVIISLGHQSVKTRVIKSSLNPIWNESLMLSIPD  291

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETE  1377
             ++PPLKV V+DKDTF+TDDFMGEAEIDIQPL+ AA+A E S+ N+ +Q        A  +
Sbjct  292   HIPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVSAAKAYEKSSINESMQLGKWV---ASGD  348

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             N +             D  I+L EG V+QEI ++LQ+VERGVLE+ELECV L+Q
Sbjct  349   NTL-----------VKDSIISLEEGKVKQEISVRLQHVERGVLEIELECVPLTQ  391



>ref|XP_009361971.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Pyrus x bretschneideri]
Length=390

 Score =   417 bits (1072),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 239/419 (57%), Positives = 290/419 (69%), Gaps = 44/419 (11%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDT----SPSDSDQMEPQMQDYSLSPRC  492
             +MS QQDN+  N         VSG+ LYDLL  D      PSD   +          P+ 
Sbjct  2     EMSTQQDNSVPN--------KVSGSCLYDLLCSDAPAWRCPSDQRSLS--------GPQE  45

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL+ L+++S N+ CADCG+ DPKWVSLS GVFICIKCSGVHRSLGVHISKVVSVKLDEW+
Sbjct  46    RLEILLRQSANRSCADCGALDPKWVSLSFGVFICIKCSGVHRSLGVHISKVVSVKLDEWS  105

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++VDIL  MGGN   N KYEA  PEN+ K KPDSS EER  FIRRKYEL  F+N +  L
Sbjct  106   DDEVDILASMGGNTTVNKKYEACLPENFCKPKPDSSIEERFYFIRRKYELLDFLNPNEPL  165

Query  853   MCPLP---------ttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATR-KSNS  1002
              CP P         +T SS+  +K++      + +G AFRNSW +K+S+ + A +  S  
Sbjct  166   SCPFPPNKRSPPSNSTFSSTQDKKQYEKQPTKNRIGQAFRNSWGRKDSEHKTAKKGYSMP  225

Query  1003  MAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLM  1182
             MAGM+EF+GLIKVNVV+GTNL +RDM++SDPYVIL LG+QSVKTRVIKNNLNPVWNE LM
Sbjct  226   MAGMIEFVGLIKVNVVKGTNLVVRDMMTSDPYVILALGHQSVKTRVIKNNLNPVWNESLM  285

Query  1183  LSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPK  1362
             LSIP+++PPLKV V+DKDTF  DD+MGEAEIDIQPL+ AA A E ST N+P+Q       
Sbjct  286   LSIPDHIPPLKVLVYDKDTFKADDYMGEAEIDIQPLVSAAIAYEKSTINEPMQLGKWI--  343

Query  1363  KAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              A  EN +             DG INL +G VRQ+I L+LQNVERG+LE+ELECV L+Q
Sbjct  344   -ASKENTL-----------VKDGVINLVDGRVRQQISLRLQNVERGILEIELECVPLNQ  390



>ref|XP_002299211.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE84016.2| zinc finger family protein [Populus trichocarpa]
Length=358

 Score =   416 bits (1068),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 225/365 (62%), Positives = 274/365 (75%), Gaps = 24/365 (7%)
 Frame = +1

Query  472   YSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVS  651
             Y   P  RL+ L+ +SGN+ CADCGSPDPKWVSLS GVFICIKCSGVHRSLGVH+SKV+S
Sbjct  9     YLSGPLKRLERLLSQSGNKTCADCGSPDPKWVSLSYGVFICIKCSGVHRSLGVHLSKVLS  68

Query  652   VKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQF  831
             +KLDEWT EQV+ L ++GGN  AN KYEA  P++Y+K +PD+STEER DFIRRKYEL++F
Sbjct  69    IKLDEWTDEQVNALIDLGGNTAANKKYEAFMPDDYRKPRPDASTEERYDFIRRKYELKEF  128

Query  832   VNSDLHLMCPLPttsss---------stsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKA  984
              N D  +  P P + SS         S  +K++      H +G AFRNSW +K+S+  K 
Sbjct  129   SNCDEQMSSPFPGSISSLPTPSNNCPSQDKKQYEKQATRHRIGNAFRNSWGRKDSE-HKH  187

Query  985   TRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPV  1164
             T+KS S+AGMVEFIGLIKVNVV+GTNLA+RD+++SDPYVI++LG QSV+TRVIKNNLNP+
Sbjct  188   TKKSTSLAGMVEFIGLIKVNVVKGTNLAVRDVMTSDPYVIISLGQQSVRTRVIKNNLNPI  247

Query  1165  WNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQ  1344
             WNE LMLSIPE +PPLKV V+DKDTFTTDDFMGEAEIDIQPL+ AA+A ENST  + +Q 
Sbjct  248   WNESLMLSIPEQIPPLKVLVYDKDTFTTDDFMGEAEIDIQPLVAAAKAYENSTITESMQL  307

Query  1345  QPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELEC  1524
                    A  EN +             DG I L +G V+QEI LKL+NVERGVLE+ELEC
Sbjct  308   GKWI---AGQENTL-----------VKDGIITLVDGKVKQEISLKLKNVERGVLEIELEC  353

Query  1525  VSLSQ  1539
             V L+Q
Sbjct  354   VPLTQ  358



>ref|XP_010460091.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Camelina sativa]
 ref|XP_010460166.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Camelina sativa]
Length=383

 Score =   415 bits (1067),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 239/407 (59%), Positives = 295/407 (72%), Gaps = 27/407 (7%)
 Frame = +1

Query  328   MSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKAL  507
             MSV Q+N +   V        S A LY+LL  +T P  + QM+  +Q  S  PR RL+ L
Sbjct  1     MSVGQENVEPVEVSG------SHACLYELLCSET-PRWTPQMD--LQISSSDPRDRLEKL  51

Query  508   MKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVD  687
             +K+ GN++CADCGSP+PKWVSLSLGVFICIKCSGVHRSLGVHISKV+SVKLD+WT +QVD
Sbjct  52    LKQPGNKYCADCGSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVLSVKLDDWTDDQVD  111

Query  688   ILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLP  867
             +L   GGN   N ++EA   +  KK KPDS+ EERNDFIR+KYE+ QF++     +CP  
Sbjct  112   MLVGYGGNTTVNQRFEACNIDQSKKPKPDSTNEERNDFIRKKYEMHQFMDPKDGALCPYQ  171

Query  868   ttsssstsEKKH-SGGHRI--HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIK  1038
               S  +TS     S  HR   + +G AFRNSW ++ESD  K  +KSNSMAGM+EF+GLIK
Sbjct  172   QPSRRNTSPPSSCSANHRSTKNRIGHAFRNSWGRRESD-HKGPKKSNSMAGMIEFVGLIK  230

Query  1039  VNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKV  1218
             VNVV+GTNLA+RD+++SDPYVIL LG QSVKTRVIKNNLNPVWNE LMLSIPE +PPLKV
Sbjct  231   VNVVKGTNLAVRDVMTSDPYVILALGQQSVKTRVIKNNLNPVWNETLMLSIPEPMPPLKV  290

Query  1219  HVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpppl  1398
              V+DKDTF+TDDFMGEAEIDIQPL+ AA+A E+S+  +P+Q        A  EN +    
Sbjct  291   LVYDKDTFSTDDFMGEAEIDIQPLVSAAKAYESSSIKEPMQLGSWV---ASKENTL----  343

Query  1399  plpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                      DG I+L EG VRQ+I L+LQNVERGVLE++LEC+ L+Q
Sbjct  344   -------VSDGIISLEEGKVRQDISLRLQNVERGVLEIQLECLPLTQ  383



>ref|XP_011000555.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X4 [Populus euphratica]
Length=370

 Score =   414 bits (1065),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 223/365 (61%), Positives = 275/365 (75%), Gaps = 24/365 (7%)
 Frame = +1

Query  472   YSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVS  651
             Y   P  RL+ L+ +SGN+ CADCGSPDP+WVSLS GVFICIKCSGVHRSLGVH+SKV+S
Sbjct  21    YLSGPLKRLERLLSQSGNKTCADCGSPDPRWVSLSYGVFICIKCSGVHRSLGVHLSKVLS  80

Query  652   VKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQF  831
             +KLDEWT EQV+ L ++GGN  AN KYEA+ P++Y+K +PD+STEER DFIRRKYEL++F
Sbjct  81    IKLDEWTDEQVNALIDLGGNTAANKKYEASMPDDYRKPRPDASTEERYDFIRRKYELKEF  140

Query  832   VNSDLHLMCPLPttsss---------stsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKA  984
              N D  +  P P + SS         S  +K++      H +G AFRNSW +K+S+  K 
Sbjct  141   SNCDDKMSSPFPGSISSLPTPSNSCPSQDKKQYEKQATRHRIGNAFRNSWGRKDSE-HKH  199

Query  985   TRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPV  1164
             T+KS S+AGMVEFIGLIKVNVV+GTNLA+RD+++SDPYVI++LG QSV+TRVIKNNLNP+
Sbjct  200   TKKSYSLAGMVEFIGLIKVNVVKGTNLAVRDVMTSDPYVIISLGQQSVRTRVIKNNLNPI  259

Query  1165  WNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQ  1344
             WNE LMLSIPE +PPLKV V+DKDTF+TDDFMGEAEIDIQPL+ AA+A ENST  + +Q 
Sbjct  260   WNESLMLSIPEQIPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVAAAKAYENSTITESMQL  319

Query  1345  QPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELEC  1524
                    A  EN +             DG I L +G V+QEI LKL+NVERGVLE+ELEC
Sbjct  320   GKWI---AGQENTL-----------VKDGIITLVDGKVKQEISLKLKNVERGVLEIELEC  365

Query  1525  VSLSQ  1539
             V L+Q
Sbjct  366   VPLTQ  370



>ref|XP_010486369.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Camelina sativa]
Length=383

 Score =   414 bits (1065),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 237/395 (60%), Positives = 291/395 (74%), Gaps = 23/395 (6%)
 Frame = +1

Query  370   NTEGNNVSG--ARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADC  543
             N E   VSG  A LY+LL  +T P  + QM+  +Q  S  PR RL+ L+K+ GN++CADC
Sbjct  7     NVEPVEVSGSHACLYELLCSET-PRWTPQMD--LQTSSSDPRDRLEKLLKQPGNKYCADC  63

Query  544   GSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVAN  723
             GSP+PKWVSLSLGVFICIKCSGVHRSLGVHISKV+SVKLD+WT +QVD+L   GGN   N
Sbjct  64    GSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVLSVKLDDWTDDQVDMLVGYGGNTTVN  123

Query  724   LKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsEKK-  900
              ++EA   +  KK KPDS+ EERNDFIR+KYE+ QF++     +CP    S  +TS    
Sbjct  124   QRFEACNIDQSKKPKPDSTNEERNDFIRKKYEMHQFMDPKDGALCPYQQPSRIATSPPSL  183

Query  901   HSGGHRI--HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIR  1074
              S  HR   + +G AFRNSW ++ESD  K  +KSNSMAGM+EF+GLIKVNVV+GTNLA+R
Sbjct  184   CSANHRSTKNRIGHAFRNSWGRRESD-HKGPKKSNSMAGMIEFVGLIKVNVVKGTNLAVR  242

Query  1075  DMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttdd  1254
             D+++SDPYVIL LG QSVKTRVIKNNLNPVWNE LMLSIPE +PPLKV V+DKDTF+TDD
Sbjct  243   DVMTSDPYVILALGQQSVKTRVIKNNLNPVWNETLMLSIPEPMPPLKVLVYDKDTFSTDD  302

Query  1255  fMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGT  1434
             FMGEAEIDIQPL+ AA+A E+S+  +P+Q        A  EN +             DG 
Sbjct  303   FMGEAEIDIQPLVSAAKAYESSSIEEPMQLGSWV---ASKENTL-----------VSDGI  348

Query  1435  INLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             I+L EG VRQ+I L+LQNVERGVLE++LEC+ L+Q
Sbjct  349   ISLEEGKVRQDISLRLQNVERGVLEIQLECLPLTQ  383



>ref|XP_003598626.1| ADP-ribosylation factor GTPase-activating protein [Medicago truncatula]
 gb|AES68877.1| calcium-dependent ARF-type GTPase activating family protein [Medicago 
truncatula]
 gb|AFK45534.1| unknown [Medicago truncatula]
Length=400

 Score =   414 bits (1065),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 234/417 (56%), Positives = 302/417 (72%), Gaps = 35/417 (8%)
 Frame = +1

Query  334   VQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLS-PRCRLKALM  510
             + Q+ ++ N +    G+      LYDL   +T PS + Q   Q + + LS P+ RL  LM
Sbjct  4     IHQEKSEINGISGIPGS--GSCCLYDLFCTET-PSLNSQ--SQRERWMLSGPQERLDNLM  58

Query  511   KESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDI  690
             +++GN+FCADCGS +PKWVS SLGVFICIKCSG+HRSLGVHISKV+S+ LD+WT EQVD 
Sbjct  59    RQAGNKFCADCGSSEPKWVSSSLGVFICIKCSGIHRSLGVHISKVLSLNLDDWTDEQVDS  118

Query  691   LTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCP-LP  867
             L  +GGN + N KYEA  P   KK KP+SS EER+DFIRRKYELQQF++S+ +L+CP +P
Sbjct  119   LVNLGGNTLINKKYEACVPSYVKKPKPNSSIEERSDFIRRKYELQQFLDSEENLICPFIP  178

Query  868   ttssss-------------tsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMA  1008
             + S ++               +K++      + +G +FRNSW +K+S++ K+T+KSNS+A
Sbjct  179   SHSRTTSSSHSSSSSYNPPQEKKRYDKQTTRNRIGLSFRNSWGRKDSES-KSTKKSNSLA  237

Query  1009  GMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLS  1188
             GMVEF+GLIKVNVV+GTNLAIRD+V+SDPYVIL+LG+QSVKTRVIKNNLNPVWNE LMLS
Sbjct  238   GMVEFVGLIKVNVVKGTNLAIRDIVTSDPYVILSLGHQSVKTRVIKNNLNPVWNESLMLS  297

Query  1189  IPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKA  1368
             IPEN+PPLK+ V+DKD+F  DDFMGEAEIDIQPL+ AA+A E S+  + +Q        A
Sbjct  298   IPENIPPLKIIVYDKDSFKNDDFMGEAEIDIQPLVSAAKAYEKSSIMESMQLGKWV---A  354

Query  1369  ETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
               +N +             DG I+L EG VRQEI L+LQNVERGVLE++LECV L+Q
Sbjct  355   SGDNTL-----------VKDGIISLEEGKVRQEISLRLQNVERGVLEIQLECVPLTQ  400



>ref|XP_008811224.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Phoenix dactylifera]
Length=358

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 226/369 (61%), Positives = 277/369 (75%), Gaps = 26/369 (7%)
 Frame = +1

Query  454   EPQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVH  633
             +P  Q   LSP  RL+ L+ +  N+FCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVH
Sbjct  9     DPSNQPGPLSPWKRLENLLSQPANRFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVH  68

Query  634   ISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRK  813
             ISKV+SVKLDEWT EQVD L+  GGN V N++YEA  PEN+KK +PDSS EER+DFI+RK
Sbjct  69    ISKVLSVKLDEWTDEQVDSLSAGGGNAVVNMRYEAFLPENFKKPRPDSSIEERSDFIKRK  128

Query  814   YELQQFVNSDLHLMCPLPttsssstsE-------KKHSGGHRIHGLGFAFRNSWRKKESD  972
             YELQQF NS+  ++   P + S++          +K   G R HGLG AFRNSWR+KES+
Sbjct  129   YELQQFANSNGLIISTTPGSLSTTLQNNVSIKSFEKQPTGLR-HGLGHAFRNSWRRKESE  187

Query  973   TQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNN  1152
              QKA +K+    GMVEF+GLIKVN++RGTNLA+RD+++SDPYVIL LG+QS+KT+VIK+N
Sbjct  188   -QKAIKKT---MGMVEFVGLIKVNIIRGTNLAVRDVMTSDPYVILNLGHQSMKTQVIKSN  243

Query  1153  LNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKND  1332
             LNP+WNE+LMLSIP+ +PPLK+ V+DKDTF+TDD MGEAEIDIQPL+ AA+A ENST ++
Sbjct  244   LNPIWNERLMLSIPDPIPPLKLQVYDKDTFSTDDRMGEAEIDIQPLVSAAKAYENSTISE  303

Query  1333  PVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEV  1512
              +Q              +   L      L  D  I+L  G V+QEI LKLQNVERG LE+
Sbjct  304   SMQ--------------LGKCLVSDDDTLVKDSIISLDNGKVKQEITLKLQNVERGELEI  349

Query  1513  ELECVSLSQ  1539
             ELECV LSQ
Sbjct  350   ELECVPLSQ  358



>ref|XP_009124033.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Brassica rapa]
 ref|XP_009124041.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Brassica rapa]
 emb|CDY22145.1| BnaC01g39560D [Brassica napus]
Length=383

 Score =   413 bits (1062),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 230/386 (60%), Positives = 286/386 (74%), Gaps = 21/386 (5%)
 Frame = +1

Query  391   SGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVS  570
             S A LYDLL ++TS   ++ +E   Q  S  PR RL+ L+K+  N++CADCGSP+PKWVS
Sbjct  16    SHACLYDLLCLETS---NETLENDFQTSSSDPRDRLEKLLKQPANKYCADCGSPEPKWVS  72

Query  571   LSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPE  750
             LSLGVFICIKCSGVHRSLGVHI+KV+SVKLD+WT +QVD+L E GGN V N ++EA   +
Sbjct  73    LSLGVFICIKCSGVHRSLGVHITKVLSVKLDDWTDDQVDMLAEYGGNTVVNQRFEACNID  132

Query  751   NYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsEKK-HSGGHRI--  921
             + KK KPDS+ +ERNDFIR+KYEL QF++     +CP    S  + S     S  HR   
Sbjct  133   HLKKPKPDSNNDERNDFIRKKYELHQFMDPKDCALCPYQQPSKINDSTPSLCSANHRSTK  192

Query  922   HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYV  1101
             + +G AFRNSW ++ESD  K  +KSNS+AGM+EF+GLIKVNVV+GTNLA+RD+++SDPYV
Sbjct  193   NRIGNAFRNSWGRRESD-HKGHKKSNSLAGMIEFVGLIKVNVVKGTNLAVRDVMTSDPYV  251

Query  1102  ILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDI  1281
             ILTLG QSVKTRVIKNNLNPVWNE LMLSIPE +PPLKV V+DKDTF+TDDFMGEAEIDI
Sbjct  252   ILTLGQQSVKTRVIKNNLNPVWNETLMLSIPEQMPPLKVLVYDKDTFSTDDFMGEAEIDI  311

Query  1282  QPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVR  1461
             QPL+ AA+A E S+  +P+Q        A  EN +             DG I+  EG V+
Sbjct  312   QPLVSAAKAYETSSIKEPMQLGSWV---ASKENTL-----------VSDGIISQEEGKVK  357

Query  1462  QEIVLKLQNVERGVLEVELECVSLSQ  1539
             Q+I L+LQ VERGVLE++LECV L+Q
Sbjct  358   QDISLRLQKVERGVLEIQLECVPLTQ  383



>ref|XP_011000554.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X3 [Populus euphratica]
Length=425

 Score =   414 bits (1063),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 223/364 (61%), Positives = 275/364 (76%), Gaps = 24/364 (7%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S  P  RL+ L+ +SGN+ CADCGSPDP+WVSLS GVFICIKCSGVHRSLGVH+SKV+S+
Sbjct  77    SPGPLKRLERLLSQSGNKTCADCGSPDPRWVSLSYGVFICIKCSGVHRSLGVHLSKVLSI  136

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
             KLDEWT EQV+ L ++GGN  AN KYEA+ P++Y+K +PD+STEER DFIRRKYEL++F 
Sbjct  137   KLDEWTDEQVNALIDLGGNTAANKKYEASMPDDYRKPRPDASTEERYDFIRRKYELKEFS  196

Query  835   NSDLHLMCPLPttsss---------stsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKAT  987
             N D  +  P P + SS         S  +K++      H +G AFRNSW +K+S+  K T
Sbjct  197   NCDDKMSSPFPGSISSLPTPSNSCPSQDKKQYEKQATRHRIGNAFRNSWGRKDSE-HKHT  255

Query  988   RKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVW  1167
             +KS S+AGMVEFIGLIKVNVV+GTNLA+RD+++SDPYVI++LG QSV+TRVIKNNLNP+W
Sbjct  256   KKSYSLAGMVEFIGLIKVNVVKGTNLAVRDVMTSDPYVIISLGQQSVRTRVIKNNLNPIW  315

Query  1168  NEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQ  1347
             NE LMLSIPE +PPLKV V+DKDTF+TDDFMGEAEIDIQPL+ AA+A ENST  + +Q  
Sbjct  316   NESLMLSIPEQIPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVAAAKAYENSTITESMQLG  375

Query  1348  PRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECV  1527
                   A  EN +             DG I L +G V+QEI LKL+NVERGVLE+ELECV
Sbjct  376   KWI---AGQENTL-----------VKDGIITLVDGKVKQEISLKLKNVERGVLEIELECV  421

Query  1528  SLSQ  1539
              L+Q
Sbjct  422   PLTQ  425



>gb|KDP40520.1| hypothetical protein JCGZ_24519 [Jatropha curcas]
Length=383

 Score =   412 bits (1058),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 224/363 (62%), Positives = 274/363 (75%), Gaps = 26/363 (7%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             P+ +L+ L+ ++ N+ CADCGSPDPKWVS +LGVFICIKCSGVHRSLGVHISKV+S+KLD
Sbjct  36    PQKKLEKLLNQNANKICADCGSPDPKWVSFNLGVFICIKCSGVHRSLGVHISKVLSIKLD  95

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             EWT +QV    E+GGNNVA  KYEA  P++Y+K KPD++ EER DFIR+KYE QQFV S 
Sbjct  96    EWTDDQVASFIELGGNNVAIKKYEACLPDDYRKPKPDATIEERTDFIRKKYEKQQFVYSP  155

Query  844   LHLMCPLPttssssts-------EKKHSGGHRI-HGLGFAFRNSWRKKESDTQKATRKSN  999
               ++CP     ++S+S       EKKH       H +G AFRNSW +K+++  K  +KSN
Sbjct  156   EQMICPYRPHRTASSSQALPPSQEKKHFDKQATRHRIGHAFRNSWGRKDAEY-KNPKKSN  214

Query  1000  SM---AGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWN  1170
             SM   AGMVEF+GLIKVNVV+GTNLA+RD+V+SDPYVIL LG+QSV+TRVIKNNLNPVWN
Sbjct  215   SMVMTAGMVEFVGLIKVNVVKGTNLAVRDVVTSDPYVILALGHQSVRTRVIKNNLNPVWN  274

Query  1171  EQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQP  1350
             E LMLSIPE++PPLKV V+DKDTF+TDDFMGEAEIDIQPL+ AA+A E S+ N+P+Q   
Sbjct  275   ESLMLSIPEHIPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVSAAKAYETSSINEPMQLGK  334

Query  1351  RTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVS  1530
                 K  T              L  DG INL +G V+QEI L+LQNVERGVLE+ELECV 
Sbjct  335   WVASKDNT--------------LVTDGIINLVDGMVKQEITLRLQNVERGVLEIELECVP  380

Query  1531  LSQ  1539
             L+Q
Sbjct  381   LTQ  383



>ref|XP_011000552.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Populus euphratica]
Length=437

 Score =   414 bits (1064),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 223/364 (61%), Positives = 275/364 (76%), Gaps = 24/364 (7%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S  P  RL+ L+ +SGN+ CADCGSPDP+WVSLS GVFICIKCSGVHRSLGVH+SKV+S+
Sbjct  89    SPGPLKRLERLLSQSGNKTCADCGSPDPRWVSLSYGVFICIKCSGVHRSLGVHLSKVLSI  148

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
             KLDEWT EQV+ L ++GGN  AN KYEA+ P++Y+K +PD+STEER DFIRRKYEL++F 
Sbjct  149   KLDEWTDEQVNALIDLGGNTAANKKYEASMPDDYRKPRPDASTEERYDFIRRKYELKEFS  208

Query  835   NSDLHLMCPLPttsss---------stsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKAT  987
             N D  +  P P + SS         S  +K++      H +G AFRNSW +K+S+  K T
Sbjct  209   NCDDKMSSPFPGSISSLPTPSNSCPSQDKKQYEKQATRHRIGNAFRNSWGRKDSE-HKHT  267

Query  988   RKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVW  1167
             +KS S+AGMVEFIGLIKVNVV+GTNLA+RD+++SDPYVI++LG QSV+TRVIKNNLNP+W
Sbjct  268   KKSYSLAGMVEFIGLIKVNVVKGTNLAVRDVMTSDPYVIISLGQQSVRTRVIKNNLNPIW  327

Query  1168  NEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQ  1347
             NE LMLSIPE +PPLKV V+DKDTF+TDDFMGEAEIDIQPL+ AA+A ENST  + +Q  
Sbjct  328   NESLMLSIPEQIPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVAAAKAYENSTITESMQLG  387

Query  1348  PRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECV  1527
                   A  EN +             DG I L +G V+QEI LKL+NVERGVLE+ELECV
Sbjct  388   KWI---AGQENTL-----------VKDGIITLVDGKVKQEISLKLKNVERGVLEIELECV  433

Query  1528  SLSQ  1539
              L+Q
Sbjct  434   PLTQ  437



>ref|XP_010032309.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Eucalyptus grandis]
 gb|KCW51723.1| hypothetical protein EUGRSUZ_J01190 [Eucalyptus grandis]
 gb|KCW51724.1| hypothetical protein EUGRSUZ_J01190 [Eucalyptus grandis]
Length=398

 Score =   412 bits (1059),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 237/424 (56%), Positives = 289/424 (68%), Gaps = 50/424 (12%)
 Frame = +1

Query  328   MSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMD------TSPSDSDQMEPQMQDYSLSPR  489
             MS+QQDN+    V  T      G+ L+DLL+ +      TS   +   E Q         
Sbjct  5     MSIQQDNSGSGDVSGT------GSCLFDLLRAENPGWGNTSDKKTSYSEAQQ--------  50

Query  490   CRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEW  669
              RL+ LM + GN+FCADCGSPDPKWVSL+LG FICIKCSGVHR LGVHISKV+SVKLDEW
Sbjct  51    -RLEKLMSQPGNEFCADCGSPDPKWVSLTLGAFICIKCSGVHRGLGVHISKVLSVKLDEW  109

Query  670   THEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLH  849
             T EQV+ L   GGN   NLKYEA  P N +K K DSS EER+DFIRRKYEL QF+NS   
Sbjct  110   TDEQVEALVVRGGNTAVNLKYEACVPGNLRKPKADSSIEERSDFIRRKYELLQFLNSPEQ  169

Query  850   LMCPLPtt--------------sssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKAT  987
             + CP P++              SS++  +++       H +G AFRNSW ++E+D  KA 
Sbjct  170   MSCPFPSSNNRYPSSSQSSSSSSSANQEKRQFEKQPTKHRIGQAFRNSWGRREND-HKAY  228

Query  988   RKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVW  1167
             +K  S AGMVEF+GLIKVNVVRGTNL IRD+++SDPYVIL LG+QSVKTRVIKNNLNPVW
Sbjct  229   KKKCSSAGMVEFVGLIKVNVVRGTNLVIRDVMTSDPYVILALGHQSVKTRVIKNNLNPVW  288

Query  1168  NEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQ  1347
             NE+LMLSIPE+VPPLKV V+DKDTF  DDFMGEAEIDIQPLL AA+A E+ST ++ +Q  
Sbjct  289   NEKLMLSIPESVPPLKVLVYDKDTFKQDDFMGEAEIDIQPLLSAAKAYESSTIDESMQLG  348

Query  1348  PRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECV  1527
                  +  T              L  DG I+L +G V+Q+I L+L+NVERG L++ELECV
Sbjct  349   KWVASRDNT--------------LVKDGVISLMDGKVKQDITLRLKNVERGELDIELECV  394

Query  1528  SLSQ  1539
              L+Q
Sbjct  395   PLTQ  398



>ref|XP_010938593.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Elaeis guineensis]
Length=358

 Score =   410 bits (1054),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 222/360 (62%), Positives = 273/360 (76%), Gaps = 28/360 (8%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             P  RL+ L+    N+FCADCGSPDPKWVS SLGVFICIKCSGVHRSLGVHISKV+SVKLD
Sbjct  19    PLGRLEKLLSLPANRFCADCGSPDPKWVSFSLGVFICIKCSGVHRSLGVHISKVLSVKLD  78

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             EWT EQVD LT+ GGN   N +YEA  PEN+KK +PDSS EER DFI+RKYELQQF NS+
Sbjct  79    EWTDEQVDSLTDAGGNAAVNRRYEAFLPENFKKPRPDSSIEERFDFIKRKYELQQFSNSN  138

Query  844   LHLMCPLPttssss--------tsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSN  999
               ++   P + S++        + EK+H+G    HGLG AFRNSWR+KES+ QKA +K+ 
Sbjct  139   GLIVSTTPGSLSTTLQSNVSSKSFEKQHTGLR--HGLGHAFRNSWRRKESE-QKAIKKT-  194

Query  1000  SMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQL  1179
                GMVEF+GLIKVN++RGTNLA+RDM++SDPYVIL LG+Q++KTRVIK++LNP+WNE+L
Sbjct  195   --MGMVEFVGLIKVNIIRGTNLAVRDMMTSDPYVILNLGHQTMKTRVIKSSLNPIWNERL  252

Query  1180  MLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTP  1359
             MLSIP+ +PPLK+ V+DKDTF+TDD MGEAEIDIQPL+ AA+A ENST ++P+Q      
Sbjct  253   MLSIPDPIPPLKLQVYDKDTFSTDDRMGEAEIDIQPLVSAAKAYENSTISEPMQLGKWL-  311

Query  1360  KKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
               A  +N +             D  I+L  G V+QEI L+LQNVERG LE+ELECV LSQ
Sbjct  312   --ASDDNTL-----------VKDSIISLDNGKVKQEIALRLQNVERGELEIELECVPLSQ  358



>ref|XP_004307119.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Fragaria vesca subsp. vesca]
Length=394

 Score =   412 bits (1058),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 240/419 (57%), Positives = 286/419 (68%), Gaps = 40/419 (10%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLS-PRCRLK  501
             +M+ QQ+N+  N V         G+ LYDLL      SD+     Q    +LS P+ RL+
Sbjct  2     EMATQQENSGHNNVSE------QGSCLYDLL-----CSDAPNWRTQSDRRTLSGPQERLE  50

Query  502   ALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQ  681
              L+ +S N+ CADCGSPDPKWVSL+ GVFICIKCSGVHRSLGVHISKVVSVKLDEWT+E+
Sbjct  51    ILLHQSANKSCADCGSPDPKWVSLNFGVFICIKCSGVHRSLGVHISKVVSVKLDEWTNEE  110

Query  682   VDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCP  861
             VD L  MGGN   N K+EA  P + +K KPDSS EER  FIRRKYELQ F+N+   + CP
Sbjct  111   VDGLASMGGNVTINKKFEACMPVHVQKPKPDSSIEERFYFIRRKYELQDFLNTSDEMSCP  170

Query  862   LPttsss----------stsEKKHSGGHRI-HGLGFAFRNSWRKKESDTQKATRKSN--S  1002
              P                + +KK        H +G AFRNSW +K+SD  +A +K N  S
Sbjct  171   FPPAHKRHSSTNSSSSSYSQDKKQCDKQPTRHRIGHAFRNSWGRKDSD-HRAAKKGNSMS  229

Query  1003  MAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLM  1182
             MAGMVEF+GLIKVNVVRGTNL +RD+V+SDPYVIL LG+QSVKTRVIKNNLNPVWNE LM
Sbjct  230   MAGMVEFVGLIKVNVVRGTNLVVRDVVTSDPYVILALGHQSVKTRVIKNNLNPVWNESLM  289

Query  1183  LSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPK  1362
             LSIPE +PPLKV V+DKDTFTTDD+MGEAEIDIQPL+ AA A E S+ N+  Q       
Sbjct  290   LSIPEQIPPLKVLVYDKDTFTTDDYMGEAEIDIQPLVTAAVAFEKSSINETTQLGKWIAS  349

Query  1363  KAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             K  T              L  DG I+L +G VRQ+I L+LQNVERG+LE+ELECV L+Q
Sbjct  350   KDNT--------------LVKDGVISLIDGKVRQQIALRLQNVERGMLEIELECVPLTQ  394



>ref|XP_010464440.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Camelina sativa]
Length=384

 Score =   411 bits (1056),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 238/407 (58%), Positives = 294/407 (72%), Gaps = 26/407 (6%)
 Frame = +1

Query  328   MSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKAL  507
             MS+ Q+N +   V    G   S A LY+LL  +T P  +  M+  +Q     PR RL+ L
Sbjct  1     MSLGQENVE--PVVEVSG---SHACLYELLCSET-PRWTPHMD--LQTSPSDPRDRLEKL  52

Query  508   MKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVD  687
             +K+ GN++CADCGSP+PKWVSLSLGVFICIKCSGVHRSLGVHISKV+SVKLD+WT +QVD
Sbjct  53    LKQPGNKYCADCGSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVLSVKLDDWTDDQVD  112

Query  688   ILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLP  867
             +L   GGN   N +YEA   +  KK KPDS+ EERNDFIR+KYE+ QF++     +CP  
Sbjct  113   MLVGYGGNTTVNERYEACNIDQSKKPKPDSTNEERNDFIRKKYEMHQFMDPKDGALCPYQ  172

Query  868   ttsssstsEKK-HSGGHRI--HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIK  1038
               S  +TS     S  HR   + +G AFRNSW ++ESD  K  +KSNSMAGM+EF+GLIK
Sbjct  173   QPSRIATSPPSLCSANHRSTKNRIGHAFRNSWGRRESD-HKGPKKSNSMAGMIEFVGLIK  231

Query  1039  VNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKV  1218
             VNVV+GTNLA+RD+++SDPYVIL LG QSVKTRVIKNNLNPVWNE LMLSIPE +PPLKV
Sbjct  232   VNVVKGTNLAVRDVMTSDPYVILALGQQSVKTRVIKNNLNPVWNETLMLSIPEPMPPLKV  291

Query  1219  HVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpppl  1398
              V+DKDTF+TDDFMGEAEIDIQPL+ AA+A E+S+  +P+Q        A  EN +    
Sbjct  292   LVYDKDTFSTDDFMGEAEIDIQPLVSAAKAYESSSIKEPMQLGSWV---ASKENTL----  344

Query  1399  plpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                      DG I+L EG VRQ+I L+LQNVERGVLE++LEC+ L+Q
Sbjct  345   -------VSDGIISLEEGKVRQDISLRLQNVERGVLEIQLECLPLTQ  384



>ref|XP_006407779.1| hypothetical protein EUTSA_v10020854mg [Eutrema salsugineum]
 gb|ESQ49232.1| hypothetical protein EUTSA_v10020854mg [Eutrema salsugineum]
Length=404

 Score =   411 bits (1057),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 235/409 (57%), Positives = 291/409 (71%), Gaps = 28/409 (7%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKA  504
             +MS+ Q+N     V        S A LYDLL+ +T P  + Q +  +Q  S  PR RL+ 
Sbjct  20    EMSLGQENVDPVEVSG------SHACLYDLLRSET-PKGTPQKD--LQTSSSDPRDRLEK  70

Query  505   LMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQV  684
             L+K+ GN++CADCGSP+PKWVSLSLGVFICIKCSGVHRSLGVHISKV+SVKLDEWT +QV
Sbjct  71    LLKQPGNKYCADCGSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVLSVKLDEWTDDQV  130

Query  685   DILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPL  864
             D L   GGN   N ++EA   +  KK KPDS+ EERNDFIR+KYE  QF++     +CP 
Sbjct  131   DTLVGYGGNTAVNQRFEACNIDQSKKPKPDSTNEERNDFIRKKYEQHQFMDPKDGALCPY  190

Query  865   PttsssstsEKKH--SGGHRI--HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
                +S   +      S  HR   + +G AFRNSW ++ESD  K  +KSNS+AGMVEF+GL
Sbjct  191   QQQASRVNNSPPSLCSASHRSTKNRIGHAFRNSWGRRESD-HKGPKKSNSLAGMVEFVGL  249

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             IKVNVV+GTNLA+RD+++SDPYVIL+LG QSVKTRVIKNNLNPVWNE LMLSIPE +PPL
Sbjct  250   IKVNVVKGTNLAVRDVMTSDPYVILSLGQQSVKTRVIKNNLNPVWNETLMLSIPEQMPPL  309

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             KV V+DKDTF+TDDFMGEAEIDIQPL+ AA+A E S+  +P+Q        A  EN +  
Sbjct  310   KVLVYDKDTFSTDDFMGEAEIDIQPLVGAAKAYETSSIQEPMQLGSWV---ASKENTL--  364

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                        DG I+L EG V+Q+I L+LQ VERGVLE++LEC+ L+Q
Sbjct  365   ---------VSDGIISLEEGKVKQDISLRLQKVERGVLEIQLECLPLTQ  404



>gb|KHG04159.1| hypothetical protein F383_28664 [Gossypium arboreum]
Length=425

 Score =   412 bits (1058),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 240/445 (54%), Positives = 293/445 (66%), Gaps = 61/445 (14%)
 Frame = +1

Query  328   MSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMD----TSPSDSDQMEPQMQDY--SLSPR  489
             MS Q  N+      +T+  + SG+RLYDLL  +      PSD+D      ++   S   +
Sbjct  1     MSTQHGNS------DTKPPSGSGSRLYDLLCAEQPYWNRPSDADSTPWNFRELWKSSGAK  54

Query  490   CRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISK---------  642
              RL+ L+KESGN  CADCG+PDPKWVSL+LGVFICIKCSGVHRSLGVHISK         
Sbjct  55    ERLEKLLKESGNGVCADCGTPDPKWVSLTLGVFICIKCSGVHRSLGVHISKCFDYLSYSD  114

Query  643   ----------------VVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPD  774
                             V+SVKLDEWT EQVD+L  +GGNNVAN KYEA  PEN KK+ PD
Sbjct  115   SSFLLEVSMFNPCPDMVLSVKLDEWTDEQVDVLVNLGGNNVANNKYEALIPENLKKLTPD  174

Query  775   SSTEERNDFIRRKYELQQFVNSDLH----------LMCPLPttsssstsEKKHSGGHRIH  924
             SS EER DFIRRKYE+ QF + + H                 ++  S  ++++      H
Sbjct  175   SSNEERADFIRRKYEMLQFFDGNKHDPHSHQRTSSSSSQGSLSNLFSQDKRQYEKQPTRH  234

Query  925   GLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVI  1104
              +G  FRNSW +++SD  K+ RKSNS+AGMVEFIG+IKVNVV+GTNLA+RDMV+SDPYVI
Sbjct  235   RIGQKFRNSWGRRDSDNHKSVRKSNSLAGMVEFIGMIKVNVVKGTNLAVRDMVTSDPYVI  294

Query  1105  LTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQ  1284
             LTLG QSVKTRVIKNNLNPVWNE LMLSIP+++PPLKV V+DKDTF+ DDFMGEAEIDIQ
Sbjct  295   LTLGQQSVKTRVIKNNLNPVWNESLMLSIPDSIPPLKVIVYDKDTFSHDDFMGEAEIDIQ  354

Query  1285  PLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQ  1464
             PL+ AA+A E S   + +Q       K  T              L  DG I + +G V+Q
Sbjct  355   PLVAAAKAHERSEIQESMQLGKWVASKDNT--------------LEKDGIITVTDGKVQQ  400

Query  1465  EIVLKLQNVERGVLEVELECVSLSQ  1539
             +I L+LQ VERGVLE+ELECV L+Q
Sbjct  401   DISLRLQKVERGVLEIELECVPLTQ  425



>ref|XP_008813423.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Phoenix dactylifera]
Length=400

 Score =   411 bits (1056),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 222/360 (62%), Positives = 275/360 (76%), Gaps = 28/360 (8%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             P  RL+ L+ +  N+FCADCGSPDPKWVSLSLGVFICIKCSGVHRSLG HISKV+SVKLD
Sbjct  61    PLGRLENLLSQPANRFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGAHISKVLSVKLD  120

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             EWT EQVD L++ GGN   N++YEA  PEN+KK +PDSS EER+DFI+RKYELQQF NS+
Sbjct  121   EWTDEQVDSLSDGGGNAAVNMRYEAFLPENFKKPRPDSSIEERSDFIKRKYELQQFSNSN  180

Query  844   LHLMCPLP--------ttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSN  999
               ++   P         T SS + EK+H+G    HGLG AFRNSWR+KES+ QKA +K+ 
Sbjct  181   GLIISTTPGSLSKTLQKTVSSKSFEKQHTGLR--HGLGHAFRNSWRRKESE-QKAIKKT-  236

Query  1000  SMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQL  1179
                GMVEF+GLIKVN++RGTNLA+RD+++SDPYVIL +G+Q++KTRVIK+NLNPVWNE+L
Sbjct  237   --MGMVEFLGLIKVNIIRGTNLAVRDVMTSDPYVILNMGHQTMKTRVIKSNLNPVWNERL  294

Query  1180  MLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTP  1359
             MLSIP+ +PPLK+ V+DKDTF+TDD MGEAEIDIQPL+ AA+A E+ST ++P+Q      
Sbjct  295   MLSIPDPIPPLKLQVYDKDTFSTDDRMGEAEIDIQPLVSAAKAYESSTISEPMQLGKWL-  353

Query  1360  KKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
               A  +N +             D  I+L  G V+QEI L+LQNVERG LE+ELECV LSQ
Sbjct  354   --ASDDNTL-----------VKDSIISLDNGKVKQEITLRLQNVERGELEIELECVPLSQ  400



>ref|XP_011000553.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Populus euphratica]
Length=437

 Score =   412 bits (1058),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 222/364 (61%), Positives = 274/364 (75%), Gaps = 24/364 (7%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S  P  RL+ L+ +SGN+ CADCGSPDP+WVSLS GVFICIKCSGVHRSLGVH+SKV+S+
Sbjct  89    SPGPLKRLERLLSQSGNKTCADCGSPDPRWVSLSYGVFICIKCSGVHRSLGVHLSKVLSI  148

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
             KLDEWT EQV+ L ++GGN  AN KYEA+ P++Y+K +PD+STEER DFIRRKYEL++F 
Sbjct  149   KLDEWTDEQVNALIDLGGNTAANKKYEASMPDDYRKPRPDASTEERYDFIRRKYELKEFS  208

Query  835   NSDLHLMCPLPttsss---------stsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKAT  987
               D  +  P P + SS         S  +K++      H +G AFRNSW +K+S+  K T
Sbjct  209   KCDEKMSSPFPGSISSLPTPSNSCPSQDKKQYEKQATRHRIGNAFRNSWGRKDSE-HKHT  267

Query  988   RKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVW  1167
             +KS S+AGMVEFIGLIKVNVV+GTNLA+RD+++SDPYVI++LG QSV+TRVIKNNLNP+W
Sbjct  268   KKSYSLAGMVEFIGLIKVNVVKGTNLAVRDVMTSDPYVIISLGQQSVRTRVIKNNLNPIW  327

Query  1168  NEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQ  1347
             NE LMLSIPE +PPLKV V+DKDTF+TDDFMGEAEIDIQPL+ AA+A ENST  + +Q  
Sbjct  328   NESLMLSIPEQIPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVAAAKAYENSTITESMQLG  387

Query  1348  PRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECV  1527
                   A  EN +             DG I L +G V+QEI LKL+NVERGVLE+ELECV
Sbjct  388   KWI---AGQENTL-----------VKDGIITLVDGKVKQEISLKLKNVERGVLEIELECV  433

Query  1528  SLSQ  1539
              L+Q
Sbjct  434   PLTQ  437



>ref|XP_002882559.1| hypothetical protein ARALYDRAFT_478135 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58818.1| hypothetical protein ARALYDRAFT_478135 [Arabidopsis lyrata subsp. 
lyrata]
Length=383

 Score =   409 bits (1052),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 236/397 (59%), Positives = 288/397 (73%), Gaps = 27/397 (7%)
 Frame = +1

Query  370   NTEGNNVSG--ARLYDLLQMDTSPSDSDQMEP--QMQDYSLSPRCRLKALMKESGNQFCA  537
             N E   VSG  A LY+LL      S++ +  P   +Q  S  PR RL+ L+K+ GN++CA
Sbjct  7     NVEPVEVSGSHACLYELLC-----SETPKWTPLKDLQTSSSDPRDRLEKLLKQPGNKYCA  61

Query  538   DCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNV  717
             DCGSP+PKWVSLSLGVFICIKCSGVHRSLGVHISKV+SVKLDEWT +QVD+L   GGN  
Sbjct  62    DCGSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVLSVKLDEWTDDQVDMLVGYGGNTA  121

Query  718   ANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsEK  897
              N ++EA   +  KK KPDS+ EERNDFIR+KYE  QF++     +CP    S ++TS  
Sbjct  122   VNQRFEACNIDQSKKPKPDSTNEERNDFIRKKYEQHQFMDPKDGALCPYQQPSRTNTSPP  181

Query  898   K-HSGGHRI--HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLA  1068
                S  HR   + +G AFRNSW ++ESD  K  +KSNSMAGMVEF+GLIKVNVV+GTNLA
Sbjct  182   SLCSASHRSTKNRIGHAFRNSWGRRESD-HKGPKKSNSMAGMVEFVGLIKVNVVKGTNLA  240

Query  1069  IRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtftt  1248
             +RD+++SDPYVIL LG QSVKTRVIKNNLNPVWNE LMLSIPE +PPLKV V+DKDTF+T
Sbjct  241   VRDVMTSDPYVILALGQQSVKTRVIKNNLNPVWNETLMLSIPEPMPPLKVLVYDKDTFST  300

Query  1249  ddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppD  1428
             DDFMGEAEIDIQPL+ AA+A E S+  +P+Q        A  EN +             D
Sbjct  301   DDFMGEAEIDIQPLVSAAKAYETSSIKEPMQLGSWV---ASKENTL-----------VSD  346

Query  1429  GTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             G I+L EG V+Q+I L+LQNVERGVLE++LEC+ L+Q
Sbjct  347   GIISLEEGKVKQDISLRLQNVERGVLEIQLECLPLTQ  383



>ref|XP_006297895.1| hypothetical protein CARUB_v10013935mg [Capsella rubella]
 gb|EOA30793.1| hypothetical protein CARUB_v10013935mg [Capsella rubella]
Length=383

 Score =   409 bits (1052),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 236/409 (58%), Positives = 292/409 (71%), Gaps = 31/409 (8%)
 Frame = +1

Query  328   MSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEP--QMQDYSLSPRCRLK  501
             MS+ Q+N     V  T       A LY+LL      S++ +  P   +Q  S  PR RL+
Sbjct  1     MSLGQENVDPVEVPGTH------ACLYELLC-----SETPKWTPLKDLQTSSSDPRDRLE  49

Query  502   ALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQ  681
              L+K+ GN++CADCGSP+PKWVSLSLGVFICIKCSGVHRSLGVHISKV+SVKLD+WT +Q
Sbjct  50    KLLKQPGNKYCADCGSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVLSVKLDDWTDDQ  109

Query  682   VDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCP  861
             VD+L   GGN V N ++EA   +  KK KPDS+ EERNDFIR+KYE+ QF++     +CP
Sbjct  110   VDMLVGYGGNTVVNQRFEACNIDQSKKPKPDSTNEERNDFIRKKYEMHQFMDPKDGALCP  169

Query  862   LPttsssstsEKK-HSGGHRI--HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
                 S  +TS     S  HR   + +G AFRNSW ++ESD  K  +KSNSMAGM+EF+GL
Sbjct  170   YQQPSKVNTSPPSLCSANHRSTKNRIGHAFRNSWGRRESDP-KGPKKSNSMAGMIEFVGL  228

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             IKVNVV+GTNLA+RD+++SDPYVIL LG QSVKTRVIKNNLNPVWNE LMLSIPE +PPL
Sbjct  229   IKVNVVKGTNLAVRDVMTSDPYVILALGQQSVKTRVIKNNLNPVWNETLMLSIPEPMPPL  288

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             KV V+DKDTF+TDDFMGEAEIDIQPL+ AA+A E S+  +P+Q        A  EN +  
Sbjct  289   KVLVYDKDTFSTDDFMGEAEIDIQPLVSAAKAYETSSIKEPMQLGSWV---ASKENTL--  343

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                        DG I+L EG V+Q+I L+LQNVERGVLE++LEC+ L+Q
Sbjct  344   ---------VRDGIISLEEGKVKQDISLRLQNVERGVLEIQLECLPLTQ  383



>ref|XP_008813422.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Phoenix dactylifera]
Length=406

 Score =   410 bits (1053),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 222/360 (62%), Positives = 275/360 (76%), Gaps = 28/360 (8%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             P  RL+ L+ +  N+FCADCGSPDPKWVSLSLGVFICIKCSGVHRSLG HISKV+SVKLD
Sbjct  67    PLGRLENLLSQPANRFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGAHISKVLSVKLD  126

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             EWT EQVD L++ GGN   N++YEA  PEN+KK +PDSS EER+DFI+RKYELQQF NS+
Sbjct  127   EWTDEQVDSLSDGGGNAAVNMRYEAFLPENFKKPRPDSSIEERSDFIKRKYELQQFSNSN  186

Query  844   LHLMCPLP--------ttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSN  999
               ++   P         T SS + EK+H+G    HGLG AFRNSWR+KES+ QKA +K+ 
Sbjct  187   GLIISTTPGSLSKTLQKTVSSKSFEKQHTGLR--HGLGHAFRNSWRRKESE-QKAIKKT-  242

Query  1000  SMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQL  1179
                GMVEF+GLIKVN++RGTNLA+RD+++SDPYVIL +G+Q++KTRVIK+NLNPVWNE+L
Sbjct  243   --MGMVEFLGLIKVNIIRGTNLAVRDVMTSDPYVILNMGHQTMKTRVIKSNLNPVWNERL  300

Query  1180  MLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTP  1359
             MLSIP+ +PPLK+ V+DKDTF+TDD MGEAEIDIQPL+ AA+A E+ST ++P+Q      
Sbjct  301   MLSIPDPIPPLKLQVYDKDTFSTDDRMGEAEIDIQPLVSAAKAYESSTISEPMQLGKWL-  359

Query  1360  KKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
               A  +N +             D  I+L  G V+QEI L+LQNVERG LE+ELECV LSQ
Sbjct  360   --ASDDNTL-----------VKDSIISLDNGKVKQEITLRLQNVERGELEIELECVPLSQ  406



>ref|XP_002513070.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF49573.1| DNA binding protein, putative [Ricinus communis]
Length=382

 Score =   409 bits (1050),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 230/397 (58%), Positives = 282/397 (71%), Gaps = 39/397 (10%)
 Frame = +1

Query  421   MDTSPSDSDQMEPQMQDYSL----------------SPRCRLKALMKESGNQFCADCGSP  552
             M  S  +SD     +QD+ L                 P  +L+ L+ +S N+ CADCGSP
Sbjct  1     MSMSQENSDAPTTLLQDFFLPDNKHCWSRKERHKFSGPLKKLEKLLSQSSNKTCADCGSP  60

Query  553   DPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKY  732
             DPKWVSLS GVFICIKCSGVHRSLGVHISKV+S+KLD+WT EQV+   ++GGN  AN KY
Sbjct  61    DPKWVSLSHGVFICIKCSGVHRSLGVHISKVLSIKLDDWTDEQVNNFIDLGGNAAANKKY  120

Query  733   EAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLP--------ttsssst  888
             EA  P ++KK KPD++ EER+DFIRRKYEL QF+N    ++CP            SSSS 
Sbjct  121   EACIPNDFKKPKPDATIEERSDFIRRKYELLQFLNYSDQMICPYKPQRSSSAAQMSSSSQ  180

Query  889   sEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLA  1068
              +K++      H +G AFRNSW +K+S+  K ++KSNSMAGMVEF+GLIKVNVV+GTNLA
Sbjct  181   EKKQYDKQATRHRIGNAFRNSWGRKDSEN-KQSKKSNSMAGMVEFVGLIKVNVVKGTNLA  239

Query  1069  IRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtftt  1248
             +RD+V+SDPYVIL+LG+QSV+TRVIKNNLNPVWNE LMLSIP+++P LKV V+DKDTFTT
Sbjct  240   VRDVVTSDPYVILSLGHQSVRTRVIKNNLNPVWNESLMLSIPDHIPALKVLVYDKDTFTT  299

Query  1249  ddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppD  1428
             DDFMGEAEIDIQPL+ AA+A E ST N+P+Q       K  T              L  D
Sbjct  300   DDFMGEAEIDIQPLVAAAKAYETSTINEPMQLGKWVASKDNT--------------LLKD  345

Query  1429  GTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             G I L +G V+QEI L+LQNVERGVLE+ELECV L+Q
Sbjct  346   GIITLLDGKVKQEISLRLQNVERGVLEIELECVPLTQ  382



>gb|KEH33048.1| calcium-dependent ARF-type GTPase activating family protein [Medicago 
truncatula]
Length=370

 Score =   408 bits (1048),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 220/366 (60%), Positives = 278/366 (76%), Gaps = 29/366 (8%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             P+ RL  LM+++GN+FCADCGS +PKWVS SLGVFICIKCSG+HRSLGVHISKV+S+ LD
Sbjct  20    PQERLDNLMRQAGNKFCADCGSSEPKWVSSSLGVFICIKCSGIHRSLGVHISKVLSLNLD  79

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             +WT EQVD L  +GGN + N KYEA  P   KK KP+SS EER+DFIRRKYELQQF++S+
Sbjct  80    DWTDEQVDSLVNLGGNTLINKKYEACVPSYVKKPKPNSSIEERSDFIRRKYELQQFLDSE  139

Query  844   LHLMCP-LPttssss-------------tsEKKHSGGHRIHGLGFAFRNSWRKKESDTQK  981
              +L+CP +P+ S ++               +K++      + +G +FRNSW +K+S++ K
Sbjct  140   ENLICPFIPSHSRTTSSSHSSSSSYNPPQEKKRYDKQTTRNRIGLSFRNSWGRKDSES-K  198

Query  982   ATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNP  1161
             +T+KSNS+AGMVEF+GLIKVNVV+GTNLAIRD+V+SDPYVIL+LG+QSVKTRVIKNNLNP
Sbjct  199   STKKSNSLAGMVEFVGLIKVNVVKGTNLAIRDIVTSDPYVILSLGHQSVKTRVIKNNLNP  258

Query  1162  VWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQ  1341
             VWNE LMLSIPEN+PPLK+ V+DKD+F  DDFMGEAEIDIQPL+ AA+A E S+  + +Q
Sbjct  259   VWNESLMLSIPENIPPLKIIVYDKDSFKNDDFMGEAEIDIQPLVSAAKAYEKSSIMESMQ  318

Query  1342  QQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELE  1521
                     A  +N +             DG I+L EG VRQEI L+LQNVERGVLE++LE
Sbjct  319   LGKWV---ASGDNTL-----------VKDGIISLEEGKVRQEISLRLQNVERGVLEIQLE  364

Query  1522  CVSLSQ  1539
             CV L+Q
Sbjct  365   CVPLTQ  370



>ref|XP_006385992.1| hypothetical protein POPTR_0003s19790g [Populus trichocarpa]
 gb|ERP63789.1| hypothetical protein POPTR_0003s19790g [Populus trichocarpa]
Length=461

 Score =   411 bits (1056),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 218/365 (60%), Positives = 272/365 (75%), Gaps = 25/365 (7%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S  P+ RL+ L+ +SGN+ CADCGSPDPKWVS+S GVFICIKCSGVHRSLGVH++KV+S+
Sbjct  112   SSGPQKRLEQLLSQSGNKICADCGSPDPKWVSISFGVFICIKCSGVHRSLGVHLTKVLSI  171

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
             KLDEWT EQV+ L ++GGN  AN KYEA  P++Y+K K D+S EER+DFIRRKYE +QF 
Sbjct  172   KLDEWTDEQVNTLIDLGGNTAANKKYEAFIPDDYQKPKSDASIEERSDFIRRKYEQKQFS  231

Query  835   NSDLHLMCPLPttssss----------tsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKA  984
             N D  + CP P   S+             +K++      H +G AFRNSW +K+++  K 
Sbjct  232   NCDGQMSCPFPGPRSTLSSSCSSHCSPQDKKQYEKQATRHRIGNAFRNSWGRKDTEY-KN  290

Query  985   TRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPV  1164
              +KSNS+A MVEF+GLIKVNVV+GTNLA+RD+++SDPYV+LTLG QSV+TRVIKNNLNP+
Sbjct  291   NKKSNSLAAMVEFVGLIKVNVVKGTNLAVRDVLTSDPYVVLTLGQQSVRTRVIKNNLNPI  350

Query  1165  WNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQ  1344
             WNE LMLSIPE +PPLKV V+DKD FTTDDFMGEAEIDIQPL+ AA+A ENST  + +Q 
Sbjct  351   WNESLMLSIPEQIPPLKVLVYDKDKFTTDDFMGEAEIDIQPLVSAAKAYENSTITESMQL  410

Query  1345  QPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELEC  1524
                    A  +N +             DG I+LA+G V+QEI LKL+NVERGVLE+ELEC
Sbjct  411   GKWI---AGQDNTL-----------VKDGIISLADGKVKQEISLKLKNVERGVLEIELEC  456

Query  1525  VSLSQ  1539
             V L+Q
Sbjct  457   VPLTQ  461



>ref|XP_006385991.1| hypothetical protein POPTR_0003s19790g [Populus trichocarpa]
 ref|XP_006385993.1| hypothetical protein POPTR_0003s19790g [Populus trichocarpa]
 gb|ERP63788.1| hypothetical protein POPTR_0003s19790g [Populus trichocarpa]
 gb|ERP63790.1| hypothetical protein POPTR_0003s19790g [Populus trichocarpa]
Length=467

 Score =   410 bits (1055),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 218/365 (60%), Positives = 272/365 (75%), Gaps = 25/365 (7%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S  P+ RL+ L+ +SGN+ CADCGSPDPKWVS+S GVFICIKCSGVHRSLGVH++KV+S+
Sbjct  118   SSGPQKRLEQLLSQSGNKICADCGSPDPKWVSISFGVFICIKCSGVHRSLGVHLTKVLSI  177

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
             KLDEWT EQV+ L ++GGN  AN KYEA  P++Y+K K D+S EER+DFIRRKYE +QF 
Sbjct  178   KLDEWTDEQVNTLIDLGGNTAANKKYEAFIPDDYQKPKSDASIEERSDFIRRKYEQKQFS  237

Query  835   NSDLHLMCPLPttssss----------tsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKA  984
             N D  + CP P   S+             +K++      H +G AFRNSW +K+++  K 
Sbjct  238   NCDGQMSCPFPGPRSTLSSSCSSHCSPQDKKQYEKQATRHRIGNAFRNSWGRKDTEY-KN  296

Query  985   TRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPV  1164
              +KSNS+A MVEF+GLIKVNVV+GTNLA+RD+++SDPYV+LTLG QSV+TRVIKNNLNP+
Sbjct  297   NKKSNSLAAMVEFVGLIKVNVVKGTNLAVRDVLTSDPYVVLTLGQQSVRTRVIKNNLNPI  356

Query  1165  WNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQ  1344
             WNE LMLSIPE +PPLKV V+DKD FTTDDFMGEAEIDIQPL+ AA+A ENST  + +Q 
Sbjct  357   WNESLMLSIPEQIPPLKVLVYDKDKFTTDDFMGEAEIDIQPLVSAAKAYENSTITESMQL  416

Query  1345  QPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELEC  1524
                    A  +N +             DG I+LA+G V+QEI LKL+NVERGVLE+ELEC
Sbjct  417   GKWI---AGQDNTL-----------VKDGIISLADGKVKQEISLKLKNVERGVLEIELEC  462

Query  1525  VSLSQ  1539
             V L+Q
Sbjct  463   VPLTQ  467



>ref|XP_006470849.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Citrus sinensis]
Length=362

 Score =   405 bits (1042),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 226/362 (62%), Positives = 271/362 (75%), Gaps = 25/362 (7%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             PR RL+ L+++ GN+ CADCGSPDPKWVSLS GVFICIKCSG+HRSLGVHISKV+SVKLD
Sbjct  16    PRARLENLLRQPGNRHCADCGSPDPKWVSLSTGVFICIKCSGIHRSLGVHISKVLSVKLD  75

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             EWT+EQVD L EMGGN   N KYEA  P N KK  P+S  +ER+DFIRRKYE  +F N D
Sbjct  76    EWTNEQVDALAEMGGNIAVNKKYEAYTPGNLKKPSPNSFIDERSDFIRRKYEKLEFFNFD  135

Query  844   LH-LMCPLPt--------tsssstsEKKHSGGHRI-HGLGFAFRNSWRKKESDTQKATRK  993
                L+CP P         ++SSS+ +KKH       H +G AFRNSW +KES++ K ++K
Sbjct  136   EQALLCPYPAPHRRSSSSSTSSSSHDKKHYEKQATRHRIGIAFRNSWGRKESES-KNSKK  194

Query  994   SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNE  1173
             +NS+  MVEF+GLIKVNVV+GTNLA+RD+++SDPYVIL LG+Q+VKTRVIK+NLNPVWNE
Sbjct  195   ANSLVAMVEFVGLIKVNVVKGTNLAVRDVMTSDPYVILALGHQTVKTRVIKSNLNPVWNE  254

Query  1174  QLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPR  1353
              LMLSIPEN+PPLKV V+DKDTFTTDDFMG+AEIDIQPL+ AARA E S  N+ +Q    
Sbjct  255   SLMLSIPENIPPLKVLVYDKDTFTTDDFMGDAEIDIQPLVTAARACETSNINESMQLGKW  314

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                K  T              L  DG I L +G V+QEI L+LQNVERGVLE+ELECV L
Sbjct  315   VAGKDNT--------------LVNDGIITLVDGKVKQEINLRLQNVERGVLEIELECVPL  360

Query  1534  SQ  1539
             +Q
Sbjct  361   TQ  362



>ref|XP_006420736.1| hypothetical protein CICLE_v10005234mg [Citrus clementina]
 ref|XP_006420737.1| hypothetical protein CICLE_v10005234mg [Citrus clementina]
 ref|XP_006420738.1| hypothetical protein CICLE_v10005234mg [Citrus clementina]
 ref|XP_006420739.1| hypothetical protein CICLE_v10005234mg [Citrus clementina]
 ref|XP_006420740.1| hypothetical protein CICLE_v10005234mg [Citrus clementina]
 gb|ESR33976.1| hypothetical protein CICLE_v10005234mg [Citrus clementina]
 gb|ESR33977.1| hypothetical protein CICLE_v10005234mg [Citrus clementina]
 gb|ESR33978.1| hypothetical protein CICLE_v10005234mg [Citrus clementina]
 gb|ESR33979.1| hypothetical protein CICLE_v10005234mg [Citrus clementina]
 gb|ESR33980.1| hypothetical protein CICLE_v10005234mg [Citrus clementina]
Length=362

 Score =   405 bits (1042),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 226/362 (62%), Positives = 271/362 (75%), Gaps = 25/362 (7%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             PR RL+ L+++ GN+ CADCGSPDPKWVSLS GVFICIKCSG+HRSLGVHISKV+SVKLD
Sbjct  16    PRARLENLLRQPGNRHCADCGSPDPKWVSLSTGVFICIKCSGIHRSLGVHISKVLSVKLD  75

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             EWT+EQVD L EMGGN   N KYEA  P N KK  P+S  +ER+DFIRRKYE  +F N D
Sbjct  76    EWTNEQVDALAEMGGNIAVNKKYEAYTPGNLKKPNPNSFIDERSDFIRRKYEKLEFFNFD  135

Query  844   LH-LMCPLPt--------tsssstsEKKHSGGHRI-HGLGFAFRNSWRKKESDTQKATRK  993
                L+CP P         ++SSS+ +KKH       H +G AFRNSW +KES++ K ++K
Sbjct  136   EQALLCPYPAPHRRSSSSSTSSSSHDKKHYEKQATRHRIGIAFRNSWGRKESES-KNSKK  194

Query  994   SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNE  1173
             +NS+  MVEF+GLIKVNVV+GTNLA+RD+++SDPYVIL LG+Q+VKTRVIK+NLNPVWNE
Sbjct  195   ANSLVAMVEFVGLIKVNVVKGTNLAVRDVMTSDPYVILALGHQTVKTRVIKSNLNPVWNE  254

Query  1174  QLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPR  1353
              LMLSIPEN+PPLKV V+DKDTFTTDDFMG+AEIDIQPL+ AARA E S  N+ +Q    
Sbjct  255   SLMLSIPENIPPLKVLVYDKDTFTTDDFMGDAEIDIQPLVTAARACETSNINESMQLGKW  314

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                K  T              L  DG I L +G V+QEI L+LQNVERGVLE+ELECV L
Sbjct  315   VAGKDNT--------------LVNDGIITLVDGKVKQEINLRLQNVERGVLEIELECVPL  360

Query  1534  SQ  1539
             +Q
Sbjct  361   TQ  362



>ref|XP_004511023.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cicer arietinum]
Length=367

 Score =   405 bits (1042),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 216/373 (58%), Positives = 274/373 (73%), Gaps = 29/373 (8%)
 Frame = +1

Query  463   MQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISK  642
             M+D S  P+ RL  LM ++GN++CADCG+P+PKWVS SLGVFICIKCSG+HRSLGVHISK
Sbjct  10    MKDVS-GPQKRLNNLMHQAGNKYCADCGTPEPKWVSASLGVFICIKCSGIHRSLGVHISK  68

Query  643   VVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYEL  822
             V S+KLD+W++EQVD L ++GGN + N KYEA  P N KK KP +S EER+++IR+KYE 
Sbjct  69    VASLKLDQWSNEQVDALEKLGGNTLLNKKYEACLPSNIKKPKPHTSIEERSEYIRKKYEQ  128

Query  823   QQFVNSDLHLMCPL--------------PttsssstsEKKHSGGHRIHGLGFAFRNSWRK  960
              QFV  D  L C +               +  +     KK+      H +G AFRNSW +
Sbjct  129   LQFVECDEKLSCAIVPSQGRSLALLQSSSSCYTYHIDNKKYDKAPTKHRIGHAFRNSWAR  188

Query  961   KESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRV  1140
             K+SD + A++KS S+AGMVEF+GLIKVNVV+GT+LA+RD+++SDPYVIL+LG+QSVKTRV
Sbjct  189   KDSDHKSASKKSTSLAGMVEFVGLIKVNVVKGTHLAVRDVMTSDPYVILSLGHQSVKTRV  248

Query  1141  IKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENS  1320
             IKNNLNPVWNE LMLSIPEN+PPLKV V+DKDTF+TDDFMGEAEIDIQPL++AA A E S
Sbjct  249   IKNNLNPVWNESLMLSIPENIPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVLAAIAYEKS  308

Query  1321  TKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERG  1500
             T N+ +Q +     K  +              L  DG I+L EG ++Q+I ++LQNVERG
Sbjct  309   TINESMQLEKFVASKDRS--------------LVRDGIISLHEGRIKQQISVRLQNVERG  354

Query  1501  VLEVELECVSLSQ  1539
             VLE+ELECV L+Q
Sbjct  355   VLEIELECVPLTQ  367



>ref|XP_010557858.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Tarenaya hassleriana]
Length=386

 Score =   405 bits (1041),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 230/383 (60%), Positives = 281/383 (73%), Gaps = 24/383 (6%)
 Frame = +1

Query  403   LYDLLQMDTSPSDSDQMEPQ--MQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLS  576
             LYDLL      S++ + +PQ  +      PR +L+ +M++ GN++CADCGSPDPKWVSLS
Sbjct  24    LYDLLF-----SETPRWDPQKDLHASRCDPRDKLENMMRQCGNKYCADCGSPDPKWVSLS  78

Query  577   LGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENY  756
             LGVFICIKCSGVHRSLGVHI+KV+SVKLDEWT EQVD+L  +GGN   N KYEA  P+N 
Sbjct  79    LGVFICIKCSGVHRSLGVHITKVLSVKLDEWTDEQVDMLMGLGGNIAVNKKYEACVPDNI  138

Query  757   KKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPL-PttsssstsEKKHSGGHRIHG-L  930
             KK KPDS  EER+DFIRRKYELQQF++      CP  P   +SS+S    +        +
Sbjct  139   KKPKPDSHIEERSDFIRRKYELQQFMDPKDGGSCPYHPGRRTSSSSLSSSASHRSAKTRI  198

Query  931   GFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILT  1110
               AFRNSW ++ESD  K  +KS+S+AGMVEF+GLIKVNVV+GTNLA+RD+++SDPYVIL 
Sbjct  199   SHAFRNSWVRRESD-HKCPKKSHSLAGMVEFVGLIKVNVVKGTNLAVRDVMTSDPYVILA  257

Query  1111  LGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPL  1290
             LG QSVKTRVIKNNLNPVWNE LMLSIP+++PPLKV V+DKDTF+TDDFMGEAEIDIQPL
Sbjct  258   LGQQSVKTRVIKNNLNPVWNETLMLSIPDHIPPLKVLVYDKDTFSTDDFMGEAEIDIQPL  317

Query  1291  LVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEI  1470
             + AA+A E S   + +Q        A  EN +             DG I+L EG V+Q+I
Sbjct  318   VSAAKAYETSDIKESMQLGSWV---ASKENTL-----------VTDGIISLVEGKVKQDI  363

Query  1471  VLKLQNVERGVLEVELECVSLSQ  1539
              L+LQNVERGVLE+ELECV L+Q
Sbjct  364   SLRLQNVERGVLEIELECVPLTQ  386



>ref|XP_010670464.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Beta vulgaris subsp. vulgaris]
Length=431

 Score =   406 bits (1043),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 237/444 (53%), Positives = 295/444 (66%), Gaps = 62/444 (14%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQ---MDTSPSDSDQMEPQMQDYSLSP---  486
             +M+ QQ N+   T       N+ G  LY+L Q   M T+   +D+  P  Q     P   
Sbjct  11    EMTTQQTNSDTRT-------NIRGYSLYELFQAERMQTAKEHADRQFPGEQHSGKPPSEK  63

Query  487   RCR--------------LKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSL  624
             +C+              L  L+  SGN+ CADCG+P+PKWVS  +GVFICIKCSG+HRSL
Sbjct  64    QCKSSRSRIENHGPQKKLAELLSHSGNKHCADCGTPEPKWVSFGVGVFICIKCSGIHRSL  123

Query  625   GVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFI  804
             GVHI+KV+SVKLDEWT +QVD L EMGGN VAN KYEA  P N KK +PDS+ +ER+DFI
Sbjct  124   GVHITKVLSVKLDEWTDDQVDSLAEMGGNIVANKKYEACIPGNIKKPRPDSTIDERSDFI  183

Query  805   RRKYELQQFVNSDLHLMCPLPttssss------------tsEKKHSGGH----RIHGLGF  936
             RRKYELQQF+NSD  LMCP P  ++S+              ++KH        RI G+G 
Sbjct  184   RRKYELQQFLNSDECLMCPYPRPTTSTSYRSASSSDIVLALDRKHMDKQVSSLRISGIGH  243

Query  937   AF---RNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVIL  1107
              F   RNSW++K  D  +  +K +   GM+EFIGLIKVNVVRGTNLAIRDM+SSDPYVIL
Sbjct  244   VFRSGRNSWKRK--DEYRNYKKGDLTPGMIEFIGLIKVNVVRGTNLAIRDMISSDPYVIL  301

Query  1108  TLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQP  1287
             +LG+QSVKTRVIK NLNPVWNE+LMLSIP+ VPPLK+ V+DKDTFT DDFMG+AEIDIQP
Sbjct  302   SLGHQSVKTRVIKKNLNPVWNEKLMLSIPDCVPPLKLLVYDKDTFTPDDFMGQAEIDIQP  361

Query  1288  LLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQE  1467
             L+ AAR  E S++N+  Q       +A  EN +             D  I+L +G V+Q+
Sbjct  362   LVRAARDVEQSSQNETAQ---LGKWEASKENTL-----------LNDSIISLIDGAVKQQ  407

Query  1468  IVLKLQNVERGVLEVELECVSLSQ  1539
             + +KLQNVERG+LE+ELECV LSQ
Sbjct  408   MSIKLQNVERGILELELECVPLSQ  431



>gb|KHN21302.1| Putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Glycine soja]
Length=348

 Score =   402 bits (1034),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 219/362 (60%), Positives = 274/362 (76%), Gaps = 22/362 (6%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S  P+ RL  LM+++GN++CADCGS DPKWVS + GVFICIKCSGVHRSLGVHISKV+S+
Sbjct  2     SSGPQKRLDNLMRQAGNKYCADCGSSDPKWVSSNNGVFICIKCSGVHRSLGVHISKVLSL  61

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
             KLDEWT EQVD L + GGN V N+KYEA  P N KK KP+SS EER DFIRRKYE  QF+
Sbjct  62    KLDEWTDEQVDALVKFGGNTVINMKYEACLPSNIKKPKPNSSIEERYDFIRRKYEFLQFL  121

Query  835   NSDLHLMCPL------PttsssstsEKKHSGGHRIHG-LGFAFRNSWRKKESDTQKATRK  993
             N + +L CP        ++S+    +KKH         +G AFRNSW +K+S+  K+++K
Sbjct  122   NIEENLSCPFVPSHARSSSSNKFPQDKKHYDKQATKSRIGSAFRNSWGRKDSE-HKSSKK  180

Query  994   SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNE  1173
             SNS+AGMVEFIGLIKVNVV+GTNLAIRD++SSDPYVI++LG+QSVKTRVIK++LNP+WNE
Sbjct  181   SNSLAGMVEFIGLIKVNVVKGTNLAIRDVMSSDPYVIISLGHQSVKTRVIKSSLNPIWNE  240

Query  1174  QLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPR  1353
              LMLSIP+++PPLKV V+DKDTF+TDDFMGEAEIDIQPL+ AA+A E S+ N+ +Q    
Sbjct  241   SLMLSIPDHIPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVSAAKAYEKSSINESMQLGKW  300

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                 A  +N +             D  I+L EG V+QEI ++LQ+VERGVLE+ELECV L
Sbjct  301   V---ASGDNTL-----------VKDSIISLEEGKVKQEISVRLQHVERGVLEIELECVPL  346

Query  1534  SQ  1539
             +Q
Sbjct  347   TQ  348



>ref|NP_187451.2| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Arabidopsis thaliana]
 sp|Q8L7A4.1|AGD11_ARATH RecName: Full=Probable ADP-ribosylation factor GTPase-activating 
protein AGD11; Short=ARF GAP AGD11; AltName: Full=Protein 
ARF-GAP DOMAIN 11; Short=AtAGD11 [Arabidopsis thaliana]
 gb|AAM97047.1| putative GTPase-activating protein [Arabidopsis thaliana]
 gb|AAN72120.1| putative GTPase-activating protein [Arabidopsis thaliana]
 gb|AEE74623.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Arabidopsis thaliana]
Length=385

 Score =   403 bits (1036),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 233/395 (59%), Positives = 286/395 (72%), Gaps = 21/395 (5%)
 Frame = +1

Query  370   NTEGNNVSG--ARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADC  543
             N +   VSG  A LY+LL  +T      ++E  +Q  S  PR RL+ L+K+ GN++CADC
Sbjct  7     NVDPVEVSGSHACLYELLCSETPKWTPLRVE-DLQTSSSDPRDRLEKLLKQPGNKYCADC  65

Query  544   GSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVAN  723
             GSP+PKWVSLSLGVFICIKCSGVHRSLGVHISKV+SVKLDEWT +QVD+L   GGN   N
Sbjct  66    GSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVLSVKLDEWTDDQVDMLVGYGGNTAVN  125

Query  724   LKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsEKK-  900
              ++EA   +  KK KPDS+ EERNDFIR+KYE  QF++     +C     S ++TS    
Sbjct  126   ERFEACNIDQSKKPKPDSTNEERNDFIRKKYEQHQFMDPKDGALCTYQQPSRTNTSPPSL  185

Query  901   HSGGHRI--HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIR  1074
              S  HR   + +G AFRNSW ++ESD  K  +KSNSMAGMVEF+GLIKVNVV+GTNLA+R
Sbjct  186   CSASHRSTKNRIGHAFRNSWGRRESD-HKGPKKSNSMAGMVEFVGLIKVNVVKGTNLAVR  244

Query  1075  DMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttdd  1254
             D+++SDPYVIL LG QSVKTRVIKNNLNPVWNE LMLSIPE +PPLKV V+DKDTF+TDD
Sbjct  245   DVMTSDPYVILALGQQSVKTRVIKNNLNPVWNETLMLSIPEPMPPLKVLVYDKDTFSTDD  304

Query  1255  fMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGT  1434
             FMGEAEIDIQPL+ AA+A E S+  +P+Q        A  EN +             DG 
Sbjct  305   FMGEAEIDIQPLVSAAKAYETSSIKEPMQLGSWV---ASKENTL-----------VSDGI  350

Query  1435  INLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             I L +G V+Q+I L+LQNVERGVLE++LEC+ L+Q
Sbjct  351   ILLEDGKVKQDISLRLQNVERGVLEIQLECLPLTQ  385



>emb|CDY35974.1| BnaA05g29760D [Brassica napus]
Length=406

 Score =   404 bits (1038),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 237/415 (57%), Positives = 293/415 (71%), Gaps = 38/415 (9%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKA  504
             +MS+ Q N     V   E ++ S A LYDLL    S +    ++   Q  +  PR RL+ 
Sbjct  20    EMSLGQTN-----VNPIEVSSGSHACLYDLL---CSETPRGTLQKDFQTSTSDPRDRLEK  71

Query  505   LMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQV  684
             L+K+SGN++CADCGSP+PKWVSLSLGVFICIKCSGVHRSLGVHISKV S+KLDEWT EQV
Sbjct  72    LLKQSGNKYCADCGSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVFSIKLDEWTDEQV  131

Query  685   DILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMC--  858
             D+L   GGN+  N ++EA   +  KK KP+S+ EERNDFIR+KYEL QF++     +C  
Sbjct  132   DMLVGYGGNSAVNQRFEACNMDQLKKPKPNSNNEERNDFIRKKYELHQFMDPQDSALCTY  191

Query  859   --------PLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGM  1014
                      LP+  S+S S +  S  +RI   G AFRNSW ++ESD  K  +KSNSMAGM
Sbjct  192   EQPTIINNSLPSLCSASASHR--SAKNRI---GQAFRNSWGRRESD-HKCPKKSNSMAGM  245

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEF+GLI+VNVV+GTNLA+RD+++SDPYVIL+LG QSVKTRVIKNNLNPVWNE LMLSIP
Sbjct  246   VEFVGLIRVNVVKGTNLAVRDVMTSDPYVILSLGQQSVKTRVIKNNLNPVWNETLMLSIP  305

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
             E +PPLKV V+DKDTFTTDDFMGEAEIDIQPL+ AA A E S+  +P+Q       K   
Sbjct  306   EQMPPLKVLVYDKDTFTTDDFMGEAEIDIQPLVSAAIAYETSSIKEPMQLGSWVASK---  362

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             EN +             DG I+  EG V+Q+I L+LQ VERGVLE++LEC+ L+Q
Sbjct  363   ENTL-----------VSDGIISQDEGKVKQDISLRLQKVERGVLEIQLECLPLTQ  406



>ref|XP_011020380.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X3 [Populus euphratica]
Length=440

 Score =   405 bits (1040),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 215/362 (59%), Positives = 269/362 (74%), Gaps = 25/362 (7%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             P+ RL+ L+ +SGN+ CADCGSPDPKWVS+S GVFICIK  GVHRSLGVH++KV+S+KLD
Sbjct  94    PQKRLEQLLSQSGNKICADCGSPDPKWVSISFGVFICIKWPGVHRSLGVHLTKVLSIKLD  153

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             EWT EQV+ L ++GGN  AN KYEA  P++Y+K K D+S EER+DFIRRKYE +QF N D
Sbjct  154   EWTDEQVNTLIDLGGNTAANKKYEAFIPDDYQKPKSDASIEERSDFIRRKYEQKQFSNCD  213

Query  844   LHLMCPLPttssss----------tsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRK  993
               + CP P   S+             +K++      H +G AFRNSW +K+++  K  +K
Sbjct  214   GQMSCPFPGPRSALSSSCSSHCSPQDKKQYEKQATRHRIGNAFRNSWGRKDTEY-KNNKK  272

Query  994   SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNE  1173
             SNS+A MVEF+GLIKVNVV+GTNLA+RD+++SDPYV+LTLG QSV+TRVIKNNLNP+WNE
Sbjct  273   SNSLAAMVEFVGLIKVNVVKGTNLAVRDVLTSDPYVVLTLGQQSVRTRVIKNNLNPIWNE  332

Query  1174  QLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPR  1353
              LMLSIPE +PPLKV V+DKD FTTDDFMGEAEIDIQPL+ AA+A ENST  + +Q    
Sbjct  333   SLMLSIPEQIPPLKVLVYDKDKFTTDDFMGEAEIDIQPLVSAAKAYENSTITESMQLGKW  392

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                 A  +N +             DG I+LA+G V+QEI LKL+NVERGVLE+ELECV L
Sbjct  393   I---AGQDNTL-----------VKDGIISLADGKVKQEISLKLKNVERGVLEIELECVPL  438

Query  1534  SQ  1539
             +Q
Sbjct  439   TQ  440



>gb|AAF21204.1|AC013483_28 putative GTPase activating protein [Arabidopsis thaliana]
Length=373

 Score =   402 bits (1033),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 230/386 (60%), Positives = 282/386 (73%), Gaps = 19/386 (5%)
 Frame = +1

Query  391   SGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVS  570
             S A LY+LL  +T      ++E  +Q  S  PR RL+ L+K+ GN++CADCGSP+PKWVS
Sbjct  4     SHACLYELLCSETPKWTPLRVE-DLQTSSSDPRDRLEKLLKQPGNKYCADCGSPEPKWVS  62

Query  571   LSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPE  750
             LSLGVFICIKCSGVHRSLGVHISKV+SVKLDEWT +QVD+L   GGN   N ++EA   +
Sbjct  63    LSLGVFICIKCSGVHRSLGVHISKVLSVKLDEWTDDQVDMLVGYGGNTAVNERFEACNID  122

Query  751   NYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsEKK-HSGGHRI--  921
               KK KPDS+ EERNDFIR+KYE  QF++     +C     S ++TS     S  HR   
Sbjct  123   QSKKPKPDSTNEERNDFIRKKYEQHQFMDPKDGALCTYQQPSRTNTSPPSLCSASHRSTK  182

Query  922   HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYV  1101
             + +G AFRNSW ++ESD  K  +KSNSMAGMVEF+GLIKVNVV+GTNLA+RD+++SDPYV
Sbjct  183   NRIGHAFRNSWGRRESD-HKGPKKSNSMAGMVEFVGLIKVNVVKGTNLAVRDVMTSDPYV  241

Query  1102  ILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDI  1281
             IL LG QSVKTRVIKNNLNPVWNE LMLSIPE +PPLKV V+DKDTF+TDDFMGEAEIDI
Sbjct  242   ILALGQQSVKTRVIKNNLNPVWNETLMLSIPEPMPPLKVLVYDKDTFSTDDFMGEAEIDI  301

Query  1282  QPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVR  1461
             QPL+ AA+A E S+  +P+Q        A  EN +             DG I L +G V+
Sbjct  302   QPLVSAAKAYETSSIKEPMQLGSWV---ASKENTL-----------VSDGIILLEDGKVK  347

Query  1462  QEIVLKLQNVERGVLEVELECVSLSQ  1539
             Q+I L+LQNVERGVLE++LEC+ L+Q
Sbjct  348   QDISLRLQNVERGVLEIQLECLPLTQ  373



>ref|XP_009401045.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Musa acuminata subsp. malaccensis]
Length=359

 Score =   401 bits (1030),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 220/362 (61%), Positives = 271/362 (75%), Gaps = 29/362 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             SP  RL+ L+    N++CADCGSPDPKWVSL+LGVFICIKCSGVHRSLGVHISKV+SVKL
Sbjct  18    SPLGRLENLLSHPSNRYCADCGSPDPKWVSLNLGVFICIKCSGVHRSLGVHISKVISVKL  77

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             D+WT EQVD L + GGN  AN +YEA  P+N  K KPDSS +ER++FIRRKYELQQF +S
Sbjct  78    DDWTDEQVDSLIDGGGNAAANARYEAFLPDNIIKPKPDSSIDERSEFIRRKYELQQFSSS  137

Query  841   DLHL---MCPLPttsss------stsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRK  993
             ++ +   M P   TS           EK+H+G    HGLG AFRNSWRKKE++  KA +K
Sbjct  138   NVQIGYAMSPDANTSFQNNVTNNKLLEKQHTGIR--HGLGHAFRNSWRKKETE-HKAVKK  194

Query  994   SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNE  1173
                M GMVEF+GLIKVN+V+GTNLA+RDM++SDPYVIL LG+QS+KTRVIK++LNPVWNE
Sbjct  195   ---MMGMVEFVGLIKVNIVKGTNLAVRDMMTSDPYVILNLGHQSMKTRVIKSSLNPVWNE  251

Query  1174  QLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPR  1353
             +LMLSIP+ +PPL++ V+DKDTF+TDD MGEAEIDIQPL+ AA+A ENS+ ++ +Q    
Sbjct  252   KLMLSIPDPIPPLRLQVYDKDTFSTDDRMGEAEIDIQPLVAAAKAYENSSISESMQLGKW  311

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                 A  +N +             D  I+L +G V+QEI LKLQNVERG LE+ELECV L
Sbjct  312   L---ATDDNTL-----------VKDSVISLVDGKVKQEITLKLQNVERGELEIELECVPL  357

Query  1534  SQ  1539
             SQ
Sbjct  358   SQ  359



>ref|XP_009147013.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Brassica rapa]
 ref|XP_009147014.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Brassica rapa]
Length=406

 Score =   402 bits (1034),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 237/415 (57%), Positives = 292/415 (70%), Gaps = 38/415 (9%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKA  504
             +MS+ Q N     V   E ++ S A LYDLL    S +    ++   Q  +  PR RL+ 
Sbjct  20    EMSLGQAN-----VNPIEVSSGSHACLYDLL---CSETPRGILQKDFQTSTSDPRDRLEK  71

Query  505   LMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQV  684
             L+K+SGN++CADCGSP+PKWVSLSLGVFICIKCSGVHRSLGVHISKV S+KLDEWT EQV
Sbjct  72    LLKQSGNKYCADCGSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVFSIKLDEWTDEQV  131

Query  685   DILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMC--  858
             D+L   GGN   N ++EA   +  KK KP+S+ EERNDFIR+KYEL QF++     +C  
Sbjct  132   DMLVGYGGNTAVNQRFEACNMDQLKKPKPNSNNEERNDFIRKKYELHQFMDPQDSALCTY  191

Query  859   --------PLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGM  1014
                      LP+  S+S S +  S  +RI   G AFRNSW ++ESD  K  +KSNSMAGM
Sbjct  192   EQPTIINNSLPSLCSASASHR--SAKNRI---GQAFRNSWGRRESD-HKCPKKSNSMAGM  245

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEF+GLI+VNVV+GTNLA+RD+++SDPYVIL+LG QSVKTRVIKNNLNPVWNE LMLSIP
Sbjct  246   VEFVGLIRVNVVKGTNLAVRDVMTSDPYVILSLGQQSVKTRVIKNNLNPVWNETLMLSIP  305

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
             E +PPLKV V+DKDTFTTDDFMGEAEIDIQPL+ AA A E S+  +P+Q       K   
Sbjct  306   EQMPPLKVLVYDKDTFTTDDFMGEAEIDIQPLVSAAIAYETSSIKEPMQLGSWVASK---  362

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             EN +             DG I+  EG V+Q+I L+LQ VERGVLE++LEC+ L+Q
Sbjct  363   ENTL-----------VSDGIISQDEGKVKQDISLRLQKVERGVLEIQLECLPLTQ  406



>ref|XP_010032310.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Eucalyptus grandis]
Length=370

 Score =   401 bits (1031),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 220/363 (61%), Positives = 265/363 (73%), Gaps = 29/363 (8%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL+ LM + GN+FCADCGSPDPKWVSL+LG FICIKCSGVHR LGVHISKV+SVKLDEWT
Sbjct  23    RLEKLMSQPGNEFCADCGSPDPKWVSLTLGAFICIKCSGVHRGLGVHISKVLSVKLDEWT  82

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQV+ L   GGN   NLKYEA  P N +K K DSS EER+DFIRRKYEL QF+NS   +
Sbjct  83    DEQVEALVVRGGNTAVNLKYEACVPGNLRKPKADSSIEERSDFIRRKYELLQFLNSPEQM  142

Query  853   MCPLPtt--------------sssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATR  990
              CP P++              SS++  +++       H +G AFRNSW ++E+D  KA +
Sbjct  143   SCPFPSSNNRYPSSSQSSSSSSSANQEKRQFEKQPTKHRIGQAFRNSWGRREND-HKAYK  201

Query  991   KSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWN  1170
             K  S AGMVEF+GLIKVNVVRGTNL IRD+++SDPYVIL LG+QSVKTRVIKNNLNPVWN
Sbjct  202   KKCSSAGMVEFVGLIKVNVVRGTNLVIRDVMTSDPYVILALGHQSVKTRVIKNNLNPVWN  261

Query  1171  EQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQP  1350
             E+LMLSIPE+VPPLKV V+DKDTF  DDFMGEAEIDIQPLL AA+A E+ST ++ +Q   
Sbjct  262   EKLMLSIPESVPPLKVLVYDKDTFKQDDFMGEAEIDIQPLLSAAKAYESSTIDESMQLGK  321

Query  1351  RTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVS  1530
                 +  T              L  DG I+L +G V+Q+I L+L+NVERG L++ELECV 
Sbjct  322   WVASRDNT--------------LVKDGVISLMDGKVKQDITLRLKNVERGELDIELECVP  367

Query  1531  LSQ  1539
             L+Q
Sbjct  368   LTQ  370



>ref|XP_011020379.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Populus euphratica]
Length=461

 Score =   404 bits (1039),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 216/365 (59%), Positives = 270/365 (74%), Gaps = 25/365 (7%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S  P+ RL+ L+ +SGN+ CADCGSPDPKWVS+S GVFICIK  GVHRSLGVH++KV+S+
Sbjct  112   SSGPQKRLEQLLSQSGNKICADCGSPDPKWVSISFGVFICIKWPGVHRSLGVHLTKVLSI  171

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
             KLDEWT EQV+ L ++GGN  AN KYEA  P++Y+K K D+S EER+DFIRRKYE +QF 
Sbjct  172   KLDEWTDEQVNTLIDLGGNTAANKKYEAFIPDDYQKPKSDASIEERSDFIRRKYEQKQFS  231

Query  835   NSDLHLMCPLPttssss----------tsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKA  984
             N D  + CP P   S+             +K++      H +G AFRNSW +K+++  K 
Sbjct  232   NCDGQMSCPFPGPRSALSSSCSSHCSPQDKKQYEKQATRHRIGNAFRNSWGRKDTEY-KN  290

Query  985   TRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPV  1164
              +KSNS+A MVEF+GLIKVNVV+GTNLA+RD+++SDPYV+LTLG QSV+TRVIKNNLNP+
Sbjct  291   NKKSNSLAAMVEFVGLIKVNVVKGTNLAVRDVLTSDPYVVLTLGQQSVRTRVIKNNLNPI  350

Query  1165  WNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQ  1344
             WNE LMLSIPE +PPLKV V+DKD FTTDDFMGEAEIDIQPL+ AA+A ENST  + +Q 
Sbjct  351   WNESLMLSIPEQIPPLKVLVYDKDKFTTDDFMGEAEIDIQPLVSAAKAYENSTITESMQL  410

Query  1345  QPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELEC  1524
                    A  +N +             DG I+LA+G V+QEI LKL+NVERGVLE+ELEC
Sbjct  411   GKWI---AGQDNTL-----------VKDGIISLADGKVKQEISLKLKNVERGVLEIELEC  456

Query  1525  VSLSQ  1539
             V L+Q
Sbjct  457   VPLTQ  461



>ref|XP_011020374.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Populus euphratica]
 ref|XP_011020375.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Populus euphratica]
 ref|XP_011020376.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Populus euphratica]
 ref|XP_011020378.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Populus euphratica]
Length=467

 Score =   404 bits (1038),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 216/365 (59%), Positives = 270/365 (74%), Gaps = 25/365 (7%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S  P+ RL+ L+ +SGN+ CADCGSPDPKWVS+S GVFICIK  GVHRSLGVH++KV+S+
Sbjct  118   SSGPQKRLEQLLSQSGNKICADCGSPDPKWVSISFGVFICIKWPGVHRSLGVHLTKVLSI  177

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
             KLDEWT EQV+ L ++GGN  AN KYEA  P++Y+K K D+S EER+DFIRRKYE +QF 
Sbjct  178   KLDEWTDEQVNTLIDLGGNTAANKKYEAFIPDDYQKPKSDASIEERSDFIRRKYEQKQFS  237

Query  835   NSDLHLMCPLPttssss----------tsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKA  984
             N D  + CP P   S+             +K++      H +G AFRNSW +K+++  K 
Sbjct  238   NCDGQMSCPFPGPRSALSSSCSSHCSPQDKKQYEKQATRHRIGNAFRNSWGRKDTEY-KN  296

Query  985   TRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPV  1164
              +KSNS+A MVEF+GLIKVNVV+GTNLA+RD+++SDPYV+LTLG QSV+TRVIKNNLNP+
Sbjct  297   NKKSNSLAAMVEFVGLIKVNVVKGTNLAVRDVLTSDPYVVLTLGQQSVRTRVIKNNLNPI  356

Query  1165  WNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQ  1344
             WNE LMLSIPE +PPLKV V+DKD FTTDDFMGEAEIDIQPL+ AA+A ENST  + +Q 
Sbjct  357   WNESLMLSIPEQIPPLKVLVYDKDKFTTDDFMGEAEIDIQPLVSAAKAYENSTITESMQL  416

Query  1345  QPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELEC  1524
                    A  +N +             DG I+LA+G V+QEI LKL+NVERGVLE+ELEC
Sbjct  417   GKWI---AGQDNTL-----------VKDGIISLADGKVKQEISLKLKNVERGVLEIELEC  462

Query  1525  VSLSQ  1539
             V L+Q
Sbjct  463   VPLTQ  467



>ref|XP_006579229.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Glycine max]
Length=398

 Score =   401 bits (1030),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 232/419 (55%), Positives = 297/419 (71%), Gaps = 36/419 (9%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKA  504
             +MSVQ +N+      +T G + SG+ LYDLL  +T PS S Q   +    S  P+ RL  
Sbjct  2     EMSVQHENS------DTIGVSGSGSCLYDLLCSET-PSLSTQALRERW-MSSGPQKRLDN  53

Query  505   LMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQV  684
             LM ++GN++CADCGS +PKWVS S GVFICIKCSG+HRSLGVHISKV+S+KLDEWT EQV
Sbjct  54    LMLQAGNKYCADCGSLEPKWVSSSHGVFICIKCSGIHRSLGVHISKVLSLKLDEWTDEQV  113

Query  685   DILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPL  864
             D L + GGN V N+KYEA  P N KK KP+SS EER+DFIRRKYE  QF++ + +L CP 
Sbjct  114   DALVKFGGNTVINMKYEACLPSNIKKPKPNSSIEERSDFIRRKYEFLQFLDIEENLSCPF  173

Query  865   Pttsssst-------------sEKKHSGGHRIHGL-GFAFRNSWRKKESDTQKATRKSNS  1002
               + +  +              +KKH        L G  FRNSW +K+S+  K+++KSNS
Sbjct  174   VPSHARCSSYSERSSSSNNFPQDKKHYDKQETKSLIGSTFRNSWGRKDSE-HKSSKKSNS  232

Query  1003  MAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLM  1182
             +AGM+EFIGLIKVNVV+GTNL IRD+++SDPYVI++LG+QSVKTRVIK++LNPVWNE LM
Sbjct  233   LAGMIEFIGLIKVNVVKGTNLVIRDVMTSDPYVIISLGHQSVKTRVIKSSLNPVWNESLM  292

Query  1183  LSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPK  1362
             LSIP+N+P LKV V+DKD F+TDDFMG+AEIDIQPL+ AA+A E S+ ND +Q       
Sbjct  293   LSIPDNIPLLKVLVYDKDIFSTDDFMGKAEIDIQPLVSAAKAYEKSSINDSLQLGKWV--  350

Query  1363  KAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              A  +N            L  DGTI+L +G V+ +I ++LQ+VERGVLE+ELECV L+Q
Sbjct  351   -ANGDN----------NTLVKDGTISLEDGKVKHDISVRLQHVERGVLEIELECVLLTQ  398



>ref|XP_010095962.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
 gb|EXB62655.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
Length=362

 Score =   399 bits (1026),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 217/354 (61%), Positives = 259/354 (73%), Gaps = 20/354 (6%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL + + +SGN+ CADCGSPDPKWVS++ GV ICIKCSGVHRSLGVHISKV+SVKLDEWT
Sbjct  24    RLDSFLDQSGNRQCADCGSPDPKWVSITFGVVICIKCSGVHRSLGVHISKVLSVKLDEWT  83

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++VD L  +GGN V N KYE+  P N KK KPD S EER+DFIRRKYEL+QF+ S   +
Sbjct  84    AKEVDTLVTLGGNTVVNGKYESCIPVNIKKPKPDCSVEERSDFIRRKYELRQFLVSADQM  143

Query  853   MCPLPttsssstsEKKHSGGHR-----IHGLGFAFRNSWRKKESDTQKATRKSNSMAGMV  1017
              CP   T   S+S   H           + +G AFRNSW +K+++   AT++ NS AGMV
Sbjct  144   SCPFIPTHKRSSSNSDHDKKQNEKQVTKNCIGQAFRNSWGRKDTENN-ATKQYNSSAGMV  202

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EF+GLIKVNVV+GTNLAIRD+++SDPYVIL LG+QSVKTRVIKNNLNPVWNE LMLSIPE
Sbjct  203   EFVGLIKVNVVKGTNLAIRDVMTSDPYVILALGHQSVKTRVIKNNLNPVWNESLMLSIPE  262

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETE  1377
             ++PPLKV V+DKD F  DDFMGEAEIDIQPL+ AA+A E S  N+P+Q       +  T 
Sbjct  263   HIPPLKVLVYDKDKFKNDDFMGEAEIDIQPLVAAAKAYEKSAINEPMQLGKWIANEDST-  321

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                          L  DG I L +G VRQEI L+LQNVERGVLE+ELECV L+Q
Sbjct  322   -------------LVKDGVIYLIDGKVRQEISLRLQNVERGVLEIELECVPLTQ  362



>ref|XP_008446945.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X3 [Cucumis melo]
Length=363

 Score =   398 bits (1023),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 219/367 (60%), Positives = 261/367 (71%), Gaps = 32/367 (9%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RLK L   SGN++CADCGSPDPKWVSLS G FICIKCSGVHRSLGVHISKV+SVKLD+WT
Sbjct  11    RLKDLTAHSGNKYCADCGSPDPKWVSLSFGAFICIKCSGVHRSLGVHISKVLSVKLDDWT  70

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVD L  +GGN   N KYE   P+  KK KPDSS EER DFIR+KYEL QF + D   
Sbjct  71    DEQVDALMSIGGNTAVNKKYEVCIPDGNKKPKPDSSIEERFDFIRKKYELLQFTSLDDQF  130

Query  853   MCPLPttsssstsEKKHSGGHRIHG-------------LGFAFRNSWRKKESDTQKATRK  993
              CP P     ++S    +    ++              +G AFRNSW +K+S+ +   + 
Sbjct  131   FCPFPPPQKRNSSLSHSTSSTDVNQERRNYEKVPTKTRIGSAFRNSWGRKDSEHKNCKKG  190

Query  994   -----SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLN  1158
                  S+SMAGM+EF+GLIKVNVVRGTNLA+RD+V+SDPYVIL+LG+QSVKTRVIK++LN
Sbjct  191   NALVLSSSMAGMIEFVGLIKVNVVRGTNLAVRDVVTSDPYVILSLGHQSVKTRVIKSSLN  250

Query  1159  PVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPV  1338
             PVWNE LMLSIP+ +PPLKV V+DKDTF+TDDFMGEAEIDI PLL AARA E ST  +P+
Sbjct  251   PVWNESLMLSIPDYIPPLKVLVYDKDTFSTDDFMGEAEIDINPLLTAARACERSTICEPM  310

Query  1339  QQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVEL  1518
             Q        A  EN +             DG I+L +G +RQ+I LKLQNVERGVLE+EL
Sbjct  311   QLGKWV---ASKENTL-----------AKDGIISLVDGKIRQDISLKLQNVERGVLEMEL  356

Query  1519  ECVSLSQ  1539
             ECV+LSQ
Sbjct  357   ECVALSQ  363



>emb|CDY28007.1| BnaC05g44090D [Brassica napus]
Length=406

 Score =   400 bits (1027),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 235/415 (57%), Positives = 291/415 (70%), Gaps = 38/415 (9%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKA  504
             +MS+ Q N     V   E ++ S A LYDLL    S +    ++   Q  +  PR RL+ 
Sbjct  20    EMSLGQAN-----VNPLEVSSGSHACLYDLL---CSETPRGTLQKDFQTSTSDPRDRLEK  71

Query  505   LMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQV  684
             L+K+ GN++CADCGSP+PKWVSLSLGVFICIKCSGVHRSLGVHISKV S+ LDEWT EQV
Sbjct  72    LLKQPGNKYCADCGSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVFSINLDEWTDEQV  131

Query  685   DILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMC--  858
             D+L   GGNN  N ++EA   +  KK K DS+ EER+DFIR+KYEL QF++     +C  
Sbjct  132   DMLVGYGGNNAVNQRFEACNMDQLKKPKADSNNEERSDFIRKKYELHQFMDPQDGALCTY  191

Query  859   --------PLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGM  1014
                      LP+  S+S S +  S  +RI   G AFRNSW ++ESD  K  +KSNSMAGM
Sbjct  192   EQPTIINNSLPSLCSASASHR--SAKNRI---GQAFRNSWGRRESD-HKCPKKSNSMAGM  245

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEF+GLI+VNVV+GTNLA+RD+++SDPYVIL+LG QSVKTRVIKNNLNPVWNE LMLSIP
Sbjct  246   VEFVGLIRVNVVKGTNLAVRDVMTSDPYVILSLGQQSVKTRVIKNNLNPVWNETLMLSIP  305

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
             E +PPLKV V+DKDTFTTDDFMGEAEIDIQPL+ AA+A E S+  +P+Q       K   
Sbjct  306   EQMPPLKVLVYDKDTFTTDDFMGEAEIDIQPLVSAAKAYETSSIKEPMQLGSWVASK---  362

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             EN +             DG I+  EG V+Q+I L+LQ VERGVLE++LEC+ L+Q
Sbjct  363   ENTL-----------VSDGIISQEEGKVKQDISLRLQKVERGVLEIQLECLPLTQ  406



>ref|XP_008446942.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Cucumis melo]
 ref|XP_008446943.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Cucumis melo]
Length=380

 Score =   399 bits (1024),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 219/367 (60%), Positives = 261/367 (71%), Gaps = 32/367 (9%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RLK L   SGN++CADCGSPDPKWVSLS G FICIKCSGVHRSLGVHISKV+SVKLD+WT
Sbjct  28    RLKDLTAHSGNKYCADCGSPDPKWVSLSFGAFICIKCSGVHRSLGVHISKVLSVKLDDWT  87

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVD L  +GGN   N KYE   P+  KK KPDSS EER DFIR+KYEL QF + D   
Sbjct  88    DEQVDALMSIGGNTAVNKKYEVCIPDGNKKPKPDSSIEERFDFIRKKYELLQFTSLDDQF  147

Query  853   MCPLPttsssstsEKKHSGGHRIHG-------------LGFAFRNSWRKKESDTQKATRK  993
              CP P     ++S    +    ++              +G AFRNSW +K+S+ +   + 
Sbjct  148   FCPFPPPQKRNSSLSHSTSSTDVNQERRNYEKVPTKTRIGSAFRNSWGRKDSEHKNCKKG  207

Query  994   -----SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLN  1158
                  S+SMAGM+EF+GLIKVNVVRGTNLA+RD+V+SDPYVIL+LG+QSVKTRVIK++LN
Sbjct  208   NALVLSSSMAGMIEFVGLIKVNVVRGTNLAVRDVVTSDPYVILSLGHQSVKTRVIKSSLN  267

Query  1159  PVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPV  1338
             PVWNE LMLSIP+ +PPLKV V+DKDTF+TDDFMGEAEIDI PLL AARA E ST  +P+
Sbjct  268   PVWNESLMLSIPDYIPPLKVLVYDKDTFSTDDFMGEAEIDINPLLTAARACERSTICEPM  327

Query  1339  QQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVEL  1518
             Q        A  EN +             DG I+L +G +RQ+I LKLQNVERGVLE+EL
Sbjct  328   QLGKWV---ASKENTL-----------AKDGIISLVDGKIRQDISLKLQNVERGVLEMEL  373

Query  1519  ECVSLSQ  1539
             ECV+LSQ
Sbjct  374   ECVALSQ  380



>ref|XP_008446944.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Cucumis melo]
Length=378

 Score =   399 bits (1024),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 219/367 (60%), Positives = 261/367 (71%), Gaps = 32/367 (9%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RLK L   SGN++CADCGSPDPKWVSLS G FICIKCSGVHRSLGVHISKV+SVKLD+WT
Sbjct  26    RLKDLTAHSGNKYCADCGSPDPKWVSLSFGAFICIKCSGVHRSLGVHISKVLSVKLDDWT  85

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVD L  +GGN   N KYE   P+  KK KPDSS EER DFIR+KYEL QF + D   
Sbjct  86    DEQVDALMSIGGNTAVNKKYEVCIPDGNKKPKPDSSIEERFDFIRKKYELLQFTSLDDQF  145

Query  853   MCPLPttsssstsEKKHSGGHRIHG-------------LGFAFRNSWRKKESDTQKATRK  993
              CP P     ++S    +    ++              +G AFRNSW +K+S+ +   + 
Sbjct  146   FCPFPPPQKRNSSLSHSTSSTDVNQERRNYEKVPTKTRIGSAFRNSWGRKDSEHKNCKKG  205

Query  994   -----SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLN  1158
                  S+SMAGM+EF+GLIKVNVVRGTNLA+RD+V+SDPYVIL+LG+QSVKTRVIK++LN
Sbjct  206   NALVLSSSMAGMIEFVGLIKVNVVRGTNLAVRDVVTSDPYVILSLGHQSVKTRVIKSSLN  265

Query  1159  PVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPV  1338
             PVWNE LMLSIP+ +PPLKV V+DKDTF+TDDFMGEAEIDI PLL AARA E ST  +P+
Sbjct  266   PVWNESLMLSIPDYIPPLKVLVYDKDTFSTDDFMGEAEIDINPLLTAARACERSTICEPM  325

Query  1339  QQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVEL  1518
             Q        A  EN +             DG I+L +G +RQ+I LKLQNVERGVLE+EL
Sbjct  326   QLGKWV---ASKENTL-----------AKDGIISLVDGKIRQDISLKLQNVERGVLEMEL  371

Query  1519  ECVSLSQ  1539
             ECV+LSQ
Sbjct  372   ECVALSQ  378



>ref|XP_010246871.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nelumbo nucifera]
Length=345

 Score =   397 bits (1020),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 218/362 (60%), Positives = 266/362 (73%), Gaps = 30/362 (8%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             P  RL+ LM + GN+ CADCG+PDPKWVS +LGVFICIKCSGVHRSLGVHISKVVSVKLD
Sbjct  4     PLERLEDLMNQPGNKICADCGTPDPKWVSSNLGVFICIKCSGVHRSLGVHISKVVSVKLD  63

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVN--  837
             EWT E+VD L  +GGN   N+KYE + P+  KK KPDSS EER+DFIRRKYELQQF++  
Sbjct  64    EWTDEEVDSLVNLGGNTRVNMKYENSIPDYVKKPKPDSSIEERSDFIRRKYELQQFLDPP  123

Query  838   --------SDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRK  993
                     S ++ + P    +      +K     R + +G AFRNSWR+KES+  K T+K
Sbjct  124   NSSSHSISSSVNAIVPYEKKNF-----EKQVASIRFNAIGHAFRNSWRRKESE-HKPTKK  177

Query  994   SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNE  1173
             SNS  GMVEF+GLIKVNVV+GTNLAIRD+VSSDPYVIL+LG QS+KTRVIKNNLNPVWNE
Sbjct  178   SNSEPGMVEFVGLIKVNVVKGTNLAIRDVVSSDPYVILSLGQQSMKTRVIKNNLNPVWNE  237

Query  1174  QLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPR  1353
             +++LSIPE VPPLKV VFDKDTF+ DD MGEAEIDIQPLL AA++ E+ST    ++    
Sbjct  238   RILLSIPEPVPPLKVQVFDKDTFSQDDHMGEAEIDIQPLLSAAKSCESSTNKSSIE----  293

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
               K A T+++           L  D  I + +G V+Q + ++LQNVERGV+E+ELECV L
Sbjct  294   LGKLAATQDS----------TLLKDSIITVEDGKVKQVVAVRLQNVERGVIEIELECVPL  343

Query  1534  SQ  1539
             SQ
Sbjct  344   SQ  345



>ref|XP_007218074.1| hypothetical protein PRUPE_ppa006844mg [Prunus persica]
 gb|EMJ19273.1| hypothetical protein PRUPE_ppa006844mg [Prunus persica]
Length=393

 Score =   397 bits (1020),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 247/421 (59%), Positives = 287/421 (68%), Gaps = 45/421 (11%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDT----SPSDSDQMEPQMQDYSLSPRC  492
             +MS Q+DN+  N V        S + LYDLL  D      PSD              P+ 
Sbjct  2     EMSTQRDNSGPNKVSG------SSSCLYDLLCSDAPTWRCPSDRRTQS--------GPQE  47

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL+ L+ +S N+ CADCGS DPKWVSLS GVFICIKCSGVHRSLGVH+SKVVSVKLDEWT
Sbjct  48    RLEILLHQSANRSCADCGSLDPKWVSLSFGVFICIKCSGVHRSLGVHVSKVVSVKLDEWT  107

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              E+VDIL  MGGN   N KYEA  PEN KK KPDSS EER  FIRRKYEL  F+N +  +
Sbjct  108   DEEVDILASMGGNVAVNKKYEACLPENVKKPKPDSSIEERFYFIRRKYELLDFLNPNEQV  167

Query  853   MCPLPttssssts----------EKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNS  1002
              CP P +   S S          +K+       H +G AFRNSW +K+S+  K  +K NS
Sbjct  168   SCPYPPSHKKSPSSNSTNNSTQDKKQFEKQPTKHRIGQAFRNSWGRKDSE-HKTAKKGNS  226

Query  1003  --MAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQ  1176
               MAGMVEF+GL+KVNVVRGTNL +RD+++SDPYVIL LG+QSVKTRVIKNNLNPVWNE 
Sbjct  227   MPMAGMVEFVGLVKVNVVRGTNLVVRDVMTSDPYVILALGHQSVKTRVIKNNLNPVWNES  286

Query  1177  LMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRT  1356
             LMLSIPE++PPLKV V+DKDTFTTDDFMGEAEIDIQPL+ AA A E ST N+PVQ     
Sbjct  287   LMLSIPEHIPPLKVLVYDKDTFTTDDFMGEAEIDIQPLVSAAIAYEKSTINEPVQLGKWV  346

Query  1357  PKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLS  1536
                A  EN +             DG INL +G VRQ+I L+LQNVERGVLE+ELECV L+
Sbjct  347   ---ASKENTL-----------VKDGVINLVDGKVRQQITLRLQNVERGVLEIELECVPLN  392

Query  1537  Q  1539
             Q
Sbjct  393   Q  393



>ref|XP_010273190.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nelumbo nucifera]
 ref|XP_010273191.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nelumbo nucifera]
Length=382

 Score =   396 bits (1018),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 222/383 (58%), Positives = 270/383 (70%), Gaps = 28/383 (7%)
 Frame = +1

Query  427   TSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCS  606
             + PS++       Q  S  P  RL+ LM + GN+ CADCGSP+PKWVSL+ G+FICIKCS
Sbjct  16    SDPSENWSCREDDQRSSAGPLERLEELMNQPGNRICADCGSPEPKWVSLNHGIFICIKCS  75

Query  607   GVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTE  786
             GVHRSLG HISKV+SVKLD WT +QVD++  +GGN   N+KYEA F ++ KK +PDSS E
Sbjct  76    GVHRSLGAHISKVLSVKLDLWTDDQVDLMVALGGNTTVNMKYEA-FLQDIKKPRPDSSIE  134

Query  787   ERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsE------------KKHSGGHRIHGL  930
             ER+DFIRRKYE  QF N +  +    P+T+ SS S             +K S GHRIH  
Sbjct  135   ERSDFIRRKYEHMQFFNPNEKVSSSHPSTTLSSLSRPSTAPPPDKKNCEKQSTGHRIHAF  194

Query  931   GFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILT  1110
             G AF +S +KKE++  K+ + SNS  GMVEFIGLIKVN+VRGTNLA+RDM++SDPYVIL+
Sbjct  195   GHAFHSSRKKKETE-HKSAKNSNSAPGMVEFIGLIKVNIVRGTNLAVRDMITSDPYVILS  253

Query  1111  LGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPL  1290
             LG QS+KTRVIKNNLNPVWNE+LMLSIP+ VPPLKV V+DKDTFT DD MGEAEIDIQPL
Sbjct  254   LGQQSMKTRVIKNNLNPVWNERLMLSIPDTVPPLKVLVYDKDTFTPDDHMGEAEIDIQPL  313

Query  1291  LVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEI  1470
             + AA+A ENS   + +Q        A  +N +             D  I L  G V+QEI
Sbjct  314   VYAAQAYENSKTTETIQLGKWL---ATNDNTL-----------VKDSVITLTHGKVKQEI  359

Query  1471  VLKLQNVERGVLEVELECVSLSQ  1539
              L+LQNVERGVLE+ELECV LSQ
Sbjct  360   TLRLQNVERGVLEIELECVPLSQ  382



>gb|KGN52311.1| hypothetical protein Csa_5G623740 [Cucumis sativus]
Length=380

 Score =   396 bits (1017),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 217/367 (59%), Positives = 261/367 (71%), Gaps = 32/367 (9%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RLK L   SGN++CADCGSPDPKWVS+S G FICIKCSGVHRSLGVHISKV+SVKLD+WT
Sbjct  28    RLKDLTAHSGNKYCADCGSPDPKWVSVSFGAFICIKCSGVHRSLGVHISKVLSVKLDDWT  87

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              E+VD L  +GGN   N KYE   P+  KK KPDSS EER DFIR+KYEL QF N D   
Sbjct  88    DEEVDALMSVGGNTAVNKKYEVCIPDGNKKPKPDSSIEERFDFIRKKYELLQFTNLDDQF  147

Query  853   MCPLP-------------ttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRK  993
              CP P             +++ ++   + +        +G AFRNSW +K+S+ +   + 
Sbjct  148   FCPFPPPQKRNSLLSHSTSSTDANQERRNYEKVPTKTRIGSAFRNSWGRKDSEHKNCKKG  207

Query  994   -----SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLN  1158
                  S+SMAGM+EF+GLIKVNVVRGTNLA+RD+V+SDPYVIL+LG+QSVKTRVIK++LN
Sbjct  208   NALVLSSSMAGMIEFVGLIKVNVVRGTNLAVRDVVTSDPYVILSLGHQSVKTRVIKSSLN  267

Query  1159  PVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPV  1338
             PVWNE LMLSIP+ +PPLKV V+DKDTF+TDDFMGEAEIDI PLL AARA E ST  +P+
Sbjct  268   PVWNESLMLSIPDYIPPLKVLVYDKDTFSTDDFMGEAEIDINPLLTAARACERSTICEPM  327

Query  1339  QQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVEL  1518
             Q        A  EN +             DG I+L +G +RQ+I LKLQNVERGVLE+EL
Sbjct  328   QLGKWV---ASKENTL-----------AKDGIISLVDGKIRQDISLKLQNVERGVLEMEL  373

Query  1519  ECVSLSQ  1539
             ECV LSQ
Sbjct  374   ECVPLSQ  380



>ref|XP_006854752.1| hypothetical protein AMTR_s00063p00013660, partial [Amborella 
trichopoda]
 gb|ERN16219.1| hypothetical protein AMTR_s00063p00013660, partial [Amborella 
trichopoda]
Length=352

 Score =   394 bits (1011),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 217/365 (59%), Positives = 269/365 (74%), Gaps = 32/365 (9%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL+ LM + GN+ CADCGS DPKWVS++LGVFICIKCSG+HRSLGVHISKV+S KLDEWT
Sbjct  4     RLEDLMCQPGNRLCADCGSADPKWVSVNLGVFICIKCSGIHRSLGVHISKVLSAKLDEWT  63

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVD L  MGGN  ANLKYEA+ P N++K +P++ST ER+D+I+RKYELQ+F +S++ +
Sbjct  64    EEQVDSLVAMGGNVAANLKYEASLPPNFRKPRPEASTRERSDYIKRKYELQEFSSSNVKI  123

Query  853   MCPLPttsssstsE----------------KKHSGGHRIHGLGFAFRNSWRKKESDTQKA  984
                 P  +SSS  +                +K +   R  GLG AFRNSWR+KES+ QK 
Sbjct  124   APSAPLITSSSCQKASSSRNLGSSQDKKQVEKQNPNARFQGLGHAFRNSWRRKESE-QKP  182

Query  985   TRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPV  1164
               K NS  GMVEF+GLIKVNV+RGT LAIRD+++SDPYVILT+G+QS+KTRVI++NLNPV
Sbjct  183   PMK-NSTMGMVEFVGLIKVNVIRGTKLAIRDVMTSDPYVILTIGHQSMKTRVIRSNLNPV  241

Query  1165  WNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQ  1344
             WNEQ++LSIPE VPPLK+ V+DKDTF+TDD MGEAEIDIQPL+ AA+A ENST  D +Q 
Sbjct  242   WNEQILLSIPEPVPPLKLLVYDKDTFSTDDHMGEAEIDIQPLVSAAKAYENSTITDSMQL  301

Query  1345  QPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELEC  1524
                    A  +N +             D  I+L +G V+QEI L+LQNVERG LE+ELEC
Sbjct  302   GKWL---ASEDNTL-----------IKDSVISLVDGKVKQEITLRLQNVERGELEIELEC  347

Query  1525  VSLSQ  1539
             V LSQ
Sbjct  348   VPLSQ  352



>ref|XP_003541598.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Glycine max]
Length=368

 Score =   394 bits (1012),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 221/377 (59%), Positives = 281/377 (75%), Gaps = 32/377 (8%)
 Frame = +1

Query  457   PQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHI  636
             P+ +D  + P+ R+  LM  +GN+FCADCG+P+P+WVS SLGVFICIKCSG+HRSLGVHI
Sbjct  8     PETKDV-ICPQKRIADLMHHAGNKFCADCGTPEPRWVSSSLGVFICIKCSGIHRSLGVHI  66

Query  637   SKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKY  816
             SKV+S+KLDEWT EQVD L ++GGN + N KYEA  P N +K KP SS EER++FIRRKY
Sbjct  67    SKVLSLKLDEWTDEQVDALAKLGGNTLLNKKYEACLPSNIRKPKPHSSIEERSEFIRRKY  126

Query  817   ELQQFVNSDLHLMCPL---------------PttsssstsEKKHSGGHRI-HGLGFAFRN  948
             E+QQFV+ D +L CP+                T+  +S  +KK S   +  H +G AFRN
Sbjct  127   EMQQFVDCDDNLSCPIIPSQGRSISLALAQSSTSYYNSFMDKKPSEKQQSKHRIGNAFRN  186

Query  949   SWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSV  1128
             SW +K+S+  KA +KS S+AGMVEF+GLIKVNVV+GT+LAIRD+++SDPYVIL+LG+QSV
Sbjct  187   SWGRKDSE-HKAAKKSTSLAGMVEFVGLIKVNVVKGTHLAIRDVMTSDPYVILSLGHQSV  245

Query  1129  KTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARA  1308
             KTRVIK+NLNPVWNE LMLSIPEN+PPLKV V+DKDTF+TDDFMGEAEIDIQPL++AA+A
Sbjct  246   KTRVIKSNLNPVWNESLMLSIPENIPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVIAAKA  305

Query  1309  SENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQN  1488
              E S  N+ +Q        A  +N +             DG I+L EG ++QEI ++LQN
Sbjct  306   YEKSNINESMQLGKFV---ASNDNTL-----------VRDGIISLDEGKIKQEISVRLQN  351

Query  1489  VERGVLEVELECVSLSQ  1539
             +ERG LE+ELECV L+Q
Sbjct  352   IERGELELELECVPLTQ  368



>ref|XP_010556250.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Tarenaya hassleriana]
Length=386

 Score =   392 bits (1007),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 224/387 (58%), Positives = 277/387 (72%), Gaps = 24/387 (6%)
 Frame = +1

Query  391   SGARLYDLLQMDTSPSDSDQMEPQMQDYSLS--PRCRLKALMKESGNQFCADCGSPDPKW  564
             S A LYDLL      S++ +  PQ   +++S  PR +L+ +M++ GN++CADCGS DPKW
Sbjct  20    SDACLYDLLC-----SETPRWGPQTDLHAVSCDPREKLENMMRQCGNKYCADCGSTDPKW  74

Query  565   VSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAF  744
             VS S+GVFICIKCSGVHRSLGVHISKV+SVKLDEWT EQVD+L   GGN   N K+EA  
Sbjct  75    VSFSIGVFICIKCSGVHRSLGVHISKVLSVKLDEWTDEQVDMLMGFGGNEAVNKKFEACI  134

Query  745   PENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPL-PttsssstsEKKHSGGHRI  921
             P N KK KPDS  EER+DFIRRKYE QQF++ +    CP  P   +SS+S    S     
Sbjct  135   PNNIKKPKPDSPIEERSDFIRRKYEQQQFMDPNDGASCPYHPGRRTSSSSLNSSSSHRST  194

Query  922   HG-LGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPY  1098
                +G +FRNSW +++SD  K  +KS SMAGM+EF+GLIKVNVV+GTNLA+RD+++SDPY
Sbjct  195   KNRIGHSFRNSWGRRDSD-HKGPKKSQSMAGMIEFVGLIKVNVVKGTNLAVRDVMTSDPY  253

Query  1099  VILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEID  1278
             V L LG Q VKTRVIKNNLNPVWNE LMLSIP+++PPL+V V+DKDTF+TDDFMGEAEID
Sbjct  254   VKLALGQQFVKTRVIKNNLNPVWNETLMLSIPDHMPPLRVLVYDKDTFSTDDFMGEAEID  313

Query  1279  IQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTV  1458
             IQPL+ AA+A E S   + +Q        A  EN +             D  I+L EG V
Sbjct  314   IQPLVSAAKAYETSNIRESMQLGSWV---ASKENTL-----------VSDSIISLVEGKV  359

Query  1459  RQEIVLKLQNVERGVLEVELECVSLSQ  1539
             +Q+I L+LQ VERGVLE+ELECV L+Q
Sbjct  360   KQDITLRLQKVERGVLEIELECVPLTQ  386



>ref|XP_010556251.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Tarenaya hassleriana]
Length=382

 Score =   391 bits (1004),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 227/396 (57%), Positives = 281/396 (71%), Gaps = 26/396 (7%)
 Frame = +1

Query  370   NTEGNNVSG--ARLYDLLQMDTSPSDSDQMEPQMQDYSLS--PRCRLKALMKESGNQFCA  537
             N +   VSG  A LYDLL      S++ +  PQ   +++S  PR +L+ +M++ GN++CA
Sbjct  7     NVDPFEVSGSDACLYDLLC-----SETPRWGPQTDLHAVSCDPREKLENMMRQCGNKYCA  61

Query  538   DCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNV  717
             DCGS DPKWVS S+GVFICIKCSGVHRSLGVHISKV+SVKLDEWT EQVD+L   GGN  
Sbjct  62    DCGSTDPKWVSFSIGVFICIKCSGVHRSLGVHISKVLSVKLDEWTDEQVDMLMGFGGNEA  121

Query  718   ANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPL-PttsssstsE  894
              N K+EA  P N KK KPDS  EER+DFIRRKYE QQF++ +    CP  P   +SS+S 
Sbjct  122   VNKKFEACIPNNIKKPKPDSPIEERSDFIRRKYEQQQFMDPNDGASCPYHPGRRTSSSSL  181

Query  895   KKHSGGHRIHG-LGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAI  1071
                S        +G +FRNSW +++SD  K  +KS SMAGM+EF+GLIKVNVV+GTNLA+
Sbjct  182   NSSSSHRSTKNRIGHSFRNSWGRRDSD-HKGPKKSQSMAGMIEFVGLIKVNVVKGTNLAV  240

Query  1072  RDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttd  1251
             RD+++SDPYV L LG Q VKTRVIKNNLNPVWNE LMLSIP+++PPL+V V+DKDTF+TD
Sbjct  241   RDVMTSDPYVKLALGQQFVKTRVIKNNLNPVWNETLMLSIPDHMPPLRVLVYDKDTFSTD  300

Query  1252  dfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDG  1431
             DFMGEAEIDIQPL+ AA+A E S   + +Q        A  EN +             D 
Sbjct  301   DFMGEAEIDIQPLVSAAKAYETSNIRESMQLGSWV---ASKENTL-----------VSDS  346

Query  1432  TINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              I+L EG V+Q+I L+LQ VERGVLE+ELECV L+Q
Sbjct  347   IISLVEGKVKQDITLRLQKVERGVLEIELECVPLTQ  382



>gb|AET02273.2| ADP-ribosylation factor GTPase-activating protein AGD10 [Medicago 
truncatula]
Length=367

 Score =   390 bits (1002),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 214/381 (56%), Positives = 271/381 (71%), Gaps = 31/381 (8%)
 Frame = +1

Query  442   SDQMEPQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRS  621
             S    P  +D S + + RL  LM ++GN++CADCG+P+PKWVS SLGVFICIKCSG+HRS
Sbjct  3     SKHESPDKKDVSGTHK-RLSNLMHQAGNRYCADCGTPEPKWVSSSLGVFICIKCSGIHRS  61

Query  622   LGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDF  801
             LGVHISK+ S+KLD+W+ EQVD L ++GGN   N KYEA  P N KK KP +S EER+++
Sbjct  62    LGVHISKIASLKLDQWSDEQVDALEKLGGNTFLNKKYEACLPSNIKKPKPHTSIEERSEY  121

Query  802   IRRKYELQQFV-NSDLHLMCPL--------------PttsssstsEKKHSGGHRIHGLGF  936
             IR+KYE  QF+  SD + +CP                +  +     KK+      H +G 
Sbjct  122   IRKKYEELQFMMESDENSLCPFVPSQGRSVSLGPSSSSCYTYHIDNKKYEKALTRHHIGH  181

Query  937   AFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLG  1116
             AFR SW +K+S+  K ++KS S+AGMVEF+GLIKVNV +GT+LAIRD+V+SDPYVIL+LG
Sbjct  182   AFRKSWTRKDSE-HKCSKKSTSLAGMVEFVGLIKVNVRKGTHLAIRDVVTSDPYVILSLG  240

Query  1117  NQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLV  1296
             +QSVKTRVI+NNLNPVWNE LMLSIPEN+PPLKV V+DKDTF+TDDFMGEAEIDIQPL++
Sbjct  241   HQSVKTRVIRNNLNPVWNESLMLSIPENIPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVL  300

Query  1297  AARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVL  1476
             AA A E ST N+ VQ +     +  T              L  DG I+L +G ++QEI +
Sbjct  301   AAIAYEKSTANESVQLEKFVESRDNT--------------LVRDGVISLEDGKIKQEISV  346

Query  1477  KLQNVERGVLEVELECVSLSQ  1539
             +LQNVERGVLE+ELECV L Q
Sbjct  347   RLQNVERGVLEIELECVPLIQ  367



>ref|XP_009135010.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Brassica rapa]
Length=398

 Score =   390 bits (1003),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 231/408 (57%), Positives = 283/408 (69%), Gaps = 26/408 (6%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKA  504
             KMSV Q+N     V        S A LYDLL  DT P  + QM+ Q    S  PR RL+ 
Sbjct  14    KMSVGQENVYPVEVPG------SRACLYDLLCSDT-PRWTLQMDLQTSSSS-DPRDRLEK  65

Query  505   LMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQV  684
             L+K+ GN++CADCGSP PKWVSL+LGVFICIKCSGVHRSLGVHISKV+SVKLDEWT +QV
Sbjct  66    LLKQPGNKYCADCGSPKPKWVSLNLGVFICIKCSGVHRSLGVHISKVLSVKLDEWTDDQV  125

Query  685   DILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPL  864
             D+L   GGN V N ++EA   +  KK KPDS+ EER+DFIR+KYEL QF++ +   +C  
Sbjct  126   DMLVGCGGNTVVNQRFEACNIDQLKKPKPDSNNEERSDFIRKKYELHQFMDPNDSDLCSH  185

Query  865   PttsssstsEKK-HSGGHRI--HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLI  1035
                S  +       S  HR   + +G A RNSW ++ESD  K T+KSNS+AGMVEF+GLI
Sbjct  186   QQPSQVNNPPASLCSSSHRSAKNRIGHALRNSWGRRESD-HKGTKKSNSLAGMVEFVGLI  244

Query  1036  KVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLK  1215
             KVNVV+GTNLA+RD+++SDPYVIL+LG QSVKTRVIKNNLNPVWNE LMLSIPE VPPLK
Sbjct  245   KVNVVKGTNLAVRDVMTSDPYVILSLGQQSVKTRVIKNNLNPVWNETLMLSIPEQVPPLK  304

Query  1216  VHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppp  1395
             V V+DKD FTTDDFMGEAEIDI+PL+ AA   E ST  +  +       K +T       
Sbjct  305   VLVYDKDKFTTDDFMGEAEIDIEPLVSAAIEYETSTIRETRRLGSWLACKEDTS------  358

Query  1396  lplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                       DG ++  E  V+Q+I L+LQ VERGVLE+++EC+ L+Q
Sbjct  359   --------VSDGIVSHEEVKVKQDISLRLQKVERGVLEIQIECLPLTQ  398



>emb|CDX74022.1| BnaA03g30250D [Brassica napus]
Length=384

 Score =   390 bits (1001),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 231/407 (57%), Positives = 281/407 (69%), Gaps = 26/407 (6%)
 Frame = +1

Query  328   MSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKAL  507
             MSV Q+N     V        S A LYDLL  DT P  + QM+ Q    S  PR RL+ L
Sbjct  1     MSVGQENVYPVEVPG------SRACLYDLLCSDT-PRWTLQMDLQTSSSS-DPRDRLEKL  52

Query  508   MKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVD  687
             +K+ GN++CADCGSP PKWVSL+LGVFICIKCSGVHRSLGVHISKV+SVKLDEWT +QVD
Sbjct  53    LKQPGNKYCADCGSPKPKWVSLNLGVFICIKCSGVHRSLGVHISKVLSVKLDEWTDDQVD  112

Query  688   ILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLP  867
             +L   GGN V N ++EA   +  KK KPDS+ EERNDFIR+KYEL QF++     +C   
Sbjct  113   MLVGCGGNTVVNQRFEACNIDQLKKPKPDSNNEERNDFIRKKYELHQFMDPKDSDLCSHQ  172

Query  868   ttsssstsEKK-HSGGHRI--HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIK  1038
               S  +       S  HR   + +G A RNSW ++ESD  K T+KSNS+AGMVEF+GLIK
Sbjct  173   QPSQVNNPPASLCSSSHRSAKNRIGHALRNSWGRRESD-HKGTKKSNSLAGMVEFVGLIK  231

Query  1039  VNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKV  1218
             VNVV+GTNLA+RD+++SDPYVIL+LG QSVKTRVIKNNLNPVWNE LMLSIPE VPPLKV
Sbjct  232   VNVVKGTNLAVRDVMTSDPYVILSLGQQSVKTRVIKNNLNPVWNETLMLSIPEQVPPLKV  291

Query  1219  HVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpppl  1398
              V+DKD FTTDDFMGEAEIDI+PL+ AA   E ST  +  +       K +T        
Sbjct  292   LVYDKDKFTTDDFMGEAEIDIEPLVSAAIEYETSTIRETRRLGSWLACKEDTS-------  344

Query  1399  plpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                      DG ++  E  V+Q+I L+LQ VERGVLE+++EC+ L+Q
Sbjct  345   -------VSDGIVSHEEVKVKQDISLRLQKVERGVLEIQIECLPLTQ  384



>ref|XP_007133773.1| hypothetical protein PHAVU_011G207700g [Phaseolus vulgaris]
 gb|ESW05767.1| hypothetical protein PHAVU_011G207700g [Phaseolus vulgaris]
Length=365

 Score =   389 bits (998),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 217/369 (59%), Positives = 270/369 (73%), Gaps = 32/369 (9%)
 Frame = +1

Query  478   LSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVK  657
             + P+ RL  LM  SGN+FCADCG+P+PKWVS SLGVFICIKCSG+HRSLGVHISKV+S+K
Sbjct  14    ICPQRRLTNLMHHSGNKFCADCGTPEPKWVSSSLGVFICIKCSGIHRSLGVHISKVLSLK  73

Query  658   LDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVN  837
             LDEWT EQVD L ++GGN + N KYEA  P N +K KP SS EER++FIRRKYE+QQF+ 
Sbjct  74    LDEWTDEQVDALAKLGGNTLLNKKYEACLPSNMRKPKPHSSIEERSEFIRRKYEMQQFMG  133

Query  838   SDLHLMCPLPttsssstsEKKHSGGHRIHG---------------LGFAFRNSWRKKESD  972
              D H+   +  +   S S  + S  +  H                +G AFRNSW +K  D
Sbjct  134   CDDHMAGTIVQSQGRSISLAQCSSSY-YHAFMDKKPSERFPSKTRIGSAFRNSWGRK--D  190

Query  973   TQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNN  1152
             ++  ++KS S+AGMVEF+GLIKVNVV+GT+LA+RD+++SDPYVIL+LG+QSVKTRVIKNN
Sbjct  191   SEHKSKKSTSLAGMVEFVGLIKVNVVKGTHLAVRDVMTSDPYVILSLGHQSVKTRVIKNN  250

Query  1153  LNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKND  1332
             LNPVWNE LMLSIPEN+PPLKV V+DKDTF+TDDFMGEAEIDIQPL++AA+A E ST N+
Sbjct  251   LNPVWNESLMLSIPENIPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVIAAKAYEKSTINE  310

Query  1333  PVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEV  1512
              +Q       K  T              L  DG I+L EG ++QEI ++LQN+ERG LE+
Sbjct  311   SMQLGKFVASKDNT--------------LVRDGIISLDEGKIKQEISVRLQNIERGELEL  356

Query  1513  ELECVSLSQ  1539
             ELECV L+Q
Sbjct  357   ELECVPLTQ  365



>ref|XP_006598113.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Glycine max]
Length=368

 Score =   387 bits (995),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 217/373 (58%), Positives = 269/373 (72%), Gaps = 37/373 (10%)
 Frame = +1

Query  478   LSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVK  657
             + P+ RL+ LM  +GN+FCADCG+ +P+WVS S GVFICIKCSG+HRSLGVHISKV+S+K
Sbjct  14    ICPQKRLENLMHHAGNKFCADCGTTEPRWVSSSFGVFICIKCSGIHRSLGVHISKVLSLK  73

Query  658   LDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVN  837
             LDEWT EQVD L ++GGN + N KYEA  P N +K KP SS EER++FIRRKYE+QQF+ 
Sbjct  74    LDEWTDEQVDALAKLGGNTLLNKKYEACLPSNIRKPKPHSSIEERSEFIRRKYEMQQFIG  133

Query  838   SDLHLMCPLPttssssts-------------------EKKHSGGHRIHGLGFAFRNSWRK  960
              D  L CP+  +   S S                    +KH   HRI   G  FRNSW +
Sbjct  134   YDDGLSCPIVPSQGRSISLALAQSSTSYYNSFMDNKPSEKHQSKHRI---GNTFRNSWGR  190

Query  961   KESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRV  1140
             K+S+  K+ +KS S+AGMVEF+GLIKVNVV+GT+LAIRD+++SDPYVIL+LG+QSVKTRV
Sbjct  191   KDSE-HKSAKKSTSLAGMVEFVGLIKVNVVKGTHLAIRDVMTSDPYVILSLGHQSVKTRV  249

Query  1141  IKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENS  1320
             IK+NLNPVWNE LMLSIPEN+PPLKV V+DKDTF+TDDFMGEAEIDIQPL++AA+A E  
Sbjct  250   IKSNLNPVWNESLMLSIPENIPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVIAAKAYEKL  309

Query  1321  TKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERG  1500
               N+ +Q       K  T              L  DG I+L EG ++QEI L+LQN+ERG
Sbjct  310   NINESMQLGKFVASKDNT--------------LVRDGIISLDEGKIKQEISLRLQNIERG  355

Query  1501  VLEVELECVSLSQ  1539
              LE+ELECV L+Q
Sbjct  356   ELELELECVPLTQ  368



>ref|XP_008465595.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Cucumis melo]
 ref|XP_008465599.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Cucumis melo]
Length=416

 Score =   387 bits (994),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 232/424 (55%), Positives = 285/424 (67%), Gaps = 48/424 (11%)
 Frame = +1

Query  370   NTEGNNVSGARLYDLLQMDTS---------PSDSD-QMEPQMQDYSLS-PRCRLKALMKE  516
             N++ N VSGA L+DLL  D+          PSDS+ Q     +D  LS P+ RL+ L+++
Sbjct  7     NSDSNGVSGACLFDLLFPDSEMQGWDWSRMPSDSETQRWNWKKDQQLSGPQKRLEDLLQQ  66

Query  517   SGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILT  696
             SGN FCADCGSPDPKWVSL+LGVFICIKCSGVHRSLGVHISKV SVKLD WT EQV+  T
Sbjct  67    SGNMFCADCGSPDPKWVSLNLGVFICIKCSGVHRSLGVHISKVFSVKLDNWTDEQVNTFT  126

Query  697   EMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLPtts  876
              MGGN   N KYEA   +  +K KPDS  EER DFIRRKYEL QF N+          + 
Sbjct  127   SMGGNIDVNRKYEAGIIDLSRKPKPDSCIEERFDFIRRKYELLQFYNASSSQSSSDNNSF  186

Query  877   sssts---------------EKKHSGGHRI-HGLGFAFRNSWRKKESDTQKATRKSNSM-  1005
             S  +S               +K+H       H +G AFRNS  +++ D      + +S+ 
Sbjct  187   SKRSSSCPQSSNSSSKNSSHDKRHYEKQATRHRIGHAFRNSRGRRDGDHHHKNFEKSSLA  246

Query  1006  ------AGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVW  1167
                   AGMVEF+GLIKVNVVRGTNLA+RD+V+SDPYVIL+LG+QSV+TRVIKNNLNPVW
Sbjct  247   VSRQASAGMVEFVGLIKVNVVRGTNLAVRDVVTSDPYVILSLGHQSVRTRVIKNNLNPVW  306

Query  1168  NEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQ  1347
             NE LMLSIPE++PPLK+ V+DKDTF+TDDFMGEAEIDIQPL+ A +A E ST ++ +Q  
Sbjct  307   NESLMLSIPEHIPPLKLLVYDKDTFSTDDFMGEAEIDIQPLVAATKAYEKSTIDESMQLG  366

Query  1348  PRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECV  1527
                   A  +N +             DG INL +G VRQ+I L+LQNVERG+LE+ELEC+
Sbjct  367   KWV---ASNDNTL-----------VKDGIINLVDGKVRQDISLRLQNVERGILEIELECI  412

Query  1528  SLSQ  1539
              L+Q
Sbjct  413   PLTQ  416



>ref|XP_007148958.1| hypothetical protein PHAVU_005G028800g [Phaseolus vulgaris]
 gb|ESW20952.1| hypothetical protein PHAVU_005G028800g [Phaseolus vulgaris]
Length=401

 Score =   384 bits (987),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 221/422 (52%), Positives = 292/422 (69%), Gaps = 39/422 (9%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKA  504
             +MSVQ +N       NT G + SG+ LYDL     +PS +  +  +    S+ P+ RL +
Sbjct  2     EMSVQPENP------NTNGISGSGSCLYDLF-CSENPSFNAHVAKEQWMSSVGPQKRLDS  54

Query  505   LMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQV  684
             LM+++GN++CADCG+ +PKWVSL++GVFICIKCSG+HRSLGVHISKV+S+ LDEWT EQV
Sbjct  55    LMRQAGNRYCADCGALEPKWVSLNIGVFICIKCSGIHRSLGVHISKVLSLNLDEWTDEQV  114

Query  685   DILTEMGGNNVANLKYEAAFP-ENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCP  861
             D L ++GGN + N KYE   P  N +K +PDSS EER+DFIRRKYE  QF +++ ++ CP
Sbjct  115   DALVKLGGNTLVNKKYEVHLPINNIRKPRPDSSIEERSDFIRRKYEYLQFSDTEDNMSCP  174

Query  862   L--------------PttsssstsEKKHSGGH--RIHGLGFAFRNSWRKKESDTQKATRK  993
                              + +  T EKKH        H +G  FRNS  +K+    +A +K
Sbjct  175   FIPPPHSGSSSDSQISYSRNPFTREKKHCDNKPPNRHFIGRTFRNSRGRKDCHDFRA-KK  233

Query  994   SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNE  1173
             +NS+AGM EF+GLIKVNVV+GTNLA+RD++SSDPYV ++LG+QSVKTRVIKNNLNP+WNE
Sbjct  234   TNSLAGMTEFVGLIKVNVVKGTNLAVRDVMSSDPYVTISLGHQSVKTRVIKNNLNPIWNE  293

Query  1174  QLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPR  1353
              LMLSIP+ +PPLK+ V DKDTF+TDDFMGEAEIDIQPL+ AA A E S+ N+  +    
Sbjct  294   SLMLSIPDCIPPLKIIVLDKDTFSTDDFMGEAEIDIQPLVSAAMAYEKSSVNESTEVGKW  353

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                 A  +N++             DG I+L +G ++QEI L+LQ+VERGVLE+ELECV L
Sbjct  354   I---ASGDNSL-----------LKDGIISLEDGQIKQEISLRLQHVERGVLEIELECVPL  399

Query  1534  SQ  1539
             +Q
Sbjct  400   TQ  401



>gb|ADN34207.1| DNA binding protein [Cucumis melo subsp. melo]
Length=357

 Score =   383 bits (983),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 213/362 (59%), Positives = 253/362 (70%), Gaps = 36/362 (10%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RLK L   SGN++CADCGSPDPKWVSLS G FICIKCSGVHRSLGVHISKV+SVKLD+WT
Sbjct  19    RLKDLTAHSGNKYCADCGSPDPKWVSLSFGAFICIKCSGVHRSLGVHISKVLSVKLDDWT  78

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVD L  +GGN   N KYE   P+  KK KPDSS EER DFIR+KYEL QF + D   
Sbjct  79    DEQVDALMSIGGNTAVNKKYEVCIPDGNKKPKPDSSIEERFDFIRKKYELLQFTSLDDQF  138

Query  853   MCPLPttsssstsEKKHSGGHRIHG-------------LGFAFRNSWRKKESDTQKATRK  993
              CP P     ++S    +    ++              +G AFRNSW +K+S+  K  +K
Sbjct  139   FCPFPPPQKRNSSLSHSTSSTDVNQERRNYEKVPTKTRIGSAFRNSWGRKDSE-HKNCKK  197

Query  994   SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNE  1173
              N++AGM+EF+GLIKVNVVRGTNLA+RD+V+SDPY        SVKTRVIK++LNPVWNE
Sbjct  198   GNALAGMIEFVGLIKVNVVRGTNLAVRDVVTSDPY--------SVKTRVIKSSLNPVWNE  249

Query  1174  QLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPR  1353
              LMLSIP+ +PPLKV V+DKDTF+TDDFMGEAEIDI PLL AARA E ST  +P+Q    
Sbjct  250   SLMLSIPDYIPPLKVLVYDKDTFSTDDFMGEAEIDINPLLTAARACERSTICEPMQLGKW  309

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                 A  EN +             DG I+L +G +RQ+I LKLQNVERGVLE+ELECV+L
Sbjct  310   V---ASKENTL-----------AKDGIISLVDGKIRQDISLKLQNVERGVLEMELECVAL  355

Query  1534  SQ  1539
             SQ
Sbjct  356   SQ  357



>ref|XP_009411745.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Musa acuminata subsp. malaccensis]
Length=359

 Score =   380 bits (976),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 206/364 (57%), Positives = 260/364 (71%), Gaps = 29/364 (8%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S +P  RLK L  +  N+FCADC SPDPKW+SL+LGVFICIKCSGVHRSLGVH+SKV+S+
Sbjct  16    SSTPLRRLKILSNQPSNRFCADCDSPDPKWISLNLGVFICIKCSGVHRSLGVHVSKVLSM  75

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
             KLDEWT EQVD LT+ GGN+  N+ YEA  P   +K +PDSS EER DFIRRKYELQQF 
Sbjct  76    KLDEWTDEQVDSLTDGGGNSAINIIYEAFLPNYIQKPRPDSSIEERTDFIRRKYELQQFS  135

Query  835   NSDLHLMCPLPt---------tsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKAT  987
               +  +   +            ++    EK+ +G    +G G AFRNS R+KES+ ++  
Sbjct  136   TFNAQVGSEISAGDNTSFQNNAANIKNFEKQQTGSR--YGRGHAFRNSCRRKESEHKEVK  193

Query  988   RKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVW  1167
             +    M GMVEF+GL+KVN++RGTNLA+RD+++SDPYVIL LG+QS+KTRVIK+NLNPVW
Sbjct  194   K----MMGMVEFVGLVKVNIIRGTNLAVRDVITSDPYVILNLGHQSMKTRVIKSNLNPVW  249

Query  1168  NEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQ  1347
             NE+LMLSIP+ +PPLK+ V+DKDTF+TDD MGEAEIDIQPLL AA+A EN+   +P+Q  
Sbjct  250   NEKLMLSIPDPIPPLKLQVYDKDTFSTDDRMGEAEIDIQPLLAAAQAYENTNIFEPMQLG  309

Query  1348  PRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECV  1527
                    +T              L  D  I+L +G V+QEI L+LQNVERG LE+ELECV
Sbjct  310   KWLATNDDT--------------LVKDSVISLVDGKVKQEITLRLQNVERGELEIELECV  355

Query  1528  SLSQ  1539
              L+Q
Sbjct  356   PLTQ  359



>ref|XP_007148959.1| hypothetical protein PHAVU_005G028800g [Phaseolus vulgaris]
 gb|ESW20953.1| hypothetical protein PHAVU_005G028800g [Phaseolus vulgaris]
Length=400

 Score =   381 bits (979),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 222/422 (53%), Positives = 292/422 (69%), Gaps = 40/422 (9%)
 Frame = +1

Query  325   KMSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEPQMQDYSLSPRCRLKA  504
             +MSVQ +N       NT G + SG+ LYDL     +PS +  +  + Q  S  P+ RL +
Sbjct  2     EMSVQPENP------NTNGISGSGSCLYDLF-CSENPSFNAHVAKE-QWMSSGPQKRLDS  53

Query  505   LMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQV  684
             LM+++GN++CADCG+ +PKWVSL++GVFICIKCSG+HRSLGVHISKV+S+ LDEWT EQV
Sbjct  54    LMRQAGNRYCADCGALEPKWVSLNIGVFICIKCSGIHRSLGVHISKVLSLNLDEWTDEQV  113

Query  685   DILTEMGGNNVANLKYEAAFP-ENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCP  861
             D L ++GGN + N KYE   P  N +K +PDSS EER+DFIRRKYE  QF +++ ++ CP
Sbjct  114   DALVKLGGNTLVNKKYEVHLPINNIRKPRPDSSIEERSDFIRRKYEYLQFSDTEDNMSCP  173

Query  862   L--------------PttsssstsEKKHSGGH--RIHGLGFAFRNSWRKKESDTQKATRK  993
                              + +  T EKKH        H +G  FRNS  +K+    +A +K
Sbjct  174   FIPPPHSGSSSDSQISYSRNPFTREKKHCDNKPPNRHFIGRTFRNSRGRKDCHDFRA-KK  232

Query  994   SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNE  1173
             +NS+AGM EF+GLIKVNVV+GTNLA+RD++SSDPYV ++LG+QSVKTRVIKNNLNP+WNE
Sbjct  233   TNSLAGMTEFVGLIKVNVVKGTNLAVRDVMSSDPYVTISLGHQSVKTRVIKNNLNPIWNE  292

Query  1174  QLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPR  1353
              LMLSIP+ +PPLK+ V DKDTF+TDDFMGEAEIDIQPL+ AA A E S+ N+  +    
Sbjct  293   SLMLSIPDCIPPLKIIVLDKDTFSTDDFMGEAEIDIQPLVSAAMAYEKSSVNESTEVGKW  352

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                 A  +N++             DG I+L +G ++QEI L+LQ+VERGVLE+ELECV L
Sbjct  353   I---ASGDNSL-----------LKDGIISLEDGQIKQEISLRLQHVERGVLEIELECVPL  398

Query  1534  SQ  1539
             +Q
Sbjct  399   TQ  400



>ref|XP_004142404.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
 ref|XP_004169025.1| PREDICTED: LOW QUALITY PROTEIN: probable ADP-ribosylation factor 
GTPase-activating protein AGD11-like [Cucumis sativus]
Length=357

 Score =   380 bits (975),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 211/362 (58%), Positives = 253/362 (70%), Gaps = 36/362 (10%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RLK L   SGN++CADCGSPDPKWVS+S G FICIKCSGVHRSLGVHISKV+SVKLD+WT
Sbjct  19    RLKDLTAHSGNKYCADCGSPDPKWVSVSFGAFICIKCSGVHRSLGVHISKVLSVKLDDWT  78

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              E+VD L  +GGN   N KYE   P+  KK KPDSS EER DFIR+KYEL QF N D   
Sbjct  79    DEEVDALMSVGGNTAVNKKYEVCIPDGNKKPKPDSSIEERFDFIRKKYELLQFTNLDDQF  138

Query  853   MCPLP-------------ttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRK  993
              CP P             +++ ++   + +        +G AFRNSW +K+S+  K  +K
Sbjct  139   FCPFPPPQKRNSLLSHSTSSTDANQERRNYEKVPTKTRIGSAFRNSWGRKDSE-HKNCKK  197

Query  994   SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNE  1173
              N++AGM+EF+GLIKVNVVRGTNLA+RD+V+SDPY        SVKTRVIK++LNPVWNE
Sbjct  198   GNALAGMIEFVGLIKVNVVRGTNLAVRDVVTSDPY--------SVKTRVIKSSLNPVWNE  249

Query  1174  QLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPR  1353
              LMLSIP+ +PPLKV V+DKDTF+TDDFMGEAEIDI PLL AARA E ST  +P+Q    
Sbjct  250   SLMLSIPDYIPPLKVLVYDKDTFSTDDFMGEAEIDINPLLTAARACERSTICEPMQLGKW  309

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                 A  EN +             DG I+L +G +RQ+I LKLQNVERGVLE+ELECV L
Sbjct  310   V---ASKENTL-----------AKDGIISLVDGKIRQDISLKLQNVERGVLEMELECVPL  355

Query  1534  SQ  1539
             SQ
Sbjct  356   SQ  357



>gb|EAY77240.1| hypothetical protein OsI_05214 [Oryza sativa Indica Group]
Length=381

 Score =   379 bits (972),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 205/349 (59%), Positives = 259/349 (74%), Gaps = 19/349 (5%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL+ L+ +  N+ CADCG+PDPKWVSL+ GVFICIKCSG HRSLGVHISKVVSVKLDEWT
Sbjct  52    RLEHLLNQPANKICADCGAPDPKWVSLTFGVFICIKCSGAHRSLGVHISKVVSVKLDEWT  111

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVDIL + GGN   N+ YEA  PENY K + D S+E RNDF+RRKYELQQF+ S+  L
Sbjct  112   DEQVDILADSGGNAAVNMIYEAFIPENYMKPRQDCSSEGRNDFVRRKYELQQFL-SNTQL  170

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
              C     S  + +  +HS  +R HGLG AFRNSWR+KE ++ K+ +K+  + GMVEF+GL
Sbjct  171   TC-YSQKSGKNHNRVQHSSSNR-HGLGHAFRNSWRRKEHES-KSVKKTVEI-GMVEFVGL  226

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             IKVNV+RGTNLA+RDM+SSDPYVIL LG+QS+KT+VIK++LNPVWNE+++LSIP+ +P L
Sbjct  227   IKVNVIRGTNLAVRDMMSSDPYVILNLGHQSMKTKVIKSSLNPVWNERILLSIPDPIPML  286

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+DKDTFTTDD MGEAEI+IQPL+ AA+A E S   D  Q      K+         
Sbjct  287   KLQVYDKDTFTTDDRMGEAEINIQPLVAAAKAYETSVVADTAQLNRWLAKEG--------  338

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                     +  D  I++ +G V+QE+ ++LQNVERG LE+ELECV L+Q
Sbjct  339   ------IWIQKDSAISIIDGKVKQEVTVRLQNVERGHLEMELECVPLTQ  381



>ref|NP_001045411.1| Os01g0951100 [Oryza sativa Japonica Group]
 dbj|BAB86206.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF07325.1| Os01g0951100 [Oryza sativa Japonica Group]
 gb|EAZ14845.1| hypothetical protein OsJ_04773 [Oryza sativa Japonica Group]
Length=381

 Score =   379 bits (972),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 205/349 (59%), Positives = 259/349 (74%), Gaps = 19/349 (5%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL+ L+ +  N+ CADCG+PDPKWVSL+ GVFICIKCSG HRSLGVHISKVVSVKLDEWT
Sbjct  52    RLEHLLNQPANKICADCGAPDPKWVSLTFGVFICIKCSGAHRSLGVHISKVVSVKLDEWT  111

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVDIL + GGN   N+ YEA  PENY K + D S+E RNDF+RRKYELQQF+ S+  L
Sbjct  112   DEQVDILADSGGNAAVNMIYEAFIPENYMKPRQDCSSEGRNDFVRRKYELQQFL-SNTQL  170

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
              C     S  + +  +HS  +R HGLG AFRNSWR+KE ++ K+ +K+  + GMVEF+GL
Sbjct  171   TC-YSQKSGKNHNRVQHSSSNR-HGLGHAFRNSWRRKEHES-KSVKKTVEI-GMVEFVGL  226

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             IKVNV+RGTNLA+RDM+SSDPYVIL LG+QS+KT+VIK++LNPVWNE+++LSIP+ +P L
Sbjct  227   IKVNVIRGTNLAVRDMMSSDPYVILNLGHQSMKTKVIKSSLNPVWNERILLSIPDPIPML  286

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+DKDTFTTDD MGEAEI+IQPL+ AA+A E S   D  Q      K+         
Sbjct  287   KLQVYDKDTFTTDDRMGEAEINIQPLVAAAKAYETSVVADTAQLNRWLAKEG--------  338

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                     +  D  I++ +G V+QE+ ++LQNVERG LE+ELECV L+Q
Sbjct  339   ------IWIQKDSAISIIDGKVKQEVTVRLQNVERGHLEMELECVPLTQ  381



>ref|XP_004962220.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Setaria italica]
Length=381

 Score =   377 bits (968),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 197/353 (56%), Positives = 257/353 (73%), Gaps = 17/353 (5%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             + R  L+ L+ +  N+FCADCG PDPKW +L  G FICIKCSG HRSLGVHISKV+SV L
Sbjct  46    TAREMLECLLNQPANKFCADCGIPDPKWAALPFGAFICIKCSGTHRSLGVHISKVISVNL  105

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEWT E+V+ L E GGN+V N +YEA  PEN KKIK + STEERNDFIR+KY+ QQFV  
Sbjct  106   DEWTDEEVNCLAESGGNSVVNARYEAFLPEN-KKIKQECSTEERNDFIRKKYQFQQFV-C  163

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
             D    CPLP    +   + +    +R HG G AFRNSWRKK+SD +   + S+   GM+E
Sbjct  164   DPQFSCPLPLHKKNVPDKNQQHNSNR-HGFGHAFRNSWRKKDSDNKGLKKMSD--VGMIE  220

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             F+GL+KVN+V+GT+LA+RD++SSDPYV++ LG+QS+KT+VIKN LNP+WNE+LMLSIP+ 
Sbjct  221   FVGLVKVNIVKGTDLAVRDVMSSDPYVMIILGHQSMKTKVIKNTLNPIWNERLMLSIPDP  280

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
             +PPLK+ VFDKDTF++DD MGEAE+DI+PL+ A +  ENST    + +     + + +E+
Sbjct  281   IPPLKLQVFDKDTFSSDDRMGEAEVDIRPLIAATKEHENST----ITELTELYRWSASED  336

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             +           L  D  I++A G V+QEI LKLQNVERG +E+E+ECV LSQ
Sbjct  337   S--------NGVLAKDSVISIANGKVKQEITLKLQNVERGEVEIEIECVPLSQ  381



>ref|XP_004143816.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
Length=416

 Score =   378 bits (971),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 230/424 (54%), Positives = 282/424 (67%), Gaps = 48/424 (11%)
 Frame = +1

Query  370   NTEGNNVSGARLYDLLQMDTS---------PSDSD-QMEPQMQDYSLS-PRCRLKALMKE  516
             N++ N VSGA L+DLL  D+          PSDS+ Q     +D  LS P+ RL+ L+++
Sbjct  7     NSDSNGVSGACLFDLLFPDSEMQGWDWSRMPSDSETQRWNWKKDQRLSGPQKRLEDLLQQ  66

Query  517   SGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILT  696
             SGN FCADCGSPDPKWVSL+LGVFICIKCSGVHRSLGVH+SKV SVKLD WT EQVD   
Sbjct  67    SGNMFCADCGSPDPKWVSLNLGVFICIKCSGVHRSLGVHVSKVFSVKLDNWTDEQVDTFM  126

Query  697   EMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLPtts  876
              MGGN   N K+EA   +  +K KPDS  EER DFIRRKYEL QF N+          + 
Sbjct  127   SMGGNTDINRKFEAGIIDLNRKPKPDSCIEERFDFIRRKYELLQFYNASSSQNSSDNNSL  186

Query  877   sssts---------------EKKHSGGHRI-HGLGFAFRNSWRKKESDTQKATRKSNS--  1002
             S  +S               +K+H       H +G AFRNS  +++ D      + +S  
Sbjct  187   SKRSSSCSQSSNSSSKNGSHDKRHYEKQATRHRVGHAFRNSRGRRDGDHNHRNFERSSPP  246

Query  1003  -----MAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVW  1167
                   AGMVEF+GL+KVNVV+G NLA+RD+V+SDPYVIL+LG+QSV+TRVIKNNLNPVW
Sbjct  247   VSRQASAGMVEFVGLVKVNVVKGRNLAVRDVVTSDPYVILSLGHQSVRTRVIKNNLNPVW  306

Query  1168  NEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQ  1347
             NE LMLSIPE++PPLKV V+DKDTFTTDDFMGEAEIDIQPL+ A +A E ST ++ +Q  
Sbjct  307   NESLMLSIPEHIPPLKVLVYDKDTFTTDDFMGEAEIDIQPLVSATKAYEKSTIDESMQLG  366

Query  1348  PRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECV  1527
                   A  +N +             DG INL +G VRQ+I L+LQNVERGVLE+ELEC+
Sbjct  367   KWV---ASNDNTL-----------VKDGIINLVDGKVRQDISLRLQNVERGVLEIELECI  412

Query  1528  SLSQ  1539
              L+Q
Sbjct  413   PLTQ  416



>gb|AFW77826.1| putative calcium-dependent lipid-binding (CaLB domain) family 
protein [Zea mays]
Length=334

 Score =   374 bits (961),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 195/349 (56%), Positives = 251/349 (72%), Gaps = 17/349 (5%)
 Frame = +1

Query  496   LKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTH  675
             L+ L+ +  N+ CADCGSPDPKWV+L  G FICIKCSG HRSLGVHISKV+SV LDEWT 
Sbjct  2     LEYLLNQPANKICADCGSPDPKWVALPFGTFICIKCSGTHRSLGVHISKVISVNLDEWTD  61

Query  676   EQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLM  855
             ++V+ L E GGN+V N +YEA  PEN KK+K D STEERNDFIR+KY+ QQFV  D    
Sbjct  62    DEVNCLAESGGNSVVNSRYEAFLPEN-KKLKQDCSTEERNDFIRKKYQFQQFV-CDPQFS  119

Query  856   CPLPttsssstsEKKHSGGHRI-HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
             CPLP     +  +K H   +   +G G  FRNSWRKK+SD++   + S+   GM+EF+GL
Sbjct  120   CPLPLNRKHAPPDKNHQQHNSSKYGFGHTFRNSWRKKDSDSKSLKKMSD--VGMIEFVGL  177

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KVN+V+GT+LA+RD++SSDPYV++ LG+QS+KT+VIKN LNP+WNE+LMLSIP+ +PPL
Sbjct  178   VKVNIVKGTDLAVRDVMSSDPYVLIHLGHQSMKTKVIKNTLNPIWNERLMLSIPDPIPPL  237

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ VFDKDTF++DD MGEAE+DI+PL+ A +  ENST  +             TE     
Sbjct  238   KLQVFDKDTFSSDDRMGEAEVDIRPLIAATKEHENSTITE------------STELYRWS  285

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                     L  D  I++A G V+QEI L+LQNVERG +E+E+ECV LSQ
Sbjct  286   ASEDSNGVLAKDSVISVASGKVKQEITLRLQNVERGEVEIEIECVPLSQ  334



>ref|XP_008647442.1| PREDICTED: uncharacterized protein LOC100216740 isoform X1 [Zea 
mays]
 gb|ACF80288.1| unknown [Zea mays]
 gb|AFW77825.1| putative calcium-dependent lipid-binding (CaLB domain) family 
protein [Zea mays]
Length=385

 Score =   374 bits (961),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 198/373 (53%), Positives = 264/373 (71%), Gaps = 31/373 (8%)
 Frame = +1

Query  424   DTSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKC  603
             DT P+++ +M              L+ L+ +  N+ CADCGSPDPKWV+L  G FICIKC
Sbjct  43    DTDPANAREM--------------LEYLLNQPANKICADCGSPDPKWVALPFGTFICIKC  88

Query  604   SGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSST  783
             SG HRSLGVHISKV+SV LDEWT ++V+ L E GGN+V N +YEA  PEN KK+K D ST
Sbjct  89    SGTHRSLGVHISKVISVNLDEWTDDEVNCLAESGGNSVVNSRYEAFLPEN-KKLKQDCST  147

Query  784   EERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsEKKHSGGHRI-HGLGFAFRNSWRK  960
             EERNDFIR+KY+ QQFV  D    CPLP     +  +K H   +   +G G  FRNSWRK
Sbjct  148   EERNDFIRKKYQFQQFV-CDPQFSCPLPLNRKHAPPDKNHQQHNSSKYGFGHTFRNSWRK  206

Query  961   KESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRV  1140
             K+SD++   + S+   GM+EF+GL+KVN+V+GT+LA+RD++SSDPYV++ LG+QS+KT+V
Sbjct  207   KDSDSKSLKKMSD--VGMIEFVGLVKVNIVKGTDLAVRDVMSSDPYVLIHLGHQSMKTKV  264

Query  1141  IKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENS  1320
             IKN LNP+WNE+LMLSIP+ +PPLK+ VFDKDTF++DD MGEAE+DI+PL+ A +  ENS
Sbjct  265   IKNTLNPIWNERLMLSIPDPIPPLKLQVFDKDTFSSDDRMGEAEVDIRPLIAATKEHENS  324

Query  1321  TKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERG  1500
             T    + +     + + +E++           L  D  I++A G V+QEI L+LQNVERG
Sbjct  325   T----ITESTELYRWSASEDS--------NGVLAKDSVISVASGKVKQEITLRLQNVERG  372

Query  1501  VLEVELECVSLSQ  1539
              +E+E+ECV LSQ
Sbjct  373   EVEIEIECVPLSQ  385



>ref|NP_001136616.1| uncharacterized protein LOC100216740 [Zea mays]
 gb|ACF82275.1| unknown [Zea mays]
Length=334

 Score =   372 bits (955),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 194/349 (56%), Positives = 250/349 (72%), Gaps = 17/349 (5%)
 Frame = +1

Query  496   LKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTH  675
             L+ L+ +  N+ CADCGSPDPKWV+L  G FICIKCSG HRSLGVHISKV+SV LDEWT 
Sbjct  2     LEYLLNQPANKICADCGSPDPKWVALPFGTFICIKCSGTHRSLGVHISKVISVNLDEWTD  61

Query  676   EQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLM  855
             ++V+ L E GGN+V N +YEA  PEN KK+K D STEERNDFIR+KY+ QQFV  D    
Sbjct  62    DEVNCLAESGGNSVVNSRYEAFLPEN-KKLKQDCSTEERNDFIRKKYQFQQFV-CDPQFS  119

Query  856   CPLPttsssstsEKKHSGGHRI-HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
             CPLP     +  +K H   +   +G G  FRNSWRKK+SD++   + S+   GM+EF+GL
Sbjct  120   CPLPLNRKHAPPDKNHQQHNSSKYGFGHTFRNSWRKKDSDSKSLKKMSD--VGMIEFVGL  177

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KVN+V+GT+LA+RD++SSDPYV++ LG+QS+KT+V KN LNP+WNE+LMLSIP+ +PPL
Sbjct  178   VKVNIVKGTDLAVRDVMSSDPYVLIHLGHQSMKTKVTKNTLNPIWNERLMLSIPDPIPPL  237

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ VFDKDTF++DD MGEAE+DI+PL+ A +  ENST  +             TE     
Sbjct  238   KLQVFDKDTFSSDDRMGEAEVDIRPLIAATKEHENSTITE------------STELYRWS  285

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                     L  D  I++A G V+QEI L+LQNVERG +E+E+ECV LSQ
Sbjct  286   ASEDSNGVLAKDSVISVASGKVKQEITLRLQNVERGEVEIEIECVPLSQ  334



>ref|XP_002439716.1| hypothetical protein SORBIDRAFT_09g018900 [Sorghum bicolor]
 gb|EES18146.1| hypothetical protein SORBIDRAFT_09g018900 [Sorghum bicolor]
Length=385

 Score =   366 bits (940),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 200/373 (54%), Positives = 262/373 (70%), Gaps = 31/373 (8%)
 Frame = +1

Query  424   DTSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKC  603
             DT P+++ +M              L+ L+ +  N++CADCG+PDPKW +L  G FICIKC
Sbjct  43    DTDPANAREM--------------LEYLLNQPANKYCADCGNPDPKWAALPFGAFICIKC  88

Query  604   SGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSST  783
             SG HRSLGVHISKV+SV LD+WT E+V+ L E GGN+V N ++EA  PEN KK K D ST
Sbjct  89    SGTHRSLGVHISKVISVNLDDWTDEEVNCLAESGGNSVVNTRFEAFLPEN-KKPKHDCST  147

Query  784   EERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsEKKHSGGHRI-HGLGFAFRNSWRK  960
             EERNDFIR+KY+ QQFV  D    CPLP     +  +K H   +   +G G  FRNSWRK
Sbjct  148   EERNDFIRKKYQFQQFV-CDPQFSCPLPLNRKHAPPDKSHQQHNSSKYGFGHTFRNSWRK  206

Query  961   KESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRV  1140
             K+SD +   + S+   GM+EF+GLIKVN+V+GT+LA+RD++SSDPYV++ LG+QS+KTRV
Sbjct  207   KDSDNKGLKKMSD--VGMIEFVGLIKVNIVKGTDLAVRDVMSSDPYVMINLGHQSMKTRV  264

Query  1141  IKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENS  1320
             IKN LNP+WNE+LMLSIP+ +PPLK+ VFDKDTF++DD MGEAE+DI+PL+ A +  ENS
Sbjct  265   IKNTLNPIWNERLMLSIPDPIPPLKLQVFDKDTFSSDDRMGEAEVDIRPLIAATKEHENS  324

Query  1321  TKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERG  1500
             T  +P +    +   +E  N +          L  D  I++A G V+QEI LKLQNVERG
Sbjct  325   TITEPTELYRWS--ASEDSNGV----------LAKDSVISVANGNVKQEITLKLQNVERG  372

Query  1501  VLEVELECVSLSQ  1539
              +E+E+ECV LSQ
Sbjct  373   EIEIEIECVPLSQ  385



>ref|XP_008655157.1| PREDICTED: uncharacterized protein LOC100381421 isoform X1 [Zea 
mays]
Length=543

 Score =   371 bits (952),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 199/349 (57%), Positives = 253/349 (72%), Gaps = 19/349 (5%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL  L+ +  N++CADCG+PDPKWVS++ GVFICIKCSG HRSLGVHISKVVSVKLDEW 
Sbjct  214   RLDHLLNQPANRYCADCGAPDPKWVSMTFGVFICIKCSGAHRSLGVHISKVVSVKLDEWA  273

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVDIL + GGN   N+ YEA  PENY K + D S EERNDFIRRKYE QQF+ ++  L
Sbjct  274   DEQVDILADSGGNAAVNMIYEAFVPENYAKPRQDCSAEERNDFIRRKYEAQQFL-TNPQL  332

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
              C  P   +   + ++HS     HGLG +FRNSWR+KE +  K+T+K+  + GMVEF+GL
Sbjct  333   SC--PPRRNEKHNHQQHSTSSSRHGLGHSFRNSWRRKEHEA-KSTKKTIEV-GMVEFVGL  388

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             IK++++RGTNLAIRD++SSDPYVI+ LG+Q++KT+V+K++LNPVWNE+LMLSIP+ VP L
Sbjct  389   IKIDIIRGTNLAIRDVMSSDPYVIINLGHQTMKTKVVKSSLNPVWNERLMLSIPDPVPLL  448

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+DKDTFTTDD MGEAEI+IQPL+ AA+A E S   D  Q      K          
Sbjct  449   KLQVYDKDTFTTDDRMGEAEINIQPLVAAAKAHETSAIADTAQLNKWLAKDG--------  500

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                     +P D  I++  G V+Q +  +LQNVERG LE+ELECV L+Q
Sbjct  501   ------IWIPRDSAISIVNGKVKQVVNARLQNVERGQLEMELECVPLTQ  543



>ref|NP_001167733.1| uncharacterized protein LOC100381421 [Zea mays]
 gb|ACN25914.1| unknown [Zea mays]
Length=547

 Score =   370 bits (951),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 199/349 (57%), Positives = 253/349 (72%), Gaps = 19/349 (5%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL  L+ +  N++CADCG+PDPKWVS++ GVFICIKCSG HRSLGVHISKVVSVKLDEW 
Sbjct  218   RLDHLLNQPANRYCADCGAPDPKWVSMTFGVFICIKCSGAHRSLGVHISKVVSVKLDEWA  277

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVDIL + GGN   N+ YEA  PENY K + D S EERNDFIRRKYE QQF+ ++  L
Sbjct  278   DEQVDILADSGGNAAVNMIYEAFVPENYAKPRQDCSAEERNDFIRRKYEAQQFL-TNPQL  336

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
              C  P   +   + ++HS     HGLG +FRNSWR+KE +  K+T+K+  + GMVEF+GL
Sbjct  337   SC--PPRRNEKHNHQQHSTSSSRHGLGHSFRNSWRRKEHEA-KSTKKTIEV-GMVEFVGL  392

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             IK++++RGTNLAIRD++SSDPYVI+ LG+Q++KT+V+K++LNPVWNE+LMLSIP+ VP L
Sbjct  393   IKIDIIRGTNLAIRDVMSSDPYVIINLGHQTMKTKVVKSSLNPVWNERLMLSIPDPVPLL  452

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+DKDTFTTDD MGEAEI+IQPL+ AA+A E S   D  Q      K          
Sbjct  453   KLQVYDKDTFTTDDRMGEAEINIQPLVAAAKAHETSAIADTAQLNKWLAKDG--------  504

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                     +P D  I++  G V+Q +  +LQNVERG LE+ELECV L+Q
Sbjct  505   ------IWIPRDSAISIVNGKVKQVVNARLQNVERGQLEMELECVPLTQ  547



>gb|AFW83952.1| hypothetical protein ZEAMMB73_491534 [Zea mays]
Length=560

 Score =   370 bits (950),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 199/349 (57%), Positives = 253/349 (72%), Gaps = 19/349 (5%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL  L+ +  N++CADCG+PDPKWVS++ GVFICIKCSG HRSLGVHISKVVSVKLDEW 
Sbjct  231   RLDHLLNQPANRYCADCGAPDPKWVSMTFGVFICIKCSGAHRSLGVHISKVVSVKLDEWA  290

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVDIL + GGN   N+ YEA  PENY K + D S EERNDFIRRKYE QQF+ ++  L
Sbjct  291   DEQVDILADSGGNAAVNMIYEAFVPENYAKPRQDCSAEERNDFIRRKYEAQQFL-TNPQL  349

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
              C  P   +   + ++HS     HGLG +FRNSWR+KE +  K+T+K+  + GMVEF+GL
Sbjct  350   SC--PPRRNEKHNHQQHSTSSSRHGLGHSFRNSWRRKEHEA-KSTKKTIEV-GMVEFVGL  405

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             IK++++RGTNLAIRD++SSDPYVI+ LG+Q++KT+V+K++LNPVWNE+LMLSIP+ VP L
Sbjct  406   IKIDIIRGTNLAIRDVMSSDPYVIINLGHQTMKTKVVKSSLNPVWNERLMLSIPDPVPLL  465

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+DKDTFTTDD MGEAEI+IQPL+ AA+A E S   D  Q      K          
Sbjct  466   KLQVYDKDTFTTDDRMGEAEINIQPLVAAAKAHETSAIADTAQLNKWLAKDG--------  517

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                     +P D  I++  G V+Q +  +LQNVERG LE+ELECV L+Q
Sbjct  518   ------IWIPRDSAISIVNGKVKQVVNARLQNVERGQLEMELECVPLTQ  560



>ref|XP_004166399.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
Length=411

 Score =   364 bits (934),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 213/386 (55%), Positives = 261/386 (68%), Gaps = 37/386 (10%)
 Frame = +1

Query  451   MEPQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGV  630
             M+  +Q     P+ RL+ L+++SGN FCADCGSPDPKWVSL+LGVFICIKCSGVHRSLGV
Sbjct  40    MDDILQRKFSGPQKRLEDLLQQSGNMFCADCGSPDPKWVSLNLGVFICIKCSGVHRSLGV  99

Query  631   HISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRR  810
             H+SKV SVKLD WT EQVD    MGGN   N K+EA   +  +K KPDS  EER DFIRR
Sbjct  100   HVSKVFSVKLDNWTDEQVDTFMSMGGNTDINRKFEAGIIDLNRKPKPDSCIEERFDFIRR  159

Query  811   KYELQQFVNSDLHLMCPLPttssssts---------------EKKHSGGHRI-HGLGFAF  942
             KYEL QF N+          + S  +S               +K+H       H +G AF
Sbjct  160   KYELLQFYNASSSQNSSDNNSLSKRSSSCSQSSNSSSKNGSHDKRHYEKQATRHRVGHAF  219

Query  943   RNSWRKKESDTQKATRKSNS-------MAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYV  1101
             RNS  +++ D      + +S        AGMVEF+GL+KVNVV+G NLA+RD+V+SDPYV
Sbjct  220   RNSRGRRDGDHNHRNFERSSPPVSRQASAGMVEFVGLVKVNVVKGRNLAVRDVVTSDPYV  279

Query  1102  ILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDI  1281
             IL+LG+QSV+TRVIKNNLNPVWNE LMLSIPE++PPLKV V+DKDTFTTDDFMGEAEIDI
Sbjct  280   ILSLGHQSVRTRVIKNNLNPVWNESLMLSIPEHIPPLKVLVYDKDTFTTDDFMGEAEIDI  339

Query  1282  QPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVR  1461
             QPL+ A +A E ST ++ +Q        A  +N +             DG INL +G VR
Sbjct  340   QPLVSATKAYEKSTIDESMQLGKWV---ASNDNTL-----------VKDGIINLVDGKVR  385

Query  1462  QEIVLKLQNVERGVLEVELECVSLSQ  1539
             Q+I L+LQNVERGVLE+ELEC+ L+Q
Sbjct  386   QDISLRLQNVERGVLEIELECIPLTQ  411



>dbj|BAK03763.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=412

 Score =   363 bits (933),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 193/351 (55%), Positives = 246/351 (70%), Gaps = 22/351 (6%)
 Frame = +1

Query  487   RCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDE  666
             R RL+ L+ +  N+FCADCG+PDPKW +L  G FICIKCSG HRSLGVHISKV+SV LDE
Sbjct  84    RDRLETLLNQPANKFCADCGTPDPKWAALPFGAFICIKCSGTHRSLGVHISKVISVNLDE  143

Query  667   WTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDL  846
             WT E+V+ L   GGN   N KYEA  PENYKK + D STE+R  FIR+KYELQQF+ ++ 
Sbjct  144   WTDEEVNCLANSGGNATVNTKYEAFLPENYKKPRQDFSTEDRAVFIRKKYELQQFM-TNP  202

Query  847   HLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFI  1026
                CPL    +      +  GG + HG    FRNSWRKK+S+ +   +  +   GM+EF+
Sbjct  203   QFACPLHKHGAEKRHNNQQHGGSK-HG---TFRNSWRKKDSENKGVKKMMD--VGMIEFV  256

Query  1027  GLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVP  1206
             GLIKV+++RGT+LA+RD++SSDPYV++ LG+QS+KT+VIKN LNP+WNE+LMLSIP+ VP
Sbjct  257   GLIKVDIIRGTDLAVRDVMSSDPYVMIMLGHQSMKTKVIKNTLNPIWNERLMLSIPDPVP  316

Query  1207  PLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAM  1386
             PLKV VFDKDTFT+DD MGEAE+DIQPL+ AAR  +NS   +P               A+
Sbjct  317   PLKVQVFDKDTFTSDDRMGEAEVDIQPLISAAREYQNSMVTEP---------------AI  361

Query  1387  ppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                L      L  D  I++ +G V QEI L+LQNVE G +E++LECV LSQ
Sbjct  362   CTFLASENSILVKDSVISIVDGKVEQEIALRLQNVEHGEIEIKLECVPLSQ  412



>ref|XP_010233247.1| PREDICTED: LOW QUALITY PROTEIN: probable ADP-ribosylation factor 
GTPase-activating protein AGD11 [Brachypodium distachyon]
Length=472

 Score =   365 bits (938),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 250/351 (71%), Gaps = 22/351 (6%)
 Frame = +1

Query  487   RCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDE  666
             R RL+ L+ +  N+FCADCG+PDPKW +L  G FICIKCSG HRSLGVHISKV+SV LDE
Sbjct  144   RERLEHLLNQPANKFCADCGTPDPKWAALPFGAFICIKCSGTHRSLGVHISKVISVNLDE  203

Query  667   WTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDL  846
             WT E+V+ L   GGN   N +YEA  PENYKK + D +TEER  FIR+KYELQQFV +D 
Sbjct  204   WTDEEVNCLANSGGNATVNTRYEAFLPENYKKARQDFATEERASFIRKKYELQQFV-TDP  262

Query  847   HLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFI  1026
                CPL    +     ++H+G    HG    FRNSWRKK+ D  K  +K   +A MVEF+
Sbjct  263   QFSCPLRKPGADKHHNQQHAGSR--HG---TFRNSWRKKDPD-HKIVKKMMDVA-MVEFV  315

Query  1027  GLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVP  1206
             GLIKV+++RGTNLA+RD++SSDPYV++ LG+QS+KT+VIK+ LNP+WNE+LMLSIP  VP
Sbjct  316   GLIKVDIIRGTNLAVRDVMSSDPYVMIILGHQSMKTKVIKSTLNPIWNERLMLSIPHPVP  375

Query  1207  PLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAM  1386
             PLK+ VFDKDTF++DD MGEAE+DIQPL+ AAR  +NS     + +  +      +EN++
Sbjct  376   PLKLQVFDKDTFSSDDRMGEAEVDIQPLISAAREYQNSI----ITESAQICTFLASENSI  431

Query  1387  ppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                       L  D  I++ +G V QEIVL+LQNVE G LE++LECV LSQ
Sbjct  432   ----------LAKDSVISIVDGKVEQEIVLRLQNVEHGELEIKLECVPLSQ  472



>gb|KGN51121.1| hypothetical protein Csa_5G457230 [Cucumis sativus]
Length=459

 Score =   365 bits (937),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 229/467 (49%), Positives = 284/467 (61%), Gaps = 91/467 (19%)
 Frame = +1

Query  370   NTEGNNVSGARLYDLLQMDTS---------PSDSDQ-----------------------M  453
             N++ N VSGA L+DLL  D+          PSDS+                         
Sbjct  7     NSDSNGVSGACLFDLLFPDSEMQGWDWSRMPSDSETQRWNWKKDQRLSGIISLILNIFIT  66

Query  454   EPQMQDY----------------------SLSPRCRLKALMKESGNQFCADCGSPDPKWV  567
             +  ++DY                      +L P+ RL+ L+++SGN FCADCGSPDPKWV
Sbjct  67    DYALEDYECLIFPTPWDWLRSVDGFGKPGTLGPQKRLEDLLQQSGNMFCADCGSPDPKWV  126

Query  568   SLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFP  747
             SL+LGVFICIKCSGVHRSLGVH+SKV SVKLD WT EQVD    MGGN   N K+EA   
Sbjct  127   SLNLGVFICIKCSGVHRSLGVHVSKVFSVKLDNWTDEQVDTFMSMGGNTDINRKFEAGII  186

Query  748   ENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLPttssssts------------  891
             +  +K KPDS  EER DFIRRKYEL QF N+          + S  +S            
Sbjct  187   DLNRKPKPDSCIEERFDFIRRKYELLQFYNASSSQNSSDNNSLSKRSSSCSQSSNSSSKN  246

Query  892   ---EKKHSGGHRI-HGLGFAFRNSWRKKESDTQKATRKSNS-------MAGMVEFIGLIK  1038
                +K+H       H +G AFRNS  +++ D      + +S        AGMVEF+GL+K
Sbjct  247   GSHDKRHYEKQATRHRVGHAFRNSRGRRDGDHNHRNFERSSPPVSRQASAGMVEFVGLVK  306

Query  1039  VNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKV  1218
             VNVV+G NLA+RD+V+SDPYVIL+LG+QSV+TRVIKNNLNPVWNE LMLSIPE++PPLKV
Sbjct  307   VNVVKGRNLAVRDVVTSDPYVILSLGHQSVRTRVIKNNLNPVWNESLMLSIPEHIPPLKV  366

Query  1219  HVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpppl  1398
              V+DKDTFTTDDFMGEAEIDIQPL+ A +A E ST ++ +Q        A  +N +    
Sbjct  367   LVYDKDTFTTDDFMGEAEIDIQPLVSATKAYEKSTIDESMQLGKWV---ASNDNTL----  419

Query  1399  plpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                      DG INL +G VRQ+I L+LQNVERGVLE+ELEC+ L+Q
Sbjct  420   -------VKDGIINLVDGKVRQDISLRLQNVERGVLEIELECIPLTQ  459



>emb|CDM86580.1| unnamed protein product [Triticum aestivum]
Length=476

 Score =   365 bits (937),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 203/351 (58%), Positives = 256/351 (73%), Gaps = 24/351 (7%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL  L+ +  N+ CADCG+PDPKWVSL+ G FICIKCSG HRSLGVHISKVVSVKLDEWT
Sbjct  148   RLDRLLSQPANKCCADCGAPDPKWVSLTFGAFICIKCSGAHRSLGVHISKVVSVKLDEWT  207

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVD LT+ GGN   N  YEA F  NY K + D S+++RNDFIRRKYE QQF+ S+  L
Sbjct  208   DEQVDFLTDSGGNGAVNSTYEA-FLGNYTKPRQDCSSDDRNDFIRRKYEFQQFL-SNQQL  265

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSM-AGMVEFIG  1029
              C     +     +++H+  +R HGLG AFRNSWR+KE    K+ +K  ++  GMVEF+G
Sbjct  266   SCS-SQNNGKHCYQQQHASSNR-HGLGHAFRNSWRRKED---KSVKKPAAVEVGMVEFVG  320

Query  1030  LIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPP  1209
             LIKVN++RGTNLAIRD++SSDPYVIL LG+QS+KT+VIK++LNPVWNE+L+LSIP+ VP 
Sbjct  321   LIKVNIIRGTNLAIRDVMSSDPYVILNLGHQSMKTKVIKSSLNPVWNERLLLSIPDPVPL  380

Query  1210  LKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENA-M  1386
             LKV V+DKDTFTTDD MGEAEI+IQPL+ AARA E                K+ T+NA +
Sbjct  381   LKVQVYDKDTFTTDDRMGEAEINIQPLVAAARAYET---------------KSITDNAEL  425

Query  1387  ppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                +      +P D  I++ +  V+QE+ ++LQNVERG LE+ELECV L+Q
Sbjct  426   NKWMAKDGIWVPRDSVISIIDNKVKQEVTVRLQNVERGHLEMELECVPLTQ  476



>gb|ABR16527.1| unknown [Picea sitchensis]
Length=370

 Score =   360 bits (923),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 198/365 (54%), Positives = 253/365 (69%), Gaps = 32/365 (9%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RLK L+ +  NQ CADC SPDP+W S S+GVFICIKCSGVHRSLGVHISKV+SV LDEWT
Sbjct  22    RLKDLLAQPDNQVCADCCSPDPRWASTSIGVFICIKCSGVHRSLGVHISKVLSVTLDEWT  81

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              +QVD + ++GGN  AN  YE+  PEN++K  P++S+EER++FIR KYELQ+FV   L  
Sbjct  82    GDQVDAMIDVGGNASANAIYESLLPENFEKPGPEASSEERSNFIRHKYELQEFVKPSLRT  141

Query  853   MCP------------LPttsssstsEKKHSG----GHRIHGLGFAFRNSWRKKESDTQKA  984
             +                + S     E K +G    G R  GL  AFR SWR+ E + ++ 
Sbjct  142   VSSSSSSRGSSVQYRFSSNSLGHILELKPTGKTIRGSRFSGLSHAFRKSWRRIEPENKEM  201

Query  985   TRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPV  1164
               K NS+ GMVEF+GL+K+ VV+GTNLA+RDMV+SDPYV+LT+G+Q+VKTRVIK+NLNPV
Sbjct  202   --KKNSLLGMVEFLGLLKIKVVKGTNLAVRDMVTSDPYVVLTIGHQTVKTRVIKSNLNPV  259

Query  1165  WNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQ  1344
             WNE+LMLS+P  +PPLKV VFDKDTF++DD MGEA++DI+PL+ AA+A  N+      Q 
Sbjct  260   WNEELMLSVPNPMPPLKVKVFDKDTFSSDDSMGEADVDIEPLVSAAKAYMNAGVFGTKQI  319

Query  1345  QPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELEC  1524
                    A  +NA+             D  INL +G V+QE+ LKLQNVE G+LE+ELEC
Sbjct  320   GKWL---ATADNAL-----------ASDSIINLIDGQVKQEVTLKLQNVESGILELELEC  365

Query  1525  VSLSQ  1539
             V LSQ
Sbjct  366   VPLSQ  370



>dbj|BAJ87597.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=493

 Score =   364 bits (934),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 203/350 (58%), Positives = 250/350 (71%), Gaps = 22/350 (6%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL  L+ +  N+ CADCG+PDPKWVSL+ G FICIKCSG HRSLGVHISKVVSVKLDEWT
Sbjct  165   RLDRLLSQPANKCCADCGAPDPKWVSLTFGAFICIKCSGAHRSLGVHISKVVSVKLDEWT  224

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVD LT+ GGN   N  YEA F  NY K + D S ++RNDFIRRKYE QQF+ S+  L
Sbjct  225   DEQVDFLTDSGGNGAVNTTYEA-FLGNYTKPRQDCSADDRNDFIRRKYEFQQFL-SNQQL  282

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSM-AGMVEFIG  1029
              C     +     +++H   +R HGLG AFRNSWR+K+    KA +K  ++  GMVEF+G
Sbjct  283   SCSS-QNNGKHYYQQQHGSSNR-HGLGHAFRNSWRRKDD---KALKKPAAVEVGMVEFVG  337

Query  1030  LIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPP  1209
             LIKVN++RGTNLAIRD++SSDPYVIL LG+QS+KT+VIK++LNPVWNE+L+LSIP+ VP 
Sbjct  338   LIKVNIIRGTNLAIRDVMSSDPYVILNLGHQSMKTKVIKSSLNPVWNERLLLSIPDPVPL  397

Query  1210  LKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMp  1389
             LKV V+DKDTFTTDD MGEAEI+IQPL+ AARA E  +  D           AE    M 
Sbjct  398   LKVQVYDKDTFTTDDRMGEAEINIQPLVAAARAYETKSITD----------TAELNKWM-  446

Query  1390  pplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                      +P D  I + +  V+QE+ ++LQNVERG LE+ELECV L+Q
Sbjct  447   ---AKDGIWIPRDSAITIIDNKVKQEVTVRLQNVERGHLEMELECVPLTQ  493



>ref|XP_004971278.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Setaria italica]
Length=535

 Score =   363 bits (932),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 211/373 (57%), Positives = 261/373 (70%), Gaps = 22/373 (6%)
 Frame = +1

Query  421   MDTSPSDSDQMEPQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIK  600
             M T P DSD    Q     + P  RL  L+ +  N+ CADCG+ DPKWVS++ GVFICIK
Sbjct  185   MPTKPDDSDHCSHQA---PMKPAERLDHLLNQPANKCCADCGAQDPKWVSMTFGVFICIK  241

Query  601   CSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSS  780
             CSG HRSLGVHISKVVSVKLDEWT EQVD+L + GGN   N+ YEA  PENY K + D S
Sbjct  242   CSGAHRSLGVHISKVVSVKLDEWTDEQVDLLADSGGNAAVNMIYEAFIPENYTKPRQDCS  301

Query  781   TEERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRK  960
              EER+DFIRRKYE+QQF+ S+  L C      +   +   H  G   HGLG +F+NSWR+
Sbjct  302   AEERSDFIRRKYEVQQFL-SNPQLSC--APRRNDKQNHHHHHSGSSRHGLGHSFKNSWRR  358

Query  961   KESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRV  1140
             KE +  KA +K+  M GMVEF+GLIKV+V+RGTNLAIRD++SSDPYVI+ LG+QS+KT+V
Sbjct  359   KEHEP-KAVKKTMEM-GMVEFVGLIKVDVIRGTNLAIRDVMSSDPYVIINLGHQSMKTKV  416

Query  1141  IKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENS  1320
             IK++LNPVWNE+LMLSIP+ VP LK+ V+DKDTFTTDD MGEAEI+I+PL+ AARA E S
Sbjct  417   IKSSLNPVWNERLMLSIPDPVPLLKLQVYDKDTFTTDDRMGEAEINIEPLVAAARAYEAS  476

Query  1321  TKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERG  1500
             T  D  Q      K                  +P D TI++  G V+Q + ++LQNVERG
Sbjct  477   TITDTAQLNKWMAKDG--------------IWIPRDSTISIINGKVKQVVTVRLQNVERG  522

Query  1501  VLEVELECVSLSQ  1539
              LE+ELECV L+Q
Sbjct  523   HLEMELECVPLTQ  535



>ref|NP_001055403.1| Os05g0382000 [Oryza sativa Japonica Group]
 gb|AAT38060.1| putative zinc finger protein [Oryza sativa Japonica Group]
 dbj|BAF17317.1| Os05g0382000 [Oryza sativa Japonica Group]
 dbj|BAG93105.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00364.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79126.1| hypothetical protein OsI_19772 [Oryza sativa Indica Group]
 gb|EEE63551.1| hypothetical protein OsJ_18367 [Oryza sativa Japonica Group]
Length=395

 Score =   358 bits (918),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 191/367 (52%), Positives = 252/367 (69%), Gaps = 18/367 (5%)
 Frame = +1

Query  445   DQMEPQMQDYSLS-PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRS  621
             D+      D  L+  R RL+ L+K+  N+FCADCG+PDPKW +L  G  ICIKCSG HRS
Sbjct  45    DEAHCDASDVDLANARERLEHLLKQPANKFCADCGTPDPKWAALPFGALICIKCSGTHRS  104

Query  622   LGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDF  801
             LGVHISKV+SV LDEWT E+V+ L   GGN   N +YEA  PEN+KK + D +TEER +F
Sbjct  105   LGVHISKVISVNLDEWTDEEVNCLAGSGGNATVNTRYEAFLPENFKKPRHDCTTEERCNF  164

Query  802   IRRKYELQQFVNSDLHLMCPLPttsssstsE-KKHSGGHRIHGLGFAFRNSWRKKESDTQ  978
             IR+KYE QQFV +D    CPL   +  +  + ++       HG G AFRNSW++K++D +
Sbjct  165   IRKKYEFQQFV-TDPQFSCPLRLNTKHAPDKNQQQQNCSARHGFGHAFRNSWKRKDTDNK  223

Query  979   KATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLN  1158
                + ++   GMVEF+GLIKV++ RGTNLA+RD++SSDPYV+L LG+Q++KT+VIKN LN
Sbjct  224   GLKKMTD--VGMVEFVGLIKVDIRRGTNLAVRDVMSSDPYVMLNLGHQTMKTKVIKNTLN  281

Query  1159  PVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPV  1338
             PVWNE+LMLSIP  VPPLK+ VFDKDTF++DD MG+ E+DIQPL+ AAR  E+S     +
Sbjct  282   PVWNERLMLSIPHPVPPLKLQVFDKDTFSSDDRMGDVEVDIQPLIAAAREHESSA---AI  338

Query  1339  QQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVEL  1518
                    K   +++            L  D  I++ +G V+Q+I L+LQNVE G LE+EL
Sbjct  339   AGSVEVTKLLASDDG----------TLARDSVISVVDGKVKQDIALRLQNVEHGELEIEL  388

Query  1519  ECVSLSQ  1539
             ECV LSQ
Sbjct  389   ECVPLSQ  395



>ref|XP_003567481.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Brachypodium distachyon]
Length=430

 Score =   358 bits (919),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 201/362 (56%), Positives = 256/362 (71%), Gaps = 19/362 (5%)
 Frame = +1

Query  454   EPQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVH  633
             +P  Q   ++   +L  L+    N+ CADCG+PDPKWVSL+ GVFICIKCSG HRSLGVH
Sbjct  88    DPANQSGPVAAAEKLDILLGLPANKCCADCGAPDPKWVSLTFGVFICIKCSGAHRSLGVH  147

Query  634   ISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRK  813
             ISKVVSVKLDEWT +QV+ L E GGN V N+ YEA F  NY K K D S ++R+DFIRRK
Sbjct  148   ISKVVSVKLDEWTDDQVEFLAESGGNVVVNMTYEA-FLGNYTKPKQDCSADDRSDFIRRK  206

Query  814   YELQQFVNSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRK  993
             YE QQF+ S+  L CP  +   +   +++ S  +R +GLG AFRNSWR+KE +  K  +K
Sbjct  207   YEFQQFL-SNQQLACPSQSNGKNYYYQQQQSNSNR-YGLGHAFRNSWRRKEHE-HKPVKK  263

Query  994   SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNE  1173
             +  + GMVEF+GLIKV+++RGTNLAIRD++SSDPYVIL LG+QS+KT+VIK++LNPVWNE
Sbjct  264   TVEV-GMVEFVGLIKVDIIRGTNLAIRDVMSSDPYVILNLGHQSMKTKVIKSSLNPVWNE  322

Query  1174  QLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPR  1353
             +L+LSIP+ +P LKV V+DKDTFTTDD MGEAEI+IQPL+ AARA E  T  D  +    
Sbjct  323   RLLLSIPDPIPLLKVQVYDKDTFTTDDRMGEAEINIQPLVAAARAYETKTITDTSELNKW  382

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
               K                  +P D  I++    V+QE+ ++LQNVERG LE+ELECV L
Sbjct  383   LAKDG--------------IWIPRDSAISVIGSKVKQEVTVRLQNVERGHLEMELECVPL  428

Query  1534  SQ  1539
              Q
Sbjct  429   IQ  430



>ref|XP_010232831.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Brachypodium distachyon]
Length=404

 Score =   357 bits (916),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 201/362 (56%), Positives = 256/362 (71%), Gaps = 19/362 (5%)
 Frame = +1

Query  454   EPQMQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVH  633
             +P  Q   ++   +L  L+    N+ CADCG+PDPKWVSL+ GVFICIKCSG HRSLGVH
Sbjct  62    DPANQSGPVAAAEKLDILLGLPANKCCADCGAPDPKWVSLTFGVFICIKCSGAHRSLGVH  121

Query  634   ISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRK  813
             ISKVVSVKLDEWT +QV+ L E GGN V N+ YEA F  NY K K D S ++R+DFIRRK
Sbjct  122   ISKVVSVKLDEWTDDQVEFLAESGGNVVVNMTYEA-FLGNYTKPKQDCSADDRSDFIRRK  180

Query  814   YELQQFVNSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRK  993
             YE QQF+ S+  L CP  +   +   +++ S  +R +GLG AFRNSWR+KE +  K  +K
Sbjct  181   YEFQQFL-SNQQLACPSQSNGKNYYYQQQQSNSNR-YGLGHAFRNSWRRKEHE-HKPVKK  237

Query  994   SNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNE  1173
             +  + GMVEF+GLIKV+++RGTNLAIRD++SSDPYVIL LG+QS+KT+VIK++LNPVWNE
Sbjct  238   TVEV-GMVEFVGLIKVDIIRGTNLAIRDVMSSDPYVILNLGHQSMKTKVIKSSLNPVWNE  296

Query  1174  QLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPR  1353
             +L+LSIP+ +P LKV V+DKDTFTTDD MGEAEI+IQPL+ AARA E  T  D  +    
Sbjct  297   RLLLSIPDPIPLLKVQVYDKDTFTTDDRMGEAEINIQPLVAAARAYETKTITDTSELNKW  356

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
               K                  +P D  I++    V+QE+ ++LQNVERG LE+ELECV L
Sbjct  357   LAKDG--------------IWIPRDSAISVIGSKVKQEVTVRLQNVERGHLEMELECVPL  402

Query  1534  SQ  1539
              Q
Sbjct  403   IQ  404



>ref|XP_006646683.1| PREDICTED: uridine 5'-monophosphate synthase-like [Oryza brachyantha]
Length=915

 Score =   369 bits (948),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 204/343 (59%), Positives = 252/343 (73%), Gaps = 19/343 (6%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL+ L+ +  N+ CADCG+PDPKWVSL+ GVFICIKCSG HRSLGVHISKVVSVKLDEWT
Sbjct  49    RLEHLLNQPANKICADCGAPDPKWVSLTFGVFICIKCSGAHRSLGVHISKVVSVKLDEWT  108

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVDIL + GGN   N+ YEA  PEN  K + D STEER+DFIR+KYELQQF+ S+  L
Sbjct  109   DEQVDILADSGGNAAVNMIYEAFIPENCIKPRQDCSTEERSDFIRKKYELQQFL-SNTQL  167

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
              C     S     + +H+  +R HGLG AFRNSWR+KE +  K+ +K   M GMVEF+GL
Sbjct  168   TC-YSQKSGKHRHQMQHNSSNR-HGLGHAFRNSWRRKEHE-HKSLKKPVEM-GMVEFVGL  223

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             IKVNV+RGTNLA+RDM+SSDPYVIL LG+QS+KT+VIK++LNPVWNE+LMLSIP+ +P L
Sbjct  224   IKVNVIRGTNLAVRDMMSSDPYVILNLGHQSMKTKVIKSSLNPVWNERLMLSIPDPIPML  283

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+DKDTFTTDD MGEAEI+IQPL+ AA+A E S  +D  Q      K          
Sbjct  284   KLQVYDKDTFTTDDRMGEAEINIQPLVSAAKAYETSLVSDTAQLNRWLAKDG--------  335

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELE  1521
                     +P D  I++ +G V+QE+ ++LQNVERG LE+ELE
Sbjct  336   ------IRIPRDSVISIVDGKVKQEVTVRLQNVERGQLEMELE  372



>ref|XP_006655266.1| PREDICTED: uncharacterized protein LOC102722400 [Oryza brachyantha]
Length=1186

 Score =   359 bits (922),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 191/350 (55%), Positives = 244/350 (70%), Gaps = 17/350 (5%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL+ L+K+  N+FCADCG+PDPKW +L  G  ICIKCSG HRSLGVHISKV+SV LDEWT
Sbjct  853   RLEHLLKQPANKFCADCGTPDPKWAALPFGALICIKCSGTHRSLGVHISKVISVNLDEWT  912

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              E+V+ L   GGN   N +YEA  P+NYKK + D +TEER++FIR+KYELQQFV +D   
Sbjct  913   DEEVNCLAGSGGNARVNTRYEAFLPDNYKKPRHDCTTEERSNFIRKKYELQQFV-TDPQF  971

Query  853   MCPLPttsssstsEKKHSGGHRI-HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIG  1029
              CPL   +     + +      + HG G  FRNSWR+K++D +   + ++   GMVEF+G
Sbjct  972   SCPLRVNTKHPADKHQQQQNCSVRHGFGHPFRNSWRRKDTDHKGLKKMTD--VGMVEFVG  1029

Query  1030  LIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPP  1209
             LIKV++ RGTNLA+RD++SSDPYV+L LG+QS+KTRVIKN LNPVWNE+LMLSIP  VPP
Sbjct  1030  LIKVDIRRGTNLAVRDVMSSDPYVMLNLGHQSMKTRVIKNTLNPVWNERLMLSIPHPVPP  1089

Query  1210  LKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMp  1389
             LK+ VFDKDTF++DD MG+ E+DIQPL+  AR  E+S     V       K    ++   
Sbjct  1090  LKLQVFDKDTFSSDDRMGDVEVDIQPLIAPAREHESSA---AVAGSVEVTKLLAVDDG--  1144

Query  1390  pplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                      L  D  I++ +G V+QEI L+LQNVE G LE+ELECV LSQ
Sbjct  1145  --------TLARDSVISVVDGKVKQEISLRLQNVEHGELEIELECVPLSQ  1186



>ref|XP_008813425.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X3 [Phoenix dactylifera]
Length=322

 Score =   336 bits (861),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 206/255 (81%), Gaps = 14/255 (5%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             P  RL+ L+ +  N+FCADCGSPDPKWVSLSLGVFICIKCSGVHRSLG HISKV+SVKLD
Sbjct  67    PLGRLENLLSQPANRFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGAHISKVLSVKLD  126

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             EWT EQVD L++ GGN   N++YEA  PEN+KK +PDSS EER+DFI+RKYELQQF NS+
Sbjct  127   EWTDEQVDSLSDGGGNAAVNMRYEAFLPENFKKPRPDSSIEERSDFIKRKYELQQFSNSN  186

Query  844   LHLMCPLP--------ttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSN  999
               ++   P         T SS + EK+H+G    HGLG AFRNSWR+KES+ QKA +K+ 
Sbjct  187   GLIISTTPGSLSKTLQKTVSSKSFEKQHTGLR--HGLGHAFRNSWRRKESE-QKAIKKT-  242

Query  1000  SMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQL  1179
                GMVEF+GLIKVN++RGTNLA+RD+++SDPYVIL +G+Q++KTRVIK+NLNPVWNE+L
Sbjct  243   --MGMVEFLGLIKVNIIRGTNLAVRDVMTSDPYVILNMGHQTMKTRVIKSNLNPVWNERL  300

Query  1180  MLSIPENVPPLKVHV  1224
             MLSIP+ +PPLK+ +
Sbjct  301   MLSIPDPIPPLKLEL  315



>ref|XP_006297894.1| hypothetical protein CARUB_v10013935mg [Capsella rubella]
 gb|EOA30792.1| hypothetical protein CARUB_v10013935mg [Capsella rubella]
Length=296

 Score =   335 bits (859),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 180/302 (60%), Positives = 220/302 (73%), Gaps = 17/302 (6%)
 Frame = +1

Query  328   MSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSPSDSDQMEP--QMQDYSLSPRCRLK  501
             MS+ Q+N     V  T       A LY+LL      S++ +  P   +Q  S  PR RL+
Sbjct  1     MSLGQENVDPVEVPGTH------ACLYELLC-----SETPKWTPLKDLQTSSSDPRDRLE  49

Query  502   ALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQ  681
              L+K+ GN++CADCGSP+PKWVSLSLGVFICIKCSGVHRSLGVHISKV+SVKLD+WT +Q
Sbjct  50    KLLKQPGNKYCADCGSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVLSVKLDDWTDDQ  109

Query  682   VDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCP  861
             VD+L   GGN V N ++EA   +  KK KPDS+ EERNDFIR+KYE+ QF++     +CP
Sbjct  110   VDMLVGYGGNTVVNQRFEACNIDQSKKPKPDSTNEERNDFIRKKYEMHQFMDPKDGALCP  169

Query  862   LPttsssstsEKK-HSGGHRI--HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
                 S  +TS     S  HR   + +G AFRNSW ++ESD  K  +KSNSMAGM+EF+GL
Sbjct  170   YQQPSKVNTSPPSLCSANHRSTKNRIGHAFRNSWGRRESDP-KGPKKSNSMAGMIEFVGL  228

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             IKVNVV+GTNLA+RD+++SDPYVIL LG QSVKTRVIKNNLNPVWNE LMLSIPE +PPL
Sbjct  229   IKVNVVKGTNLAVRDVMTSDPYVILALGQQSVKTRVIKNNLNPVWNETLMLSIPEPMPPL  288

Query  1213  KV  1218
             KV
Sbjct  289   KV  290



>ref|XP_010938595.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X3 [Elaeis guineensis]
Length=298

 Score =   335 bits (859),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/253 (65%), Positives = 203/253 (80%), Gaps = 14/253 (6%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             P  RL+ L+    N+FCADCGSPDPKWVS SLGVFICIKCSGVHRSLGVHISKV+SVKLD
Sbjct  19    PLGRLEKLLSLPANRFCADCGSPDPKWVSFSLGVFICIKCSGVHRSLGVHISKVLSVKLD  78

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             EWT EQVD LT+ GGN   N +YEA  PEN+KK +PDSS EER DFI+RKYELQQF NS+
Sbjct  79    EWTDEQVDSLTDAGGNAAVNRRYEAFLPENFKKPRPDSSIEERFDFIKRKYELQQFSNSN  138

Query  844   LHLMCPLPttssss--------tsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSN  999
               ++   P + S++        + EK+H+G    HGLG AFRNSWR+KES+ QKA +K+ 
Sbjct  139   GLIVSTTPGSLSTTLQSNVSSKSFEKQHTGLR--HGLGHAFRNSWRRKESE-QKAIKKT-  194

Query  1000  SMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQL  1179
                GMVEF+GLIKVN++RGTNLA+RDM++SDPYVIL LG+Q++KTRVIK++LNP+WNE+L
Sbjct  195   --MGMVEFVGLIKVNIIRGTNLAVRDMMTSDPYVILNLGHQTMKTRVIKSSLNPIWNERL  252

Query  1180  MLSIPENVPPLKV  1218
             MLSIP+ +PPLK+
Sbjct  253   MLSIPDPIPPLKL  265



>gb|AFW83951.1| UMP synthase [Zea mays]
Length=1052

 Score =   355 bits (910),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 194/346 (56%), Positives = 248/346 (72%), Gaps = 22/346 (6%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISK---VVSVKLD  663
             RL  L+ +  N++CADCG+PDPKWVS++ GVFICIKCSG HRSLGVHISK   VVSVKLD
Sbjct  231   RLDHLLNQPANRYCADCGAPDPKWVSMTFGVFICIKCSGAHRSLGVHISKARHVVSVKLD  290

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             EW  EQVDIL + GGN   N+ YEA  PENY K + D S EERNDFIRRKYE QQF+ ++
Sbjct  291   EWADEQVDILADSGGNAAVNMIYEAFVPENYAKPRQDCSAEERNDFIRRKYEAQQFL-TN  349

Query  844   LHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEF  1023
               L CP     +   + ++HS     HGLG +FRNSWR+KE +  K+T+K+  + GMVEF
Sbjct  350   PQLSCP--PRRNEKHNHQQHSTSSSRHGLGHSFRNSWRRKEHEA-KSTKKTIEV-GMVEF  405

Query  1024  IGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENV  1203
             +GLIK++++RGTNLAIRD++SSDPYVI+ LG+Q++KT+V+K++LNPVWNE+LMLSIP+ V
Sbjct  406   VGLIKIDIIRGTNLAIRDVMSSDPYVIINLGHQTMKTKVVKSSLNPVWNERLMLSIPDPV  465

Query  1204  PPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENA  1383
             P LK+ V+DKDTFTTDD MGEAEI+IQPL+ AA+A E S   D  Q      K       
Sbjct  466   PLLKLQVYDKDTFTTDDRMGEAEINIQPLVAAAKAHETSAIADTAQLNKWLAKDG-----  520

Query  1384  MppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELE  1521
                        +P D  I++  G V+Q +  +LQNVERG LE+EL+
Sbjct  521   ---------IWIPRDSAISIVNGKVKQVVNARLQNVERGQLEMELD  557



>ref|XP_010938594.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Elaeis guineensis]
Length=319

 Score =   328 bits (840),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 192/360 (53%), Positives = 236/360 (66%), Gaps = 67/360 (19%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             P  RL+ L+    N+FCADCGSPDPKWVS SLGVFICIKCSGVHRSLGVHISKV+SVKLD
Sbjct  19    PLGRLEKLLSLPANRFCADCGSPDPKWVSFSLGVFICIKCSGVHRSLGVHISKVLSVKLD  78

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             EWT EQVD LT+ GGN   N +YEA  PEN+KK +PDSS EER DFI+RKYELQQF NS+
Sbjct  79    EWTDEQVDSLTDAGGNAAVNRRYEAFLPENFKKPRPDSSIEERFDFIKRKYELQQFSNSN  138

Query  844   LHLMCPLPttssss--------tsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSN  999
               ++   P + S++        + EK+H+G    HGLG AFRNSWR+KES+ QKA +K+ 
Sbjct  139   GLIVSTTPGSLSTTLQSNVSSKSFEKQHTGLR--HGLGHAFRNSWRRKESE-QKAIKKT-  194

Query  1000  SMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQL  1179
                                                      ++KTRVIK++LNP+WNE+L
Sbjct  195   -----------------------------------------TMKTRVIKSSLNPIWNERL  213

Query  1180  MLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTP  1359
             MLSIP+ +PPLK+ V+DKDTF+TDD MGEAEIDIQPL+ AA+A ENST ++P+Q      
Sbjct  214   MLSIPDPIPPLKLQVYDKDTFSTDDRMGEAEIDIQPLVSAAKAYENSTISEPMQLGKWL-  272

Query  1360  KKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
               A  +N +             D  I+L  G V+QEI L+LQNVERG LE+ELECV LSQ
Sbjct  273   --ASDDNTL-----------VKDSIISLDNGKVKQEIALRLQNVERGELEIELECVPLSQ  319



>gb|EMS51197.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Triticum urartu]
Length=323

 Score =   325 bits (834),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 229/324 (71%), Gaps = 22/324 (7%)
 Frame = +1

Query  568   SLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFP  747
             +L  G FICIKCSG HRSLGVHISKV+SV LDEWT E+V+ L   GGN   N KYEA  P
Sbjct  22    ALPFGAFICIKCSGTHRSLGVHISKVISVNLDEWTDEEVNCLANSGGNATVNTKYEAFLP  81

Query  748   ENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsEKKHSGGHRIHG  927
             ENYKK + D +TE+R  FIR+KYELQQFV ++    CPL    +     ++HSG    HG
Sbjct  82    ENYKKPRQDFATEDRAVFIRKKYELQQFV-TNPQFACPLHKHGAEKRHNQQHSGSK--HG  138

Query  928   LGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVIL  1107
                 FRNSWRKKES+ +   +  +   GMVEF+GLIKV+++RGT+LA+RD++SSDPYV++
Sbjct  139   ---TFRNSWRKKESENKGGKKMMD--VGMVEFVGLIKVDIIRGTDLAVRDVMSSDPYVMI  193

Query  1108  TLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQP  1287
              LG+QS+KT+VIKN LNP+WNE+LMLSIPE VPPLKV VFDKDTFT+DD MGEAE+DIQP
Sbjct  194   MLGHQSMKTKVIKNTLNPIWNERLMLSIPEPVPPLKVQVFDKDTFTSDDRMGEAEVDIQP  253

Query  1288  LLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQE  1467
             L+ AAR  ++S     + +  +      +EN++          L  D  I++ +G V QE
Sbjct  254   LISAAREYQSSI----ITESTQICTFLASENSI----------LAKDSIISIVDGKVEQE  299

Query  1468  IVLKLQNVERGVLEVELECVSLSQ  1539
             I L+LQNVE G LE++LECV LSQ
Sbjct  300   IALRLQNVEHGELEIKLECVPLSQ  323



>ref|XP_011020381.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X4 [Populus euphratica]
Length=397

 Score =   327 bits (839),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 198/258 (77%), Gaps = 11/258 (4%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S  P+ RL+ L+ +SGN+ CADCGSPDPKWVS+S GVFICIK  GVHRSLGVH++KV+S+
Sbjct  118   SSGPQKRLEQLLSQSGNKICADCGSPDPKWVSISFGVFICIKWPGVHRSLGVHLTKVLSI  177

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
             KLDEWT EQV+ L ++GGN  AN KYEA  P++Y+K K D+S EER+DFIRRKYE +QF 
Sbjct  178   KLDEWTDEQVNTLIDLGGNTAANKKYEAFIPDDYQKPKSDASIEERSDFIRRKYEQKQFS  237

Query  835   NSDLHLMCPLPttssss----------tsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKA  984
             N D  + CP P   S+             +K++      H +G AFRNSW +K+++  K 
Sbjct  238   NCDGQMSCPFPGPRSALSSSCSSHCSPQDKKQYEKQATRHRIGNAFRNSWGRKDTEY-KN  296

Query  985   TRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPV  1164
              +KSNS+A MVEF+GLIKVNVV+GTNLA+RD+++SDPYV+LTLG QSV+TRVIKNNLNP+
Sbjct  297   NKKSNSLAAMVEFVGLIKVNVVKGTNLAVRDVLTSDPYVVLTLGQQSVRTRVIKNNLNPI  356

Query  1165  WNEQLMLSIPENVPPLKV  1218
             WNE LMLSIPE +PPLKV
Sbjct  357   WNESLMLSIPEQIPPLKV  374



>gb|KDO39445.1| hypothetical protein CISIN_1g0212941mg, partial [Citrus sinensis]
Length=271

 Score =   312 bits (799),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 175/266 (66%), Positives = 208/266 (78%), Gaps = 11/266 (4%)
 Frame = +1

Query  568   SLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFP  747
             SLS GVFICIKCSG+HRSLGVHISKV+SVKLDEWT+EQVD L EMGGN   N KYEA  P
Sbjct  1     SLSTGVFICIKCSGIHRSLGVHISKVLSVKLDEWTNEQVDALAEMGGNIAVNKKYEAYTP  60

Query  748   ENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLH-LMCPLPt--------tsssstsEKK  900
              N KK  P+S  +ER+DFIRRKYE  +F N D   L+CP P         ++SSS+ +KK
Sbjct  61    GNLKKPSPNSFIDERSDFIRRKYEKLEFFNFDEQALLCPYPAPHRRSSSSSTSSSSHDKK  120

Query  901   HSGGHRI-HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRD  1077
             H       H +G AFRNSW +KES++ K ++K+NS+  MVEF+GLIKVNVV+GTNLA+RD
Sbjct  121   HYEKQATRHRIGIAFRNSWGRKESES-KNSKKANSLVAMVEFVGLIKVNVVKGTNLAVRD  179

Query  1078  MVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddf  1257
             +++SDPYVIL LG+Q+VKTRVIK+NLNPVWNE LMLSIPEN+PPLKV V+DKDTFTTDDF
Sbjct  180   VMTSDPYVILALGHQTVKTRVIKSNLNPVWNESLMLSIPENIPPLKVLVYDKDTFTTDDF  239

Query  1258  MGEAEIDIQPLLVAARASENSTKNDP  1335
             MG+AEIDIQPL+ AARA E      P
Sbjct  240   MGDAEIDIQPLVTAARACETPISMSP  265



>gb|KDO39444.1| hypothetical protein CISIN_1g0212941mg, partial [Citrus sinensis]
Length=274

 Score =   312 bits (799),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 175/266 (66%), Positives = 208/266 (78%), Gaps = 11/266 (4%)
 Frame = +1

Query  568   SLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFP  747
             SLS GVFICIKCSG+HRSLGVHISKV+SVKLDEWT+EQVD L EMGGN   N KYEA  P
Sbjct  4     SLSTGVFICIKCSGIHRSLGVHISKVLSVKLDEWTNEQVDALAEMGGNIAVNKKYEAYTP  63

Query  748   ENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLH-LMCPLPt--------tsssstsEKK  900
              N KK  P+S  +ER+DFIRRKYE  +F N D   L+CP P         ++SSS+ +KK
Sbjct  64    GNLKKPSPNSFIDERSDFIRRKYEKLEFFNFDEQALLCPYPAPHRRSSSSSTSSSSHDKK  123

Query  901   HSGGHRI-HGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRD  1077
             H       H +G AFRNSW +KES++ K ++K+NS+  MVEF+GLIKVNVV+GTNLA+RD
Sbjct  124   HYEKQATRHRIGIAFRNSWGRKESES-KNSKKANSLVAMVEFVGLIKVNVVKGTNLAVRD  182

Query  1078  MVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddf  1257
             +++SDPYVIL LG+Q+VKTRVIK+NLNPVWNE LMLSIPEN+PPLKV V+DKDTFTTDDF
Sbjct  183   VMTSDPYVILALGHQTVKTRVIKSNLNPVWNESLMLSIPENIPPLKVLVYDKDTFTTDDF  242

Query  1258  MGEAEIDIQPLLVAARASENSTKNDP  1335
             MG+AEIDIQPL+ AARA E      P
Sbjct  243   MGDAEIDIQPLVTAARACETPISMSP  268



>ref|XP_010098566.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Morus 
notabilis]
 gb|EXB75226.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Morus 
notabilis]
Length=330

 Score =   312 bits (800),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 172/353 (49%), Positives = 234/353 (66%), Gaps = 35/353 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLLQKDNRSCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+++++D + E+GGN+ AN  YEA  PE +KK  PD+S EER+ FIR KYELQ+F+  
Sbjct  73    DEWSNDEIDSMIEVGGNSSANSIYEAFIPEGFKKPGPDASHEERSIFIRSKYELQKFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +                      I     + ++S+ KK  D+ ++T   N + GMVE
Sbjct  133   SLRITS--------------------IPSTKSSLQSSFSKKIMDSFRSTNSQN-LEGMVE  171

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             F+GL+KV VV+G NLA+RDM+SSDPYV+LTLG Q+V+T V+K+NLNPVWNE+LMLS+P+ 
Sbjct  172   FMGLLKVKVVKGVNLAVRDMLSSDPYVVLTLGQQTVQTTVVKSNLNPVWNEELMLSVPQQ  231

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               PLK+ VFD DTF+ DD MGEAEID+QPL+ +A A  ++     +Q           +N
Sbjct  232   FGPLKLRVFDHDTFSADDIMGEAEIDLQPLITSAMAFGDAEMFGNMQIGKWLKSH---DN  288

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D T+N+ +G V+QE+ LKLQNVE G +E+ELE + L Q
Sbjct  289   AL-----------KEDSTVNIVDGKVKQEVSLKLQNVESGEMELELEWMPLDQ  330



>ref|XP_008383402.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Malus domestica]
 ref|XP_008383403.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Malus domestica]
Length=336

 Score =   309 bits (791),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 232/354 (66%), Gaps = 31/354 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLVQKDNRNCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN+ AN  YEA  PE   K  PD+  EER+ FIR KYELQ+F+  
Sbjct  73    DEWSDDEIDAMIEVGGNSSANSIYEAFIPEGLSKPGPDAGHEERSKFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFR-NSWRKKESDTQKATRKSNSMAGMV  1017
              L +                +SG  R + L    + NS+ +K  D+ ++     S  GMV
Sbjct  133   SLRI----------------NSGPSRKNSLQSTLQSNSFSRKIIDSFRSNSSQKSQEGMV  176

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIGL+KV V+RGTNLAIRDM++SDPYVILTLG Q+++T VIK+NLNPVWNE+LMLS+PE
Sbjct  177   EFIGLLKVKVIRGTNLAIRDMMTSDPYVILTLGKQTIRTTVIKSNLNPVWNEELMLSVPE  236

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETE  1377
                 L++ VFD DTF+ DD MGEAE+D+QPL+ +A A  ++     +Q           +
Sbjct  237   RFGALQLQVFDHDTFSADDIMGEAEVDLQPLITSAMAFGDAGMFGNMQIGKWLKSH---D  293

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             NA+             D T+N+ +G V+QE+ LKLQNVE G +++ELE + L Q
Sbjct  294   NAL-----------VDDSTVNIVDGKVKQEVSLKLQNVECGEIDLELEWMPLEQ  336



>ref|NP_001149756.1| LOC100283383 [Zea mays]
 gb|ACG36684.1| ZAC [Zea mays]
Length=319

 Score =   308 bits (788),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 228/351 (65%), Gaps = 37/351 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +L+ L+++S N+ CADCG+PDPKW S ++GVFIC+KCSGVHRSLG H+SKV+SV LD+WT
Sbjct  4     KLRELLQKSDNRVCADCGAPDPKWASANIGVFICLKCSGVHRSLGTHVSKVLSVTLDQWT  63

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  PE Y+K  PDSS EER DFIR KYELQ+F+   L L
Sbjct  64    DDEINSMIEVGGNSYANAIYEAFLPEGYQKPHPDSSQEERADFIRSKYELQEFLKPSLRL  123

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
             +               + G         A   S RK + +T   +   +S AGMVEFIG+
Sbjct  124   VS-------------SNKGSLE------ATSTSSRKHKDNTVSLSASFSSEAGMVEFIGI  164

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KV V+RGT LA+RD++SSDPY++LTLG Q  KT V K NLNPVWNE+L LS+P+   PL
Sbjct  165   LKVKVIRGTKLAVRDLMSSDPYIVLTLGQQKAKTSVSKRNLNPVWNEELKLSVPQQYGPL  224

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARA--SENSTKNDPVQQQPRTPKKAETENAM  1386
             K+ VFD D  + DD MG+AEID+QP++ AA A    +   +  + +  R+P     +NA+
Sbjct  225   KLQVFDHDMLSKDDEMGDAEIDLQPMISAATAFGDPDLLADMQIGKWLRSP-----DNAL  279

Query  1387  ppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                          D  +N+  G V+QE+ L+LQNVE G +E+ELE + L+Q
Sbjct  280   -----------ARDSAVNVVGGKVKQEVSLRLQNVESGEVELELEWIPLNQ  319



>ref|XP_009344408.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Pyrus x bretschneideri]
 ref|XP_009344410.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Pyrus x bretschneideri]
Length=336

 Score =   308 bits (789),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 232/354 (66%), Gaps = 31/354 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLVQKDNRNCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN+ AN  YEA  PE   K  PD+  EER+ FIR KYELQ+F+  
Sbjct  73    DEWSDDEIDAMIEVGGNSSANSIYEAFIPEGLSKPGPDAGHEERSKFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFR-NSWRKKESDTQKATRKSNSMAGMV  1017
              L +                +SG  R + L    + NS+ +K  D+ ++     S  GMV
Sbjct  133   SLRI----------------NSGPSRKNSLQSTLQSNSFSRKIIDSFRSNSSQKSQEGMV  176

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIGL+KV V+RGTNLAIRDM++SDPYVILTLG Q+++T VIK+NLNPVWNE+LMLS+PE
Sbjct  177   EFIGLLKVKVIRGTNLAIRDMMTSDPYVILTLGKQTLRTTVIKSNLNPVWNEELMLSVPE  236

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETE  1377
                 L++ VFD DTF+ DD MGEAE+D+QPL+ +A A  ++     +Q           +
Sbjct  237   RFGALQLQVFDHDTFSADDIMGEAEVDLQPLITSAMAFGDAGMFGNMQIGKWLKSH---D  293

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             NA+             D T+N+ +G V+QE+ LKLQNVE G +++ELE + L Q
Sbjct  294   NAL-----------IDDSTVNIVDGKVKQEVSLKLQNVECGEIDLELEWMPLEQ  336



>gb|KHN15239.1| Putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Glycine soja]
Length=415

 Score =   310 bits (794),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 231/320 (72%), Gaps = 28/320 (9%)
 Frame = +1

Query  622   LGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDF  801
             LG  + +V+S+KLDEWT EQVD L + GGN V N+KYEA  P N KK KP+SS EER+DF
Sbjct  110   LGDWLGRVLSLKLDEWTDEQVDALVKFGGNTVINMKYEACLPSNIKKPKPNSSIEERSDF  169

Query  802   IRRKYELQQFVNSDLHLMCPL-------------PttsssstsEKKHSGGHRIHGL-GFA  939
             IRRKYE  QF++ + +L CP               ++S++   +KKH        L G  
Sbjct  170   IRRKYEFLQFLDIEENLSCPFVPSHARCSSYSQRSSSSNNFPQDKKHYDKQETKSLIGST  229

Query  940   FRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGN  1119
             FRNSW +K+S+  K+++KSNS+AGMVEFIGLIKVNVV+GTNLAIRD+++SDPYVI++LG+
Sbjct  230   FRNSWGRKDSE-HKSSKKSNSLAGMVEFIGLIKVNVVKGTNLAIRDVMTSDPYVIISLGH  288

Query  1120  QSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVA  1299
             QSVKTRVIK++LNPVWNE LMLSIP+N+PPLKV V+DKD F+TDDFMG+AEIDIQPL+ A
Sbjct  289   QSVKTRVIKSSLNPVWNESLMLSIPDNIPPLKVLVYDKDIFSTDDFMGKAEIDIQPLVSA  348

Query  1300  ARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLK  1479
             A+A E S+ ND +Q        A  +N            L  DGTI+L +G V+ +I ++
Sbjct  349   AKAYEKSSINDSLQLGKWV---ANGDN----------NTLVKDGTISLEDGKVKHDISVR  395

Query  1480  LQNVERGVLEVELECVSLSQ  1539
             LQ+VERGVLE+ELECV L+Q
Sbjct  396   LQHVERGVLEIELECVLLTQ  415



>ref|XP_010051951.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X3 [Eucalyptus grandis]
Length=330

 Score =   307 bits (786),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 169/355 (48%), Positives = 235/355 (66%), Gaps = 34/355 (10%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             SL  +  +K L+ +S N+FCADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV
Sbjct  10    SLQGKRIIKDLLNQSDNRFCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSV  69

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
              LD+W+ +++D + E+GGN+ AN  YEA  PE  KK   D+S EER  FIR KYELQ+F+
Sbjct  70    TLDDWSDDEIDSMIEVGGNSSANAIYEAFIPEGVKKPGADASHEERMRFIRSKYELQEFL  129

Query  835   NSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGM  1014
                L +        +S  SE+               ++S+ +K  D+ +++  S +  GM
Sbjct  130   KPSLRI--------ASRPSERS------------TLQSSFSRKIMDSFRSSHSSKNSEGM  169

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEFIGL+KV V++GTNLAIRDM+SSDPYV+L LG Q+ +T V+K+NLNPVWN+ LMLS+P
Sbjct  170   VEFIGLVKVKVIKGTNLAIRDMLSSDPYVVLNLGQQTAQTNVVKSNLNPVWNQDLMLSVP  229

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
             ++  PLK+ VFD DTF+ DD MGEAE+D+QP++ +A A  ++     +Q           
Sbjct  230   QDFGPLKLRVFDHDTFSADDIMGEAEVDLQPMITSAMAFGDAGMFGDMQIGKWLKSH---  286

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             +NA+             D T+N+ +G V+QEI+LKLQNVE G +E+ELE + L Q
Sbjct  287   DNAL-----------LMDSTVNIVDGKVKQEILLKLQNVESGEIELELEWLPLDQ  330



>ref|XP_010245699.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Nelumbo nucifera]
Length=331

 Score =   306 bits (785),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 227/351 (65%), Gaps = 39/351 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RLK L+ +S N+FCADCG+PDPKW S ++GVFIC+KC GVHR+LG HISKV+SV LDEW+
Sbjct  18    RLKELILKSDNRFCADCGAPDPKWASANIGVFICLKCCGVHRNLGTHISKVLSVTLDEWS  77

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              E++D + E+GGN+ AN  YEA  PE + K +PDS  EER  FIR KYELQ+F+   L +
Sbjct  78    EEEIDAMVEVGGNSAANEIYEAFIPEGFSKPRPDSCHEERMKFIRAKYELQEFLKPSLRI  137

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
             +   P                       + ++S  +K  D  +++  S    GMVEFIGL
Sbjct  138   VS-FPARG--------------------SLQSSSSRKIMDNFRSSNSSTKTEGMVEFIGL  176

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KV VV+GTNLAIRDM+SSDPYV+L +G Q V+T+V+ +NLNP+WNE+LMLS+P+N  P+
Sbjct  177   LKVKVVKGTNLAIRDMLSSDPYVVLNVGKQRVQTQVVHSNLNPIWNEELMLSVPQNYGPM  236

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK--AETENAM  1386
             KV VFD DTF+ DD MGEAE+DIQP++ AA     ++  DP         K     +NA+
Sbjct  237   KVQVFDHDTFSADDIMGEAEVDIQPMITAA-----TSIGDPSMFSDMQIGKWLKSHDNAL  291

Query  1387  ppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                          D ++N+ +G ++QE+ LKL NVE G +++ELE + L  
Sbjct  292   -----------IHDSSVNIVDGKIKQEVSLKLMNVESGEIDLELEWIPLDH  331



>ref|XP_006846006.1| hypothetical protein AMTR_s00155p00064070 [Amborella trichopoda]
 gb|ERN07681.1| hypothetical protein AMTR_s00155p00064070 [Amborella trichopoda]
Length=323

 Score =   306 bits (784),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 169/339 (50%), Positives = 222/339 (65%), Gaps = 43/339 (13%)
 Frame = +1

Query  523   NQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEM  702
             N+ CADCG+P+PKW S ++GVFIC+KC GVHRSLG HISKV+SV LD+WT +Q+D + E+
Sbjct  28    NRTCADCGAPEPKWASANIGVFICLKCCGVHRSLGTHISKVLSVSLDDWTDDQIDSMIEV  87

Query  703   GGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLPttsss  882
             GGN+ AN  YEA+ P  + K  PDS  EER+ FIR KYELQ+F+   L ++         
Sbjct  88    GGNSSANAIYEASIPAGFSKPGPDSGYEERSHFIRSKYELQEFLKPSLRII---------  138

Query  883   stsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTN  1062
                               +F  S ++  S     +R S  M GMVEFIGL+KV V++GT+
Sbjct  139   ------------------SF--SAQRNSSVQSYDSRTSQKMVGMVEFIGLMKVKVIKGTD  178

Query  1063  LAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtf  1242
             LAIRDM+SSDPYVILT+G Q VKT+VIK+NLNPVW+E+LMLS+PE+   LK+ VFD DTF
Sbjct  179   LAIRDMLSSDPYVILTIGQQRVKTKVIKSNLNPVWDEELMLSVPESYGALKLQVFDHDTF  238

Query  1243  ttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplpppplp  1422
             + DD MGEAEIDIQPL+ AA A E+    + +Q        A ++NA+            
Sbjct  239   SADDIMGEAEIDIQPLVTAAMAHEDVGFVEDMQIGKWL---ASSDNAL-----------L  284

Query  1423  pDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              D  I + +G+V+QE+ LKLQNVE G +E+ELE + L Q
Sbjct  285   KDSIIRIVDGSVKQEVSLKLQNVESGEIELELEWMPLDQ  323



>ref|XP_010051947.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Eucalyptus grandis]
 ref|XP_010051948.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Eucalyptus grandis]
Length=334

 Score =   306 bits (784),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 167/348 (48%), Positives = 232/348 (67%), Gaps = 34/348 (10%)
 Frame = +1

Query  496   LKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTH  675
             +K L+ +S N+FCADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV LD+W+ 
Sbjct  21    IKDLLNQSDNRFCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTLDDWSD  80

Query  676   EQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLM  855
             +++D + E+GGN+ AN  YEA  PE  KK   D+S EER  FIR KYELQ+F+   L + 
Sbjct  81    DEIDSMIEVGGNSSANAIYEAFIPEGVKKPGADASHEERMRFIRSKYELQEFLKPSLRI-  139

Query  856   CPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLI  1035
                    +S  SE+               ++S+ +K  D+ +++  S +  GMVEFIGL+
Sbjct  140   -------ASRPSERS------------TLQSSFSRKIMDSFRSSHSSKNSEGMVEFIGLV  180

Query  1036  KVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLK  1215
             KV V++GTNLAIRDM+SSDPYV+L LG Q+ +T V+K+NLNPVWN+ LMLS+P++  PLK
Sbjct  181   KVKVIKGTNLAIRDMLSSDPYVVLNLGQQTAQTNVVKSNLNPVWNQDLMLSVPQDFGPLK  240

Query  1216  VHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppp  1395
             + VFD DTF+ DD MGEAE+D+QP++ +A A  ++     +Q           +NA+   
Sbjct  241   LRVFDHDTFSADDIMGEAEVDLQPMITSAMAFGDAGMFGDMQIGKWLKSH---DNAL---  294

Query  1396  lplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                       D T+N+ +G V+QEI+LKLQNVE G +E+ELE + L Q
Sbjct  295   --------LMDSTVNIVDGKVKQEILLKLQNVESGEIELELEWLPLDQ  334



>ref|XP_010051949.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Eucalyptus grandis]
 ref|XP_010051950.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Eucalyptus grandis]
 gb|KCW75778.1| hypothetical protein EUGRSUZ_D00176 [Eucalyptus grandis]
Length=331

 Score =   306 bits (784),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 167/348 (48%), Positives = 232/348 (67%), Gaps = 34/348 (10%)
 Frame = +1

Query  496   LKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTH  675
             +K L+ +S N+FCADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV LD+W+ 
Sbjct  18    IKDLLNQSDNRFCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTLDDWSD  77

Query  676   EQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLM  855
             +++D + E+GGN+ AN  YEA  PE  KK   D+S EER  FIR KYELQ+F+   L + 
Sbjct  78    DEIDSMIEVGGNSSANAIYEAFIPEGVKKPGADASHEERMRFIRSKYELQEFLKPSLRI-  136

Query  856   CPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLI  1035
                    +S  SE+               ++S+ +K  D+ +++  S +  GMVEFIGL+
Sbjct  137   -------ASRPSERS------------TLQSSFSRKIMDSFRSSHSSKNSEGMVEFIGLV  177

Query  1036  KVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLK  1215
             KV V++GTNLAIRDM+SSDPYV+L LG Q+ +T V+K+NLNPVWN+ LMLS+P++  PLK
Sbjct  178   KVKVIKGTNLAIRDMLSSDPYVVLNLGQQTAQTNVVKSNLNPVWNQDLMLSVPQDFGPLK  237

Query  1216  VHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppp  1395
             + VFD DTF+ DD MGEAE+D+QP++ +A A  ++     +Q           +NA+   
Sbjct  238   LRVFDHDTFSADDIMGEAEVDLQPMITSAMAFGDAGMFGDMQIGKWLKSH---DNAL---  291

Query  1396  lplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                       D T+N+ +G V+QEI+LKLQNVE G +E+ELE + L Q
Sbjct  292   --------LMDSTVNIVDGKVKQEILLKLQNVESGEIELELEWLPLDQ  331



>gb|AFW76344.1| putative calcium-dependent lipid-binding (CaLB domain) family 
protein [Zea mays]
Length=317

 Score =   305 bits (782),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 227/351 (65%), Gaps = 39/351 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +L+ L+++SGN+ CADCG+PDPKW S ++GVFIC+KCSGVHRSLG H+SKV+SV LD+WT
Sbjct  4     KLRELLQKSGNRVCADCGAPDPKWASANIGVFICLKCSGVHRSLGTHVSKVLSVTLDQWT  63

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  PE Y+K  PDSS EER DFIR KYELQ+F+   L L
Sbjct  64    DDEINSMIEVGGNSYANAIYEAFLPEGYQKPHPDSSQEERADFIRSKYELQEFLKPSLRL  123

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
             +                         G     S RK   ++   +   +S AGMVEFIG+
Sbjct  124   VS---------------------SNKGSLEATSSRKHMDNSVSLSASFSSEAGMVEFIGI  162

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KV V+RGT LA+RD++SSDPYV+LTLG Q  KT V K NLNPVWNE+L LS+P++  PL
Sbjct  163   LKVKVIRGTKLAVRDLMSSDPYVVLTLGQQKAKTSVSKRNLNPVWNEELKLSVPQHYGPL  222

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARA--SENSTKNDPVQQQPRTPKKAETENAM  1386
             K+ VFD D  + DD MG+AEID+QP++ AA A    +   +  + +  R+P     +NA+
Sbjct  223   KLQVFDHDMLSKDDEMGDAEIDLQPMISAATAFGDPDLLADMQIGKWLRSP-----DNAL  277

Query  1387  ppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                          D  +N+  G V+QE+ L+LQNVE G +E+ELE + L+Q
Sbjct  278   -----------ARDSAVNVVGGKVKQEVSLRLQNVESGEVELELEWIPLNQ  317



>ref|XP_002437267.1| hypothetical protein SORBIDRAFT_10g023880 [Sorghum bicolor]
 gb|EER88634.1| hypothetical protein SORBIDRAFT_10g023880 [Sorghum bicolor]
Length=331

 Score =   305 bits (782),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 167/351 (48%), Positives = 226/351 (64%), Gaps = 40/351 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +L+ L+++S N+ CADC +PDPKW S ++GVFIC+KCSGVHRSLG H+SKV+SV LD+W 
Sbjct  19    KLRELLQKSDNRICADCSAPDPKWASANIGVFICLKCSGVHRSLGTHVSKVLSVTLDQWA  78

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  PE Y K  PDSS EER DFIR KYELQ+F+   L L
Sbjct  79    DDEINSMIEVGGNSYANAIYEAFLPEGYHKPHPDSSQEERADFIRSKYELQEFLKPSLRL  138

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
             +      S  +TS +KH+G +      F                    NS AGMVEFIG+
Sbjct  139   VS--NKGSLEATSSRKHTGSNVSLSASF--------------------NSEAGMVEFIGI  176

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KV V+RGT LA+RD++SSDPYV+LTLG Q  KT VIK NLNPVWNE+L LS+P+   PL
Sbjct  177   LKVKVIRGTKLAVRDLISSDPYVVLTLGQQKAKTSVIKRNLNPVWNEELKLSVPQQYGPL  236

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARA--SENSTKNDPVQQQPRTPKKAETENAM  1386
             K+ VFD D  + DD MG+AEID+QP++ AA A    +   +  + +  ++P     +NA+
Sbjct  237   KLQVFDHDMLSKDDKMGDAEIDLQPMISAATAFGDPDLLADMQIGKWLKSP-----DNAL  291

Query  1387  ppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                          D  +N+  G V+QE+ L LQNVE G +E+ELE + L+Q
Sbjct  292   -----------ARDSAVNVISGKVKQEVSLMLQNVESGEVELELEWIPLNQ  331



>ref|XP_009362231.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009362232.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009362233.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009362234.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Pyrus x bretschneideri]
Length=336

 Score =   305 bits (781),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 230/354 (65%), Gaps = 31/354 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLIQKDNRNCADCGATDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN+ AN  YEA  P    K  PD+  EER+ FIR KYELQ F+  
Sbjct  73    DEWSDDEIDAMIEVGGNSSANSIYEAFIPVGVSKPGPDAGHEERSKFIRSKYELQDFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFR-NSWRKKESDTQKATRKSNSMAGMV  1017
              L +                +SG  R + L    + NS+ +K  D+ ++     S  GMV
Sbjct  133   SLRI----------------NSGPSRKNTLQSTLQSNSFSRKIIDSFRSNSSQKSQEGMV  176

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIGL+KV V+RGTNLAIRDM++SDPYVILTLG Q+++T VIK+NLNPVWNE+LMLS+PE
Sbjct  177   EFIGLLKVKVIRGTNLAIRDMMTSDPYVILTLGQQTLRTTVIKSNLNPVWNEELMLSVPE  236

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETE  1377
                PL++ VFD DTF+ DD MGEAE+D+QPL+ +A A  ++     +Q           +
Sbjct  237   QFGPLQLQVFDYDTFSADDIMGEAEVDLQPLITSAMAFGDAGMFGNMQIGKWL---KSND  293

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             NA+             D T+N+ +G V+QE+ LKLQNVE G L++ELE + L Q
Sbjct  294   NAL-----------IDDSTVNIVDGKVKQELSLKLQNVECGELDLELEWMPLEQ  336



>ref|XP_004965911.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Setaria italica]
 ref|XP_004965912.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X2 [Setaria italica]
Length=331

 Score =   304 bits (779),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 165/351 (47%), Positives = 223/351 (64%), Gaps = 40/351 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +L+ L+  S N+ CADC +PDPKW S ++GVFIC+KCSGVHRSLG H+SKV+SV LD+WT
Sbjct  19    KLRELLHTSDNRICADCSAPDPKWASANIGVFICLKCSGVHRSLGTHVSKVLSVTLDQWT  78

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  PE Y K  PDSS EER DFIR KYE Q+F+   L +
Sbjct  79    DDEINSMIEVGGNSYANAIYEAFLPEGYHKPHPDSSQEERADFIRSKYESQEFMKPSLRI  138

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
             +     +S  +   +KH   +  H   F                    NS AGMVEFIG+
Sbjct  139   VS--NKSSLEAIDSRKHMDSNASHSASF--------------------NSEAGMVEFIGI  176

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KV V+RGT LA+RD++SSDPYV+LTLG Q  KT VIK NLNPVWNE+L LS+P+   PL
Sbjct  177   LKVKVIRGTKLAVRDLISSDPYVVLTLGQQKAKTSVIKRNLNPVWNEELKLSVPQKYGPL  236

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARA--SENSTKNDPVQQQPRTPKKAETENAM  1386
             K+ VFD D  + DD MGEAEID+QP++ AA A    +   +  + +  ++P     +NA+
Sbjct  237   KLEVFDHDLLSRDDKMGEAEIDLQPMISAATAFGDPDLLADMQIGKWLKSP-----DNAL  291

Query  1387  ppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                          D  +N+  G V+QE+ LKLQNVE G +++ELE + L+Q
Sbjct  292   -----------ARDSAVNVVGGKVKQEVSLKLQNVESGEVDLELEWIPLTQ  331



>ref|XP_002523190.1| ARF GTPase activator, putative [Ricinus communis]
 gb|EEF39221.1| ARF GTPase activator, putative [Ricinus communis]
Length=330

 Score =   304 bits (779),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 171/353 (48%), Positives = 224/353 (63%), Gaps = 34/353 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +S N+FCADC +PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  12    SGKRRLKDLLLKSDNRFCADCAAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  71

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN+ AN  YEA  PE   K  PD+S +ER  FIR KYELQ+F+  
Sbjct  72    DEWSDDEIDAMIEVGGNSTANAIYEAFIPEGVSKPHPDASHDERMRFIRSKYELQEFLKP  131

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +     T S  S+  ++     RI                    A+    S  GMVE
Sbjct  132   SLRITSGKSTMSVQSSFSRRFLDSFRI--------------------ASTSQTSEEGMVE  171

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV V  GTNLAIRDM+SSDPYV+LTLG Q+V+T V+++NLNPVWNE+LMLS+P+N
Sbjct  172   FIGLLKVKVKNGTNLAIRDMMSSDPYVVLTLGKQTVQTTVVRSNLNPVWNEELMLSVPQN  231

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               P+K+ VFD DTF+ DD MGEAEID+QPL+ +A A     + D              +N
Sbjct  232   FGPVKLQVFDHDTFSADDIMGEAEIDVQPLITSAMA---FGRPDMFGNMQIGKWLKSNDN  288

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D  IN+ +G V+QEI LKLQNVE G L++E++ + L Q
Sbjct  289   AL-----------MEDSIINIVDGKVKQEISLKLQNVESGELQLEMQWIPLEQ  330



>ref|XP_008246096.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11, partial [Prunus mume]
Length=282

 Score =   302 bits (774),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 178/297 (60%), Positives = 208/297 (70%), Gaps = 27/297 (9%)
 Frame = +1

Query  643   VVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYEL  822
             VVSVKLDEWT E+VDIL  MGGN   N KYEA  PEN KK KPDSS EER  FIRRKYEL
Sbjct  1     VVSVKLDEWTDEEVDILASMGGNVAVNKKYEACLPENVKKPKPDSSIEERFYFIRRKYEL  60

Query  823   QQFVNSDLHLMCPLPttsss----------stsEKKHSGGHRIHGLGFAFRNSWRKKESD  972
               F+N + H+ CP P +             +  +K++      H +G AFRNSW +K+S+
Sbjct  61    LDFLNPNEHMSCPFPPSHKKSPSSNSTNNSAQDKKQYEKQPTKHRIGQAFRNSWGRKDSE  120

Query  973   TQKATRKSNSM--AGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIK  1146
               K  +K NSM  AGMVEF+GL+KVNVVRGTNL +RD+++SDPYVIL LG+QSVKTRVIK
Sbjct  121   -HKTLKKGNSMPMAGMVEFVGLVKVNVVRGTNLVVRDVMTSDPYVILALGHQSVKTRVIK  179

Query  1147  NNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTK  1326
             NNLNPVWNE LMLSIPE++PPLKV V+DKDTFTTDDFMGEAEIDIQPL+ AA A E ST 
Sbjct  180   NNLNPVWNESLMLSIPEHIPPLKVLVYDKDTFTTDDFMGEAEIDIQPLVSAAIAYEKSTI  239

Query  1327  NDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVER  1497
             N+PVQ        A  EN +             DG INL +G VRQ+I L+LQNVER
Sbjct  240   NEPVQLGKWV---ASKENTL-----------VKDGVINLVDGKVRQQITLRLQNVER  282



>ref|XP_006377669.1| hypothetical protein POPTR_0011s10090g [Populus trichocarpa]
 gb|ERP55466.1| hypothetical protein POPTR_0011s10090g [Populus trichocarpa]
Length=330

 Score =   304 bits (778),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 179/356 (50%), Positives = 227/356 (64%), Gaps = 34/356 (10%)
 Frame = +1

Query  472   YSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVS  651
             ++ S + RLK L+ +S N+FCADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+S
Sbjct  9     HAASGKRRLKDLLLQSDNRFCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLS  68

Query  652   VKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQF  831
             V LDEW+ +++D +TE+GGN+ AN  YEA  PE   K  PDSS EER  FIR KYELQ+F
Sbjct  69    VTLDEWSDDEIDSMTEVGGNSSANAIYEAFLPEGVSKPGPDSSHEERMRFIRSKYELQEF  128

Query  832   VNSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAG  1011
             +   L +         S  +            L  +FR     K S+            G
Sbjct  129   LKPSLRIT--------SGKTSSSSLKSSFSTKLFDSFRIPSVSKNSE------------G  168

Query  1012  MVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSI  1191
             MVEFIGL+KV V +GTNLAIRDM+SSDPYV+LTLG Q+V+T V+K+NLNPVWNE+LMLS+
Sbjct  169   MVEFIGLVKVKVKKGTNLAIRDMLSSDPYVVLTLGKQTVQTTVMKSNLNPVWNEELMLSV  228

Query  1192  PENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAE  1371
             P++  P+K+ VFD DTF+ DD MGEAEIDIQPL+ +A A  +      +Q          
Sbjct  229   PQDFGPIKLSVFDHDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGNMQIGKWLKSH--  286

Query  1372  TENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +NA+             D  IN+ +G V QEI LKLQNVE G LEVELE + L Q
Sbjct  287   -DNAL-----------VVDSIINIVDGKVMQEISLKLQNVECGELEVELEWMPLDQ  330



>ref|XP_011012078.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Populus euphratica]
Length=330

 Score =   304 bits (778),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 178/356 (50%), Positives = 229/356 (64%), Gaps = 34/356 (10%)
 Frame = +1

Query  472   YSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVS  651
             ++ S + RLK L+ +S N+FCADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+S
Sbjct  9     HAASGKRRLKDLLLQSDNRFCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLS  68

Query  652   VKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQF  831
             V LDEW+ +++D +TE+GGN+ AN  YEA  PE   K  PDSS EER  FIR KYELQ+F
Sbjct  69    VTLDEWSDDEIDSMTEVGGNSSANAIYEAFLPEGVSKPGPDSSHEERMRFIRSKYELQEF  128

Query  832   VNSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAG  1011
             +   L +     ++SS  +S                          D+ +    S +  G
Sbjct  129   LKPSLRITSGKTSSSSLKSSLSTKL--------------------FDSFRIPSVSKNSEG  168

Query  1012  MVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSI  1191
             MVEFIGL+KV V +GTNLAIRDM+SSDPYV+LTLG Q+V+T V+K+NLNPVWNE+LMLS+
Sbjct  169   MVEFIGLVKVKVKKGTNLAIRDMLSSDPYVVLTLGKQTVQTTVMKSNLNPVWNEELMLSV  228

Query  1192  PENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAE  1371
             P++  P+K+ VFD DTF+ DD MGEAEIDIQPL+ +A A  +      +Q          
Sbjct  229   PQDFGPIKLSVFDHDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGNMQIGKWLKSH--  286

Query  1372  TENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +NA+             D  IN+ +G V QEI LKLQNVE G LEVELE + L Q
Sbjct  287   -DNAL-----------VDDSIINIVDGKVMQEISLKLQNVECGELEVELEWMPLDQ  330



>gb|EMT24360.1| Putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Aegilops tauschii]
Length=314

 Score =   302 bits (774),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 178/350 (51%), Positives = 221/350 (63%), Gaps = 54/350 (15%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RL  L+ +  N+ CADCG+PDPKWVSL+ G FICIKCSG HRSLGVHISK+VSVKLDEWT
Sbjct  18    RLDRLLSQPANKCCADCGAPDPKWVSLTFGAFICIKCSGAHRSLGVHISKIVSVKLDEWT  77

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVD LT++GGN   N  YE AF  NY K + D S ++RNDFIRRKYE QQF+ S+  L
Sbjct  78    DEQVDFLTDLGGNGAVNSTYE-AFLGNYTKPRQDCSADDRNDFIRRKYEFQQFL-SNQQL  135

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSM-AGMVEFIG  1029
              C     +     +++H   +R HGLG AFRNSWR+KE    K+ +K  ++  GMVEF+G
Sbjct  136   SCS-SQNNGKHCYQQQHGSSNR-HGLGHAFRNSWRRKED---KSVKKPAAVEVGMVEFVG  190

Query  1030  LIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPP  1209
             LIKVN++RGTNLAIRD++SSDPYVIL LG+Q V  +                        
Sbjct  191   LIKVNIIRGTNLAIRDVMSSDPYVILNLGHQQVYDK------------------------  226

Query  1210  LKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMp  1389
                     DTFTTDD MGEAEI+IQPL+ AARA E  +  D           AE +N M 
Sbjct  227   --------DTFTTDDRMGEAEINIQPLVAAARAYETKSITD----------NAELKNWM-  267

Query  1390  pplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                      +P D  I + +  V+QE+ ++LQNVERG LE+ELECV L+Q
Sbjct  268   ---AKDGIWIPRDSAITIIDNKVKQEVTVRLQNVERGHLEMELECVPLTQ  314



>gb|AET04392.2| ADP-ribosylation factor GTPase-activating protein AGD10 [Medicago 
truncatula]
Length=322

 Score =   302 bits (774),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 230/354 (65%), Gaps = 39/354 (11%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             SL+ + RLK L+ +  N+FCADC +PDPKW S ++GVF+C+KC GVHRSLG HISK++SV
Sbjct  5     SLTGKRRLKDLLVQKDNRFCADCSAPDPKWASANIGVFVCLKCCGVHRSLGTHISKILSV  64

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
              LDEW+++++D + E+GGN  AN  YEA  PE Y K  PD+S EER  FIR KYE Q+F+
Sbjct  65    TLDEWSNDEIDAMMEVGGNASANSIYEAFIPEGYTKPGPDASHEERAKFIRSKYERQEFL  124

Query  835   NSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGM  1014
                                  KHS   RI       + S+ KK  D+ + +  S +M GM
Sbjct  125   ---------------------KHS--LRILSTKSKRQTSFSKKIMDSFRKSSGSKNMEGM  161

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEFIG++KV VV+GTNLAIRDM +SDPYV+L LG Q+V+T VI++NLNPVWNE+LMLS+P
Sbjct  162   VEFIGMLKVKVVKGTNLAIRDMRTSDPYVVLKLGQQTVQTTVIRSNLNPVWNEELMLSVP  221

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
             +   P+ + VFD D F+ DD MGEA+ID+QPL+ +A A  ++   D +    R  K   +
Sbjct  222   QQFGPISLEVFDHDLFSADDIMGEAQIDLQPLINSAMAFGDTGMFDDM----RIGKWLRS  277

Query  1375  -ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
              +NA+             D  +N+ +G V+QE+ +KLQNVE G L +ELE +SL
Sbjct  278   NDNAL-----------IEDSIVNIIDGKVKQEMFIKLQNVECGELNLELEWMSL  320



>ref|XP_008794724.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X2 [Phoenix dactylifera]
 ref|XP_008794725.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X2 [Phoenix dactylifera]
Length=326

 Score =   302 bits (773),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 163/349 (47%), Positives = 216/349 (62%), Gaps = 36/349 (10%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +LK L+    N+FCADCG+PDPKW S ++GVFIC+KC  VHRSLG HISKV+SV LDEWT
Sbjct  14    KLKELLHIRDNRFCADCGAPDPKWASANIGVFICLKCCAVHRSLGTHISKVLSVSLDEWT  73

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  P+ Y K  PDSS EER  FIR KYELQ+F+   L +
Sbjct  74    EDEIESMLEVGGNSYANAIYEAFLPQGYSKPNPDSSHEERAKFIRSKYELQEFLKPSLRI  133

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
                                   +     +          D++       S AGMVEFIG+
Sbjct  134   ----------------------VSSNSSSSSFRSCNSGKDSESGFDLDLSQAGMVEFIGI  171

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +K  V++GTNLAIRDM+SSDPYV+LTLG Q  +T +IK+NLNPVWNE+L L++P+   PL
Sbjct  172   LKAKVIKGTNLAIRDMLSSDPYVVLTLGKQVAQTTIIKSNLNPVWNEELKLAVPKKYGPL  231

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+HVFD D  + DD MGEAE+D+QP++ AA A  +    D +            +NA+  
Sbjct  232   KLHVFDHDMLSKDDLMGEAEVDLQPMITAAMAFGDP---DLLADMQIGKWLQSNDNAL--  286

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                        D TIN+ +G V+QE+ LKLQNVE G +E+ELE + LSQ
Sbjct  287   ---------TKDSTINIVDGKVKQEVSLKLQNVESGEIELELEWIPLSQ  326



>ref|XP_010245698.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Nelumbo nucifera]
Length=332

 Score =   302 bits (773),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 166/352 (47%), Positives = 227/352 (64%), Gaps = 40/352 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RLK L+ +S N+FCADCG+PDPKW S ++GVFIC+KC GVHR+LG HISKV+SV LDEW+
Sbjct  18    RLKELILKSDNRFCADCGAPDPKWASANIGVFICLKCCGVHRNLGTHISKVLSVTLDEWS  77

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              E++D + E+GGN+ AN  YEA  PE + K +PDS  EER  FIR KYELQ+F+   L +
Sbjct  78    EEEIDAMVEVGGNSAANEIYEAFIPEGFSKPRPDSCHEERMKFIRAKYELQEFLKPSLRI  137

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
             +   P                       + ++S  +K  D  +++  S    GMVEFIGL
Sbjct  138   VS-FPARG--------------------SLQSSSSRKIMDNFRSSNSSTKTEGMVEFIGL  176

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQS-VKTRVIKNNLNPVWNEQLMLSIPENVPP  1209
             +KV VV+GTNLAIRDM+SSDPYV+L +G Q  V+T+V+ +NLNP+WNE+LMLS+P+N  P
Sbjct  177   LKVKVVKGTNLAIRDMLSSDPYVVLNVGKQQRVQTQVVHSNLNPIWNEELMLSVPQNYGP  236

Query  1210  LKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK--AETENA  1383
             +KV VFD DTF+ DD MGEAE+DIQP++ AA     ++  DP         K     +NA
Sbjct  237   MKVQVFDHDTFSADDIMGEAEVDIQPMITAA-----TSIGDPSMFSDMQIGKWLKSHDNA  291

Query  1384  MppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             +             D ++N+ +G ++QE+ LKL NVE G +++ELE + L  
Sbjct  292   L-----------IHDSSVNIVDGKIKQEVSLKLMNVESGEIDLELEWIPLDH  332



>gb|EPS72744.1| hypothetical protein M569_02012, partial [Genlisea aurea]
Length=215

 Score =   297 bits (760),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 174/220 (79%), Gaps = 14/220 (6%)
 Frame = +1

Query  484   PRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLD  663
             PR RL++L+ E+GN+FCADCGS DPKW++L  G FICIKCSGVHRSLGVHISKV+SVKLD
Sbjct  3     PRERLESLLSEAGNRFCADCGSQDPKWIALPFGAFICIKCSGVHRSLGVHISKVLSVKLD  62

Query  664   EWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSD  843
             +WT +QVD + EMGGNN  N KYEA  PE+Y+K KP+SS +ERNDFIRRKYE+QQF+N D
Sbjct  63    DWTDDQVDAVMEMGGNNAVNAKYEAHVPESYRKPKPESSADERNDFIRRKYEVQQFLNQD  122

Query  844   LHLMCPL--PttsssstsEK-----KHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNS  1002
             L L CP   P+ +S    E+     K SG HR +G    FRNSWRK +    K ++K +S
Sbjct  123   LQLCCPFNPPSFTSLLAPERKPQHEKQSGAHRSNG----FRNSWRKTDP---KMSKKCSS  175

Query  1003  MAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQ  1122
             MAGM+EF+GLIKVN+VRGTNLA+RDMVSSDPYVIL+LGNQ
Sbjct  176   MAGMIEFVGLIKVNIVRGTNLAVRDMVSSDPYVILSLGNQ  215



>ref|XP_008794720.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Phoenix dactylifera]
 ref|XP_008794722.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Phoenix dactylifera]
 ref|XP_008794723.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Phoenix dactylifera]
Length=349

 Score =   301 bits (772),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 163/349 (47%), Positives = 216/349 (62%), Gaps = 36/349 (10%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +LK L+    N+FCADCG+PDPKW S ++GVFIC+KC  VHRSLG HISKV+SV LDEWT
Sbjct  37    KLKELLHIRDNRFCADCGAPDPKWASANIGVFICLKCCAVHRSLGTHISKVLSVSLDEWT  96

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  P+ Y K  PDSS EER  FIR KYELQ+F+   L +
Sbjct  97    EDEIESMLEVGGNSYANAIYEAFLPQGYSKPNPDSSHEERAKFIRSKYELQEFLKPSLRI  156

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
                                   +     +          D++       S AGMVEFIG+
Sbjct  157   ----------------------VSSNSSSSSFRSCNSGKDSESGFDLDLSQAGMVEFIGI  194

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +K  V++GTNLAIRDM+SSDPYV+LTLG Q  +T +IK+NLNPVWNE+L L++P+   PL
Sbjct  195   LKAKVIKGTNLAIRDMLSSDPYVVLTLGKQVAQTTIIKSNLNPVWNEELKLAVPKKYGPL  254

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+HVFD D  + DD MGEAE+D+QP++ AA A  +    D +            +NA+  
Sbjct  255   KLHVFDHDMLSKDDLMGEAEVDLQPMITAAMAFGDP---DLLADMQIGKWLQSNDNAL--  309

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                        D TIN+ +G V+QE+ LKLQNVE G +E+ELE + LSQ
Sbjct  310   ---------TKDSTINIVDGKVKQEVSLKLQNVESGEIELELEWIPLSQ  349



>ref|XP_004504220.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Cicer arietinum]
Length=329

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 167/352 (47%), Positives = 228/352 (65%), Gaps = 37/352 (11%)
 Frame = +1

Query  478   LSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVK  657
             +S + RLK L+ +  N+FCADCG+PDPKW S ++GVF+C+KC GVHRSLG HIS+++SV 
Sbjct  14    VSSKRRLKDLLVQKDNRFCADCGAPDPKWASANIGVFVCLKCCGVHRSLGTHISRILSVT  73

Query  658   LDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVN  837
             LDEW+++++D + E+GGN  AN  YEA  PE   K  PD+S E+R  FIR KYE Q+F+ 
Sbjct  74    LDEWSNDEIDAMVEVGGNASANSIYEAYIPEGCTKPGPDASHEQRVKFIRSKYERQEFL-  132

Query  838   SDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMV  1017
                                 KHS   RI       ++S+ KK  D+ ++T  S +M GMV
Sbjct  133   --------------------KHS--LRIVSTKSNRQSSFSKKIMDSFRSTSGSKNMEGMV  170

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EF+G++KV VV GTNLAIRDM+SSDPYV+L LG Q+V+T VIK+NLNPVWNE+LMLS+P+
Sbjct  171   EFMGMLKVKVVNGTNLAIRDMMSSDPYVVLKLGQQTVQTAVIKSNLNPVWNEELMLSVPQ  230

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETE  1377
                PL + VFD D F+ DD MGEAEID+QPL+ +A A  ++   D +Q           +
Sbjct  231   QFGPLSMRVFDHDLFSADDIMGEAEIDLQPLITSAIAFGDAGMFDDMQIGKWLK---SND  287

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
             NA+             D  +N+ +G V+Q+I +KLQNVE G + +ELE + L
Sbjct  288   NAL-----------IEDSIVNIIDGKVKQDISIKLQNVECGEIYLELEWICL  328



>ref|XP_007011071.1| Calcium-dependent ARF-type GTPase activating protein family isoform 
2, partial [Theobroma cacao]
 gb|EOY19881.1| Calcium-dependent ARF-type GTPase activating protein family isoform 
2, partial [Theobroma cacao]
Length=288

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 160/287 (56%), Positives = 202/287 (70%), Gaps = 27/287 (9%)
 Frame = +1

Query  328   MSVQQDNTQDNTVGNTEGNNVSGARLYDLLQMDTSP----SDSDQMEP-QMQDY--SLSP  486
             MS Q  N+      + + ++ SG+ LYDLL  +T      SD++     Q +D   S  P
Sbjct  1     MSAQHGNS------DPKSSSGSGSCLYDLLCSETPSWNRVSDAETSSSIQRKDTLKSTGP  54

Query  487   RCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDE  666
             R RL++L+ ESGN  CADCGSPDPKWVS+SLGVFICIKCSGVHRSLGVHISKV+SVKLDE
Sbjct  55    RRRLESLLHESGNGVCADCGSPDPKWVSVSLGVFICIKCSGVHRSLGVHISKVLSVKLDE  114

Query  667   WTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDL  846
             WT +QVD L  +GGN VAN KYEA  P+N KK +PDSS EER+DFI+RKYE+ QF++ + 
Sbjct  115   WTDDQVDSLVNLGGNIVANNKYEACLPDNLKKPRPDSSIEERSDFIKRKYEVLQFLDGND  174

Query  847   HLMCPLPttsssstsEKKHSGGHRI-------------HGLGFAFRNSWRKKESDTQKAT  987
              ++CP P     S+S  + S GH               H +G  FRNSW +K+S+  K+T
Sbjct  175   QIICPYPPHQKPSSSTPQCSAGHHFAQDKKQCEKQPTRHRIGHKFRNSWGRKDSE-HKST  233

Query  988   RKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSV  1128
             +K+NS+AGMVEFIGL+KVNVV+GTNLA+RDM++SDPYVIL LG Q V
Sbjct  234   KKTNSLAGMVEFIGLVKVNVVKGTNLAVRDMMTSDPYVILALGQQLV  280



>ref|XP_009362235.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Pyrus x bretschneideri]
Length=335

 Score =   300 bits (768),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 230/354 (65%), Gaps = 32/354 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLIQKDNRNCADCGATDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN+ AN  YEA  P    K  PD+  EER+ FIR KYELQ F+  
Sbjct  73    DEWSDDEIDAMIEVGGNSSANSIYEAFIPVGVSKPGPDAGHEERSKFIRSKYELQDFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFR-NSWRKKESDTQKATRKSNSMAGMV  1017
              L +                +SG  R + L    + NS+ +K  D+ ++     S  GMV
Sbjct  133   SLRI----------------NSGPSRKNTLQSTLQSNSFSRKIIDSFRSNSSQKSQEGMV  176

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIGL+KV V+RGTNLAIRDM++SDPYVILTLG Q+++T VIK+NLNPVWNE+LMLS+PE
Sbjct  177   EFIGLLKVKVIRGTNLAIRDMMTSDPYVILTLGQQTLRTTVIKSNLNPVWNEELMLSVPE  236

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETE  1377
                PL++ VFD DTF+ DD MGEAE+D+QPL+ +A A  ++     +Q           +
Sbjct  237   QFGPLQL-VFDYDTFSADDIMGEAEVDLQPLITSAMAFGDAGMFGNMQIGKWL---KSND  292

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             NA+             D T+N+ +G V+QE+ LKLQNVE G L++ELE + L Q
Sbjct  293   NAL-----------IDDSTVNIVDGKVKQELSLKLQNVECGELDLELEWMPLEQ  335



>ref|XP_008647900.1| PREDICTED: LOC100283383 isoform X3 [Zea mays]
Length=322

 Score =   299 bits (765),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 166/356 (47%), Positives = 227/356 (64%), Gaps = 44/356 (12%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +L+ L+++SGN+ CADCG+PDPKW S ++GVFIC+KCSGVHRSLG H+SKV+SV LD+WT
Sbjct  4     KLRELLQKSGNRVCADCGAPDPKWASANIGVFICLKCSGVHRSLGTHVSKVLSVTLDQWT  63

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  PE Y+K  PDSS EER DFIR KYELQ+F+   L L
Sbjct  64    DDEINSMIEVGGNSYANAIYEAFLPEGYQKPHPDSSQEERADFIRSKYELQEFLKPSLRL  123

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
             +                         G     S RK   ++   +   +S AGMVEFIG+
Sbjct  124   VS---------------------SNKGSLEATSSRKHMDNSVSLSASFSSEAGMVEFIGI  162

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGN-----QSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             +KV V+RGT LA+RD++SSDPYV+LTLG      Q  KT V K NLNPVWNE+L LS+P+
Sbjct  163   LKVKVIRGTKLAVRDLMSSDPYVVLTLGQQHCSLQKAKTSVSKRNLNPVWNEELKLSVPQ  222

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARA--SENSTKNDPVQQQPRTPKKAE  1371
             +  PLK+ VFD D  + DD MG+AEID+QP++ AA A    +   +  + +  R+P    
Sbjct  223   HYGPLKLQVFDHDMLSKDDEMGDAEIDLQPMISAATAFGDPDLLADMQIGKWLRSP----  278

Query  1372  TENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +NA+             D  +N+  G V+QE+ L+LQNVE G +E+ELE + L+Q
Sbjct  279   -DNAL-----------ARDSAVNVVGGKVKQEVSLRLQNVESGEVELELEWIPLNQ  322



>gb|EYU43231.1| hypothetical protein MIMGU_mgv1a009769mg [Erythranthe guttata]
Length=332

 Score =   299 bits (766),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 165/353 (47%), Positives = 231/353 (65%), Gaps = 32/353 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RL +LM +S N+ CADCG+PDPKW S ++GVFIC+KC G HRSLG HISKV+SV L
Sbjct  12    SGKRRLTSLMIQSDNRVCADCGAPDPKWASANIGVFICLKCCGAHRSLGAHISKVLSVTL  71

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ ++++ + E+GGN  AN  YEA FPE   K KPD+  EER+ FIR KYELQ F+  
Sbjct  72    DEWSDDEIEAMIEVGGNASANSIYEAYFPEGVSKPKPDAGHEERHQFIRSKYELQDFLKP  131

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L ++       S S++  KHS            + S  +K  D+ +++  S +  G+VE
Sbjct  132   SLRIL-------SGSSNNSKHS-----------LQTSLSRKIMDSFRSSSSSQNSNGLVE  173

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++K+ V++GTNLA+RDM+SSDPY+IL+LG Q  +T V+K+NLNPVWNE+L LS+PE+
Sbjct  174   FIGMLKIKVLKGTNLAVRDMLSSDPYIILSLGQQKAQTSVVKSNLNPVWNEELKLSVPED  233

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ V+D D F+ DD MGEAEIDIQP++ +A A  ++     +Q           +N
Sbjct  234   YGSIKLQVYDHDMFSADDIMGEAEIDIQPMITSATAFGDAGMFGDMQIGKWLKS---YDN  290

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D T+N+ +G V+QE+ L+LQNVE G +E+ELE V L Q
Sbjct  291   AL-----------IEDSTVNIVDGKVKQELWLRLQNVESGEVELELEWVPLDQ  332



>ref|XP_007022879.1| Calcium-dependent ARF-type GTPase activating protein family isoform 
1 [Theobroma cacao]
 gb|EOY25501.1| Calcium-dependent ARF-type GTPase activating protein family isoform 
1 [Theobroma cacao]
Length=322

 Score =   298 bits (764),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 169/357 (47%), Positives = 230/357 (64%), Gaps = 40/357 (11%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             + + + RLK L+ ++ N+ CADC +PDPKW S ++GVFIC+KC  VHRSLG HISKV+SV
Sbjct  4     TTTAKARLKNLLSQTDNRHCADCAAPDPKWASANIGVFICLKCCSVHRSLGTHISKVLSV  63

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
              LDEW+ +++D + E+GGN+ AN  YEA  PEN  K  PD+S +ER  FIR KYELQ+FV
Sbjct  64    TLDEWSDDEIDAMIEVGGNSSANAIYEAYIPENCSKPGPDASHDERRRFIRSKYELQEFV  123

Query  835   NSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGM  1014
                L +     + S  S+  +K               +S+R K S+  +         GM
Sbjct  124   KPSLRITSGKSSASLQSSFSRK-------------ILDSFRVKPSENSE---------GM  161

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEFIGL+KV VV+GTNLAIRDM++SDPYV+LTLG Q+V+T +IK+NLNPVWNE+LMLS+P
Sbjct  162   VEFIGLLKVKVVKGTNLAIRDMMTSDPYVVLTLGQQTVQTTIIKSNLNPVWNEELMLSVP  221

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENST--KNDPVQQQPRTPKKA  1368
             +N  P+K+ VFD DTF+ DD MGEAE+DIQPL+ +A A  +     N  + +  ++   A
Sbjct  222   QNFGPVKLQVFDHDTFSADDIMGEAEVDIQPLITSAMAYGDPEMFGNMQIGKWLKSHDNA  281

Query  1369  ETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
               E                D  IN+ +G V+Q++ LKLQNVE G L +E+E + L Q
Sbjct  282   LIE----------------DSIINIVDGKVKQDVSLKLQNVESGELYLEVEWLPLDQ  322



>gb|ADQ00629.1| ARF-GAP protein [Phytolacca acinosa]
Length=332

 Score =   299 bits (765),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 172/353 (49%), Positives = 230/353 (65%), Gaps = 32/353 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+FCADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  12    SGKRRLKDLLLQKDNRFCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  71

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E +D + E+GGN  AN  YEA  PE   K  PD+S ++R  FIR KYELQ+F+  
Sbjct  72    DEWSDEDIDAMVEVGGNAAANAIYEAFIPEGRSKPGPDASHDDRMRFIRSKYELQEFLKP  131

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L ++     +S  ++  KK               NS+R     +  +++KS +  GMVE
Sbjct  132   SLRIVSMSDKSSLQASFSKK-------------LVNSFR-----SSNSSKKSENSEGMVE  173

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++KV VV+GTNLA+RDM+SSDPYV+L LG Q+V+T V+++NLNPVWNE+LMLS+P+ 
Sbjct  174   FIGVLKVKVVKGTNLAVRDMLSSDPYVVLNLGQQTVQTSVVRSNLNPVWNEELMLSVPQR  233

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               P+KV VFD DTF+ DD MGEAE+DIQPL+ +A A  +      +Q       +   +N
Sbjct  234   YGPVKVKVFDYDTFSADDIMGEAELDIQPLITSAMAYGDPGMFGDMQIGKWLKSQ---DN  290

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D  IN+  G V+QE+ LKLQNVE G LE+E+E V L Q
Sbjct  291   AL-----------IEDSIINIVNGKVKQEMQLKLQNVESGDLEIEVEWVPLEQ  332



>gb|ACN85270.1| ZAC [Oryza alta]
Length=321

 Score =   298 bits (763),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 166/349 (48%), Positives = 222/349 (64%), Gaps = 37/349 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +LK L+ +S N+ CADC +PDPKW S ++GVFIC+KCSG+HRSLG HISKV+SV LDEWT
Sbjct  10    KLKELLHKSENRICADCSAPDPKWASANIGVFICLKCSGIHRSLGTHISKVLSVTLDEWT  69

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  P  Y K  PDSS EER DFIR KYELQ+F+   L +
Sbjct  70    DDEINSMLEVGGNSYANAIYEAFLPGGYHKPHPDSSQEERADFIRSKYELQEFLKPSLRI  129

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
             +      SS    + +   G+  +   F                     S AGMVEFIG+
Sbjct  130   VS---NKSSLQAMDSRKDVGNASNSYSF--------------------KSEAGMVEFIGI  166

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KV V+RGT LA+RD++SSDPYV+LTLG Q  KTRVIK+NLNPVWNE L LS+P+   PL
Sbjct  167   LKVKVIRGTKLAVRDILSSDPYVVLTLGQQKAKTRVIKSNLNPVWNEVLTLSVPQKYGPL  226

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+D D  + DD MGEAE+D+QP++ AA A  N     P  Q  R       +NA+  
Sbjct  227   KLQVYDHDVLSRDDIMGEAEVDLQPMITAAMAFGNPGLL-PDMQIGRW--LMSRDNAL--  281

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                        D  +++A G V+QE+ L+LQNVE G +++ELE ++L+Q
Sbjct  282   ---------ARDSAVSVAGGRVKQEVSLRLQNVECGEVDLELEWIALNQ  321



>ref|XP_010942503.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Elaeis guineensis]
 ref|XP_010942504.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Elaeis guineensis]
 ref|XP_010942505.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Elaeis guineensis]
 ref|XP_010942506.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Elaeis guineensis]
Length=326

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 216/349 (62%), Gaps = 36/349 (10%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +LK L+    N+FCADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV LDEWT
Sbjct  14    KLKELLHIRDNRFCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVSLDEWT  73

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  P+ Y K  PD+S EER  FIR KYELQ+F+   L +
Sbjct  74    EDEIESMLEVGGNSYANAIYEAFLPQGYSKPNPDASHEERTKFIRSKYELQEFLKPSLRI  133

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
                                   +     +          DT+       S AGM EFIG+
Sbjct  134   ----------------------VSSKSSSSSFRSCNSGKDTESGFDLDLSQAGMEEFIGI  171

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KV V++GTNLAIRDM+SSDPYV+LTLG Q+ +T VI +NLNPVWNE+L L++P+   PL
Sbjct  172   LKVKVIKGTNLAIRDMLSSDPYVVLTLGKQTGQTTVINSNLNPVWNEELKLAVPKKYGPL  231

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ VFD D  + DD MG+AE+D+QP++ AA A  +    D +            +NA+  
Sbjct  232   KLQVFDHDMLSKDDLMGDAEVDLQPMITAAMAFGDP---DLLADMQIGKWLQSNDNAL--  286

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                        D TIN+ +G V+QE+ LKLQNVE G +E+ELE + LSQ
Sbjct  287   ---------AKDSTINIVDGKVKQEVSLKLQNVESGEIELELEWIPLSQ  326



>ref|XP_004293985.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Fragaria vesca subsp. vesca]
Length=338

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 166/353 (47%), Positives = 228/353 (65%), Gaps = 31/353 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + +LK L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  17    SGKRKLKDLLLQKDNRTCADCGAADPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  76

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ ++++ +TE+GGN+ AN  YEA  PE Y K  PD+  EER+ FIR KYELQ+F+  
Sbjct  77    DEWSDDEIEAMTEVGGNSSANSIYEAFLPEGYSKPGPDAGHEERSKFIRSKYELQEFLKP  136

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +                +S          + + S+ +K  D+ ++   S    GMVE
Sbjct  137   SLRI----------------NSASKPQETPKISVQTSFSRKIMDSFRSN-SSKPTDGMVE  179

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV V++GTNLAIRDM++SDPYVILTLG Q+++T V+K+NLNPVWNE+LMLS+P+ 
Sbjct  180   FIGLLKVKVIKGTNLAIRDMMTSDPYVILTLGRQTLQTTVVKSNLNPVWNEELMLSVPQR  239

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               PL++ VFD D F+ DD MGEAEID+QPL+ +A A  ++     +Q           +N
Sbjct  240   YGPLQLRVFDHDLFSADDIMGEAEIDLQPLITSAMAFGDAGMFGNMQIGKWLKSH---DN  296

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D T+N+ +G VRQ + LKLQNVE G L++ELE + L Q
Sbjct  297   AL-----------LDDSTVNIVDGKVRQAVSLKLQNVECGELDLELEWMPLEQ  338



>ref|XP_001758688.1| predicted protein [Physcomitrella patens]
 gb|EDQ76666.1| predicted protein [Physcomitrella patens]
Length=302

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/348 (47%), Positives = 218/348 (63%), Gaps = 50/348 (14%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             RLK L ++  N+ CADCG+PDPKW S S+GVF+CIKCSGVHRSLGVHISKVVSV LD+W+
Sbjct  3     RLKKLRQQPDNRICADCGAPDPKWASTSIGVFLCIKCSGVHRSLGVHISKVVSVTLDDWS  62

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              EQVD++  +GGN  AN  YEA  P + +K  PD+S +ER++FIRRKYE Q+F+  +L  
Sbjct  63    DEQVDLMEAIGGNASANSVYEACMPSDVRKPSPDASVDERSEFIRRKYEDQEFLKPNL--  120

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
                                               R K   T +A R   S AGMVEF+G+
Sbjct  121   ----------------------------------RMKSQPTSRA-RTITSQAGMVEFLGM  145

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KV +VRGTNLA+RD++SSDPYV+ TLG Q+ KT+V+  NLNPVWNE+LM S+P    PL
Sbjct  146   LKVRIVRGTNLAVRDLLSSDPYVVATLGAQTAKTKVVNRNLNPVWNEELMFSVPSPPQPL  205

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ VFD D  + DD MGEA ID++PL++AA+  +   +    +Q  +    A  +NA+  
Sbjct  206   KLQVFDHDVLSADDSMGEAAIDLEPLILAAQMHQGMFEEFGCEQIGKW--LATDDNAL--  261

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLS  1536
                        D  I + +  ++Q++ LKLQNVERG +EV LE V LS
Sbjct  262   ---------VKDSNIEVIDRQIKQDVHLKLQNVERGQIEVSLEWVPLS  300



>ref|XP_007211569.1| hypothetical protein PRUPE_ppa008355mg [Prunus persica]
 ref|XP_008225596.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Prunus mume]
 gb|EMJ12768.1| hypothetical protein PRUPE_ppa008355mg [Prunus persica]
Length=335

 Score =   298 bits (762),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 165/353 (47%), Positives = 227/353 (64%), Gaps = 30/353 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLLQKDNRSCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN+ AN  YEA  P+   K  PD+  EER+ FIR KYE Q+F+  
Sbjct  73    DEWSDDEIDAMIEVGGNSSANAIYEAFIPDGCSKPGPDAGHEERSKFIRSKYEAQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +                +SG  R + L    ++S   ++      +  S    GMVE
Sbjct  133   SLRI----------------NSGPSRKNSLQNTLQSSSFSRKIIDSFRSNSSQKTEGMVE  176

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV V+RGTNLAIRDM++SDPYVILTLG Q+++T +IK+NLNPVWNE+LMLS+P+ 
Sbjct  177   FIGLLKVKVIRGTNLAIRDMMTSDPYVILTLGQQTLQTTIIKSNLNPVWNEELMLSVPQR  236

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                L++ VFD DTF+ DD MGEAE+D+QPL+ +A A  ++     +Q           +N
Sbjct  237   YGALQLRVFDHDTFSADDIMGEAEVDLQPLITSAMAFGDAGMFGNMQIGKWL---KSNDN  293

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D T+N+ +G V+QE+ LKLQNVE G +++ELE + L Q
Sbjct  294   AL-----------VDDSTVNIVDGKVKQEVTLKLQNVECGEIDLELEWMPLEQ  335



>gb|ACN85257.1| ZAC [Oryza alta]
Length=321

 Score =   296 bits (759),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 223/349 (64%), Gaps = 37/349 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +LK L+ +S N+ CADC +PDPKW S ++GVFIC+KCSG+HRSLG HISKV+SV LD+WT
Sbjct  10    KLKELLHKSENRICADCSAPDPKWASANIGVFICLKCSGIHRSLGTHISKVLSVTLDDWT  69

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  P  Y K  PDSS EER DFIR KYELQ+F+   L +
Sbjct  70    DDEINSMLEVGGNSYANAIYEAFLPGGYHKPHPDSSQEERADFIRSKYELQEFLKPSLRI  129

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
                +   SS   ++ +   G+  +   F                     S AGMVEFIG+
Sbjct  130   ---VSNKSSLQAADSRKDVGNASNSFSF--------------------KSEAGMVEFIGI  166

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KV V+RGT LA+RD++SSDPYV+LTLG Q  KT+VIK+NLNPVWNE L LS+P+   PL
Sbjct  167   LKVKVIRGTKLAVRDILSSDPYVVLTLGQQKAKTKVIKSNLNPVWNEVLTLSVPQKYGPL  226

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+D D  + DD MGEAE+D+QP++ AA A  +      +Q       +   +NA+  
Sbjct  227   KLQVYDHDVLSRDDIMGEAEVDLQPMITAAMAFGDPGLLSDMQIGRWLMSR---DNAL--  281

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                        D T+N+  G V+QE+ L+LQNVE G +++ELE ++L+Q
Sbjct  282   ---------ARDSTVNVVGGRVKQEVSLRLQNVECGEVDLELEWIALNQ  321



>ref|XP_002263067.2| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 [Vitis vinifera]
 ref|XP_010655743.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 [Vitis vinifera]
 ref|XP_010655744.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 [Vitis vinifera]
 ref|XP_010655745.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 [Vitis vinifera]
 emb|CBI31017.3| unnamed protein product [Vitis vinifera]
Length=330

 Score =   296 bits (759),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 170/353 (48%), Positives = 229/353 (65%), Gaps = 35/353 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +S N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLLKSDNRTCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVAL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             D+W+ +++D + E+GGN+ AN  YEA  PE   K KP+SS EER  FIR KYELQ+F+  
Sbjct  73    DDWSDDEIDAMVEVGGNSSANSIYEAFIPEGVTKPKPNSSHEERMRFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +                      +     + ++S+ +K  D  +++  S  + GMVE
Sbjct  133   SLRIAS--------------------VSSGKSSLQSSFSRKLMDNFRSS-NSQKLEGMVE  171

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             +IGL+KV V+RG NLA+RDM+SSDPYV+LTLG Q+V+T+VI +NLNPVWNE+LMLS+P +
Sbjct  172   YIGLLKVKVIRGKNLAVRDMLSSDPYVVLTLGPQTVQTQVITSNLNPVWNEELMLSVPMD  231

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               P+KV VFD DTF+ DD MGEAEIDIQPL+ +A A  N+     +Q           +N
Sbjct  232   YGPIKVKVFDHDTFSADDIMGEAEIDIQPLITSAMAFGNAEMFGDMQIGKWLKSH---DN  288

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D  IN+  G V+QE+ LKLQNVE G L++E+E + L Q
Sbjct  289   AL-----------LEDSIINIIGGKVKQEVQLKLQNVESGELDLEIEWLPLDQ  330



>dbj|BAD35631.1| putative zinc finger and C2 domain protein [Oryza sativa Japonica 
Group]
 dbj|BAD35474.1| putative zinc finger and C2 domain protein [Oryza sativa Japonica 
Group]
 gb|ACN85199.1| ZAC [Oryza glaberrima]
 gb|AEP20523.1| zinc finger protein [Oryza sativa Japonica Group]
Length=321

 Score =   295 bits (756),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 163/349 (47%), Positives = 221/349 (63%), Gaps = 37/349 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +LK L+ +S N+ CADC SPDPKW S ++GVFIC+KCSG+HRSLG HISKV+SV LDEWT
Sbjct  10    KLKELLHKSENRICADCSSPDPKWASANIGVFICLKCSGIHRSLGTHISKVLSVTLDEWT  69

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  P  Y K  PDSS EER DFIR KYELQ+F+   L +
Sbjct  70    DDEINSMLEVGGNSYANAIYEAFLPGGYHKPHPDSSQEERADFIRSKYELQEFLKPSLRI  129

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
                +   SS    + +   G+  +   F                     S AGMVEFIG+
Sbjct  130   ---VSNKSSLQAMDSRKDIGNASNSYSF--------------------KSEAGMVEFIGI  166

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             IKV V+RGT LA+RD++SSDPYV+LTLG Q  KT+VIK+NLNPVWNE L LS+P+   PL
Sbjct  167   IKVKVIRGTKLAVRDILSSDPYVVLTLGQQKAKTKVIKSNLNPVWNEVLTLSVPQKYGPL  226

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+D D  + DD MGEAE+D+QP++ AA A  +      +Q       +   +NA+  
Sbjct  227   KLQVYDHDVLSRDDIMGEAEVDLQPMITAAMAFGDPGLLSDMQIGRWLMSR---DNAL--  281

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                        D  +++  G V+QE+ L+LQNVE G +++ELE ++L+Q
Sbjct  282   ---------ARDSAVSVVGGRVKQEVSLRLQNVECGEVDLELEWIALNQ  321



>gb|KHN06470.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Glycine 
soja]
Length=322

 Score =   295 bits (756),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/352 (46%), Positives = 227/352 (64%), Gaps = 37/352 (11%)
 Frame = +1

Query  478   LSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVK  657
             L+ + R+K L+ +  N+FCADC +PDPKW S ++GVF+C+KC GVHRSLG  ISKV+SV 
Sbjct  6     LTGKRRMKDLLLQKDNRFCADCNAPDPKWASANIGVFVCLKCCGVHRSLGSQISKVLSVT  65

Query  658   LDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVN  837
             LDEW+ +++D + E+GGN+ AN  YEA FPE Y K  PD+S E+R  FIR KYE Q+F+ 
Sbjct  66    LDEWSSDEIDAMIEVGGNSSANSIYEAYFPEGYTKPGPDASHEQRAKFIRLKYERQEFLK  125

Query  838   SDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMV  1017
               L ++                SG            +S  K   D+ + T  S  M GMV
Sbjct  126   PSLRIV----------------SGKSNPP-------SSISKGVKDSFRITSDSQHMEGMV  162

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIG++KV V++GT+LAIRDM++SDPYVIL LG Q+V+T VIK+NLNPVWNE+LMLS+P+
Sbjct  163   EFIGMLKVKVIKGTDLAIRDMMTSDPYVILKLGQQTVQTTVIKSNLNPVWNEELMLSVPQ  222

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETE  1377
                 L ++VFD D F+ DD MGEA+ID+QPL+ +A A  ++   D +Q       +   +
Sbjct  223   QFGILNLNVFDYDLFSADDIMGEADIDLQPLITSAIAYGDARMFDDMQIGKWLKSQ---D  279

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
             NA+             D T+N+ +G V+Q++ +KLQNVE G L++ELE + L
Sbjct  280   NAL-----------IYDSTVNIVDGKVKQDMSIKLQNVESGELDLELEWIPL  320



>ref|XP_009394693.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Musa acuminata subsp. malaccensis]
 ref|XP_009394694.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Musa acuminata subsp. malaccensis]
Length=331

 Score =   295 bits (756),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 164/353 (46%), Positives = 230/353 (65%), Gaps = 35/353 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S R +LK L+ +S N+ CADCG+PDPKW S ++GVFIC+KCSGVHR+LG HISKV+SV L
Sbjct  14    SKRQKLKELLLKSDNRICADCGAPDPKWASANIGVFICLKCSGVHRNLGTHISKVLSVTL  73

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+  Q++ + E+GGN+ AN  YEA  PE Y K   DS+ EER +FIR KYELQ+F+  
Sbjct  74    DEWSDVQINSMIEVGGNSCANAIYEAFLPEGYAKPNSDSNYEERANFIRSKYELQEFLKP  133

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +   +P+ ++S+T                    S +  +S +  A+    S AGMVE
Sbjct  134   SLRI---VPSKNTSTTC------------------GSGKDSDSVSGSASVNKTSQAGMVE  172

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++ V V++GTNLA+RD+ SSDPYV+LTLG Q  +T VIK++LNPVWNE+L LS+P+N
Sbjct  173   FIGILNVKVIKGTNLAVRDVRSSDPYVVLTLGQQRAQTAVIKSDLNPVWNEELKLSVPQN  232

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                LKV VFD+D  +++D MGEA++++QP++ AA A  +    D +            +N
Sbjct  233   YGALKVQVFDQDVLSSNDIMGEADVNLQPMITAATAFGDP---DLLADMQIGKWLQSNDN  289

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D TIN+ +G V+QE+ LKLQNVE G +++ELE + L+Q
Sbjct  290   AL-----------IRDSTINIIDGKVKQEVSLKLQNVESGGIDLELEWIPLAQ  331



>gb|ACN85316.1| ZAC [Oryza brachyantha]
Length=321

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 163/349 (47%), Positives = 223/349 (64%), Gaps = 37/349 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +LK L+++S N+ CADC +PDPKW S ++GVF+C+KCSG+HRSLG HISKV+SV LDEWT
Sbjct  10    KLKELLRKSDNRICADCSAPDPKWASTNIGVFLCLKCSGIHRSLGTHISKVLSVTLDEWT  69

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  P  Y K  PDS+ EER DFIR KYELQ+F+   L +
Sbjct  70    DDEINSMLEVGGNSYANAIYEAFLPVGYHKPHPDSTQEERADFIRSKYELQEFLKPSLRI  129

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
             +      SS    + +   G+  +   F                     S AGMVEFIG+
Sbjct  130   VS---NKSSLQAMDSRKDVGNSSNSYSF--------------------KSEAGMVEFIGI  166

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KV V+RGT LA+RD++SSDPYV+LTLG Q  KTRVIK+NLNPVWNE L LS+P+   PL
Sbjct  167   LKVKVIRGTKLAVRDILSSDPYVVLTLGQQKAKTRVIKSNLNPVWNEVLTLSVPQRYGPL  226

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+D D  + DD MGEAE+D+QP++ AA A  +     P  Q  R  +    +NA+  
Sbjct  227   KLQVYDHDVLSRDDIMGEAEVDLQPMINAAMAFGDPGLL-PDMQIGRWLR--SRDNAL--  281

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                        D  +++A G V+QE+ L LQNVE G +++ELE ++L+Q
Sbjct  282   ---------ARDSAVSVAGGKVKQEVSLTLQNVECGEVDLELEWIALNQ  321



>gb|ACN85166.1| ZAC [Oryza nivara]
 gb|ACN85183.1| ZAC [Oryza rufipogon]
Length=321

 Score =   294 bits (753),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 221/349 (63%), Gaps = 37/349 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +LK L+ +S N+ CADC SPDPKW S ++GVFIC+KCSG+HRSLG HISKV+SV LDEWT
Sbjct  10    KLKELLHKSENRICADCSSPDPKWASANIGVFICLKCSGIHRSLGTHISKVLSVTLDEWT  69

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  P  Y K  PDSS EER DFIR KYELQ+F+   L +
Sbjct  70    DDEINSMLEVGGNSYANAIYEAFLPGGYHKPHPDSSQEERADFIRSKYELQEFLKPSLRI  129

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
                +   SS    + +   G+  +   F                     S AGMVEFIG+
Sbjct  130   ---VSNKSSLQAMDSRKDIGNASNSYSF--------------------KSEAGMVEFIGI  166

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             IKV V+RGT LA+RD++SSDPYV+LTLG Q  KT+VIK+NLNPVWNE L LS+P+   PL
Sbjct  167   IKVKVIRGTKLAVRDILSSDPYVVLTLGQQKAKTKVIKSNLNPVWNEVLTLSVPQKYGPL  226

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+D D  + DD MGEAE+D+QP++ AA A  +      +Q       +   +NA+  
Sbjct  227   KLQVYDHDVLSRDDIMGEAEVDLQPMITAAMAFGDPGLLSDMQIGRWLMSR---DNAL--  281

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                        D  +++  G V+QE+ L+LQNVE G +++E+E ++L+Q
Sbjct  282   ---------ARDSAVSVVGGRVKQEVSLRLQNVECGEVDLEVEWIALNQ  321



>ref|XP_002298890.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE83695.1| zinc finger family protein [Populus trichocarpa]
Length=330

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 172/355 (48%), Positives = 227/355 (64%), Gaps = 38/355 (11%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +S N+FCADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  12    SGKRRLKDLLLQSDNRFCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  71

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN  AN  YEA  PE   K  P+SS EER  FIR KYELQ+F+  
Sbjct  72    DEWSDDEIDAMIEVGGNLSANSIYEAFLPEGVSKPGPNSSNEERTRFIRSKYELQEFLKP  131

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +     ++SS  +S   +                      D+ +    S ++ G+VE
Sbjct  132   SLRITSGKTSSSSLKSSLSTNL--------------------FDSFQIPSVSQNLDGIVE  171

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             F+G++KV V++GTNLAIRDM+SSDPYVI+ LG Q+ +T V+K+NLNPVWNE+LMLS+P++
Sbjct  172   FMGILKVKVIKGTNLAIRDMMSSDPYVIVALGKQTAQTTVMKSNLNPVWNEELMLSVPQD  231

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK--AET  1374
               P+K+ VFD DTF+ DD MGEAEIDIQPL+ +A A       DP         K     
Sbjct  232   FGPIKLSVFDHDTFSADDIMGEAEIDIQPLITSAMAF-----GDPEMFGNMQIGKWLKSN  286

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             +NA+             D  IN+ +G V+QEI LKLQNVE G L+VELE + L Q
Sbjct  287   DNAL-----------IDDSIINIVDGKVKQEISLKLQNVESGELQVELEWMPLDQ  330



>gb|ACN85244.1| ZAC [Oryza officinalis]
Length=321

 Score =   294 bits (752),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 221/349 (63%), Gaps = 37/349 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +LK L+ +S N+ CADC +PDPKW S ++GVFIC+KCSG+HRSLG HISKV+SV LD+WT
Sbjct  10    KLKELLHKSENRICADCSAPDPKWASANIGVFICLKCSGIHRSLGTHISKVLSVTLDDWT  69

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  P  Y K  PDSS EER DFIR KYELQ+F+   L +
Sbjct  70    DDEINSMLEVGGNSYANAIYEAFLPGGYHKPHPDSSQEERADFIRSKYELQEFLKPSLRI  129

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
                +   SS   ++ +   G+  +   F                     S AGMVEFIG+
Sbjct  130   ---VSNKSSLQAADSRKDVGNASNSFSF--------------------KSEAGMVEFIGI  166

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KV V+RGT LA+RD++SSDPYV+LTLG Q  KT+VIK+NLNPVWNE L LS+P+   PL
Sbjct  167   LKVKVIRGTKLAVRDILSSDPYVVLTLGQQKAKTKVIKSNLNPVWNEVLTLSVPQKYGPL  226

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+D D  + DD MGEAE+D+QP++ AA A       DP            ++  +  
Sbjct  227   KLQVYDHDVLSRDDIMGEAEVDLQPMITAAMAF-----GDP---------GLLSDMQIGR  272

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              L      L  D  +N+  G V+QE+ L+LQNVE G +++ELE ++L+Q
Sbjct  273   WLMSHDNALARDSAVNVVGGRVKQEVSLRLQNVECGEVDLELEWIALNQ  321



>gb|ACN85216.1| ZAC [Oryza punctata]
Length=321

 Score =   294 bits (752),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 161/349 (46%), Positives = 221/349 (63%), Gaps = 37/349 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +LK L+ +S N+ CADC +PDPKW S ++GVFIC+KCSG+HRSLG HISKV+SV LDEWT
Sbjct  10    KLKELLHKSENRICADCSAPDPKWASANIGVFICLKCSGIHRSLGTHISKVLSVTLDEWT  69

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  P  Y K  PDSS EER DFIR KYELQ+F+   L +
Sbjct  70    DDEINSILEVGGNSYANAIYEAFLPGGYHKPHPDSSQEERADFIRSKYELQEFLKPSLRI  129

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
                +   SS    + +   G+  +   F                     S AGMVEFIG+
Sbjct  130   ---VSNKSSLQAMDSRKDVGNASNSFSF--------------------KSEAGMVEFIGI  166

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KV V+RGT LA+RD++SSDPYV+LTLG Q  KT+VIK+NLNPVWNE L LS+P+   PL
Sbjct  167   LKVKVIRGTKLAVRDILSSDPYVVLTLGQQKAKTKVIKSNLNPVWNEVLTLSVPQKYGPL  226

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+D D  + DD MGEAE+D+QP++ AA A  +      +Q       +   +NA+  
Sbjct  227   KLQVYDHDVLSRDDIMGEAEVDLQPMITAAMAFGDPGLLSDMQIGRWLMSR---DNAL--  281

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                        D  +++  G V+QE+ L+LQNVE G +++ELE ++L+Q
Sbjct  282   ---------ARDSAVSVVGGRVKQEVSLRLQNVECGEVDLELEWIALNQ  321



>ref|XP_006413813.1| hypothetical protein EUTSA_v10025660mg [Eutrema salsugineum]
 ref|XP_006413814.1| hypothetical protein EUTSA_v10025660mg [Eutrema salsugineum]
 ref|XP_006413815.1| hypothetical protein EUTSA_v10025660mg [Eutrema salsugineum]
 ref|XP_006413816.1| hypothetical protein EUTSA_v10025660mg [Eutrema salsugineum]
 gb|ESQ55266.1| hypothetical protein EUTSA_v10025660mg [Eutrema salsugineum]
 gb|ESQ55267.1| hypothetical protein EUTSA_v10025660mg [Eutrema salsugineum]
 gb|ESQ55268.1| hypothetical protein EUTSA_v10025660mg [Eutrema salsugineum]
 gb|ESQ55269.1| hypothetical protein EUTSA_v10025660mg [Eutrema salsugineum]
Length=337

 Score =   294 bits (752),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 167/353 (47%), Positives = 225/353 (64%), Gaps = 28/353 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +S N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLNQSDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K  PD+S ++R  FIR KYELQ+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFIPEGSSKPGPDASHDQRMRFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +        +S       +  +    L     +S+R   S  Q        + GMVE
Sbjct  133   SLRI--------TSVKGSSTKNPAYLSSSLSKKIIDSFRTNSSSQQP------QLEGMVE  178

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++KV + +GTNLAIRDM++SDPYV+LTLG Q+V++ V+K+NLNPVWNE+LMLS+P N
Sbjct  179   FIGMLKVTLKKGTNLAIRDMMTSDPYVVLTLGQQTVQSTVMKSNLNPVWNEELMLSVPHN  238

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ VFD DTF+ DD MGEAEIDIQPL+ +A A  +      +Q           +N
Sbjct  239   YGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQIGKWLKSH---DN  295

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D  IN+A+G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  296   AL-----------IEDSIINIADGKVKQEVQIKLQNVESGELELEVEWLPLDQ  337



>ref|XP_006656236.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Oryza brachyantha]
Length=367

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/349 (47%), Positives = 223/349 (64%), Gaps = 37/349 (11%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +LK L+++S N+ CADC +PDPKW S ++GVF+C+KCSG+HRSLG HISKV+SV LDEWT
Sbjct  56    KLKELLRKSDNRICADCSAPDPKWASTNIGVFLCLKCSGIHRSLGTHISKVLSVTLDEWT  115

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              ++++ + E+GGN+ AN  YEA  P  Y K  PDS+ EER DFIR KYELQ+F+   L +
Sbjct  116   DDEINSMLEVGGNSYANAIYEAFLPVGYHKPHPDSTQEERADFIRSKYELQEFLKPSLRI  175

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
                +   SS    + +   G+  +   F                     S AGMVEFIG+
Sbjct  176   ---VSNKSSLQAMDSRKDVGNSSNSYSF--------------------KSEAGMVEFIGI  212

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             +KV V+RGT LA+RD++SSDPYV+LTLG Q  KTRVIK+NLNPVWNE L LS+P+   PL
Sbjct  213   LKVKVIRGTKLAVRDILSSDPYVVLTLGQQKAKTRVIKSNLNPVWNEVLTLSVPQRYGPL  272

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             K+ V+D D  + DD MGEAE+D+QP++ AA A  +     P  Q  R  +    +NA+  
Sbjct  273   KLQVYDHDVLSRDDIMGEAEVDLQPMINAAMAFGDPGLL-PDMQIGRWLR--SRDNAL--  327

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                        D  +++A G V+QE+ L LQNVE G +++ELE ++L+Q
Sbjct  328   ---------ARDSAVSVAGGKVKQEVSLTLQNVECGEVDLELEWIALNQ  367



>ref|XP_006448905.1| hypothetical protein CICLE_v10015859mg [Citrus clementina]
 ref|XP_006448906.1| hypothetical protein CICLE_v10015859mg [Citrus clementina]
 ref|XP_006448907.1| hypothetical protein CICLE_v10015859mg [Citrus clementina]
 ref|XP_006468309.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Citrus sinensis]
 ref|XP_006468310.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X2 [Citrus sinensis]
 ref|XP_006468311.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X3 [Citrus sinensis]
 gb|ESR62145.1| hypothetical protein CICLE_v10015859mg [Citrus clementina]
 gb|ESR62146.1| hypothetical protein CICLE_v10015859mg [Citrus clementina]
 gb|ESR62147.1| hypothetical protein CICLE_v10015859mg [Citrus clementina]
 gb|KDO75257.1| hypothetical protein CISIN_1g019726mg [Citrus sinensis]
 gb|KDO75258.1| hypothetical protein CISIN_1g019726mg [Citrus sinensis]
 gb|KDO75259.1| hypothetical protein CISIN_1g019726mg [Citrus sinensis]
 gb|KDO75260.1| hypothetical protein CISIN_1g019726mg [Citrus sinensis]
 gb|KDO75261.1| hypothetical protein CISIN_1g019726mg [Citrus sinensis]
Length=336

 Score =   293 bits (749),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 220/343 (64%), Gaps = 40/343 (12%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG H+SKV+SV L
Sbjct  18    SGKGRLKDLLLQRDNRICADCGAPDPKWASANIGVFICLKCCGVHRSLGTHVSKVLSVTL  77

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             D+W+ ++VD + E+GGN+ AN  YEA  PE   K  PDSS E R+ FIR KYELQ+F+  
Sbjct  78    DDWSDDEVDAMIEVGGNSSANAIYEAFIPEGVSKPGPDSSHEIRSKFIRSKYELQEFLKP  137

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSM-AGMV  1017
              L +    P+                      + ++S+ +K  D+ ++T  S     GMV
Sbjct  138   SLRIASGKPSA---------------------SLQSSFSRKIIDSFRSTNSSQKKDVGMV  176

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIGL+KV VV+G NLAIRDM+SSDPYV+L LG Q+V+T ++K+NLNPVWNE+LMLS+P+
Sbjct  177   EFIGLLKVKVVKGINLAIRDMMSSDPYVVLRLGQQTVQTTIVKSNLNPVWNEELMLSVPQ  236

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENST--KNDPVQQQPRTPKKAE  1371
                P+K+ VFD DTF+ DD MGEAEIDIQPLL +A A  +     N  + +  ++   A 
Sbjct  237   EYGPVKLEVFDHDTFSADDIMGEAEIDIQPLLTSALAFGDPEMFGNMQIGKWLKSDDNAL  296

Query  1372  TENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERG  1500
              E                D TIN+ +G V+Q+I LKLQNVE G
Sbjct  297   LE----------------DSTINIIDGKVKQKISLKLQNVESG  323



>ref|XP_003535088.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 isoform X1 [Glycine max]
Length=324

 Score =   292 bits (747),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 164/353 (46%), Positives = 228/353 (65%), Gaps = 36/353 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S R +LK L+ +SGN+ CADC +PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  8     SSRRKLKDLLHQSGNRLCADCNAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  67

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             D+W+ +++D + E+GGN  AN  YEA  PE Y K  PD+  E+R+ FIR KYELQ+F+  
Sbjct  68    DDWSEDEIDAMIEVGGNVSANSIYEAYIPEGYTKPGPDAGHEQRSKFIRSKYELQEFLKP  127

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L ++    +  SSS                 +F +S+        K+T  S  M GMVE
Sbjct  128   SLRIVSGKSSLQSSSAKS--------------SFMDSF--------KSTSSSQRMEGMVE  165

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++KV V++GTNLAIRD+ SSDPYV+L+LG Q+V+T +I++NLNPVWNE+ MLS+PE+
Sbjct  166   FIGMLKVKVIKGTNLAIRDIKSSDPYVVLSLGQQTVQTTIIRSNLNPVWNEEYMLSVPEH  225

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ VFD DTF+ DD MGEA+ID+Q L+ +A A  ++     +Q           +N
Sbjct  226   YGQIKLKVFDHDTFSADDIMGEADIDLQSLITSAMAFGDAGMFGDMQIGKWLKSD---DN  282

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D T+N+ +G V+Q + LKLQ+VE G L++ELE + L Q
Sbjct  283   AL-----------IEDSTVNIVDGKVKQMMSLKLQDVESGELDLELEWIPLEQ  324



>ref|XP_010687080.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Beta vulgaris subsp. vulgaris]
Length=333

 Score =   292 bits (747),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 168/356 (47%), Positives = 227/356 (64%), Gaps = 37/356 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+FCADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  12    SGKRRLKDLLLKKDNRFCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  71

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E +D + E+GGN  AN  YEA  P+   K  PD+S ++R  FIR KYELQ+F+  
Sbjct  72    DEWSDEDIDAMVEVGGNAAANAIYEAFIPDGSSKPGPDASHDDRMRFIRSKYELQEFLKP  131

Query  841   DLHLMC-PLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMV  1017
              L ++  P    S   +  KK               NS+R   S  +  + +     GMV
Sbjct  132   SLRIVSMPAAKNSLQPSLSKK-------------LMNSFRGSHSSKRSESSE-----GMV  173

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIG++KV VV+GT LA+RDM+SSDPYV+L LG+Q+++T V+K+NLNP+WNE+LMLS+P+
Sbjct  174   EFIGVLKVKVVKGTTLAVRDMLSSDPYVVLNLGHQNIQTSVVKSNLNPIWNEELMLSVPQ  233

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENST--KNDPVQQQPRTPKKAE  1371
                P+K+ VFD DTF+ DD MGEAEIDIQPL+ +A A  +     N  + +  ++   A 
Sbjct  234   RYGPVKLKVFDHDTFSADDIMGEAEIDIQPLITSAMAYGDPGMFGNMQIGKWLKSHDNAL  293

Query  1372  TENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              E                D  IN+ +G V+QE+ LKLQNVE G LE+E+E + L Q
Sbjct  294   VE----------------DSIINIVDGKVKQEMQLKLQNVESGELELEVEWMPLEQ  333



>ref|XP_006580209.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Glycine max]
Length=322

 Score =   291 bits (746),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 161/352 (46%), Positives = 226/352 (64%), Gaps = 37/352 (11%)
 Frame = +1

Query  478   LSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVK  657
             L+ + R+K L+ +  N+FCADC +PDPKW S ++GVF+C+KC GVHRSLG  ISKV+SV 
Sbjct  6     LTGKRRMKDLLLQKDNRFCADCNAPDPKWASANIGVFVCLKCCGVHRSLGSQISKVLSVT  65

Query  658   LDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVN  837
             LDEW+ +++D + E+GGN+ AN  YEA FPE Y K   D+S E+R  FIR KYE Q+F+ 
Sbjct  66    LDEWSSDEIDAMIEVGGNSSANSIYEAYFPEGYTKPGSDASHEQRAKFIRLKYERQEFLK  125

Query  838   SDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMV  1017
               L ++                SG            +S  K   D+ + T  S  M GMV
Sbjct  126   PSLRIV----------------SGKSNPP-------SSISKGVKDSFRITSDSQHMEGMV  162

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIG++KV V++GT+LA+RDM++SDPYVIL LG Q+V+T VIK+NLNPVWNE+LMLS+P+
Sbjct  163   EFIGMLKVKVIKGTDLAVRDMMTSDPYVILKLGQQTVQTTVIKSNLNPVWNEELMLSVPQ  222

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETE  1377
                 L ++VFD D F+ DD MGEA+ID+QPL+ +A A  ++   D +Q       +   +
Sbjct  223   QFGILNLNVFDYDLFSADDIMGEADIDLQPLITSAIAYGDARMFDDMQIGKWLKSQ---D  279

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
             NA+             D T+N+ +G V+Q++ +KLQNVE G L++ELE + L
Sbjct  280   NAL-----------IYDSTVNIVDGKVKQDMSIKLQNVESGELDLELEWIPL  320



>ref|XP_002869903.1| zac [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46162.1| zac [Arabidopsis lyrata subsp. lyrata]
Length=332

 Score =   291 bits (746),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 169/357 (47%), Positives = 223/357 (62%), Gaps = 32/357 (9%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S S + R++ L+ +S N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV
Sbjct  6     SGSGKRRIRDLLTQSDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSV  65

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
              LDEW+ E+VD + E+GGN  AN  YEA  PE   K  PD+S ++R  FIR KYE Q+F+
Sbjct  66    TLDEWSDEEVDSMIEIGGNASANSIYEAFIPEGSSKPGPDASHDQRMRFIRSKYEHQEFL  125

Query  835   NSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGM  1014
                L +        +S       S  +    +     +S+R   S  Q        + GM
Sbjct  126   KPSLRI--------TSVRGSSTKSTPYLSSSISKKIIDSFRTNSSSQQP------QLEGM  171

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEFIGL+KV + +GTNLA+RDM+SSDPYV+LTLG Q  ++ V+K+NLNPVWNE+LMLS+P
Sbjct  172   VEFIGLLKVTIKKGTNLAVRDMMSSDPYVVLTLGQQKAQSTVVKSNLNPVWNEELMLSVP  231

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK--A  1368
              N   +K+ VFD DTF+ DD MGEAEIDIQPL+ +A A       DP         K   
Sbjct  232   HNYGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAF-----GDPEMFGDMQIGKWLK  286

Query  1369  ETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
               +NA+             D  IN+A+G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  287   SHDNAL-----------IEDSIINIADGKVKQEVQIKLQNVESGELELEMEWLPLDQ  332



>gb|EYU19118.1| hypothetical protein MIMGU_mgv1a009770mg [Erythranthe guttata]
 gb|EYU19119.1| hypothetical protein MIMGU_mgv1a009770mg [Erythranthe guttata]
Length=332

 Score =   291 bits (746),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 162/355 (46%), Positives = 224/355 (63%), Gaps = 37/355 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCGSPDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLVQRDNRVCADCGSPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ ++VD + E+GGN  AN  YEA  P+   K  PD+S E R+ FIR KYE Q+F+  
Sbjct  73    DEWSDDEVDSMIEVGGNASANSIYEAYIPDGVSKPGPDASHEVRSKFIRSKYEHQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +     +T                     + + S  +K  D+ +++  S    GMVE
Sbjct  133   SLRIHSTSSSTKH-------------------SLQASLSRKIMDSFRSSGSSEKSVGMVE  173

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++K+ V++G NLAIRDM+SSDPYV+LTLG Q  +T V+K+NLNPVWNE+LMLS+P+N
Sbjct  174   FIGMLKIKVIKGVNLAIRDMLSSDPYVVLTLGQQKAQTTVVKSNLNPVWNEELMLSVPQN  233

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASEN--STKNDPVQQQPRTPKKAET  1374
               P+K+ V+D DTF++DD MGEAEIDIQ ++ +A A  +     N  + +  ++   A  
Sbjct  234   YGPIKLQVYDYDTFSSDDIMGEAEIDIQSMITSATAFGDIGMFGNMQIGKWLKSHDNALI  293

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             E                D T+N+ +G V+Q + LKLQNVE G +++ELE + L Q
Sbjct  294   E----------------DSTVNIVDGKVKQAVSLKLQNVESGDIDLELEWIPLDQ  332



>dbj|BAF01268.1| hypothetical protein [Arabidopsis thaliana]
Length=337

 Score =   291 bits (746),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 167/353 (47%), Positives = 222/353 (63%), Gaps = 28/353 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +S N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLTQSDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGSHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K  PD+S ++R  FIR KYE Q+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFIPEGSSKPGPDASHDQRMRFIRSKYEHQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +        +S       +       L     +S+R   S  Q        + GMVE
Sbjct  133   SLRI--------TSVRGSSTKTPAFLSSSLSKKIVDSFRTNSSSQQP------QLEGMVE  178

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV + +GTN+AIRDM+SSDPYV+LTLG Q V++ V+K+NLNPVWNE+LMLS+P N
Sbjct  179   FIGLLKVTIKKGTNMAIRDMMSSDPYVVLTLGQQKVQSTVVKSNLNPVWNEELMLSVPHN  238

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ VFD DTF+ DD MGEAEIDIQPL+ +A A  +      +Q           +N
Sbjct  239   YGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQIGKWLKSH---DN  295

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D  IN+A+G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  296   AL-----------IEDSIINIADGKVKQEVQIKLQNVESGELELEMEWLPLEQ  337



>ref|XP_002981669.1| hypothetical protein SELMODRAFT_115211 [Selaginella moellendorffii]
 gb|EFJ17151.1| hypothetical protein SELMODRAFT_115211 [Selaginella moellendorffii]
Length=325

 Score =   291 bits (745),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 164/355 (46%), Positives = 223/355 (63%), Gaps = 40/355 (11%)
 Frame = +1

Query  496   LKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTH  675
             LK L+ +  N+ CADCG+ DPKW S +LGVF+CI+CSG+HRSLGVHISKV+S  LDEWT 
Sbjct  4     LKRLLAQRDNRVCADCGAADPKWASANLGVFVCIQCSGIHRSLGVHISKVMSTSLDEWTD  63

Query  676   EQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLM  855
             EQV ++ E+GGN  AN  YEA  P   +K  PDS+ EER ++I RKYE Q FV   L L 
Sbjct  64    EQVSVMAEVGGNAAANAIYEAHLPAGSRKPCPDSTMEERREWIVRKYEYQDFVKPTLRL-  122

Query  856   CPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSM---AGMVEFI  1026
                            +S  H  H     +R S+R++E           +    A MVEF+
Sbjct  123   ---------------NSTNHSSH-----YRQSFRQEEEPLPSFLTTKLAFLFQAAMVEFL  162

Query  1027  GLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVP  1206
             GL+KV VV+GTNLA+RD+++SDPYV+L LG+Q+ KT+V+ +NLNPVW+E++MLS+P   P
Sbjct  163   GLLKVRVVKGTNLAVRDILTSDPYVVLNLGHQTAKTKVVNSNLNPVWDEEIMLSVPSGPP  222

Query  1207  -PLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKN---DPVQQQPRTPKKAET  1374
              PLK+ VFD D F+ DD MGE E+D+QP++ AA   E + ++   DP + Q      A  
Sbjct  223   VPLKLQVFDYDKFSADDIMGEVEVDLQPIVAAASVLEEAMEDQIVDPGEVQIGR-CLATA  281

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             ENA+             D  I L  G ++Q++ +KLQNVE G +++ELE V L+Q
Sbjct  282   ENAL-----------VSDSVIRLVGGQIKQDLAVKLQNVESGEVQLELEWVPLAQ  325



>ref|XP_010455861.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Camelina sativa]
Length=334

 Score =   291 bits (745),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 168/353 (48%), Positives = 222/353 (63%), Gaps = 31/353 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLNQPDNRVCADCGASDPKWASTNIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  P+   K  PD S ++R  FIR KYELQ+F+  
Sbjct  73    DEWSEEEVDSMIEIGGNASANSIYEAFVPDTCSKPGPDVSHDQRMRFIRAKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +                 SG        F   +S  +K  D+ K+   S  M GMVE
Sbjct  133   SLRI----------------KSGKRSTKSSAF-LTSSLSRKIMDSFKSNSSSQKMEGMVE  175

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV V +GTNLAIRD++SSDPYV+L LG Q ++T V+ +NLNPVWN++LMLS+PE+
Sbjct  176   FIGLLKVTVKKGTNLAIRDLMSSDPYVVLNLGKQKLQTTVVNSNLNPVWNQELMLSVPES  235

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               P+K+ V+D DTF+ DD MGEA+IDIQPL+ +A A       DP         +   + 
Sbjct  236   YGPVKLQVYDYDTFSADDIMGEADIDIQPLITSAMAF-----GDP---------EMFGDM  281

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  282   QIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVECGELELEMEWLPLDQ  334



>ref|XP_004231566.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 [Solanum lycopersicum]
 ref|XP_010315635.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 [Solanum lycopersicum]
Length=331

 Score =   291 bits (744),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 163/354 (46%), Positives = 231/354 (65%), Gaps = 36/354 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCGSPDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SSKRRLKDLLLQKDNRVCADCGSPDPKWASTNIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN  AN  YEA  PE   K   D+S E+R+ FIR KYE Q+F+  
Sbjct  73    DEWSDDEIDAMVEVGGNASANSIYEAYIPEGISKPGADASHEQRSKFIRSKYERQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMA-GMV  1017
              L ++          +++KK S            + S   K +D+ +++  ++  + GMV
Sbjct  133   SLRIL----------SNQKKGS-----------LKTSLSNKITDSFRSSSSTSQKSEGMV  171

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIG++KV V++GTNLAIRDM+SSDPYV+L LG Q V+T V+K+NLNP+WNE++MLS+P+
Sbjct  172   EFIGMLKVKVIKGTNLAIRDMLSSDPYVVLNLGKQKVQTSVVKSNLNPIWNEEVMLSVPQ  231

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETE  1377
             +   +++ V+D DTF+ DD MGEAEIDIQP++ +A A  ++     +Q           +
Sbjct  232   DYGVVRLQVYDHDTFSADDIMGEAEIDIQPMITSAMAFGDAGMFGNMQIGKWL---KSND  288

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             NA+             D T+N+ +G V+QE+ LKLQNVE G LE+ELE + L Q
Sbjct  289   NAL-----------LDDSTVNIVDGKVKQEVNLKLQNVESGDLELELEWIPLDQ  331



>ref|XP_010422422.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Camelina sativa]
Length=334

 Score =   291 bits (744),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 167/353 (47%), Positives = 223/353 (63%), Gaps = 31/353 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLNQPDNRVCADCGASDPKWASTNIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  P+   K  PD S ++R  FI+ KYELQ+F+  
Sbjct  73    DEWSEEEVDSMIEIGGNASANSIYEAFVPDTCSKPGPDVSHDQRMRFIKAKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +                 SG        F   +S  +K  D+ K+   S  M GMVE
Sbjct  133   SLRI----------------KSGKRSTKSSAF-LTSSLSRKIMDSFKSNSSSQKMEGMVE  175

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV V +GTNLAIRD++SSDPYV+L LG Q+++T V+ +NLNPVWN++LMLS+PE+
Sbjct  176   FIGLLKVTVKKGTNLAIRDLMSSDPYVVLNLGKQTLQTTVVNSNLNPVWNQELMLSVPES  235

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               P+K+ V+D DTF+ DD MGEA+IDIQPL+ +A A       DP         +   + 
Sbjct  236   YGPVKLQVYDYDTFSADDIMGEADIDIQPLITSAMAF-----GDP---------EMFGDM  281

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  282   QIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVECGELELEMEWLPLDQ  334



>ref|XP_008445220.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Cucumis melo]
 ref|XP_008445229.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Cucumis melo]
Length=333

 Score =   291 bits (744),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 162/353 (46%), Positives = 225/353 (64%), Gaps = 32/353 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  NQ CADCG+PDPKW S ++GVFIC+KCSGVHRSLG HISKV+S+ L
Sbjct  13    SAKSRLKDLLLQIDNQLCADCGAPDPKWASANIGVFICLKCSGVHRSLGTHISKVLSITL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN  AN  YEA  P+ Y K  P +S EER++FIR KYELQ+F+  
Sbjct  73    DEWSDDEIDAMIEVGGNGSANAIYEAFIPDGYTKPGPSASHEERSNFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L ++        S+ S K          +  +FR+S   K+S  +          GMVE
Sbjct  133   SLRIV--------SNNSSKSSEEPSYFQEITDSFRSSNSSKKSPQE----------GMVE  174

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             F+GL+KV V++GTNLA+RD+ +SDP+V LTLG Q+ KT VIK+NLNPVWNE+LMLS+P  
Sbjct  175   FMGLLKVKVIKGTNLAVRDVKTSDPFVTLTLGQQTAKTTVIKSNLNPVWNEELMLSVPLE  234

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               PLK+ VFD D   ++D MGEAEID+QP++ +A A  ++   + +Q           +N
Sbjct  235   YGPLKLQVFDHDMILSNDLMGEAEIDLQPMITSAIAFGDAEMLENMQIGKWL---KSDDN  291

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D  + + +G V+QE+ LKLQNVE G + +ELE + + Q
Sbjct  292   AL-----------IDDSAVVIVDGKVKQEVSLKLQNVESGEVHLELEWMPIDQ  333



>ref|XP_009418489.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Musa acuminata subsp. malaccensis]
Length=320

 Score =   290 bits (742),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 222/349 (64%), Gaps = 35/349 (10%)
 Frame = +1

Query  493   RLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWT  672
             +LK L+ +S N+ CADCG+ DPKW S ++GVFIC+KCSGVHRSLG HISKV+SV LDEW+
Sbjct  7     KLKDLLLKSDNRNCADCGATDPKWASANIGVFICLKCSGVHRSLGTHISKVLSVTLDEWS  66

Query  673   HEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHL  852
              E+++ + E+GGN+ AN  YEA  P+ + K KPDSS +ER  FIR KY+LQ+F+   L +
Sbjct  67    DEEINSMIEVGGNSYANAIYEAFLPKGFSKPKPDSSHQERTKFIRSKYQLQEFLKPSLRI  126

Query  853   MCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGL  1032
             +                S G       F   +S +  +S +   +  S S AGMVEFIG+
Sbjct  127   V---------------SSKG------SFTSCDSGKDTDSISPSESSTSISQAGMVEFIGI  165

Query  1033  IKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPL  1212
             + V V+RGTNLA+RDM++SDPYV+L LG Q  +T VIK+NLNPVWNE+L LS+P+N   L
Sbjct  166   LNVKVIRGTNLAVRDMLTSDPYVVLILGQQKAQTAVIKSNLNPVWNEELKLSVPQNYGAL  225

Query  1213  KVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMpp  1392
             KV V+D D  ++DD MGEAE+D+QP++ +A A  +    D +            +NA+  
Sbjct  226   KVQVYDHDLISSDDIMGEAEVDLQPMITSATAFGDP---DLLSDMQIGKWLLSNDNAL--  280

Query  1393  plplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                        D  IN+ +G V+QE+ LKLQNVE G L++EL  + L Q
Sbjct  281   ---------IRDSVINVVDGKVKQEVSLKLQNVECGELDLELRWIPLIQ  320



>gb|AAM65970.1| putative GTPase activating protein [Arabidopsis thaliana]
Length=337

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 166/353 (47%), Positives = 221/353 (63%), Gaps = 28/353 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +S N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLTQSDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGSHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K  PD+S ++R  FIR KYE Q+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFIPEGSSKPGPDASHDQRMRFIRSKYEHQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +        +S       +       L     +S+R   S  Q        + GMVE
Sbjct  133   SLRI--------TSVRVSSTKTPAFLSSSLSKKIVDSFRTNSSSQQP------QLEGMVE  178

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV + +GTN+AIRDM+SSDPYV+LTLG Q  ++ V+K+NLNPVWNE+LMLS+P N
Sbjct  179   FIGLLKVTIKKGTNMAIRDMMSSDPYVVLTLGQQKAQSTVVKSNLNPVWNEELMLSVPHN  238

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ VFD DTF+ DD MGEAEIDIQPL+ +A A  +      +Q           +N
Sbjct  239   YGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQIGKWLKSH---DN  295

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D  IN+A+G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  296   AL-----------IEDSIINIADGKVKQEVQIKLQNVESGELELEMEWLPLEQ  337



>ref|XP_011038875.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Populus euphratica]
 ref|XP_011038876.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Populus euphratica]
 ref|XP_011038877.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Populus euphratica]
Length=330

 Score =   290 bits (742),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 170/355 (48%), Positives = 225/355 (63%), Gaps = 38/355 (11%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +S N+FCADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  12    SGKRRLKDLLLQSDNRFCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  71

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN  AN  YEA  PE   K  P+ S EER  FIR KYELQ+F+  
Sbjct  72    DEWSDDEIDAMIEVGGNLSANSIYEAFLPEGVSKPGPNCSNEERTRFIRSKYELQEFLKP  131

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +     ++SS  +S   +                      D+ +    S ++ G+VE
Sbjct  132   SLRITSGKTSSSSLKSSLSTNL--------------------FDSFQIPSVSQNLDGIVE  171

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             F+G++KV V++GTNLAIRDM+SSDPYVI+ LG Q+ +  V+K+NLNPVWNE+LMLS+P++
Sbjct  172   FMGILKVKVIKGTNLAIRDMMSSDPYVIVALGKQTAQPTVMKSNLNPVWNEELMLSVPQD  231

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK--AET  1374
               P+K+ VFD DTF+ DD MGEAEIDIQPL+ +A A       DP         K     
Sbjct  232   FGPIKLSVFDHDTFSADDIMGEAEIDIQPLITSAMAF-----GDPEMFGNMQIGKWLKSN  286

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             +NA+             D  IN+ +G V+QEI LKLQNVE G L+VELE + L Q
Sbjct  287   DNAL-----------IDDSIINIVDGKVKQEISLKLQNVESGELQVELEWMPLDQ  330



>gb|KHN23004.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Glycine 
soja]
Length=323

 Score =   290 bits (741),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 163/353 (46%), Positives = 228/353 (65%), Gaps = 40/353 (11%)
 Frame = +1

Query  487   RCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDE  666
             R +LK L+ +SGN+ CADC +PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV LD+
Sbjct  9     RRKLKDLLHQSGNRLCADCNAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTLDD  68

Query  667   WTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDL  846
             W+ +++D + E+GGN  AN  YEA  PE Y K  PD+  E+R+ FIR KYELQ+F+   L
Sbjct  69    WSEDEIDAMIEVGGNVSANSIYEAYIPEGYTKPGPDAGHEQRSKFIRSKYELQEFLKPSL  128

Query  847   HLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFI  1026
              ++    +  SSS                 +F +S+        K+T  S  M GMVEFI
Sbjct  129   RIVSGKSSLQSSSAKS--------------SFMDSF--------KSTSSSQRMEGMVEFI  166

Query  1027  GLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVP  1206
             G++KV V++GTNLAIRD+ SSDPYV+L+LG Q+V+T +I++NLNPVWNE+ MLS+PE+  
Sbjct  167   GMLKVKVIKGTNLAIRDIKSSDPYVVLSLGQQTVQTTIIRSNLNPVWNEEYMLSVPEHYG  226

Query  1207  PLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENST--KNDPVQQQPRTPKKAETEN  1380
              +K+ VFD DTF+ DD MGEA+ID+Q L+ +A A  ++    N  + +  ++   A  E 
Sbjct  227   QIKLKVFDHDTFSADDIMGEADIDLQSLITSAMAFGDAGMFGNMQIGKWLKSDDNALIE-  285

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
                            D T+N+ +G V+Q + LKLQ+VE G L++ELE + L Q
Sbjct  286   ---------------DSTVNIVDGKVKQMMSLKLQDVESGELDLELEWIPLEQ  323



>ref|NP_567620.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Arabidopsis 
thaliana]
 ref|NP_849416.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Arabidopsis 
thaliana]
 ref|NP_974581.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Arabidopsis 
thaliana]
 ref|NP_974582.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Arabidopsis 
thaliana]
 sp|Q9FVJ3.1|AGD12_ARATH RecName: Full=ADP-ribosylation factor GTPase-activating protein 
AGD12; Short=ARF GAP AGD12; AltName: Full=Protein ARF-GAP 
DOMAIN 12; Short=AtAGD12; AltName: Full=Zinc- and calcium-binding 
protein; Short=AtZAC [Arabidopsis thaliana]
 gb|AAG09280.1|AF177381_1 zinc finger and C2 domain protein [Arabidopsis thaliana]
 gb|AAL32627.1| putative protein [Arabidopsis thaliana]
 gb|AAP68261.1| At4g21160 [Arabidopsis thaliana]
 gb|AEE84411.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Arabidopsis 
thaliana]
 gb|AEE84412.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Arabidopsis 
thaliana]
 gb|AEE84413.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Arabidopsis 
thaliana]
 gb|AEE84414.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Arabidopsis 
thaliana]
Length=337

 Score =   290 bits (741),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 166/353 (47%), Positives = 221/353 (63%), Gaps = 28/353 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +S N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLTQSDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGSHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K  PD+S ++R  FIR KYE Q+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFIPEGSSKPGPDASHDQRMRFIRSKYEHQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +        +S       +       L     +S+R   S  Q        + GMVE
Sbjct  133   SLRI--------TSVRGSSTKTPAFLSSSLSKKIVDSFRTNSSSQQP------QLEGMVE  178

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV + +GTN+AIRDM+SSDPYV+LTLG Q  ++ V+K+NLNPVWNE+LMLS+P N
Sbjct  179   FIGLLKVTIKKGTNMAIRDMMSSDPYVVLTLGQQKAQSTVVKSNLNPVWNEELMLSVPHN  238

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ VFD DTF+ DD MGEAEIDIQPL+ +A A  +      +Q           +N
Sbjct  239   YGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQIGKWLKSH---DN  295

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D  IN+A+G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  296   AL-----------IEDSIINIADGKVKQEVQIKLQNVESGELELEMEWLPLEQ  337



>ref|XP_006363654.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Solanum tuberosum]
 ref|XP_006363655.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X2 [Solanum tuberosum]
Length=331

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/354 (46%), Positives = 230/354 (65%), Gaps = 36/354 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADC SPDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SSKRRLKDLLLQKDNRVCADCASPDPKWASTNIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN  AN  YEA  PE   K   D+S E+R+ FIR KYE Q+F+  
Sbjct  73    DEWSDDEIDAMVEVGGNASANSIYEAYIPEGISKPGADASHEQRSKFIRSKYEQQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMA-GMV  1017
              L ++          +++KK S            + S   K +D+ +++  ++  + GMV
Sbjct  133   SLRIL----------SNQKKGS-----------LKTSLSNKITDSFRSSSSTSQKSEGMV  171

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIG++KV V++GTNLAIRDM+SSDPYV+L LG Q V+T V+K+NLNP+WNE++MLS+P+
Sbjct  172   EFIGMLKVKVIKGTNLAIRDMLSSDPYVVLNLGKQKVQTSVVKSNLNPIWNEEVMLSVPQ  231

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETE  1377
             +   +++ V+D DTF+ DD MGEAEIDIQP++ +A A  ++     +Q           +
Sbjct  232   DYGAVRLQVYDHDTFSADDIMGEAEIDIQPMITSAMAFGDAGMFGNMQIGKWL---KSND  288

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             NA+             D T+N+ +G V+QE+ LKLQNVE G LE+ELE + L Q
Sbjct  289   NAL-----------LDDSTVNIVDGKVKQEVNLKLQNVESGDLELELEWIPLDQ  331



>ref|XP_003629916.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Medicago 
truncatula]
Length=341

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 169/373 (45%), Positives = 230/373 (62%), Gaps = 58/373 (16%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISK----  642
             SL+ + RLK L+ +  N+FCADC +PDPKW S ++GVF+C+KC GVHRSLG HISK    
Sbjct  5     SLTGKRRLKDLLVQKDNRFCADCSAPDPKWASANIGVFVCLKCCGVHRSLGTHISKNRGC  64

Query  643   ---------------VVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDS  777
                            ++SV LDEW+++++D + E+GGN  AN  YEA  PE Y K  PD+
Sbjct  65    LLCIKSLRRFLFPCQILSVTLDEWSNDEIDAMMEVGGNASANSIYEAFIPEGYTKPGPDA  124

Query  778   STEERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWR  957
             S EER  FIR KYE Q+F+                     KHS   RI       + S+ 
Sbjct  125   SHEERAKFIRSKYERQEFL---------------------KHS--LRILSTKSKRQTSFS  161

Query  958   KKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTR  1137
             KK  D+ + +  S +M GMVEFIG++KV VV+GTNLAIRDM +SDPYV+L LG Q+V+T 
Sbjct  162   KKIMDSFRKSSGSKNMEGMVEFIGMLKVKVVKGTNLAIRDMRTSDPYVVLKLGQQTVQTT  221

Query  1138  VIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASEN  1317
             VI++NLNPVWNE+LMLS+P+   P+ + VFD D F+ DD MGEA+ID+QPL+ +A A  +
Sbjct  222   VIRSNLNPVWNEELMLSVPQQFGPISLEVFDHDLFSADDIMGEAQIDLQPLINSAMAFGD  281

Query  1318  STKNDPVQQQPRTPKKAET-ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVE  1494
             +   D +    R  K   + +NA+             D  +N+ +G V+QE+ +KLQNVE
Sbjct  282   TGMFDDM----RIGKWLRSNDNAL-----------IEDSIVNIIDGKVKQEMFIKLQNVE  326

Query  1495  RGVLEVELECVSL  1533
              G L +ELE +SL
Sbjct  327   CGELNLELEWMSL  339



>ref|XP_006580210.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X2 [Glycine max]
Length=311

 Score =   289 bits (739),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 159/346 (46%), Positives = 222/346 (64%), Gaps = 37/346 (11%)
 Frame = +1

Query  496   LKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTH  675
             +K L+ +  N+FCADC +PDPKW S ++GVF+C+KC GVHRSLG  ISKV+SV LDEW+ 
Sbjct  1     MKDLLLQKDNRFCADCNAPDPKWASANIGVFVCLKCCGVHRSLGSQISKVLSVTLDEWSS  60

Query  676   EQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLM  855
             +++D + E+GGN+ AN  YEA FPE Y K   D+S E+R  FIR KYE Q+F+   L ++
Sbjct  61    DEIDAMIEVGGNSSANSIYEAYFPEGYTKPGSDASHEQRAKFIRLKYERQEFLKPSLRIV  120

Query  856   CPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLI  1035
                             SG            +S  K   D+ + T  S  M GMVEFIG++
Sbjct  121   ----------------SGKSNPP-------SSISKGVKDSFRITSDSQHMEGMVEFIGML  157

Query  1036  KVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLK  1215
             KV V++GT+LA+RDM++SDPYVIL LG Q+V+T VIK+NLNPVWNE+LMLS+P+    L 
Sbjct  158   KVKVIKGTDLAVRDMMTSDPYVILKLGQQTVQTTVIKSNLNPVWNEELMLSVPQQFGILN  217

Query  1216  VHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppp  1395
             ++VFD D F+ DD MGEA+ID+QPL+ +A A  ++   D +Q       +   +NA+   
Sbjct  218   LNVFDYDLFSADDIMGEADIDLQPLITSAIAYGDARMFDDMQIGKWLKSQ---DNAL---  271

Query  1396  lplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                       D T+N+ +G V+Q++ +KLQNVE G L++ELE + L
Sbjct  272   --------IYDSTVNIVDGKVKQDMSIKLQNVESGELDLELEWIPL  309



>gb|KHG02798.1| hypothetical protein F383_08812 [Gossypium arboreum]
Length=326

 Score =   289 bits (740),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/355 (46%), Positives = 223/355 (63%), Gaps = 35/355 (10%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S S + +L+ L+ +  N+ CADCG+PDPKW S ++GVF+C+KC GVHRSLG HISKV+SV
Sbjct  7     STSAKIKLRGLLNQPDNRTCADCGAPDPKWASANIGVFLCLKCCGVHRSLGTHISKVLSV  66

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
              LDEW+ E++D + E+GGN+ AN  YEA  PE Y K   ++S +ER  FI+ KYELQ+F+
Sbjct  67    ALDEWSDEEIDAMIEVGGNSSANSIYEAYIPEGYTKPGLNASNDERRKFIKSKYELQEFL  126

Query  835   NSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGM  1014
                L +                 + G            S +  ++    +T+K     GM
Sbjct  127   KPSLRI-----------------TSGKDSSSSSTQSNISGKILDTILSNSTQKE----GM  165

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEFIGL+KV VV+GTNLA+RDM++SDPYV+LTLG Q+V++ VI +NLNPVWNE+LMLS+P
Sbjct  166   VEFIGLLKVKVVKGTNLAVRDMMTSDPYVVLTLGKQTVQSTVISSNLNPVWNEELMLSVP  225

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
              N  P+K+ V+D DTF+ DD MGEAEIDIQPL+ +A +  N      +Q           
Sbjct  226   SNYGPVKLQVYDHDTFSADDIMGEAEIDIQPLITSATSYGNPEMFGNMQIGKWLQSH---  282

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             +NA+             D  +N+ +G V+Q++ LKLQNVE G L +ELE + L Q
Sbjct  283   DNAL-----------MEDSIVNIIDGKVKQDVSLKLQNVECGELYLELEWLPLDQ  326



>ref|XP_006396607.1| hypothetical protein EUTSA_v10028788mg [Eutrema salsugineum]
 ref|XP_006396610.1| hypothetical protein EUTSA_v10028788mg [Eutrema salsugineum]
 gb|ESQ38060.1| hypothetical protein EUTSA_v10028788mg [Eutrema salsugineum]
 gb|ESQ38063.1| hypothetical protein EUTSA_v10028788mg [Eutrema salsugineum]
Length=334

 Score =   289 bits (740),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 168/353 (48%), Positives = 224/353 (63%), Gaps = 31/353 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLNQPDNRVCADCGASDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K  PD S ++R  FIR KYELQ+F+  
Sbjct  73    DEWSDEEVDAMIEIGGNASANSIYEAFVPEGSSKPGPDVSHDQRMRFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +        SS    KK+S             +S  +K  D+ +    S  + GMVE
Sbjct  133   SLRI--------SSGKCSKKNSA---------FLTSSLSRKIMDSFRTNSSSKKIEGMVE  175

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++KV V +GTNLAIRDM+SSDPYV+L LG Q ++T V+ +NLNPVWN++LMLS+PE+
Sbjct  176   FIGMLKVTVKKGTNLAIRDMMSSDPYVVLNLGKQKLQTTVVNSNLNPVWNQELMLSVPES  235

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               P+K+ V+D DTF+ DD MGEAEIDIQPL+ +A A       DP         +   + 
Sbjct  236   YGPVKLQVYDYDTFSADDIMGEAEIDIQPLITSAMAF-----GDP---------EMFGDM  281

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  282   QIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVESGELELEMEWLPLDQ  334



>ref|XP_003546262.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Glycine max]
 gb|KHN14329.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Glycine 
soja]
Length=324

 Score =   289 bits (739),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 163/355 (46%), Positives = 228/355 (64%), Gaps = 40/355 (11%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S R +LK L+ +S N+ CADC +PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  8     SSRRKLKDLLLQSDNRLCADCNAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  67

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             D+W+ +++D + E+GGN  AN  YEA  PE Y K  PD+  E+R+ FIR KYELQ+F+  
Sbjct  68    DDWSEDEIDAMMEVGGNASANSIYEAYIPEGYTKPGPDAGHEQRSKFIRSKYELQEFLKP  127

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L ++    +  SSS                 +F +S+        K+T  S  M GMVE
Sbjct  128   SLRIVSGKSSLQSSSAKS--------------SFMDSF--------KSTGSSQRMEGMVE  165

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++KV V++GTNLAIRD+ SSDPYV+L+LG Q+V+T +I++NLNPVWNE+ MLS+PE+
Sbjct  166   FIGMLKVKVIKGTNLAIRDIKSSDPYVVLSLGQQTVQTTIIRSNLNPVWNEEYMLSVPEH  225

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENST--KNDPVQQQPRTPKKAET  1374
                +K+ VFD DTF+ DD MGEA+ID+Q L+ +A A  ++    N  + +  ++   A  
Sbjct  226   YGQMKLKVFDHDTFSADDIMGEADIDLQSLITSAMAFGDAGMFGNMQIGKWLKSDDNALI  285

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             E                D T+N+ +G V+Q + LKLQ+VE G L++ELE + L Q
Sbjct  286   E----------------DSTVNIVDGKVKQMMSLKLQDVESGELDLELEWIPLEQ  324



>emb|CDP17304.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   288 bits (738),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 159/355 (45%), Positives = 225/355 (63%), Gaps = 39/355 (11%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RL  L+ +  N+ CADC +P+PKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLNDLLLQRDNRVCADCSAPEPKWASANIGVFICLKCCGVHRSLGSHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ ++++ + E+GGN  AN  YEA  PE   K  PD++ + R+ FIR KYE Q+F+  
Sbjct  73    DEWSDDEIESMIEVGGNASANSIYEAYIPEGVSKPGPDATHDARSKFIRSKYERQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L ++              K S          + + S  +K   T ++   S++  GMVE
Sbjct  133   SLRILSA-----------PKSS----------SLQTSLSRKIMSTFRSASSSHASEGMVE  171

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++K+ VV+GTNLAIRDM+SSDPYV+LTLG Q  +T V+K+NLNPVWNE+LMLS+P+N
Sbjct  172   FIGMLKIKVVKGTNLAIRDMLSSDPYVVLTLGQQKAQTAVVKSNLNPVWNEELMLSVPQN  231

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENST--KNDPVQQQPRTPKKAET  1374
                +K+ V+D DTF+ DD MGEAEIDIQP++ +A A  ++   +N  + +  ++   A  
Sbjct  232   YGAVKMQVYDHDTFSADDIMGEAEIDIQPMITSAMAFGDAGMFQNMQIGKWLKSNDNALI  291

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             E                D T+N+ +G V+Q + LKLQNVE G +E+ELE + L Q
Sbjct  292   E----------------DSTVNIIDGKVKQAVSLKLQNVESGEIELELEWIPLDQ  330



>ref|XP_010431511.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Camelina sativa]
Length=334

 Score =   288 bits (738),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 167/353 (47%), Positives = 222/353 (63%), Gaps = 31/353 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLNQPDNRVCADCGASDPKWASTNIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  P+   K  PD S ++R  FI+ KYELQ+F+  
Sbjct  73    DEWSEEEVDSMIEIGGNASANSIYEAFVPDTCSKPGPDVSHDQRMRFIKAKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +                 SG        F   +S  +K  D+ K+   S  M GMVE
Sbjct  133   SLRI----------------KSGKRSTKSSAF-LTSSLSRKIMDSFKSNSSSQKMEGMVE  175

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV V +GTNLAIRD++SSDPYV L LG Q+++T V+ +NLNPVWN++LMLS+PE+
Sbjct  176   FIGLLKVTVKKGTNLAIRDLMSSDPYVDLNLGKQTLQTTVVNSNLNPVWNQELMLSVPES  235

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               P+K+ V+D DTF+ DD MGEA+IDIQPL+ +A A       DP         +   + 
Sbjct  236   YGPVKLQVYDYDTFSADDIMGEADIDIQPLITSAMAF-----GDP---------EMFGDM  281

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  282   QIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVECGELELEMEWLPLDQ  334



>emb|CAB81075.1| putative protein [Arabidopsis thaliana]
Length=334

 Score =   288 bits (737),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 164/353 (46%), Positives = 222/353 (63%), Gaps = 31/353 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLNQPDNRVCADCGASDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  P+   K  PD + ++R  FIR KYELQ+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFLPDTCSKPGPDVNHDQRMRFIRAKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +                 SG        F   +S  +K  D+ +    S +M GMVE
Sbjct  133   SLRIT----------------SGKGSTKSSAF-LTSSLSRKIMDSFRTNSSSQTMEGMVE  175

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV + +GTNLAIRDM+SSDPYV+L LG Q ++T V+ +NLNPVWN++LMLS+PE+
Sbjct  176   FIGLLKVTIKKGTNLAIRDMMSSDPYVVLNLGKQKLQTTVMNSNLNPVWNQELMLSVPES  235

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               P+K+ V+D DTF+ DD MGEA+IDIQPL+ +A A       DP         +   + 
Sbjct  236   YGPVKLQVYDYDTFSADDIMGEADIDIQPLITSAMAF-----GDP---------EMFGDM  281

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  282   QIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVESGELELEMEWLPLDQ  334



>ref|XP_010910384.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11, partial [Elaeis guineensis]
Length=253

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 179/225 (80%), Gaps = 14/225 (6%)
 Frame = +1

Query  568   SLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFP  747
             SLSLGVFICIKCSGVHRSLGVHISKV+SVKL+EWT EQVD L++ GGN   N++YEA  P
Sbjct  35    SLSLGVFICIKCSGVHRSLGVHISKVLSVKLEEWTDEQVDFLSDRGGNAAVNMRYEAFLP  94

Query  748   ENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLPttssss--------tsEKKH  903
             EN KK  PDSS EER+DFI+RKYELQQF NS   ++   P + S++        + EK+H
Sbjct  95    ENLKKPGPDSSIEERSDFIKRKYELQQFSNSGGLIISTTPGSLSTALQNNVSSKSFEKQH  154

Query  904   SGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMV  1083
             +G    +GLG AF+NSWR+KES+ QKA +K   M GM+EF+GLIKVN++RGTNLA+RD++
Sbjct  155   TGLR--YGLGHAFQNSWRRKESE-QKAIKK---MMGMIEFVGLIKVNIIRGTNLAVRDVM  208

Query  1084  SSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKV  1218
             +SDPYVIL LG+QS+KTRVIK+N NP+WNE LMLSIP+ + PLK+
Sbjct  209   TSDPYVILNLGHQSMKTRVIKSNWNPIWNESLMLSIPDPIQPLKL  253



>ref|XP_004134589.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Cucumis sativus]
 ref|XP_004163868.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Cucumis sativus]
Length=333

 Score =   287 bits (735),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 158/340 (46%), Positives = 218/340 (64%), Gaps = 34/340 (10%)
 Frame = +1

Query  523   NQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEM  702
             N+FCADC + DPKW S ++GVFIC+KC GVHRSLG HISKV+SV LDEW  +++D + E+
Sbjct  27    NRFCADCRAADPKWASANIGVFICLKCCGVHRSLGSHISKVLSVTLDEWNDDEIDAMIEV  86

Query  703   GGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMCPLPttsss  882
             GGN+ AN  YEA  PE + K  PD++ E+R+ FIR KYELQ+F+   L ++         
Sbjct  87    GGNSSANAIYEAFLPEGFSKPGPDATHEQRSKFIRSKYELQEFLKPSLRIL---------  137

Query  883   stsEKKHSGGHRIHG-LGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGT  1059
                   +S    I         NS+R   S   ++        GMVE+IGL+KV V++GT
Sbjct  138   ----SSNSDKSNIQASFSSKIMNSFRSNSSQKSQSQ------QGMVEYIGLLKVKVIKGT  187

Query  1060  NLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdt  1239
             NLAIRDM+SSDPYV++TLG Q+V+T V+++NLNPVWNE+L LS+P+    +K+ V+D DT
Sbjct  188   NLAIRDMMSSDPYVVMTLGKQTVQTSVVRSNLNPVWNEELTLSVPQGFGSIKLEVYDYDT  247

Query  1240  fttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMppplplppppl  1419
             F+ DD MGEAEID+QPL+ +A A  ++     +Q           +NA+           
Sbjct  248   FSADDIMGEAEIDLQPLITSAMAFGDAGMFSNMQIGKWLKSH---DNAL-----------  293

Query  1420  ppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
               D T+N+ +G V+QEI LKLQNVE G L++ELE ++L Q
Sbjct  294   INDSTVNIVDGKVKQEIALKLQNVESGELDLELEWMALEQ  333



>ref|XP_010913280.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Elaeis guineensis]
Length=329

 Score =   287 bits (734),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 162/353 (46%), Positives = 219/353 (62%), Gaps = 38/353 (11%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S +PR +LK LM  S N+ CADCG+PDPKW S ++GVFIC+KCS VHR LG  ISKV+SV
Sbjct  13    SGTPR-KLKELMLRSDNRICADCGAPDPKWASANIGVFICLKCSDVHRRLGSDISKVLSV  71

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
              LDEW+   +D + E+GGN+ AN  YEA  P+ Y K KP SS E+R  FIR KYELQ+F+
Sbjct  72    TLDEWSEGDIDSMVEVGGNSYANSIYEAFLPKEYPKPKPHSSNEDRTKFIRSKYELQEFL  131

Query  835   NSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGM  1014
                L                       RI     +F++    K+ D+   +  S + A +
Sbjct  132   KPSL-----------------------RIVSSKMSFKSCDSGKDFDSSFNSNNSRTAADI  168

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
              EF+G ++V V+RGTNLA+RDM++SDPYV+LTLG Q V+T V K+NLNP+WNE+L LSIP
Sbjct  169   GEFVGFLRVKVIRGTNLAVRDMLTSDPYVVLTLGQQRVQTTVKKSNLNPIWNEELTLSIP  228

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
                  LK+ VFD D F+ DD MGEAE+D+QP++ AA A  ++     +Q          +
Sbjct  229   RRYGALKLLVFDHDVFSADDIMGEAEVDLQPMVTAAMAFGDAKLLGDMQIGKWF---KTS  285

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
             +NA+             D T+N+ +G V+QE+ LKLQNVE G +E+ELE + L
Sbjct  286   DNAL-----------IKDSTVNIIDGNVKQEVFLKLQNVESGEMELELEWIPL  327



>ref|XP_002967849.1| hypothetical protein SELMODRAFT_169243 [Selaginella moellendorffii]
 gb|EFJ31196.1| hypothetical protein SELMODRAFT_169243 [Selaginella moellendorffii]
Length=315

 Score =   286 bits (733),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 163/356 (46%), Positives = 219/356 (62%), Gaps = 52/356 (15%)
 Frame = +1

Query  496   LKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTH  675
             LK L+ +  N+ CADCG+ DPKW S +LGVF+CI+CSG+HRSLGVHISKV+S  LDEWT 
Sbjct  4     LKRLLAQRDNRVCADCGAADPKWASANLGVFVCIQCSGIHRSLGVHISKVMSTSLDEWTD  63

Query  676   EQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLM  855
             EQV ++ E+GGN  AN  YEA  P   +K  PDS+ EER ++I RKYE Q FV   L L 
Sbjct  64    EQVSVMAEVGGNAAANAIYEAHLPAGSRKPCPDSTMEERREWIVRKYEYQDFVKPTLRL-  122

Query  856   CPLPttsssstsEKKHSGGHR----IHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEF  1023
                        +   HS  +R       L F F+                    A MVEF
Sbjct  123   -----------NSTNHSSHYRQSFLTSKLAFLFQ--------------------AAMVEF  151

Query  1024  IGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENV  1203
             +GL+KV VV+GTNLA+RD+++SDPYV+L LG+Q+ KT+V+ +NLNPVW+E++MLS+P   
Sbjct  152   LGLLKVRVVKGTNLAVRDILTSDPYVVLNLGHQTAKTKVVNSNLNPVWDEEIMLSVPSGP  211

Query  1204  P-PLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTK---NDPVQQQPRTPKKAE  1371
             P PLK+ VFD D F+ DD MGE E+D+QP++ AA   E + +   +DP + Q      A 
Sbjct  212   PVPLKLQVFDYDKFSADDIMGEVEVDLQPIVAAASVLEEAMEDQIDDPGEVQIGRC-LAT  270

Query  1372  TENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              ENA+             D  I L  G ++Q++ +KLQNVE G +++ELE V L+Q
Sbjct  271   AENAL-----------VSDSVIRLVGGQIKQDLAVKLQNVESGEVQLELEWVPLAQ  315



>ref|XP_008805540.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X2 [Phoenix dactylifera]
Length=329

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 164/353 (46%), Positives = 218/353 (62%), Gaps = 38/353 (11%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S +PR +LK LM +S N+ CADCG+PDPKWVS ++GVFIC+KCS VHR LG  ISKV+SV
Sbjct  13    SGTPR-KLKELMLKSDNRICADCGAPDPKWVSANIGVFICLKCSDVHRRLGSDISKVLSV  71

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
              LDEW+   +D + E+GGN+ AN  YEA  P+ Y K KP SS E+R  FIR KYELQ+F+
Sbjct  72    TLDEWSDGDIDSMVEVGGNSYANSIYEAFLPKEYPKPKPHSSNEDRTKFIRSKYELQEFL  131

Query  835   NSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGM  1014
                L                       RI     +F++    K  D+   +  S   A M
Sbjct  132   KPSL-----------------------RIVSSKMSFKSCESGKNFDSSFNSNNSRKAADM  168

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
              EFIG+++V V+RGTNLA+RDM++SDPYV+LTLG Q V+T V  +NLNP+WNE+L LSIP
Sbjct  169   GEFIGVLRVKVIRGTNLAVRDMLTSDPYVVLTLGQQRVQTTVKNSNLNPIWNEELTLSIP  228

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
                  LK+ VFD D F+ DD MGEAE+D+QP++ AA A  ++     +Q          +
Sbjct  229   RCYGALKLQVFDHDVFSADDIMGEAEVDLQPMVTAAMAFGDAKLLGDMQIGKWF---KTS  285

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
             +NA+             D T+N+  G V+QE+ LKLQNVE G +E+ELE + L
Sbjct  286   DNAL-----------IKDSTVNIINGNVKQEVFLKLQNVESGEMELELEWIPL  327



>gb|KHN48068.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Glycine 
soja]
Length=322

 Score =   286 bits (731),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 161/352 (46%), Positives = 222/352 (63%), Gaps = 37/352 (11%)
 Frame = +1

Query  478   LSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVK  657
             L+ + RL+ L+ +  N+FCADC +PDPKW S ++GVF+C+KC GVHRSLG  ISKV+SV 
Sbjct  6     LTGKRRLQDLLLQKDNRFCADCNAPDPKWASANIGVFVCLKCCGVHRSLGSQISKVLSVT  65

Query  658   LDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVN  837
             LDEW+ +++D + E+GGN+ AN  YEA FPE + K  PD++ ++R  FIR KYE Q+F+ 
Sbjct  66    LDEWSSDEIDAMIEVGGNSSANSIYEAYFPEGFTKPGPDATHDQRVKFIRLKYEHQEFLQ  125

Query  838   SDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMV  1017
               L ++                SG             S  K   D+ + T  S  M GMV
Sbjct  126   PSLRIV----------------SGKSNPP-------KSISKGIMDSFRITSDSQHMEGMV  162

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIG++KV V++GT+LAIRDM++SDPYVIL LG Q+V+T VIK+NLNPVWNE+LMLS+P+
Sbjct  163   EFIGMLKVKVIKGTDLAIRDMMTSDPYVILKLGQQTVQTTVIKSNLNPVWNEELMLSVPQ  222

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETE  1377
                 L ++VFD D F+ DD MGEA+ID+QPL+ +A A  ++   D +Q            
Sbjct  223   QFGILNLNVFDYDLFSADDIMGEADIDLQPLITSAIAYGDARMFDDMQIGKWLKSNG---  279

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
             NA+             D  +N+ +G V+Q I LKLQNVE G L++ELE + L
Sbjct  280   NAL-----------IDDSIVNIVDGKVKQVISLKLQNVESGELDLELEWMPL  320



>ref|XP_010455859.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Camelina sativa]
 ref|XP_010455860.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Camelina sativa]
Length=336

 Score =   286 bits (732),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 168/355 (47%), Positives = 222/355 (63%), Gaps = 33/355 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLNQPDNRVCADCGASDPKWASTNIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  P+   K  PD S ++R  FIR KYELQ+F+  
Sbjct  73    DEWSEEEVDSMIEIGGNASANSIYEAFVPDTCSKPGPDVSHDQRMRFIRAKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSM--AGM  1014
              L +                 SG        F   +S  +K  D+ K+   S  M   GM
Sbjct  133   SLRI----------------KSGKRSTKSSAF-LTSSLSRKIMDSFKSNSSSQKMFQEGM  175

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEFIGL+KV V +GTNLAIRD++SSDPYV+L LG Q ++T V+ +NLNPVWN++LMLS+P
Sbjct  176   VEFIGLLKVTVKKGTNLAIRDLMSSDPYVVLNLGKQKLQTTVVNSNLNPVWNQELMLSVP  235

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
             E+  P+K+ V+D DTF+ DD MGEA+IDIQPL+ +A A       DP         +   
Sbjct  236   ESYGPVKLQVYDYDTFSADDIMGEADIDIQPLITSAMAF-----GDP---------EMFG  281

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             +  +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  282   DMQIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVECGELELEMEWLPLDQ  336



>emb|CDY62002.1| BnaA03g57220D [Brassica napus]
Length=337

 Score =   286 bits (732),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 172/353 (49%), Positives = 225/353 (64%), Gaps = 28/353 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R+K L+ +  N+ CADC +PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIKDLLNQPDNRVCADCSAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K  PD S ++R  FIR KYELQ+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFVPEGSSKPGPDVSHDQRMRFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +      TS   +S KK S   R   L   F +S+R   S       K     GMVE
Sbjct  133   SLRI------TSGKCSSTKKPS--FRKSTLSTKFMDSFRANSS------SKKIFEEGMVE  178

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV V +GTNLAIRDM+SSDPYV+L LG Q ++T V+ +NLNP+WN++LMLS+PE+
Sbjct  179   FIGLLKVTVKKGTNLAIRDMMSSDPYVVLNLGKQKLQTTVVNSNLNPIWNQELMLSVPES  238

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               P+K+ V+D DTF+ DD MGEAE+DIQPL+ +A A       DP         +   + 
Sbjct  239   YGPVKLQVYDYDTFSADDIMGEAELDIQPLITSAMAF-----GDP---------EMFGDM  284

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  285   QIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVECGELELEMEWLPLEQ  337



>ref|XP_008805539.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Phoenix dactylifera]
Length=359

 Score =   286 bits (733),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 164/353 (46%), Positives = 218/353 (62%), Gaps = 38/353 (11%)
 Frame = +1

Query  475   SLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSV  654
             S +PR +LK LM +S N+ CADCG+PDPKWVS ++GVFIC+KCS VHR LG  ISKV+SV
Sbjct  43    SGTPR-KLKELMLKSDNRICADCGAPDPKWVSANIGVFICLKCSDVHRRLGSDISKVLSV  101

Query  655   KLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFV  834
              LDEW+   +D + E+GGN+ AN  YEA  P+ Y K KP SS E+R  FIR KYELQ+F+
Sbjct  102   TLDEWSDGDIDSMVEVGGNSYANSIYEAFLPKEYPKPKPHSSNEDRTKFIRSKYELQEFL  161

Query  835   NSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGM  1014
                L                       RI     +F++    K  D+   +  S   A M
Sbjct  162   KPSL-----------------------RIVSSKMSFKSCESGKNFDSSFNSNNSRKAADM  198

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
              EFIG+++V V+RGTNLA+RDM++SDPYV+LTLG Q V+T V  +NLNP+WNE+L LSIP
Sbjct  199   GEFIGVLRVKVIRGTNLAVRDMLTSDPYVVLTLGQQRVQTTVKNSNLNPIWNEELTLSIP  258

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
                  LK+ VFD D F+ DD MGEAE+D+QP++ AA A  ++     +Q          +
Sbjct  259   RCYGALKLQVFDHDVFSADDIMGEAEVDLQPMVTAAMAFGDAKLLGDMQIGKWF---KTS  315

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
             +NA+             D T+N+  G V+QE+ LKLQNVE G +E+ELE + L
Sbjct  316   DNAL-----------IKDSTVNIINGNVKQEVFLKLQNVESGEMELELEWIPL  357



>ref|XP_006585208.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Glycine max]
 ref|XP_006585209.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X2 [Glycine max]
Length=328

 Score =   285 bits (730),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 161/352 (46%), Positives = 222/352 (63%), Gaps = 37/352 (11%)
 Frame = +1

Query  478   LSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVK  657
             +S + RL+ L+ +  N+FCADC +PDPKW S ++GVF+C+KC GVHRSLG  ISKV+SV 
Sbjct  12    VSSKRRLQDLLLQKDNRFCADCNAPDPKWASANIGVFVCLKCCGVHRSLGSQISKVLSVT  71

Query  658   LDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVN  837
             LDEW+ +++D + E+GGN+ AN  YEA FPE + K  PD++ ++R  FIR KYE Q+F+ 
Sbjct  72    LDEWSSDEIDAMIEVGGNSSANSIYEAYFPEGFTKPGPDATHDQRVKFIRLKYEHQEFLQ  131

Query  838   SDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMV  1017
               L ++                SG             S  K   D+ + T  S  M GMV
Sbjct  132   PSLRIV----------------SGKSNPP-------KSISKGIMDSFRITSDSQHMEGMV  168

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIG++KV V++GT+LAIRDM++SDPYVIL LG Q+V+T VIK+NLNPVWNE+LMLS+P+
Sbjct  169   EFIGMLKVKVIKGTDLAIRDMMTSDPYVILKLGQQTVQTTVIKSNLNPVWNEELMLSVPQ  228

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETE  1377
                 L ++VFD D F+ DD MGEA+ID+QPL+ +A A  ++   D +Q            
Sbjct  229   QFGILNLNVFDYDLFSADDIMGEADIDLQPLITSAIAYGDARMFDDMQIGKWLKSNG---  285

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
             NA+             D  +N+ +G V+Q I LKLQNVE G L++ELE + L
Sbjct  286   NAL-----------IDDSIVNIVDGKVKQVISLKLQNVESGELDLELEWMPL  326



>ref|XP_010422420.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Camelina sativa]
 ref|XP_010422421.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Camelina sativa]
Length=336

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 167/355 (47%), Positives = 223/355 (63%), Gaps = 33/355 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLNQPDNRVCADCGASDPKWASTNIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  P+   K  PD S ++R  FI+ KYELQ+F+  
Sbjct  73    DEWSEEEVDSMIEIGGNASANSIYEAFVPDTCSKPGPDVSHDQRMRFIKAKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSM--AGM  1014
              L +                 SG        F   +S  +K  D+ K+   S  M   GM
Sbjct  133   SLRI----------------KSGKRSTKSSAF-LTSSLSRKIMDSFKSNSSSQKMFQEGM  175

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEFIGL+KV V +GTNLAIRD++SSDPYV+L LG Q+++T V+ +NLNPVWN++LMLS+P
Sbjct  176   VEFIGLLKVTVKKGTNLAIRDLMSSDPYVVLNLGKQTLQTTVVNSNLNPVWNQELMLSVP  235

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
             E+  P+K+ V+D DTF+ DD MGEA+IDIQPL+ +A A       DP         +   
Sbjct  236   ESYGPVKLQVYDYDTFSADDIMGEADIDIQPLITSAMAF-----GDP---------EMFG  281

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             +  +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  282   DMQIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVECGELELEMEWLPLDQ  336



>emb|CDY21329.1| BnaC03g30130D [Brassica napus]
Length=337

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 172/353 (49%), Positives = 225/353 (64%), Gaps = 28/353 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R+K L+K+  N+ CADC +PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIKDLLKQPDNRVCADCSAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K  PD S ++R  FIR KYELQ+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFVPEGSSKPGPDVSHDQRMRFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +      TS   +S KK S       L   F +S+R   S       K     GMVE
Sbjct  133   SLRI------TSGKCSSTKKPS--FLKSTLSTKFMDSFRANSS------SKKIFEEGMVE  178

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV V +GTNLAIRDM+SSDPYV+L LG Q ++T V+ +NLNP+WN++LMLS+PE+
Sbjct  179   FIGLLKVTVKKGTNLAIRDMMSSDPYVVLNLGKQKLQTTVVNSNLNPIWNQELMLSVPES  238

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               P+K+ V+D DTF+ DD MGEAE+DIQPL+ +A A       DP         +   + 
Sbjct  239   YGPVKLQVYDYDTFSADDIMGEAELDIQPLITSAMAF-----GDP---------EMFGDM  284

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  285   QIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVECGELELEMEWLPLEQ  337



>ref|XP_011096685.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Sesamum indicum]
 ref|XP_011096687.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Sesamum indicum]
Length=325

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 165/359 (46%), Positives = 224/359 (62%), Gaps = 38/359 (11%)
 Frame = +1

Query  463   MQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISK  642
             M  +  S + RLK L+ +  N+ CADCG+PDPKW S ++GVFIC+KC G+HRSLG HISK
Sbjct  1     MSHHPSSGKRRLKDLLAQPDNRTCADCGTPDPKWASANIGVFICLKCCGIHRSLGTHISK  60

Query  643   VVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYEL  822
             V+SV LDEW+ E+VD + E+GGN  AN  YEA  P+   K  PD+S E R  FIR KYE 
Sbjct  61    VLSVTLDEWSEEEVDSMIEVGGNGSANSIYEAYIPQGVSKPGPDASHEVRAKFIRAKYES  120

Query  823   QQFVNSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNS  1002
             Q+F+   L ++         S+S K+ S            + S  KK  D+   +  S +
Sbjct  121   QEFLKPSLRIL---------SSSSKQPS-----------LQASLSKKIMDSFGHSGSSEN  160

Query  1003  MAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLM  1182
               GMVEFIG++K  V+RG NLA+RDM+SSDPYV+LTLG+Q  +T V+K+NLNPVWNE+LM
Sbjct  161   SEGMVEFIGMLKAKVLRGANLAVRDMLSSDPYVVLTLGHQKAQTSVVKSNLNPVWNEELM  220

Query  1183  LSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENST--KNDPVQQQPRT  1356
             LS+P+N   +K+ VFD DTF+ DD MGEAEIDIQ ++ +A A  +     N  + +  ++
Sbjct  221   LSVPQNYGVIKLQVFDHDTFSADDIMGEAEIDIQSMITSATAFGDPEMFGNMQIGKWLKS  280

Query  1357  PKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                A  E                D T+N+ +G V+Q + LKLQNVE G + +ELE + L
Sbjct  281   GDNALLE----------------DSTVNIVDGKVKQFVSLKLQNVESGEMYLELEWIPL  323



>ref|XP_009114487.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
 ref|XP_009114488.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
Length=338

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 168/353 (48%), Positives = 223/353 (63%), Gaps = 27/353 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +  N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLNQPDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             D+W+ E+VD + E+GGN  AN  YEA  PE   K  PD S ++R  FIR KYELQ+F+  
Sbjct  73    DDWSDEEVDSMIEIGGNASANSIYEAFVPEGSSKPGPDVSHDQRMRFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +       +S  T+  K         L   F +S+R   S       K     GMVE
Sbjct  133   SLRI-------TSGKTTSTKKPPSFLSSSLSTKFMDSFRTNSS------SKKIFEEGMVE  179

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV V +GTNLAIRDM+SSDPYV+L LG Q ++T V+ +NLNPVWN++LMLS+PE+
Sbjct  180   FIGLLKVTVKKGTNLAIRDMMSSDPYVVLNLGKQKLQTTVVNSNLNPVWNQELMLSVPES  239

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               P+K+ V+D DTF+ DD MGEAE+DIQPL+ +A A       DP         +   + 
Sbjct  240   YGPVKLQVYDYDTFSADDIMGEAELDIQPLITSAMAF-----GDP---------EMFGDM  285

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  286   QIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVESGELELEMEWLPLDQ  338



>ref|XP_009137170.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Brassica rapa]
 ref|XP_009137171.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Brassica rapa]
 ref|XP_009137172.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Brassica rapa]
Length=338

 Score =   284 bits (727),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 224/351 (64%), Gaps = 27/351 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +S N+FCADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRELLTQSDNRFCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN+ AN  YEA  P  + K  PD+S ++R  FIR KYE Q+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNDSANSIYEAFIPHGFSKPGPDASHDQRLRFIRSKYEHQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +       +S      K S  +    L   F +S+R   S           + GMVE
Sbjct  133   SLRI-------TSVKAPSTKSSSSYLSSSLSKKFMDSFRTNSSSQHP------QLEGMVE  179

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV + +GTNLA+RDM++SDPYV LTLG Q+V++ V K+NLNPVWNE+LMLS+P +
Sbjct  180   FIGLLKVTLKKGTNLAVRDMMTSDPYVKLTLGQQTVQSTVKKSNLNPVWNEELMLSVPHD  239

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ VFD DTF+ DD MGEA IDIQPL+ +A A  +      +Q           +N
Sbjct  240   YGSVKLQVFDYDTFSADDIMGEAGIDIQPLITSAMAFGDPEMFGDMQIGKWLKSH---DN  296

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
             A+             D  IN+A+G V+QE+ +KLQNVE G LE+E+E +SL
Sbjct  297   AL-----------IEDSIINIADGRVKQEVRIKLQNVESGELELEVEWLSL  336



>emb|CDY58481.1| BnaA03g58510D [Brassica napus]
Length=338

 Score =   284 bits (727),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 224/351 (64%), Gaps = 27/351 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +S N+FCADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRELLTQSDNRFCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN+ AN  YEA  P  + K  PD+S ++R  FIR KYE Q+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNDSANSIYEAFIPHGFSKPGPDASHDQRLRFIRSKYEHQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +       +S      K S  +    L   F +S+R   S           + GMVE
Sbjct  133   SLRI-------TSVKAPTTKTSSSYLSSSLSKKFMDSFRTNSSSQHP------QLEGMVE  179

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV + +GTNLA+RDM++SDPYV LTLG Q+V++ V K+NLNPVWNE+LMLS+P +
Sbjct  180   FIGLLKVTLKKGTNLAVRDMMTSDPYVKLTLGQQTVQSTVKKSNLNPVWNEELMLSVPHD  239

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ VFD DTF+ DD MGEA IDIQPL+ +A A  +      +Q           +N
Sbjct  240   YGSVKLQVFDYDTFSADDIMGEAGIDIQPLITSAMAFGDPEMFGDMQIGKWLKSH---DN  296

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
             A+             D  IN+A+G V+QE+ +KLQNVE G LE+E+E +SL
Sbjct  297   AL-----------IEDSIINIADGRVKQEVRIKLQNVESGELELEVEWLSL  336



>ref|XP_001775397.1| predicted protein [Physcomitrella patens]
 gb|EDQ59726.1| predicted protein [Physcomitrella patens]
Length=330

 Score =   284 bits (726),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 159/348 (46%), Positives = 219/348 (63%), Gaps = 27/348 (8%)
 Frame = +1

Query  505   LMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEWTHEQV  684
             L+++  N+ CADCG+PDPKW S S+GVF+CIKC GVHRSLGVHISKVVS  LD W+ EQV
Sbjct  2     LLQKPENRVCADCGAPDPKWASTSIGVFLCIKCCGVHRSLGVHISKVVSTTLDTWSDEQV  61

Query  685   DILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLHLMC--  858
             D++  +GGN  AN  YEA  P   +K  P++S EER++FIRRKYE Q F+  +L +    
Sbjct  62    DLMEAIGGNASANSVYEACIPSGTRKPPPNASVEERSEFIRRKYEDQDFLKPNLRMKSQS  121

Query  859   ---PLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIG  1029
                  P T   +      S    +H    ++ N         +++  +++S AGMVEF+G
Sbjct  122   TSRARPPTGLETDDLSAPSDRAPVHSRTSSYSN---------RESINRTSSSAGMVEFLG  172

Query  1030  LIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPP  1209
             ++KV +VRG NLA+RD++SSDPYV  TLG Q+VKTRV+  NLNPVW+E+ MLS+P    P
Sbjct  173   MLKVRIVRGINLAVRDLLSSDPYVTATLGTQTVKTRVVNRNLNPVWDEEHMLSVPSPPQP  232

Query  1210  LKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMp  1389
             LK+ VFD D F+ DD MG+A ID+ PL++AA+  +   +    +Q  R    A  +NA+ 
Sbjct  233   LKLQVFDHDVFSADDSMGDAAIDLNPLILAAQMHQGMFEEFGCEQIGRW--LATNDNAL-  289

Query  1390  pplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                         D  I + +G ++Q++ LKL NVERG +EV LE V L
Sbjct  290   ----------VKDSNIEVIDGQIKQDVHLKLWNVERGEIEVSLEWVPL  327



>ref|XP_006396608.1| hypothetical protein EUTSA_v10028788mg [Eutrema salsugineum]
 ref|XP_006396609.1| hypothetical protein EUTSA_v10028788mg [Eutrema salsugineum]
 gb|ESQ38061.1| hypothetical protein EUTSA_v10028788mg [Eutrema salsugineum]
 gb|ESQ38062.1| hypothetical protein EUTSA_v10028788mg [Eutrema salsugineum]
Length=336

 Score =   284 bits (726),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 169/353 (48%), Positives = 222/353 (63%), Gaps = 29/353 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLNQPDNRVCADCGASDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K  PD S ++R  FIR KYELQ+F+  
Sbjct  73    DEWSDEEVDAMIEIGGNASANSIYEAFVPEGSSKPGPDVSHDQRMRFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +        SS    KK+S       L     +S+R   S       K     GMVE
Sbjct  133   SLRI--------SSGKCSKKNS-AFLTSSLSRKIMDSFRTNSS------SKKIFQEGMVE  177

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++KV V +GTNLAIRDM+SSDPYV+L LG Q ++T V+ +NLNPVWN++LMLS+PE+
Sbjct  178   FIGMLKVTVKKGTNLAIRDMMSSDPYVVLNLGKQKLQTTVVNSNLNPVWNQELMLSVPES  237

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               P+K+ V+D DTF+ DD MGEAEIDIQPL+ +A A       DP         +   + 
Sbjct  238   YGPVKLQVYDYDTFSADDIMGEAEIDIQPLITSAMAF-----GDP---------EMFGDM  283

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  284   QIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVESGELELEMEWLPLDQ  336



>ref|XP_010431492.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Camelina sativa]
 ref|XP_010431499.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Camelina sativa]
 ref|XP_010431506.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Camelina sativa]
Length=336

 Score =   283 bits (725),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 167/355 (47%), Positives = 222/355 (63%), Gaps = 33/355 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRLKDLLNQPDNRVCADCGASDPKWASTNIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  P+   K  PD S ++R  FI+ KYELQ+F+  
Sbjct  73    DEWSEEEVDSMIEIGGNASANSIYEAFVPDTCSKPGPDVSHDQRMRFIKAKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSM--AGM  1014
              L +                 SG        F   +S  +K  D+ K+   S  M   GM
Sbjct  133   SLRI----------------KSGKRSTKSSAF-LTSSLSRKIMDSFKSNSSSQKMFQEGM  175

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEFIGL+KV V +GTNLAIRD++SSDPYV L LG Q+++T V+ +NLNPVWN++LMLS+P
Sbjct  176   VEFIGLLKVTVKKGTNLAIRDLMSSDPYVDLNLGKQTLQTTVVNSNLNPVWNQELMLSVP  235

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
             E+  P+K+ V+D DTF+ DD MGEA+IDIQPL+ +A A       DP         +   
Sbjct  236   ESYGPVKLQVYDYDTFSADDIMGEADIDIQPLITSAMAF-----GDP---------EMFG  281

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             +  +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  282   DMQIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVECGELELEMEWLPLDQ  336



>emb|CDX94026.1| BnaC07g36600D [Brassica napus]
Length=338

 Score =   283 bits (725),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 165/351 (47%), Positives = 226/351 (64%), Gaps = 27/351 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +S N+FCADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRELLTQSDNRFCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN+ AN  YEA  P+ + K  PD++ ++R  FIR KYE Q+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNDSANSIYEAFLPDGFFKPGPDATHDQRLRFIRSKYEHQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +       +S      K S  +    L   F +S+R   S  Q        + GMVE
Sbjct  133   SLRI-------TSVKAPSTKSSSSYLSSSLSKKFMDSFRTNPSSQQP------QLEGMVE  179

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV + +GTNLA+RDM++SDPYV LTLG Q+V++ V K+NLNPVWNE+LMLS+P +
Sbjct  180   FIGLLKVTLKKGTNLAVRDMMTSDPYVKLTLGQQTVQSTVKKSNLNPVWNEELMLSVPHD  239

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ VFD DTF+ DD MGEA IDIQPL+ +A A  +      +Q           +N
Sbjct  240   YGSVKLQVFDYDTFSADDIMGEAGIDIQPLITSAMAFGDPEMFGDMQIGKWLKSH---DN  296

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
             A+             D  IN+++G V+QE+ +KLQNVE G LE+E+E +SL
Sbjct  297   AL-----------IEDSIINISDGKVKQEVHIKLQNVESGELELEVEWLSL  336



>gb|KDP34932.1| hypothetical protein JCGZ_09220 [Jatropha curcas]
Length=328

 Score =   283 bits (724),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 160/339 (47%), Positives = 214/339 (63%), Gaps = 40/339 (12%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S R RLK L+++S N+FCADC +PDPKW S ++GVFIC+KC GVHR LG HISKV+SV L
Sbjct  12    SGRRRLKELLQQSDNRFCADCAAPDPKWASANIGVFICLKCCGVHRGLGSHISKVLSVTL  71

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEWT +++D + E+GGN+ AN  YEA  PE   K +PD++ E+R  +IR KYELQ+F+  
Sbjct  72    DEWTDDEIDAMMEVGGNSAANAIYEAFIPETVTKPRPDANHEDRRKYIRSKYELQEFLKP  131

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +    P                       + ++S+ +K  D+ ++T  S      VE
Sbjct  132   SLRITSGKP---------------------AISIQSSFSRKILDSFRSTSTSQDSED-VE  169

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
              IGL+KV V  GTNLAIRDM+SSDPYV+LTLG Q+V+T V+++NLNP WNE LMLS+P++
Sbjct  170   SIGLLKVKVKSGTNLAIRDMMSSDPYVVLTLGKQTVQTTVMQSNLNPTWNETLMLSVPQD  229

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK--AET  1374
               P+K+ VFD DTF+ DD MGEAE+DIQPL+ +A A       DP         K     
Sbjct  230   FGPVKLQVFDHDTFSADDIMGEAELDIQPLITSAMAF-----GDPEMFGNMQIGKWLKSH  284

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNV  1491
             +NA+             D TIN+ +GTV+Q + LKLQNV
Sbjct  285   DNAL-----------IDDSTINIVDGTVKQAVSLKLQNV  312



>ref|XP_010529365.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Tarenaya hassleriana]
 ref|XP_010529366.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Tarenaya hassleriana]
 ref|XP_010529367.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Tarenaya hassleriana]
Length=334

 Score =   283 bits (725),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 160/353 (45%), Positives = 220/353 (62%), Gaps = 31/353 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +  N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLNQPDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K   D+S ++R  FIR KYE Q+F+  
Sbjct  73    DEWSDEEVDSMIEVGGNASANSIYEAFIPEGCSKPGHDASHDQRMRFIRSKYEFQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +                 SG   I        +  RK   D+ +      +  GMVE
Sbjct  133   SLRIT----------------SGKSSIKSSASLTSSLSRKI-MDSFRTNSSHQTQEGMVE  175

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             F+G++KV V +GTNLA+RDM+SSDPYV+L LG+Q+V+T V+K+NLNP+WN++LMLS+P++
Sbjct  176   FMGMLKVTVKKGTNLAVRDMMSSDPYVVLNLGHQTVQTAVMKSNLNPIWNQELMLSVPQD  235

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ V+D DTF+ DD MGEAEIDIQPL+ +A A  +      +Q           +N
Sbjct  236   YSSVKLQVYDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQIGKWLKSH---DN  292

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D  IN+ +G VRQE+ +KLQNVE G +E+ELE + L Q
Sbjct  293   AL-----------VEDSIINILDGKVRQEVQIKLQNVESGEIELELEWLPLDQ  334



>ref|XP_010529368.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Tarenaya hassleriana]
Length=333

 Score =   283 bits (724),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 161/353 (46%), Positives = 220/353 (62%), Gaps = 32/353 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +  N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLNQPDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K   D+S ++R  FIR KYE Q+F+  
Sbjct  73    DEWSDEEVDSMIEVGGNASANSIYEAFIPEGCSKPGHDASHDQRMRFIRSKYEFQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +                 SG   I        +  RK     +  T  S+   GMVE
Sbjct  133   SLRIT----------------SGKSSIKSSASLTSSLSRKIMDSFR--TNSSHQTEGMVE  174

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             F+G++KV V +GTNLA+RDM+SSDPYV+L LG+Q+V+T V+K+NLNP+WN++LMLS+P++
Sbjct  175   FMGMLKVTVKKGTNLAVRDMMSSDPYVVLNLGHQTVQTAVMKSNLNPIWNQELMLSVPQD  234

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ V+D DTF+ DD MGEAEIDIQPL+ +A A  +      +Q           +N
Sbjct  235   YSSVKLQVYDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQIGKWLKSH---DN  291

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D  IN+ +G VRQE+ +KLQNVE G +E+ELE + L Q
Sbjct  292   AL-----------VEDSIINILDGKVRQEVQIKLQNVESGEIELELEWLPLDQ  333



>ref|XP_002874839.1| ARF-GAP domain 13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51098.1| ARF-GAP domain 13 [Arabidopsis lyrata subsp. lyrata]
Length=336

 Score =   283 bits (724),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 166/353 (47%), Positives = 223/353 (63%), Gaps = 29/353 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLNQPDNRVCADCGASDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  P+   K  PD S ++R  FIR KYELQ+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFVPDTCSKPGPDVSHDQRMRFIRAKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +         +S      S       L     +S+R   S +QK  ++     GMVE
Sbjct  133   SLRI---------TSGKCSTKSSAFLTSSLSRKIMDSFRTNSS-SQKIFQE-----GMVE  177

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV + +GTNLAIRDM+SSDPYV+L LG Q ++T V+ +NLNPVWN++LMLS+PE+
Sbjct  178   FIGLLKVTIKKGTNLAIRDMMSSDPYVVLNLGKQKLQTTVVNSNLNPVWNQELMLSVPES  237

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               P+K+ V+D DTF+ DD MGEAEIDIQPL+ +A A       DP         +   + 
Sbjct  238   YGPVKLQVYDYDTFSADDIMGEAEIDIQPLITSAMAF-----GDP---------EMFGDM  283

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  284   QIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVESGELELEMEWLPLDQ  336



>ref|NP_567292.1| putative ADP-ribosylation factor GTPase-activating protein AGD13 
[Arabidopsis thaliana]
 sp|Q8LFN9.1|AGD13_ARATH RecName: Full=Probable ADP-ribosylation factor GTPase-activating 
protein AGD13; Short=ARF GAP AGD13; AltName: Full=Protein 
ARF-GAP DOMAIN 13; Short=AtAGD13 [Arabidopsis thaliana]
 gb|AAM61306.1| putative zinc finger and C2 domain protein [Arabidopsis thaliana]
 gb|ABD59071.1| At4g05330 [Arabidopsis thaliana]
 gb|AEE82506.1| putative ADP-ribosylation factor GTPase-activating protein AGD13 
[Arabidopsis thaliana]
Length=336

 Score =   283 bits (723),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 164/355 (46%), Positives = 222/355 (63%), Gaps = 33/355 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLNQPDNRVCADCGASDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  P+   K  PD + ++R  FIR KYELQ+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFLPDTCSKPGPDVNHDQRMRFIRAKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSM--AGM  1014
              L +                 SG        F   +S  +K  D+ +    S +M   GM
Sbjct  133   SLRIT----------------SGKGSTKSSAF-LTSSLSRKIMDSFRTNSSSQTMFQEGM  175

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEFIGL+KV + +GTNLAIRDM+SSDPYV+L LG Q ++T V+ +NLNPVWN++LMLS+P
Sbjct  176   VEFIGLLKVTIKKGTNLAIRDMMSSDPYVVLNLGKQKLQTTVMNSNLNPVWNQELMLSVP  235

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
             E+  P+K+ V+D DTF+ DD MGEA+IDIQPL+ +A A       DP         +   
Sbjct  236   ESYGPVKLQVYDYDTFSADDIMGEADIDIQPLITSAMAF-----GDP---------EMFG  281

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             +  +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  282   DMQIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVESGELELEMEWLPLDQ  336



>ref|XP_009134332.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
 ref|XP_009134333.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
Length=337

 Score =   283 bits (723),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 167/356 (47%), Positives = 223/356 (63%), Gaps = 34/356 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R+K L+K+  N+ CADC +PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIKDLLKQPDNRVCADCSAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K  PD S ++R  FIR KYELQ+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFVPEGSSKPGPDVSHDQRMRFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRN-SWRKKESDTQKATRKSNSM--AG  1011
              L +                 + G        +F N S   K  D+ +A   S  +   G
Sbjct  133   SLRI-----------------TSGKACSTKKPSFLNSSISTKFMDSFRANSSSKKIFEEG  175

Query  1012  MVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSI  1191
             MVEFIGL+KV V +GTNLAIRD++SSDPYV+L LG Q ++T V+ +NLNP+WN++LMLS+
Sbjct  176   MVEFIGLLKVTVKKGTNLAIRDVMSSDPYVVLNLGKQKLQTTVVNSNLNPIWNQELMLSV  235

Query  1192  PENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAE  1371
             PE+  P+K+ V+D DTF+ DD MGEAE+DIQPL+ +A A       DP         +  
Sbjct  236   PESYGPVKLQVYDYDTFSADDIMGEAELDIQPLITSAMAF-----GDP---------EMF  281

Query  1372  TENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +  +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  282   GDMQIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVECGELELEMEWLPLEQ  337



>ref|XP_010537894.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537902.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Tarenaya hassleriana]
Length=334

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 160/338 (47%), Positives = 216/338 (64%), Gaps = 33/338 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +  N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLSQPDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K +PD+S ++R  FIR KYELQ+F+  
Sbjct  73    DEWSDEEVDSMIEVGGNASANSIYEAFIPEGCSKPRPDASHDQRMRFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +                 SG   I        +  RK   D+ +      +  GMVE
Sbjct  133   SLRIT----------------SGKTSIKSSASLTSSLSRKI-MDSFRTNSSHQTQEGMVE  175

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++KV + +GTNLAIRDM+SSDPYV+LTLG Q+V+T V+K+NLNPVWN++LMLS+P+N
Sbjct  176   FIGMLKVIIKKGTNLAIRDMMSSDPYVVLTLGQQTVQTVVMKSNLNPVWNQELMLSVPQN  235

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET-E  1377
               P+K+ V+D DTF+ DD MGEAEIDIQPL+ +A A  +      +Q      K  ++ +
Sbjct  236   YGPVKLQVYDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQ----IGKWLQSHD  291

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNV  1491
             NA+             D  IN+ +G VRQE+ +KLQNV
Sbjct  292   NAL-----------IEDSIINIVDGKVRQEVQIKLQNV  318



>ref|XP_003594529.1| ZAC [Medicago truncatula]
 gb|AES64780.1| ADP-ribosylation factor GTPase-activating protein AGD10 [Medicago 
truncatula]
Length=329

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 159/353 (45%), Positives = 221/353 (63%), Gaps = 39/353 (11%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S R RLK L+ +  N+ C+DC +PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  16    SGRRRLKDLLHQKDNRVCSDCNAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  75

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             D+W+ ++VD + E+GGN  AN  YEA  PE Y K  PD+S E+R  FIR KYELQ+F+  
Sbjct  76    DDWSDDEVDAMIEVGGNASANSIYEAYIPEGYTKPGPDASHEQRAKFIRSKYELQEFLKP  135

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L ++                SG   +     +F +S++         +  S  M GMVE
Sbjct  136   SLRIV----------------SGKSNLSSSSNSFMDSFK---------STNSERMEGMVE  170

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++KV V++GT+LA+RD+ SSDPYV+L LG Q+V+T V+++NLNPVWNE+ MLS+PE+
Sbjct  171   FIGMLKVKVIKGTDLAVRDIKSSDPYVVLNLGTQTVQTSVMRSNLNPVWNEEHMLSVPEH  230

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                LK+ VFD DTF+ DD MGEA+ID+Q L+ +A A  ++     +Q           +N
Sbjct  231   YGQLKLKVFDHDTFSADDIMGEADIDLQSLITSAMAFGDAGMFGDMQIGKWLKSD---DN  287

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D  + + +G V+Q + LKLQNVE G +E+ELE +SL  
Sbjct  288   AL-----------IEDSAVKIIDGKVKQMMTLKLQNVECGEIELELEWISLDH  329



>ref|XP_010537911.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Tarenaya hassleriana]
Length=333

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 216/338 (64%), Gaps = 34/338 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +  N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLSQPDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K +PD+S ++R  FIR KYELQ+F+  
Sbjct  73    DEWSDEEVDSMIEVGGNASANSIYEAFIPEGCSKPRPDASHDQRMRFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +                 SG   I        +  RK     +  T  S+   GMVE
Sbjct  133   SLRIT----------------SGKTSIKSSASLTSSLSRKIMDSFR--TNSSHQTEGMVE  174

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++KV + +GTNLAIRDM+SSDPYV+LTLG Q+V+T V+K+NLNPVWN++LMLS+P+N
Sbjct  175   FIGMLKVIIKKGTNLAIRDMMSSDPYVVLTLGQQTVQTVVMKSNLNPVWNQELMLSVPQN  234

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET-E  1377
               P+K+ V+D DTF+ DD MGEAEIDIQPL+ +A A  +      +Q      K  ++ +
Sbjct  235   YGPVKLQVYDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQ----IGKWLQSHD  290

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNV  1491
             NA+             D  IN+ +G VRQE+ +KLQNV
Sbjct  291   NAL-----------IEDSIINIVDGKVRQEVQIKLQNV  317



>ref|NP_001168952.1| uncharacterized protein LOC100382772 [Zea mays]
 ref|XP_008644019.1| PREDICTED: uncharacterized protein LOC100382772 isoform X1 [Zea 
mays]
 ref|XP_008644020.1| PREDICTED: uncharacterized protein LOC100382772 isoform X1 [Zea 
mays]
 ref|XP_008644021.1| PREDICTED: uncharacterized protein LOC100382772 isoform X1 [Zea 
mays]
 gb|ACN31172.1| unknown [Zea mays]
 gb|AFW70725.1| putative calcium-dependent lipid-binding (CaLB domain) family 
protein isoform 1 [Zea mays]
 gb|AFW70726.1| putative calcium-dependent lipid-binding (CaLB domain) family 
protein isoform 2 [Zea mays]
Length=322

 Score =   281 bits (719),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 160/348 (46%), Positives = 210/348 (60%), Gaps = 41/348 (12%)
 Frame = +1

Query  490   CRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEW  669
              +LK L+++S N  CADCG+ DPKW S ++GVFIC+KCSGVHRSLG HISKV+SV LD+W
Sbjct  14    AKLKELLQKSENHICADCGASDPKWASANIGVFICVKCSGVHRSLGTHISKVLSVTLDKW  73

Query  670   THEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLH  849
             +  +VD + E+GGN+ AN  YEA  PE Y+K   DS+ EER  FIR KYELQ+F+   L 
Sbjct  74    SDSEVDSMIEVGGNSQANAIYEAFIPEGYQKPHSDSTQEEREKFIRSKYELQEFLKPSLR  133

Query  850   LMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIG  1029
             ++   P+ S        HS G                           S S  GM+EFIG
Sbjct  134   IVSHQPSDSGKHAGNASHSDG---------------------------SKSQVGMIEFIG  166

Query  1030  LIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPP  1209
             ++ V V+ GTNLAIRDM SSDPYV+LTLG Q  +T VI  NLNPVWNE+L LS+P+   P
Sbjct  167   ILNVKVIGGTNLAIRDMSSSDPYVVLTLGQQKAQTSVINGNLNPVWNEELKLSVPQQYGP  226

Query  1210  LKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMp  1389
             LK+ VFD D  + DD MGEAEID+Q ++ AA A  +      +Q       K+E +NA+ 
Sbjct  227   LKLQVFDHDMVSKDDLMGEAEIDLQTMINAAAAFGDPELLGDIQIGRWL--KSE-DNAL-  282

Query  1390  pplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                         D  + ++ G V+Q + LKLQ+ E G LE+E+E + L
Sbjct  283   ----------VRDSAVVVSGGKVKQGMALKLQHTESGELELEMEWMPL  320



>ref|XP_004158071.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Cucumis sativus]
Length=333

 Score =   281 bits (720),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 222/353 (63%), Gaps = 32/353 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  NQ CADCG+PDPKW S ++GVFIC+KCSGVHRSLG H+SKV+S+ L
Sbjct  13    SAKSRLKDLLLQIDNQLCADCGAPDPKWASANIGVFICLKCSGVHRSLGTHVSKVLSITL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN  AN  YEA  P+ Y K  P +S EER++FIR KYELQ+F+  
Sbjct  73    DEWSDDEIDAMIEVGGNGSANAIYEAFIPDGYTKPGPSASHEERSNFIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L ++        S+ S K          +  +FR            ++ K +   GM+E
Sbjct  133   SLRIV--------SNNSSKSSEEPSYFQEITDSFR----------SSSSSKKSPQEGMIE  174

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             F+GL+KV V+ GTNLA+RD+ +SDP+V LTLG Q+ KT VIK+NLNPVWNE+LMLS+P  
Sbjct  175   FMGLLKVKVIEGTNLAVRDVKTSDPFVTLTLGQQTAKTTVIKSNLNPVWNEELMLSVPLE  234

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
               PLK+ VFD D   ++D MGEAEID+QP++ +A A  ++   + +Q           +N
Sbjct  235   YGPLKLQVFDHDIILSNDLMGEAEIDLQPMITSAIAFGDAEMLENMQIGKWLKSD---DN  291

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D  + + +G V+QE+ LKLQNVE G + +ELE + + +
Sbjct  292   AL-----------VNDSAVVIVDGKVKQEVSLKLQNVESGEVHLELEWIPIDR  333



>gb|EPS58515.1| hypothetical protein M569_16298, partial [Genlisea aurea]
Length=329

 Score =   281 bits (719),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 221/347 (64%), Gaps = 34/347 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + +LK L+ +  N+ CADCG+P+PKW S ++GVFIC+KC GVHRSLG ++SKV+SV L
Sbjct  14    SGKRKLKELLSQKDNRLCADCGAPEPKWASANIGVFICLKCCGVHRSLGSNVSKVLSVTL  73

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E++D + E+GGN  AN  YEA  PE   K +PD+S E+R  FIR KYELQ+F+  
Sbjct  74    DEWSDEEIDAMIEVGGNASANSIYEAYLPEGVTKPRPDASHEQRTKFIRSKYELQEFLKP  133

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +                 SGG+  H L  +F     +K  D  +++  S +   + E
Sbjct  134   SLRI----------------QSGGNTKHSLQASF----SRKILDNFRSSSSSQNSTSVEE  173

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             +IG +K+ V++GTNLAIRDM+SSDPY+IL+LG Q V+T V+K+NLNPVWNE+L L IP++
Sbjct  174   YIGTLKIKVLKGTNLAIRDMLSSDPYIILSLGKQKVQTSVVKSNLNPVWNEELKLKIPQD  233

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +KV V+D D F+ DD MGEAEIDIQP++ +A A  ++     +Q           +N
Sbjct  234   YGSIKVQVYDHDMFSADDIMGEAEIDIQPMITSATAFGDAGMFSDMQIGKWL---KSYDN  290

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELE  1521
             A+             D  +N+ +G V+Q++ L+LQNVE G +E+E+E
Sbjct  291   AL-----------IEDSPVNIVDGKVKQDLWLRLQNVESGEIELEME  326



>ref|XP_004951559.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Setaria italica]
 ref|XP_004951560.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X2 [Setaria italica]
Length=324

 Score =   280 bits (717),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 164/348 (47%), Positives = 215/348 (62%), Gaps = 40/348 (11%)
 Frame = +1

Query  490   CRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEW  669
              +LK L+  S N+ CADC +PDPKW S ++GVFIC+KCSGVHRSLG HISKV+SV LD+W
Sbjct  15    AKLKELLHRSENRICADCSAPDPKWASANIGVFICVKCSGVHRSLGTHISKVLSVTLDKW  74

Query  670   THEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLH  849
             T  +V+ + E+GGN+ AN  YEA  PE Y+K  PDSS EER  FIR KYELQ+F+   L 
Sbjct  75    TDNEVESMIEVGGNSNANAIYEAFLPEGYQKPHPDSSQEEREKFIRSKYELQEFLKPSLR  134

Query  850   LMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIG  1029
             ++     +  +S    KH+G                     +   +  S S  GM+EFIG
Sbjct  135   IV-----SHHTSDDCGKHAG---------------------SASHSDGSKSEIGMIEFIG  168

Query  1030  LIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPP  1209
             ++ V V+ GTNLAIRDM SSDPYV+LTLG+Q V++ VIK NLNPVWNE+L LS+P    P
Sbjct  169   ILNVKVIGGTNLAIRDMSSSDPYVVLTLGHQKVQSSVIKGNLNPVWNEELKLSVPREYGP  228

Query  1210  LKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETENAMp  1389
             LK+ VFD D  + DD MGEAEID+Q ++ AA A  N      +Q       K+E +NA+ 
Sbjct  229   LKLQVFDHDMMSKDDLMGEAEIDLQTMINAAAAFGNPELLGDMQIGRWL--KSE-DNAL-  284

Query  1390  pplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                         D  + +A G V+Q + LKLQ+ E G LE+E+E + L
Sbjct  285   ----------VRDSAVVVAGGKVKQGVSLKLQHTESGELELEMEWMPL  322



>ref|XP_006289871.1| hypothetical protein CARUB_v10003483mg [Capsella rubella]
 gb|EOA22769.1| hypothetical protein CARUB_v10003483mg [Capsella rubella]
Length=336

 Score =   280 bits (717),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 166/355 (47%), Positives = 219/355 (62%), Gaps = 33/355 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R+K L+ +  N+ CADCG+ DPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIKDLLNQPDNRVCADCGASDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  P+   K  PD S ++R  FIR KYELQ+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFVPDTCSKPGPDVSHDQRMRFIRAKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSM--AGM  1014
              L +                 SG        F   +S  +K  D+ +    S  M   GM
Sbjct  133   SLRI----------------KSGKCSTKSSPF-LTSSLSRKIMDSFRTNSSSQKMFQEGM  175

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEFIGL+KV + +GTNLAIRD++SSDPYV+L LG Q ++T V+ +NLNPVWN++LMLS+P
Sbjct  176   VEFIGLLKVTIKKGTNLAIRDLMSSDPYVVLNLGKQKLQTTVVNSNLNPVWNQELMLSVP  235

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
             E+  P+K+ V+D DTF+ DD MGEA+IDIQPL+ +A A       DP         K   
Sbjct  236   ESYGPVKLQVYDYDTFSADDIMGEADIDIQPLITSAMAF-----GDPEMFGNMQIGKWLK  290

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              N           PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  291   SN---------DNPLIDDSIINIVDGKVKQEVQIKLQNVECGELELEMEWLPLEQ  336



>ref|XP_010434225.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 isoform X1 [Camelina sativa]
 ref|XP_010434226.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 isoform X1 [Camelina sativa]
 ref|XP_010434227.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 isoform X1 [Camelina sativa]
 ref|XP_010439508.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 isoform X1 [Camelina sativa]
 ref|XP_010439509.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 isoform X1 [Camelina sativa]
 ref|XP_010439510.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 isoform X1 [Camelina sativa]
Length=337

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 163/342 (48%), Positives = 214/342 (63%), Gaps = 32/342 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +S N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLTQSDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K  PD+S ++R  FIR KYE Q+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFIPEGSSKPGPDASHDQRMRFIRSKYEHQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +     +++ SS           +        +S+R   S  Q        + GMVE
Sbjct  133   SLRITSGKASSTKSSAYLSSSLSKKIV--------DSFRTNSSSQQP------QLEGMVE  178

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV + +GTNLAIRDM+SSDPYV+LTLG Q  ++ V+K+NLNPVWNE+LMLS+P N
Sbjct  179   FIGLLKVTIKKGTNLAIRDMMSSDPYVVLTLGQQKAQSTVVKSNLNPVWNEELMLSVPHN  238

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK--AET  1374
                +K+ VFD DTF+ DD MGEAEIDIQPL+ +A A       DP         K     
Sbjct  239   YGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAF-----GDPEMFGDMQIGKWLKSH  293

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERG  1500
             +NA+             D  IN+A+G V+QE+ +KLQNVE G
Sbjct  294   DNAL-----------IEDSIINIADGKVKQEVQIKLQNVESG  324



>ref|XP_011085202.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Sesamum indicum]
 ref|XP_011085203.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Sesamum indicum]
Length=337

 Score =   280 bits (716),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/351 (44%), Positives = 220/351 (63%), Gaps = 29/351 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCG+PDPKW S ++GVF+C+KC  VHR+LG HISKV+SV L
Sbjct  13    SGKKRLKDLLVQRDNRLCADCGAPDPKWASSNIGVFLCLKCCAVHRNLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN  AN  YEA  PE  KK +PD+  +ER  +IR KYELQ+F+  
Sbjct  73    DEWSEDEIDAMMEVGGNASANSIYEAYLPEGVKKPRPDAPHDERTKYIRSKYELQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +             +   S    +       + + RK   D +  T  S +  G+ E
Sbjct  133   SLRI-------------KSGPSSKQSLQASLSGKKMNERKGSMDNK--TVSSMNANGVSE  177

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++KV V++GTNLAIRDM+SSDPY+ILTLG Q V+T V+ +NLNPVWNE+L L++P++
Sbjct  178   FIGMLKVRVLKGTNLAIRDMLSSDPYIILTLGQQKVQTSVVTSNLNPVWNEELDLAVPQD  237

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ V+D D F+ DD MGEAEIDIQP++ +A A  ++T    +Q           +N
Sbjct  238   YGSIKLQVYDHDMFSADDIMGEAEIDIQPMITSALAFGDATMFGDMQIGKWL---KSYDN  294

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
             A+             D T+N+  G V+Q++ L+LQNVE G +E+ELE   L
Sbjct  295   AL-----------IEDSTVNIVAGKVKQDLWLRLQNVESGEVELELEWTPL  334



>gb|EEE66000.1| hypothetical protein OsJ_21940 [Oryza sativa Japonica Group]
Length=994

 Score =   296 bits (758),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 169/376 (45%), Positives = 233/376 (62%), Gaps = 39/376 (10%)
 Frame = +1

Query  418   QMDTSPSDSDQMEPQMQD-YSLSPRCR-LKALMKESGNQFCADCGSPDPKWVSLSLGVFI  591
             Q+D   S+S Q+    +   SL+ + R LK L+ +S N+ CADC SPDPKW S ++GVFI
Sbjct  656   QLDQEYSNSYQISYVYESSMSLTDKMRKLKELLHKSENRICADCSSPDPKWASANIGVFI  715

Query  592   CIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKP  771
             C+KCSG+HRSLG HISKV+SV LDEWT ++++ + E+GGN+ AN  YEA  P  Y K  P
Sbjct  716   CLKCSGIHRSLGTHISKVLSVTLDEWTDDEINSMLEVGGNSYANAIYEAFLPGGYHKPHP  775

Query  772   DSSTEERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNS  951
             DSS EER DFIR KYELQ+F+   L ++                S    +  +       
Sbjct  776   DSSQEERADFIRSKYELQEFLKPSLRIV----------------SNKSSLQAMD------  813

Query  952   WRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVK  1131
               +K+      +    S AGMVEFIG+IKV V+RGT LA+RD++SSDPYV+LTLG Q  K
Sbjct  814   -SRKDIGNASNSYSFKSEAGMVEFIGIIKVKVIRGTKLAVRDILSSDPYVVLTLGQQKAK  872

Query  1132  TRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARAS  1311
             T+VIK+NLNPVWNE L LS+P+   PLK+ V+D D  + DD MGEAE+D+QP++ AA A 
Sbjct  873   TKVIKSNLNPVWNEVLTLSVPQKYGPLKLQVYDHDVLSRDDIMGEAEVDLQPMITAAMAF  932

Query  1312  ENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNV  1491
              +      +Q       +   +NA+             D  +++  G V+QE+ L+LQNV
Sbjct  933   GDPGLLSDMQIGRWLMSR---DNAL-----------ARDSAVSVVGGRVKQEVSLRLQNV  978

Query  1492  ERGVLEVELECVSLSQ  1539
             E G +++ELE ++L+Q
Sbjct  979   ECGEVDLELEWIALNQ  994



>ref|XP_010449110.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Camelina sativa]
 ref|XP_010449111.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Camelina sativa]
Length=337

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 163/342 (48%), Positives = 214/342 (63%), Gaps = 32/342 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +S N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLTQSDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K  PD+S ++R  FIR KYE Q+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFIPEGSSKPGPDASHDQRMRFIRSKYEHQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +     +++ SS           +        +S+R   S  Q        + GMVE
Sbjct  133   SLRITSGKTSSTKSSAYLSSSLSKKIV--------DSFRSNSSSQQP------QLEGMVE  178

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV + +GTNLAIRDM+SSDPYV+LTLG Q  ++ V+K+NLNPVWNE+LMLS+P N
Sbjct  179   FIGLLKVTIKKGTNLAIRDMMSSDPYVVLTLGQQKAQSTVVKSNLNPVWNEELMLSVPHN  238

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK--AET  1374
                +K+ VFD DTF+ DD MGEAEIDIQPL+ +A A       DP         K     
Sbjct  239   YGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAF-----GDPEMFGDMQIGKWLKSH  293

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERG  1500
             +NA+             D  IN+A+G V+QE+ +KLQNVE G
Sbjct  294   DNAL-----------IEDSIINIADGKVKQEVQIKLQNVESG  324



>gb|EEC80955.1| hypothetical protein OsI_23669 [Oryza sativa Indica Group]
Length=1116

 Score =   296 bits (758),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 169/376 (45%), Positives = 233/376 (62%), Gaps = 39/376 (10%)
 Frame = +1

Query  418   QMDTSPSDSDQMEPQMQD-YSLSPRCR-LKALMKESGNQFCADCGSPDPKWVSLSLGVFI  591
             Q+D   S+S Q+    +   SL+ + R LK L+ +S N+ CADC SPDPKW S ++GVFI
Sbjct  778   QLDQEYSNSYQISYVYESSMSLTDKMRKLKELLHKSENRICADCSSPDPKWASANIGVFI  837

Query  592   CIKCSGVHRSLGVHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKP  771
             C+KCSG+HRSLG HISKV+SV LDEWT ++++ + E+GGN+ AN  YEA  P  Y K  P
Sbjct  838   CLKCSGIHRSLGTHISKVLSVTLDEWTDDEINSMLEVGGNSYANAIYEAFLPGGYHKPHP  897

Query  772   DSSTEERNDFIRRKYELQQFVNSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNS  951
             DSS EER DFIR KYELQ+F+   L ++                S    +  +       
Sbjct  898   DSSQEERADFIRSKYELQEFLKPSLRIV----------------SNKSSLQAMD------  935

Query  952   WRKKESDTQKATRKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVK  1131
               +K+      +    S AGMVEFIG+IKV V+RGT LA+RD++SSDPYV+LTLG Q  K
Sbjct  936   -SRKDIGNASNSYSFKSEAGMVEFIGIIKVKVIRGTKLAVRDILSSDPYVVLTLGQQKAK  994

Query  1132  TRVIKNNLNPVWNEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARAS  1311
             T+VIK+NLNPVWNE L LS+P+   PLK+ V+D D  + DD MGEAE+D+QP++ AA A 
Sbjct  995   TKVIKSNLNPVWNEVLTLSVPQKYGPLKLQVYDHDVLSRDDIMGEAEVDLQPMITAAMAF  1054

Query  1312  ENSTKNDPVQQQPRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNV  1491
              +      +Q       +   +NA+             D  +++  G V+QE+ L+LQNV
Sbjct  1055  GDPGLLSDMQIGRWLMSR---DNAL-----------ARDSAVSVVGGRVKQEVSLRLQNV  1100

Query  1492  ERGVLEVELECVSLSQ  1539
             E G +++ELE ++L+Q
Sbjct  1101  ECGEVDLELEWIALNQ  1116



>emb|CDY46364.1| BnaA09g19780D [Brassica napus]
Length=345

 Score =   278 bits (712),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 168/360 (47%), Positives = 224/360 (62%), Gaps = 34/360 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +  N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLNQPDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRR-------KYE  819
             D+W+ E+VD + E+GGN  AN  YEA  PE   K  PD S ++R  FIR+       KYE
Sbjct  73    DDWSDEEVDSMIEIGGNASANSIYEAFVPEGSSKPGPDVSHDQRMRFIRQAYSTRQSKYE  132

Query  820   LQQFVNSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSN  999
             LQ+F+   L +       +S  T+  K         L   F +S+R   S       K  
Sbjct  133   LQEFLKPSLRI-------TSGKTTSTKKPPSFLSSSLSTKFMDSFRTNSS------SKKI  179

Query  1000  SMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQL  1179
                GMVEFIGL+KV V +GTNLAIRDM+SSDPYV+L LG Q ++T V+ +NLNPVWN++L
Sbjct  180   FEEGMVEFIGLLKVTVKKGTNLAIRDMMSSDPYVVLNLGKQKLQTTVVNSNLNPVWNQEL  239

Query  1180  MLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTP  1359
             MLS+PE+  P+K+ V+D DTF+ DD MGEAE+DIQPL+ +A A       DP        
Sbjct  240   MLSVPESYGPVKLQVYDYDTFSADDIMGEAELDIQPLITSAMAF-----GDP--------  286

Query  1360  KKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              +   +  +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  287   -EMFGDMQIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVESGELELEMEWLPLDQ  345



>ref|XP_006284072.1| hypothetical protein CARUB_v10005198mg [Capsella rubella]
 ref|XP_006284073.1| hypothetical protein CARUB_v10005198mg [Capsella rubella]
 gb|EOA16970.1| hypothetical protein CARUB_v10005198mg [Capsella rubella]
 gb|EOA16971.1| hypothetical protein CARUB_v10005198mg [Capsella rubella]
Length=337

 Score =   277 bits (709),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 161/342 (47%), Positives = 215/342 (63%), Gaps = 32/342 (9%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +S N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLTQSDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K  PD+S ++R  FIR KYE Q+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFIPEGSSKPGPDASHDQRMRFIRSKYEHQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +     +++ SS           I     +FR +          ++ +   + GMVE
Sbjct  133   SLRITSVKGSSTKSSAQLSSSLSKKIID----SFRTN----------SSSQHPQLEGMVE  178

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV + +GTNLAIRDM+SSDPYV+LTLG Q  ++ V+K+NLNPVWNE+LMLS+P N
Sbjct  179   FIGLLKVTIKKGTNLAIRDMMSSDPYVVLTLGQQKAQSTVVKSNLNPVWNEELMLSVPHN  238

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK--AET  1374
                +K+ VFD DTF+ DD MGEAEIDIQPL+ +A A       DP         K     
Sbjct  239   YGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAF-----GDPEMFGDMQIGKWLKSH  293

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERG  1500
             +NA+             D  IN+A+G V+Q++ +KLQNVE G
Sbjct  294   DNAL-----------IEDSIINIADGKVKQDVQIKLQNVESG  324



>ref|XP_007147482.1| hypothetical protein PHAVU_006G128200g [Phaseolus vulgaris]
 ref|XP_007147483.1| hypothetical protein PHAVU_006G128200g [Phaseolus vulgaris]
 gb|ESW19476.1| hypothetical protein PHAVU_006G128200g [Phaseolus vulgaris]
 gb|ESW19477.1| hypothetical protein PHAVU_006G128200g [Phaseolus vulgaris]
Length=324

 Score =   277 bits (708),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 224/353 (63%), Gaps = 36/353 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S R +LK L+ +  N+ CADC +PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  8     SSRRKLKDLLLQKDNRCCADCNAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  67

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN  AN  YEA  PE   K +PD+  E+R+ FIR KYE Q+F+  
Sbjct  68    DEWSEDEIDAMMEVGGNASANSIYEAYIPEGLTKPEPDAGHEQRSKFIRSKYEFQEFLKP  127

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L ++          + +           +  +F ++     S+TQ+       + GMVE
Sbjct  128   SLRIV----------SGKSSTGSNSSKSLIIDSFTSA-----SNTQR-------LEGMVE  165

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++KV V++GTNLAIRD+ SSDPYVIL+LG Q+V+T V ++NLNPVWNE+ MLS+PE+
Sbjct  166   FIGMLKVKVIKGTNLAIRDIKSSDPYVILSLGQQTVQTSVARSNLNPVWNEEYMLSVPEH  225

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ VFD DTF+ DD MG+A+ID+Q L+ +A A  ++   D +Q           +N
Sbjct  226   YGQMKLKVFDYDTFSADDIMGDADIDLQSLITSAMAFGDAGMFDDMQIGKWLKSD---DN  282

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D T+N+ +G V+Q + LKLQNVE G L++EL+ + L Q
Sbjct  283   AL-----------IEDSTVNIVDGKVKQMMSLKLQNVESGELDLELQWIPLDQ  324



>ref|XP_010233985.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Brachypodium distachyon]
 ref|XP_010233986.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Brachypodium distachyon]
Length=322

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 158/352 (45%), Positives = 206/352 (59%), Gaps = 53/352 (15%)
 Frame = +1

Query  490   CRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEW  669
              +LK L+  S N+ CADC +PDPKW S ++GVFIC+KCSGVHRSLG HISKV+SV LD+W
Sbjct  18    AKLKELLHRSENRICADCSAPDPKWASANIGVFICLKCSGVHRSLGTHISKVLSVTLDKW  77

Query  670   THEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLH  849
             T +QVD + E GGN+ AN  YEA  P+ + K  PDS+ EER +FIR KYELQ+F+   L 
Sbjct  78    TDDQVDSMVEAGGNSHANAIYEAFLPQGHCKPHPDSNQEERQNFIRSKYELQEFLEPSLR  137

Query  850   LMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIG  1029
             ++   P                                ++    A+  S S  GMVEFIG
Sbjct  138   IVADHP-------------------------------SDAGKHTASDSSKSEIGMVEFIG  166

Query  1030  LIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPP  1209
             ++ V V+ GT LAIRDM SSDPYVILTLG+Q  +T VIK NLNPVWNE+L  S+P+    
Sbjct  167   ILNVKVIGGTKLAIRDMSSSDPYVILTLGHQRAQTSVIKGNLNPVWNEELKFSVPQQYGS  226

Query  1210  LKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPV----QQQPRTPKKAETE  1377
             LK+ V D D  + DD MGEAEID+QP++ AA     +   DP      Q  R  K A  +
Sbjct  227   LKLQVLDHDMVSKDDVMGEAEIDLQPMINAA-----AVFGDPELLGDMQIGRWLKSA--D  279

Query  1378  NAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
             NA+             D  + +  G V+QE+ LKLQ  E G + +E++ + L
Sbjct  280   NAL-----------TEDSAVMVTGGMVKQEVSLKLQRTESGEVALEMQWIPL  320



>ref|XP_010434228.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 isoform X2 [Camelina sativa]
 ref|XP_010439513.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 isoform X2 [Camelina sativa]
Length=336

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 214/342 (63%), Gaps = 33/342 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +S N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLTQSDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  PE   K  PD+S ++R  FIR KYE Q+F+  
Sbjct  73    DEWSDEEVDSMIEIGGNASANSIYEAFIPEGSSKPGPDASHDQRMRFIRSKYEHQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +     +++ SS           +        +S+R   S  Q        + GMVE
Sbjct  133   SLRITSGKASSTKSSAYLSSSLSKKIV--------DSFRTNSSSQQP------QLEGMVE  178

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIGL+KV + +GTNLAIRDM+SSDPYV+LTLG Q+  T V+K+NLNPVWNE+LMLS+P N
Sbjct  179   FIGLLKVTIKKGTNLAIRDMMSSDPYVVLTLGQQAQST-VVKSNLNPVWNEELMLSVPHN  237

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK--AET  1374
                +K+ VFD DTF+ DD MGEAEIDIQPL+ +A A       DP         K     
Sbjct  238   YGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAF-----GDPEMFGDMQIGKWLKSH  292

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERG  1500
             +NA+             D  IN+A+G V+QE+ +KLQNVE G
Sbjct  293   DNAL-----------IEDSIINIADGKVKQEVQIKLQNVESG  323



>ref|XP_009802941.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Nicotiana sylvestris]
Length=331

 Score =   276 bits (705),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 163/353 (46%), Positives = 224/353 (63%), Gaps = 34/353 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + RLK L+ +  N+ CADCGSPDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SSKRRLKDLLLQKDNRVCADCGSPDPKWASTNIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ +++D + E+GGN  AN  YEA  PE   K  PD+S E+R+ +IR KYE Q+F+  
Sbjct  73    DEWSDDEIDSMIEVGGNASANSIYEAYLPEGISKPGPDASHEQRSKYIRSKYERQEFLKP  132

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L ++     +S  ++   K +                       + ++  S    GMVE
Sbjct  133   SLRILSNPKKSSLKTSLSSKIT--------------------DSFRSSSSSSQKSEGMVE  172

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++KV V++GTNLAIRDM+SSDPYV+L LG Q V+T V+K+NLNPVWNE+LMLS+P++
Sbjct  173   FIGMLKVKVIKGTNLAIRDMLSSDPYVVLALGKQKVQTTVVKSNLNPVWNEELMLSVPQD  232

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                +K+ V+D DTF+ DD MGEAEIDIQP++ +A A  ++     +Q           +N
Sbjct  233   YGAVKLQVYDHDTFSADDIMGEAEIDIQPMITSAMAFGDAGMFGNMQIGKWL---KSNDN  289

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D T+N+ +G V+QE+ LKLQNVE G LE+ELE + L Q
Sbjct  290   AL-----------MDDSTVNIVDGKVKQEVNLKLQNVESGELELELEWIPLDQ  331



>gb|AFK36973.1| unknown [Medicago truncatula]
Length=329

 Score =   275 bits (704),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 163/353 (46%), Positives = 219/353 (62%), Gaps = 39/353 (11%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S R RLK L+ +  N+ C+DC +PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  16    SGRRRLKDLLHQKDNRVCSDCNAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  75

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             D+W+ ++VD + E+GGN  AN  YEA  PE Y K  PD+S E+R  FIR KYELQ+F+  
Sbjct  76    DDWSDDEVDAMIEVGGNASANSIYEAYIPEGYTKPGPDASHEQRAKFIRSKYELQEFLKP  135

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L ++      SSSS S              F   NS R               M GMVE
Sbjct  136   SLRIVSGKSNLSSSSNSFMNS----------FKSTNSER---------------MEGMVE  170

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG++KV V++GT+LA+RD+ SSDPYV+L LG Q+V+T V+++NLNPVWNE+ MLS+PE+
Sbjct  171   FIGMLKVKVIKGTDLAVRDIKSSDPYVVLNLGTQTVQTSVMRSNLNPVWNEEHMLSVPEH  230

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAETEN  1380
                LK+ VFD DTF+ DD MGEA+ID+Q L+ +A A  ++     +Q           +N
Sbjct  231   YGQLKLKVFDHDTFSADDIMGEADIDLQSLITSAMAFGDAGMFGDMQIGKWLKSD---DN  287

Query  1381  AMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             A+             D  + + +G V+Q + LKLQNVE G +E+ELE +SL  
Sbjct  288   AL-----------IEDSAVKIIDGKVKQMMTLKLQNVECGEIELELEWISLDH  329



>ref|XP_004486456.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like isoform X1 [Cicer arietinum]
 ref|XP_004486457.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like isoform X2 [Cicer arietinum]
 ref|XP_004486458.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like isoform X3 [Cicer arietinum]
Length=329

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 160/356 (45%), Positives = 222/356 (62%), Gaps = 42/356 (12%)
 Frame = +1

Query  478   LSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVK  657
             +S R RLK L+ +  N+ CADC +PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV 
Sbjct  14    MSGRRRLKDLLLQKDNRVCADCNAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVT  73

Query  658   LDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVN  837
             LD+W+ ++VD + E+GGN  AN  YEA  PE + K  PD+  E R  FIR KYELQ+F+ 
Sbjct  74    LDDWSDDEVDAMVEVGGNASANSIYEAYIPEGFTKPGPDAGHEHRAKFIRSKYELQEFLK  133

Query  838   SDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMV  1017
               L ++    +  SSS+     S                  K S +Q+         GMV
Sbjct  134   PSLRIVSGKSSIDSSSSKSFMDS-----------------FKSSSSQRTE-------GMV  169

Query  1018  EFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPE  1197
             EFIGL+K+ V++GT+LAIRD+ SSDPYV+L LG Q+V+T VI++NLNPVWNE+ MLS+PE
Sbjct  170   EFIGLLKIKVIKGTDLAIRDIKSSDPYVVLNLGQQTVQTSVIRSNLNPVWNEERMLSVPE  229

Query  1198  NVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENST--KNDPVQQQPRTPKKAE  1371
             +   LK+ VFD DTF+ DD MGEA+ID+Q L+ +A A  ++    N  + +  ++   A 
Sbjct  230   HYGQLKLKVFDHDTFSADDIMGEADIDLQSLITSAMAFGDAGMFGNMQIGKWLKSDDNAL  289

Query  1372  TENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
              E+++                + + +G V+Q + LKLQNVE G +E+ELE + L Q
Sbjct  290   IEDSL----------------VEITDGKVKQMMSLKLQNVESGEIELELEWIPLDQ  329



>gb|EAY84886.1| hypothetical protein OsI_06251 [Oryza sativa Indica Group]
Length=320

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 159/351 (45%), Positives = 209/351 (60%), Gaps = 45/351 (13%)
 Frame = +1

Query  490   CRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEW  669
              +LK L+  S N+ CADC +PDPKW S ++GVFIC+KCSGVHRSLG HISKV+SV LD+W
Sbjct  12    AKLKELLHRSENRICADCSAPDPKWASANIGVFICLKCSGVHRSLGTHISKVLSVTLDQW  71

Query  670   THEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLH  849
             +  ++D + E+GGN+ AN  YEA  P+N+ K  PDS+ EER  FIR KYELQ+F+   L 
Sbjct  72    SDNEIDNVIEVGGNSHANAIYEAFLPQNHSKPHPDSTQEEREKFIRSKYELQEFLEPSLR  131

Query  850   LMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIG  1029
             ++            +   SG H                 + +   +  S S  GM+EFIG
Sbjct  132   IVS----------HQSSDSGKH-----------------AGSASHSVSSKSEVGMIEFIG  164

Query  1030  LIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPP  1209
             ++ V V  GTNLAIRDM SSDPYV+LTLG Q  +T VIK NLNPVWNE+L LS+P+   P
Sbjct  165   ILNVKVKGGTNLAIRDMSSSDPYVVLTLGQQKAQTSVIKANLNPVWNEELKLSVPQQYGP  224

Query  1210  LKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK--AETENA  1383
             LK+  FD D  + DD MGEAEID+QP++ AA A       DP     R   +     +NA
Sbjct  225   LKLQAFDHDMLSKDDLMGEAEIDLQPMINAAAAF-----GDPGLLGDRQIGRWLKSGDNA  279

Query  1384  MppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLS  1536
             +             D  + +A G VRQE+ LKLQ  E G +E+E++   L+
Sbjct  280   L-----------VRDSAVVVAGGEVRQELALKLQFTESGEVELEMQWFPLN  319



>ref|NP_001046206.2| Os02g0198300 [Oryza sativa Japonica Group]
 dbj|BAD25461.1| putative zinc finger and C2 domain protein [Oryza sativa Japonica 
Group]
 gb|EAZ22108.1| hypothetical protein OsJ_05767 [Oryza sativa Japonica Group]
 dbj|BAG87490.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF08120.2| Os02g0198300 [Oryza sativa Japonica Group]
Length=320

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 159/351 (45%), Positives = 209/351 (60%), Gaps = 45/351 (13%)
 Frame = +1

Query  490   CRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKLDEW  669
              +LK L+  S N+ CADC +PDPKW S ++GVFIC+KCSGVHRSLG HISKV+SV LD+W
Sbjct  12    AKLKELLHRSENRICADCSAPDPKWASANIGVFICLKCSGVHRSLGTHISKVLSVTLDQW  71

Query  670   THEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNSDLH  849
             +  ++D + E+GGN+ AN  YE   P+N+ K  PDS+ EER  FIR KYELQ+F+   L 
Sbjct  72    SDNEIDNVIEVGGNSHANAIYETFLPQNHSKPHPDSTQEEREKFIRSKYELQEFLEPSLR  131

Query  850   LMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVEFIG  1029
             ++            +   SG H                 + +   +  S S  GM+EFIG
Sbjct  132   IVS----------HQSSDSGKH-----------------AGSASHSVSSKSEVGMIEFIG  164

Query  1030  LIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPENVPP  1209
             ++ V V  GTNLAIRDM SSDPYV+LTLG Q  +T VIK NLNPVWNE+L LS+P+   P
Sbjct  165   ILNVKVKGGTNLAIRDMSSSDPYVVLTLGQQKAQTSVIKANLNPVWNEELKLSVPQQYGP  224

Query  1210  LKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK--AETENA  1383
             LK+ VFD D  + DD MGEAEID+QP++ AA A       DP     R   +     +NA
Sbjct  225   LKLQVFDHDMLSKDDLMGEAEIDLQPMINAAAAF-----GDPGLLGDRQIGRWLKSGDNA  279

Query  1384  MppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLS  1536
             +             D  + +A G VRQE+ LKLQ  E G +E+E++   L+
Sbjct  280   L-----------VRDSAVVVAGGEVRQELALKLQFTESGEVELEMQWFPLN  319



>gb|EMT13535.1| Putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Aegilops tauschii]
Length=360

 Score =   274 bits (701),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 208/304 (68%), Gaps = 22/304 (7%)
 Frame = +1

Query  628   VHISKVVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIR  807
             V  ++V+SV LDEWT E+V+ L   GGN   N KYEA  PENYKK + D +TE+R  FIR
Sbjct  79    VEYAQVISVNLDEWTDEEVNCLANSGGNATVNTKYEAFLPENYKKPRQDFATEDRAIFIR  138

Query  808   RKYELQQFVNSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKAT  987
             +KYELQQFV ++    CPL    +     ++HSG    HG    FRNSW KKES+ +   
Sbjct  139   KKYELQQFV-TNPQFACPLHKHGAEKRHNQQHSGSK--HG---TFRNSWMKKESENKGVK  192

Query  988   RKSNSMAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVW  1167
             +  +   GMVEF+GLIKV+++RGT+LA+RD++SSDPYV++ LG+QS+KT+VIKN LNP+W
Sbjct  193   KMMD--VGMVEFVGLIKVDIIRGTDLAVRDVMSSDPYVMIILGHQSMKTKVIKNTLNPIW  250

Query  1168  NEQLMLSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQ  1347
             NE+LMLSIP+ VPPLKV VFDKDTFT+DD MGEAE+DIQPL+ AAR  ++S   +  Q  
Sbjct  251   NERLMLSIPDPVPPLKVLVFDKDTFTSDDRMGEAEVDIQPLISAAREYQSSIITESTQ--  308

Query  1348  PRTPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECV  1527
                     +EN++          L  D  I++  G V QEI L+LQNVE G LE++LECV
Sbjct  309   --ICTFLASENSI----------LAKDSIISIVGGKVEQEIALRLQNVEHGELEIKLECV  356

Query  1528  SLSQ  1539
              L+Q
Sbjct  357   PLNQ  360



>emb|CDY39164.1| BnaC09g21800D [Brassica napus]
Length=340

 Score =   273 bits (699),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 165/355 (46%), Positives = 221/355 (62%), Gaps = 29/355 (8%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +  N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG HISKV+SV L
Sbjct  13    SGKRRIRDLLNQPDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHISKVLSVTL  72

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYEL--QQFV  834
             D+W+ E+VD + E+GGN  AN  YEA  PE   K  PD S ++R  FIR+ Y    Q+F+
Sbjct  73    DDWSDEEVDSMIEIGGNASANSIYEAFVPEGSSKPGPDVSHDQRLRFIRQAYSTRRQKFL  132

Query  835   NSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGM  1014
                L +       +S  T+  K         L   F +S+R   S       K     GM
Sbjct  133   KPSLRI-------TSGKTTSTKKPPSFLSSSLSTKFMDSFRTNSS------SKKIFEEGM  179

Query  1015  VEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIP  1194
             VEFIGL+KV V +GTNLAIRDM+SSDPYV+L LG Q ++T V+ +NLNPVWN++LMLS+P
Sbjct  180   VEFIGLLKVTVKKGTNLAIRDMMSSDPYVVLNLGKQKLQTTVVNSNLNPVWNQELMLSVP  239

Query  1195  ENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKKAET  1374
             E+  P+K+ V+D DTF+ DD MGEAE+DIQPL+ +A A       DP         +   
Sbjct  240   ESYGPVKLQVYDYDTFSADDIMGEAELDIQPLITSAMAF-----GDP---------EMFG  285

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSLSQ  1539
             +  +   L     PL  D  IN+ +G V+QE+ +KLQNVE G LE+E+E + L Q
Sbjct  286   DMQIGKWLKSHDNPLIDDSIINIVDGKVKQEVQIKLQNVESGELELEMEWLPLEQ  340



>ref|XP_009108508.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12 isoform X2 [Brassica rapa]
Length=329

 Score =   273 bits (698),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 163/342 (48%), Positives = 216/342 (63%), Gaps = 35/342 (10%)
 Frame = +1

Query  481   SPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKVVSVKL  660
             S + R++ L+ +S N+ CADCG+PDPKW S ++GVFIC+KC GVHRSLG H+SKV+SV L
Sbjct  8     SGKRRIRDLLTQSDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSLGTHVSKVLSVTL  67

Query  661   DEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQQFVNS  840
             DEW+ E+VD + E+GGN  AN  YEA  P+   K  PD+S + R  FIR KYE Q+F+  
Sbjct  68    DEWSDEEVDSMIEIGGNASANSIYEAFIPDGSSKPGPDASHDHRMRFIRSKYEFQEFLKP  127

Query  841   DLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSMAGMVE  1020
              L +           TS K  S  +R   L     +S+R   S +QK       + GMVE
Sbjct  128   SLRI-----------TSGKTSSSSYRSSSLSSNIIDSFRTTSS-SQKP-----QLEGMVE  170

Query  1021  FIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLMLSIPEN  1200
             FIG +KV + +GTNLAIRDM++SDPYV+LTLG Q+ ++ V+K+NLNPVWNE+LMLS+P +
Sbjct  171   FIGSLKVTLKKGTNLAIRDMMTSDPYVVLTLGQQTAQSTVMKSNLNPVWNEELMLSVPHD  230

Query  1201  VPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPKK--AET  1374
                +K+ VFD DTF+ DD MGEAEIDIQPL+ +A A       DP         K     
Sbjct  231   YGSVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAF-----GDPEMFGDMQIGKWLKSN  285

Query  1375  ENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERG  1500
             +NA+             D  IN+A+G V+QE+ +KLQNVE G
Sbjct  286   DNAL-----------IEDSIINIADGKVKQEVQIKLQNVESG  316



>ref|XP_006647030.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X1 [Oryza brachyantha]
 ref|XP_006647031.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X2 [Oryza brachyantha]
 ref|XP_006647032.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like isoform X3 [Oryza brachyantha]
Length=322

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 167/360 (46%), Positives = 215/360 (60%), Gaps = 48/360 (13%)
 Frame = +1

Query  466   QDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISKV  645
              D + +   +LK L+  S N+ CADC +PDPKW S ++GVFIC+KCSGVHRSLG HISKV
Sbjct  5     HDGAPAKMAKLKELLHRSENRICADCSAPDPKWASANIGVFICLKCSGVHRSLGAHISKV  64

Query  646   VSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYELQ  825
             +SV LD+W+  ++D + E+GGN+ AN  YEA  PE+Y K  PDS+ EER +FIR KYELQ
Sbjct  65    LSVTLDQWSDNEIDNMIEVGGNSHANAIYEAFLPESYSKPHPDSTQEERENFIRSKYELQ  124

Query  826   QFVNSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNSM  1005
             +F+   L ++            +   SG H                ES +  +   S S 
Sbjct  125   EFLEPSLRIVS----------HQSSESGKH---------------AESGSHHSV-SSKSD  158

Query  1006  AGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLML  1185
              GMVEFIG++ V V  GTNLAIRDM SSDPYV+LTLG Q V+T VIK NLNPVWNE L L
Sbjct  159   VGMVEFIGILNVKVKGGTNLAIRDMSSSDPYVVLTLGQQKVQTSVIKANLNPVWNEDLKL  218

Query  1186  SIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPV----QQQPR  1353
             S+P+   PLK+ VFD D  + DD MGEAEID+QP++ A  A       DP      Q  R
Sbjct  219   SVPQEYVPLKLQVFDHDMLSKDDLMGEAEIDLQPMINATAAF-----GDPELLGDMQIGR  273

Query  1354  TPKKAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
               K  +  NA+             D  + +A G VRQE+ L+LQ  E G +E+E+E + L
Sbjct  274   WLKSGD--NALVR-----------DSVVVVAGGRVRQELSLRLQFTESGEVELEMEWIPL  320



>ref|XP_007159543.1| hypothetical protein PHAVU_002G246400g [Phaseolus vulgaris]
 gb|ESW31537.1| hypothetical protein PHAVU_002G246400g [Phaseolus vulgaris]
Length=321

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/357 (43%), Positives = 216/357 (61%), Gaps = 38/357 (11%)
 Frame = +1

Query  463   MQDYSLSPRCRLKALMKESGNQFCADCGSPDPKWVSLSLGVFICIKCSGVHRSLGVHISK  642
             M+  SL+ + R+K L+ +  N+FCADC +PDPKW S ++GVF+C+KC GVHRSLG H+SK
Sbjct  1     MKTGSLTGKRRVKDLLLQQHNRFCADCNAPDPKWASANIGVFVCLKCCGVHRSLGSHVSK  60

Query  643   VVSVKLDEWTHEQVDILTEMGGNNVANLKYEAAFPENYKKIKPDSSTEERNDFIRRKYEL  822
             V+SV LDEW+ +++D + E+GGN+ AN  YEA  P+   K  PD++ E+R  FIR KYE 
Sbjct  61    VLSVTLDEWSSDEIDAMVEVGGNSSANSIYEAYIPQGCTKPGPDATHEQRTKFIRLKYES  120

Query  823   QQFVNSDLHLMCPLPttsssstsEKKHSGGHRIHGLGFAFRNSWRKKESDTQKATRKSNS  1002
             Q F+   L +M           S K +       G+    R+S   +E            
Sbjct  121   QAFLKPSLRIM-----------SGKMNPPSSITKGIKDNLRSSSGSRED-----------  158

Query  1003  MAGMVEFIGLIKVNVVRGTNLAIRDMVSSDPYVILTLGNQSVKTRVIKNNLNPVWNEQLM  1182
               G+  FIG +KV V++GT+LAIRDM++SDPYVI TLG Q+V+T V+ +NLNPVWNE+LM
Sbjct  159   --GVAGFIGKLKVKVIKGTDLAIRDMMTSDPYVIFTLGQQTVQTTVVNSNLNPVWNEELM  216

Query  1183  LSIPENVPPLKVHVfdkdtfttddfMGEAEIDIQPLLVAARASENSTKNDPVQQQPRTPK  1362
             LS+ +    L + VFD D  + DD MGEA+ID+QPL+ +A A  +    D +Q       
Sbjct  217   LSVTQQFGLLNLKVFDYDLLSADDIMGEADIDLQPLITSAMAYGDPRMFDNMQIGKWMKS  276

Query  1363  KAETENAMppplplpppplppDGTINLAEGTVRQEIVLKLQNVERGVLEVELECVSL  1533
                 +NA+             D  +N+ +G V+QEI +KLQNVE G LE+ LE + L
Sbjct  277   H---DNAL-----------IDDSAVNIVDGKVKQEIFIKLQNVESGELELALEWIPL  319



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5517879775164