BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21137_g1_i1 len=2359 path=[2335:0-98 4684:99-100 2434:101-1672
4006:1673-1762 @4096@!:1763-2175 4509:2176-2358]

Length=2359
                                                                      Score     E

ref|XP_009789959.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...   1054   0.0      
ref|XP_009604926.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...   1037   0.0      
ref|XP_006339432.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...   1033   0.0      
emb|CDP17773.1|  unnamed protein product                               1029   0.0      
ref|XP_004229815.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...   1020   0.0      
ref|XP_011090723.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...   1018   0.0      
ref|XP_011090712.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...   1009   0.0      
ref|XP_002273349.2|  PREDICTED: ATP-dependent DNA helicase 2 subu...    988   0.0      Vitis vinifera
ref|XP_011034378.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    983   0.0      
ref|XP_010661636.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    981   0.0      
gb|EYU31996.1|  hypothetical protein MIMGU_mgv1a022226mg                981   0.0      
ref|XP_004506489.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    972   0.0      
ref|XP_004506490.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    971   0.0      
ref|XP_007218942.1|  hypothetical protein PRUPE_ppa002331mg             963   0.0      
emb|CBI38852.3|  unnamed protein product                                963   0.0      
ref|XP_002511723.1|  ku P80 DNA helicase, putative                      962   0.0      Ricinus communis
ref|XP_002320725.2|  Ku80 family protein                                960   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010056303.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    959   0.0      
ref|XP_008348444.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    951   0.0      
ref|XP_010056304.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    950   0.0      
ref|XP_010106185.1|  hypothetical protein L484_009609                   949   0.0      
ref|XP_004513141.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    945   0.0      
ref|XP_008232669.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    944   0.0      
ref|XP_010277368.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    943   0.0      
gb|KDP28751.1|  hypothetical protein JCGZ_14522                         939   0.0      
ref|XP_008438156.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    938   0.0      
ref|XP_010661637.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    937   0.0      
ref|XP_003605072.1|  ATP-dependent DNA helicase 2 subunit               935   0.0      
gb|AAL87543.1|AF293343_1  KAP-2                                         932   0.0      Medicago truncatula
ref|XP_010056306.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    930   0.0      
ref|XP_010056305.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    926   0.0      
ref|XP_010692265.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    918   0.0      
ref|XP_004169630.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    917   0.0      
ref|XP_004134348.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    917   0.0      
ref|XP_004306918.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    916   0.0      
ref|XP_007052049.1|  Ku80 family protein isoform 1                      909   0.0      
ref|XP_003524779.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    904   0.0      
ref|XP_006445252.1|  hypothetical protein CICLE_v10019016mg             903   0.0      
ref|XP_006386572.1|  hypothetical protein POPTR_0002s14910g             903   0.0      
ref|XP_006490926.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    901   0.0      
ref|XP_006580031.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    897   0.0      
ref|XP_006580030.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    897   0.0      
ref|XP_007159070.1|  hypothetical protein PHAVU_002G205800g             885   0.0      
ref|XP_010056307.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    880   0.0      
gb|KDO85828.1|  hypothetical protein CISIN_1g005544mg                   877   0.0      
ref|XP_010479215.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    869   0.0      
ref|XP_010461606.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    868   0.0      
ref|XP_010934679.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    863   0.0      
ref|XP_010544652.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    861   0.0      
gb|AAX43993.1|  Ku80-like                                               861   0.0      Vigna radiata [mung bean]
ref|XP_002273329.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    860   0.0      Vitis vinifera
ref|XP_007052052.1|  Ku80 family protein isoform 4                      860   0.0      
ref|XP_010500317.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    859   0.0      
ref|XP_007052050.1|  Ku80 family protein isoform 2                      858   0.0      
gb|KFK36112.1|  hypothetical protein AALP_AA4G079700                    857   0.0      
ref|XP_006445251.1|  hypothetical protein CICLE_v10019016mg             854   0.0      
ref|XP_002891405.1|  hypothetical protein ARALYDRAFT_891612             854   0.0      
gb|KDO85830.1|  hypothetical protein CISIN_1g005544mg                   852   0.0      
ref|NP_564520.1|  ATP-dependent DNA helicase 2 subunit KU80             851   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934678.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    852   0.0      
ref|XP_008791289.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    850   0.0      
ref|XP_010661632.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    848   0.0      
ref|XP_006303163.1|  hypothetical protein CARUB_v10008497mg             848   0.0      
ref|XP_009107395.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    847   0.0      
emb|CDY65827.1|  BnaA08g29690D                                          830   0.0      
ref|XP_010934680.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    829   0.0      
ref|XP_008791290.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    828   0.0      
emb|CDX77346.1|  BnaC08g03910D                                          831   0.0      
gb|AAG51535.1|AC051631_15  hypothetical protein; 39910-36975            819   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CBI38851.3|  unnamed protein product                                813   0.0      
ref|XP_006580032.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    806   0.0      
ref|XP_009399523.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    808   0.0      
ref|XP_010661633.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    805   0.0      
gb|KHN25856.1|  ATP-dependent DNA helicase 2 subunit KU80               797   0.0      
ref|XP_010661635.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    791   0.0      
ref|XP_007052051.1|  Ku80 family protein isoform 3                      790   0.0      
gb|AAF79532.1|AC023673_20  F21D18.26                                    785   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004980986.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    783   0.0      
ref|XP_003559791.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    773   0.0      
ref|XP_006650927.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    771   0.0      
gb|ADO00729.1|  Ku80                                                    770   0.0      
ref|XP_004980985.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    769   0.0      
dbj|BAJ95046.1|  predicted protein                                      769   0.0      
sp|Q75IP6.1|KU80_ORYSJ  RecName: Full=ATP-dependent DNA helicase ...    767   0.0      Oryza sativa Japonica Group [Japonica rice]
tpg|DAA52573.1|  TPA: KAP-2                                             765   0.0      
ref|NP_001147945.1|  LOC100281554                                       764   0.0      Zea mays [maize]
gb|AEO86624.1|  Ku80                                                    761   0.0      
ref|XP_009399514.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    759   0.0      
gb|AEW90637.1|  KU80-like protein                                       752   0.0      
gb|ACN25700.1|  unknown                                                 744   0.0      Zea mays [maize]
ref|XP_002466067.1|  hypothetical protein SORBIDRAFT_01g000620          736   0.0      Sorghum bicolor [broomcorn]
gb|EMT04533.1|  ATP-dependent DNA helicase 2 subunit ku80               735   0.0      
gb|EPS71667.1|  hypothetical protein M569_03092                         736   0.0      
ref|XP_008380667.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    699   0.0      
gb|KCW72969.1|  hypothetical protein EUGRSUZ_E01418                     692   0.0      
gb|KDO85831.1|  hypothetical protein CISIN_1g005544mg                   668   0.0      
gb|EEC76568.1|  hypothetical protein OsI_14396                          670   0.0      Oryza sativa Indica Group [Indian rice]
gb|EEE60332.1|  hypothetical protein OsJ_13430                          669   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAN68627.1|  hypothetical protein VITISV_004463                     657   0.0      Vitis vinifera
ref|XP_001770110.1|  predicted protein                                  629   0.0      
gb|EMS53802.1|  ATP-dependent DNA helicase 2 subunit KU80               620   0.0      
ref|XP_006847691.1|  hypothetical protein AMTR_s00149p00057710          602   0.0      
ref|XP_002961041.1|  hypothetical protein SELMODRAFT_74928              605   0.0      
ref|XP_002966971.1|  hypothetical protein SELMODRAFT_86463              602   0.0      
dbj|BAJ97086.1|  predicted protein                                      592   0.0      
tpg|DAA52574.1|  TPA: hypothetical protein ZEAMMB73_970034              533   6e-179   
gb|AAS01978.1|  putative H-box binding protein, KAP2, with altern...    409   2e-132   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006393488.1|  hypothetical protein EUTSA_v100113511mg            399   2e-128   
gb|KHN03547.1|  ATP-dependent DNA helicase 2 subunit KU80               395   1e-125   
ref|XP_004362085.1|  ATP-dependent DNA helicase                         321   7e-94    
gb|AEZ36039.1|  KU80                                                    299   2e-92    
dbj|GAM18435.1|  hypothetical protein SAMD00019534_016100               317   4e-92    
ref|XP_003293765.1|  hypothetical protein DICPUDRAFT_158675             301   2e-86    
ref|XP_006393489.1|  hypothetical protein EUTSA_v100113510mg            279   4e-84    
ref|XP_002672413.1|  Ku70/Ku80 beta-barrel domain-containing protein    288   3e-81    Naegleria gruberi strain NEG-M
ref|XP_637846.1|  ATP-dependent DNA helicase                            283   3e-79    Dictyostelium discoideum AX4
gb|EJY76224.1|  ATP-dependent DNA helicase                              268   5e-74    
gb|ELU08335.1|  hypothetical protein CAPTEDRAFT_163248                  258   6e-71    
ref|XP_004345889.1|  ATPdependent DNA helicase                          256   6e-70    
gb|ACB11497.1|  KU80-like protein                                       232   1e-66    Pinus sylvestris [Scotch pine]
ref|XP_008606662.1|  hypothetical protein SDRG_02836                    245   2e-66    
emb|CDW74323.1|  atp-dependent dna helicase                             241   1e-64    
gb|EFW41225.2|  hypothetical protein CAOG_06357                         240   2e-64    
gb|KDO24367.1|  hypothetical protein SPRG_10445                         239   5e-64    
gb|KHN17333.1|  ATP-dependent DNA helicase 2 subunit KU80               218   1e-62    
ref|XP_010058458.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    216   1e-60    
gb|EFA77444.1|  ATP-dependent DNA helicase                              225   2e-59    Polysphondylium pallidum PN500
ref|XP_005107132.1|  PREDICTED: X-ray repair cross-complementing ...    220   1e-57    
gb|EKC32697.1|  ATP-dependent DNA helicase 2 subunit 2                  217   1e-56    
ref|XP_009530013.1|  hypothetical protein PHYSODRAFT_316299             216   5e-56    
ref|XP_006028756.1|  PREDICTED: X-ray repair cross-complementing ...    215   7e-56    
ref|XP_422072.4|  PREDICTED: X-ray repair cross-complementing pro...    215   9e-56    Gallus gallus [bantam]
gb|KFO69669.1|  X-ray repair cross-complementing protein 5              214   1e-55    
ref|XP_004942947.1|  PREDICTED: X-ray repair cross-complementing ...    214   1e-55    
ref|XP_788472.3|  PREDICTED: X-ray repair cross-complementing pro...    213   2e-55    Strongylocentrotus purpuratus [purple urchin]
gb|KFW00558.1|  X-ray repair cross-complementing protein 5              213   2e-55    
gb|KFU88460.1|  X-ray repair cross-complementing protein 5              213   2e-55    
ref|XP_005030596.1|  PREDICTED: X-ray repair cross-complementing ...    213   2e-55    
ref|XP_010711901.1|  PREDICTED: X-ray repair cross-complementing ...    213   4e-55    
ref|XP_005049501.1|  PREDICTED: X-ray repair cross-complementing ...    212   5e-55    
gb|KFO55071.1|  X-ray repair cross-complementing protein 5              212   7e-55    
ref|XP_007420221.1|  PREDICTED: X-ray repair cross-complementing ...    211   1e-54    
gb|ETP37839.1|  hypothetical protein F442_14420                         211   1e-54    
gb|ETO68595.1|  hypothetical protein F444_14597                         211   1e-54    
ref|XP_006124793.1|  PREDICTED: X-ray repair cross-complementing ...    211   2e-54    
gb|KFP61416.1|  X-ray repair cross-complementing protein 5              211   2e-54    
gb|ETL86709.1|  hypothetical protein L917_13909                         211   2e-54    
gb|KFO94722.1|  X-ray repair cross-complementing protein 5              210   3e-54    
gb|KFQ28286.1|  X-ray repair cross-complementing protein 5              210   3e-54    
ref|XP_008910277.1|  hypothetical protein PPTG_15029                    210   3e-54    
gb|ETK79992.1|  hypothetical protein L915_14226                         210   3e-54    
gb|ETM39882.1|  hypothetical protein L914_14029                         210   3e-54    
gb|ETI39867.1|  hypothetical protein F443_14591                         210   3e-54    
ref|XP_010144967.1|  PREDICTED: X-ray repair cross-complementing ...    209   4e-54    
ref|XP_008874858.1|  hypothetical protein H310_10297                    209   5e-54    
ref|XP_009555976.1|  PREDICTED: X-ray repair cross-complementing ...    209   7e-54    
ref|XP_007072873.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...    209   8e-54    
ref|XP_010405273.1|  PREDICTED: X-ray repair cross-complementing ...    208   9e-54    
ref|XP_005485248.1|  PREDICTED: X-ray repair cross-complementing ...    208   1e-53    
ref|XP_008643055.1|  PREDICTED: X-ray repair cross-complementing ...    208   1e-53    
ref|XP_005279951.2|  PREDICTED: X-ray repair cross-complementing ...    208   1e-53    
ref|XP_005237741.1|  PREDICTED: X-ray repair cross-complementing ...    208   2e-53    
gb|KFW80172.1|  X-ray repair cross-complementing protein 5              207   2e-53    
gb|EPZ30967.1|  Ku70/Ku80 beta-barrel domain-containing protein         207   2e-53    
ref|XP_004478743.1|  PREDICTED: X-ray repair cross-complementing ...    206   4e-53    
ref|XP_005443001.1|  PREDICTED: X-ray repair cross-complementing ...    207   4e-53    
ref|XP_009994539.1|  PREDICTED: X-ray repair cross-complementing ...    206   6e-53    
ref|XP_010142399.1|  PREDICTED: X-ray repair cross-complementing ...    206   7e-53    
ref|XP_005520033.1|  PREDICTED: X-ray repair cross-complementing ...    206   8e-53    
ref|XP_008937038.1|  PREDICTED: X-ray repair cross-complementing ...    206   8e-53    
ref|XP_008921156.1|  PREDICTED: X-ray repair cross-complementing ...    205   1e-52    
gb|KFV63426.1|  X-ray repair cross-complementing protein 5              205   1e-52    
ref|XP_002897431.1|  conserved hypothetical protein                     205   1e-52    
ref|XP_009645458.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...    204   2e-52    
ref|XP_009707214.1|  PREDICTED: X-ray repair cross-complementing ...    204   2e-52    
ref|XP_002588418.1|  hypothetical protein BRAFLDRAFT_164247             204   2e-52    Branchiostoma floridae
ref|XP_005154127.1|  PREDICTED: X-ray repair cross-complementing ...    204   3e-52    
ref|XP_005415838.1|  PREDICTED: X-ray repair cross-complementing ...    204   3e-52    
gb|KFP99347.1|  X-ray repair cross-complementing protein 5              203   4e-52    
ref|XP_009939224.1|  PREDICTED: X-ray repair cross-complementing ...    203   5e-52    
ref|XP_002117043.1|  hypothetical protein TRIADDRAFT_61074              204   5e-52    Trichoplax adhaerens
ref|XP_009666109.1|  PREDICTED: X-ray repair cross-complementing ...    203   6e-52    
ref|XP_010213604.1|  PREDICTED: X-ray repair cross-complementing ...    202   1e-51    
ref|XP_005498630.1|  PREDICTED: X-ray repair cross-complementing ...    202   1e-51    
gb|KGL77706.1|  X-ray repair cross-complementing protein 5              202   1e-51    
ref|XP_004401280.1|  PREDICTED: X-ray repair cross-complementing ...    202   1e-51    
gb|KFW08590.1|  X-ray repair cross-complementing protein 5              201   2e-51    
ref|XP_009909485.1|  PREDICTED: X-ray repair cross-complementing ...    201   2e-51    
ref|XP_008143502.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...    200   2e-51    
ref|XP_006935602.1|  PREDICTED: X-ray repair cross-complementing ...    201   2e-51    
ref|XP_005331894.1|  PREDICTED: X-ray repair cross-complementing ...    201   2e-51    
ref|XP_002913725.1|  PREDICTED: x-ray repair cross-complementing ...    201   2e-51    
ref|XP_008688711.1|  PREDICTED: X-ray repair cross-complementing ...    201   3e-51    
gb|KFQ91744.1|  X-ray repair cross-complementing protein 5              200   4e-51    
gb|KFQ09175.1|  X-ray repair cross-complementing protein 5              201   4e-51    
gb|KFV77700.1|  X-ray repair cross-complementing protein 5              200   4e-51    
ref|NP_033559.2|  X-ray repair cross-complementing protein 5            200   5e-51    Mus musculus [mouse]
gb|KFP36887.1|  X-ray repair cross-complementing protein 5              200   5e-51    
dbj|BAE41402.1|  unnamed protein product                                200   5e-51    Mus musculus [mouse]
gb|AAH29218.1|  Xrcc5 protein                                           200   5e-51    Mus musculus [mouse]
dbj|BAE39415.1|  unnamed protein product                                200   5e-51    Mus musculus [mouse]
ref|XP_004674863.1|  PREDICTED: X-ray repair cross-complementing ...    200   5e-51    
ref|XP_009580184.1|  PREDICTED: X-ray repair cross-complementing ...    200   6e-51    
dbj|BAE38207.1|  unnamed protein product                                200   6e-51    Mus musculus [mouse]
ref|XP_009951473.1|  PREDICTED: X-ray repair cross-complementing ...    200   6e-51    
ref|XP_008823904.1|  PREDICTED: X-ray repair cross-complementing ...    200   6e-51    
ref|XP_009470504.1|  PREDICTED: X-ray repair cross-complementing ...    199   7e-51    
gb|EDL75243.1|  X-ray repair complementing defective repair in Ch...    199   9e-51    
ref|XP_006972290.1|  PREDICTED: X-ray repair cross-complementing ...    199   1e-50    
ref|XP_006935603.1|  PREDICTED: X-ray repair cross-complementing ...    199   1e-50    
gb|KDR13452.1|  ATP-dependent DNA helicase 2 subunit 2                  199   1e-50    
ref|XP_005883444.1|  PREDICTED: X-ray repair cross-complementing ...    199   1e-50    
ref|XP_006082557.1|  PREDICTED: X-ray repair cross-complementing ...    199   1e-50    
gb|EMC84191.1|  ATP-dependent DNA helicase 2 subunit 2                  199   1e-50    
dbj|BAC38276.1|  unnamed protein product                                198   2e-50    Mus musculus [mouse]
ref|XP_003405959.2|  PREDICTED: X-ray repair cross-complementing ...    198   2e-50    
ref|XP_005676574.1|  PREDICTED: X-ray repair cross-complementing ...    198   2e-50    
ref|NP_001126362.1|  X-ray repair cross-complementing protein 5         198   2e-50    Pongo abelii [orang utan]
ref|XP_005610646.1|  PREDICTED: X-ray repair cross-complementing ...    198   2e-50    
ref|XP_004376438.1|  PREDICTED: X-ray repair cross-complementing ...    198   3e-50    
ref|XP_009086125.1|  PREDICTED: X-ray repair cross-complementing ...    198   3e-50    
ref|XP_009923647.1|  PREDICTED: X-ray repair cross-complementing ...    197   3e-50    
gb|AAD49720.1|AF166486_1  Ku autoantigen                                198   3e-50    Mus musculus [mouse]
ref|XP_009923646.1|  PREDICTED: X-ray repair cross-complementing ...    197   3e-50    
gb|KFW66754.1|  X-ray repair cross-complementing protein 5              197   3e-50    
ref|XP_007908297.1|  PREDICTED: X-ray repair cross-complementing ...    197   3e-50    
gb|KFP03339.1|  X-ray repair cross-complementing protein 5              197   4e-50    
ref|XP_001023138.1|  Ku70/Ku80 beta-barrel domain containing protein    198   4e-50    Tetrahymena thermophila
ref|XP_006495955.1|  PREDICTED: X-ray repair cross-complementing ...    197   4e-50    
ref|XP_009321814.1|  PREDICTED: X-ray repair cross-complementing ...    197   5e-50    
ref|XP_002712509.1|  PREDICTED: X-ray repair cross-complementing ...    197   5e-50    Oryctolagus cuniculus [domestic rabbit]
dbj|BAD96323.1|  ATP-dependent DNA helicase II variant                  197   6e-50    Homo sapiens [man]
gb|KFM04654.1|  X-ray repair cross-complementing protein 5              196   6e-50    
gb|KGL95186.1|  X-ray repair cross-complementing protein 5              196   7e-50    
ref|NP_803154.1|  X-ray repair cross-complementing protein 5            197   7e-50    Rattus norvegicus [brown rat]
ref|XP_009273242.1|  PREDICTED: X-ray repair cross-complementing ...    196   8e-50    
ref|XP_008116997.1|  PREDICTED: X-ray repair cross-complementing ...    196   9e-50    
ref|NP_066964.1|  X-ray repair cross-complementing protein 5            196   1e-49    Homo sapiens [man]
ref|XP_004825919.1|  PREDICTED: X-ray repair cross-complementing ...    196   1e-49    
ref|XP_004762766.1|  PREDICTED: X-ray repair cross-complementing ...    196   1e-49    
ref|XP_002191185.2|  PREDICTED: X-ray repair cross-complementing ...    197   1e-49    Taeniopygia guttata
ref|XP_004033222.1|  PREDICTED: X-ray repair cross-complementing ...    196   1e-49    
ref|XP_009885633.1|  PREDICTED: X-ray repair cross-complementing ...    196   1e-49    
dbj|BAF83429.1|  unnamed protein product                                196   1e-49    Homo sapiens [man]
ref|XP_003254095.1|  PREDICTED: X-ray repair cross-complementing ...    196   1e-49    
ref|XP_009833210.1|  hypothetical protein H257_08842                    196   1e-49    
gb|EMP26688.1|  X-ray repair cross-complementing protein 5              197   1e-49    
ref|XP_005969263.1|  PREDICTED: X-ray repair cross-complementing ...    196   1e-49    
ref|XP_010123040.1|  PREDICTED: X-ray repair cross-complementing ...    195   2e-49    
ref|XP_006186968.1|  PREDICTED: X-ray repair cross-complementing ...    196   2e-49    
ref|XP_009969837.1|  PREDICTED: X-ray repair cross-complementing ...    195   2e-49    
ref|XP_010978064.1|  PREDICTED: X-ray repair cross-complementing ...    196   2e-49    
ref|XP_004004963.1|  PREDICTED: X-ray repair cross-complementing ...    195   2e-49    
gb|KFR00750.1|  X-ray repair cross-complementing protein 5              195   2e-49    
ref|XP_006207362.1|  PREDICTED: X-ray repair cross-complementing ...    195   2e-49    
ref|XP_001151873.2|  PREDICTED: X-ray repair cross-complementing ...    196   3e-49    Pan troglodytes
ref|XP_007086166.1|  PREDICTED: X-ray repair cross-complementing ...    195   3e-49    
ref|XP_005246893.1|  PREDICTED: X-ray repair cross-complementing ...    196   3e-49    
ref|XP_010360622.1|  PREDICTED: X-ray repair cross-complementing ...    194   3e-49    
ref|NP_001244295.1|  X-ray repair cross-complementing protein 5         194   4e-49    
gb|EHH21651.1|  hypothetical protein EGK_04770                          194   5e-49    
emb|CAA46999.1|  p80 Ku autoantigen                                     194   5e-49    Mus musculus [mouse]
ref|XP_003133697.2|  PREDICTED: X-ray repair cross-complementing ...    194   7e-49    
ref|XP_536061.4|  PREDICTED: X-ray repair cross-complementing pro...    193   8e-49    Canis lupus familiaris [dogs]
ref|XP_005896238.1|  PREDICTED: X-ray repair cross-complementing ...    193   9e-49    
ref|XP_008495277.1|  PREDICTED: X-ray repair cross-complementing ...    193   9e-49    
ref|XP_004427590.1|  PREDICTED: X-ray repair cross-complementing ...    193   1e-48    
ref|NP_001268322.1|  X-ray repair complementing defective repair ...    193   1e-48    
ref|XP_007086167.1|  PREDICTED: X-ray repair cross-complementing ...    193   1e-48    
ref|XP_005395745.1|  PREDICTED: X-ray repair cross-complementing ...    193   1e-48    
ref|XP_007964393.1|  PREDICTED: X-ray repair cross-complementing ...    193   2e-48    
gb|ETE70834.1|  X-ray repair cross-complementing protein 5              192   2e-48    
ref|XP_010859461.1|  PREDICTED: X-ray repair cross-complementing ...    192   2e-48    
emb|CCA27667.1|  conserved hypothetical protein                         192   3e-48    
gb|EHH55147.1|  hypothetical protein EGM_04294                          192   3e-48    
ref|XP_010334654.1|  PREDICTED: X-ray repair cross-complementing ...    191   4e-48    
ref|XP_003462130.2|  PREDICTED: X-ray repair cross-complementing ...    191   4e-48    
ref|XP_007187942.1|  PREDICTED: X-ray repair cross-complementing ...    191   4e-48    
ref|XP_006892014.1|  PREDICTED: X-ray repair cross-complementing ...    191   4e-48    
ref|XP_004641424.1|  PREDICTED: X-ray repair cross-complementing ...    191   4e-48    
ref|XP_007535731.1|  PREDICTED: X-ray repair cross-complementing ...    192   4e-48    
ref|XP_007462915.1|  PREDICTED: X-ray repair cross-complementing ...    191   6e-48    
ref|XP_007187941.1|  PREDICTED: X-ray repair cross-complementing ...    191   6e-48    
gb|EOA93610.1|  ATP-dependent DNA helicase 2 subunit 2                  190   7e-48    
ref|XP_005574285.1|  PREDICTED: X-ray repair cross-complementing ...    191   7e-48    
ref|XP_004905045.1|  PREDICTED: X-ray repair cross-complementing ...    190   8e-48    
ref|XP_008257344.1|  PREDICTED: X-ray repair cross-complementing ...    190   1e-47    
ref|XP_005610647.1|  PREDICTED: X-ray repair cross-complementing ...    190   1e-47    
ref|XP_007230493.1|  PREDICTED: X-ray repair cross-complementing ...    190   1e-47    
ref|XP_002749807.3|  PREDICTED: X-ray repair cross-complementing ...    189   2e-47    
ref|XP_005672234.1|  PREDICTED: X-ray repair cross-complementing ...    189   2e-47    
gb|EPQ18407.1|  X-ray repair cross-complementing protein 5              189   3e-47    
ref|XP_006495956.1|  PREDICTED: X-ray repair cross-complementing ...    189   3e-47    
ref|XP_006867919.1|  PREDICTED: X-ray repair cross-complementing ...    189   3e-47    
ref|XP_005849000.1|  hypothetical protein CHLNCDRAFT_144569             188   4e-47    
ref|XP_010947027.1|  PREDICTED: X-ray repair cross-complementing ...    188   4e-47    
ref|XP_003385993.1|  PREDICTED: x-ray repair cross-complementing ...    189   7e-47    
dbj|BAB83859.1|  Xrcc5                                                  187   8e-47    
ref|XP_004577295.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...    188   8e-47    
ref|XP_006763364.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...    187   1e-46    
ref|XP_007908298.1|  PREDICTED: X-ray repair cross-complementing ...    186   1e-46    
ref|XP_004262791.1|  PREDICTED: X-ray repair cross-complementing ...    186   2e-46    
ref|XP_008572576.1|  PREDICTED: X-ray repair cross-complementing ...    186   2e-46    
ref|XP_008116998.1|  PREDICTED: X-ray repair cross-complementing ...    186   2e-46    
ref|XP_002942054.2|  PREDICTED: X-ray repair cross-complementing ...    186   2e-46    
ref|NP_001095611.1|  X-ray repair cross-complementing protein 5         185   4e-46    
ref|XP_003785139.1|  PREDICTED: X-ray repair cross-complementing ...    185   5e-46    
ref|XP_001426860.1|  hypothetical protein                               185   7e-46    
ref|XP_006906803.1|  PREDICTED: X-ray repair cross-complementing ...    184   9e-46    
ref|XP_006076522.1|  PREDICTED: X-ray repair cross-complementing ...    184   1e-45    
ref|XP_006076521.1|  PREDICTED: X-ray repair cross-complementing ...    184   1e-45    
gb|EGV95625.1|  ATP-dependent DNA helicase 2 subunit 2                  183   2e-45    
gb|ERE83872.1|  X-ray repair cross-complementing protein 5 precursor    183   2e-45    
ref|NP_001233669.1|  X-ray repair cross-complementing protein 5 p...    183   2e-45    
ref|XP_005361717.1|  PREDICTED: X-ray repair cross-complementing ...    182   4e-45    
gb|ERE83874.1|  X-ray repair cross-complementing protein 5 precursor    182   4e-45    
ref|XP_007634627.1|  PREDICTED: X-ray repair cross-complementing ...    182   5e-45    
gb|ELR56072.1|  X-ray repair cross-complementing protein 5              181   6e-45    
ref|NP_001081127.1|  X-ray repair complementing defective repair ...    181   1e-44    
ref|XP_008053748.1|  PREDICTED: X-ray repair cross-complementing ...    180   2e-44    
ref|XP_010173508.1|  PREDICTED: X-ray repair cross-complementing ...    179   3e-44    
gb|ERE83873.1|  X-ray repair cross-complementing protein 5 precursor    180   4e-44    
emb|CDS10801.1|  hypothetical protein LRAMOSA11287                      179   1e-43    
ref|XP_008326808.1|  PREDICTED: X-ray repair cross-complementing ...    177   1e-43    
gb|ELK17231.1|  ATP-dependent DNA helicase 2 subunit 2                  178   2e-43    
dbj|BAA76954.1|  human Ku80 autoantigen homologue                       177   2e-43    
gb|EFB15830.1|  hypothetical protein PANDA_001572                       176   3e-43    
ref|XP_004081756.1|  PREDICTED: X-ray repair cross-complementing ...    177   3e-43    
ref|XP_003962032.1|  PREDICTED: X-ray repair cross-complementing ...    176   4e-43    
ref|XP_797768.3|  PREDICTED: X-ray repair cross-complementing pro...    174   1e-42    
tpg|DAA32458.1|  TPA: ATP-dependent DNA helicase II                     174   2e-42    
ref|XP_001432583.1|  hypothetical protein                               174   3e-42    
ref|XP_006258953.1|  PREDICTED: X-ray repair cross-complementing ...    173   3e-42    
ref|XP_004345106.1|  conserved hypothetical protein                     172   8e-42    
ref|XP_007778710.1|  ATP-dependent DNA helicase II subunit 2            172   1e-41    
gb|KFZ51095.1|  X-ray repair cross-complementing protein 5              171   1e-41    
ref|XP_008402166.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...    172   1e-41    
ref|XP_003447481.1|  PREDICTED: X-ray repair cross-complementing ...    172   1e-41    
ref|XP_007501832.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...    172   2e-41    
ref|XP_002503592.1|  predicted protein                                  171   2e-41    
ref|XP_007934023.1|  PREDICTED: X-ray repair cross-complementing ...    171   3e-41    
gb|ELK30494.1|  X-ray repair cross-complementing protein 5              171   5e-41    
emb|CBJ26499.1|  ku P80 DNA helicase, putative                          167   6e-41    
gb|KFV18945.1|  X-ray repair cross-complementing protein 5              167   7e-41    
gb|KFV45073.1|  X-ray repair cross-complementing protein 5              168   7e-41    
ref|XP_003765999.1|  PREDICTED: X-ray repair cross-complementing ...    171   8e-41    
ref|XP_005723401.1|  PREDICTED: X-ray repair cross-complementing ...    169   1e-40    
ref|XP_007577654.1|  PREDICTED: X-ray repair cross-complementing ...    169   1e-40    
ref|XP_009864688.1|  PREDICTED: X-ray repair cross-complementing ...    167   2e-40    
ref|XP_003662861.1|  hypothetical protein MYCTH_2118116                 168   2e-40    
gb|KFP80431.1|  X-ray repair cross-complementing protein 5              167   2e-40    
ref|XP_007577653.1|  PREDICTED: X-ray repair cross-complementing ...    168   3e-40    
ref|XP_006495957.1|  PREDICTED: X-ray repair cross-complementing ...    167   3e-40    
ref|XP_008518141.1|  PREDICTED: X-ray repair cross-complementing ...    166   4e-40    
ref|XP_004555511.1|  PREDICTED: X-ray repair cross-complementing ...    167   4e-40    
gb|ESA01237.1|  hypothetical protein GLOINDRAFT_338082                  168   4e-40    
ref|XP_005918353.1|  PREDICTED: X-ray repair cross-complementing ...    167   6e-40    
ref|XP_001433714.1|  hypothetical protein                               167   6e-40    
emb|CAG09291.1|  unnamed protein product                                167   8e-40    
gb|KDD73580.1|  hypothetical protein H632_c2038p0                       161   1e-39    
gb|KFV14386.1|  X-ray repair cross-complementing protein 5              165   1e-39    
ref|XP_009986055.1|  PREDICTED: X-ray repair cross-complementing ...    164   1e-39    
ref|XP_010080660.1|  PREDICTED: X-ray repair cross-complementing ...    164   2e-39    
sp|Q7RX73.2|KU80_NEUCR  RecName: Full=ATP-dependent DNA helicase ...    166   2e-39    
ref|XP_009815841.1|  PREDICTED: X-ray repair cross-complementing ...    164   2e-39    
gb|EAA27151.3|  Ku70/Ku80 family protein                                166   2e-39    
gb|KEQ87487.1|  putative Ku family DNA helicase                         165   2e-39    
ref|XP_003919748.1|  PREDICTED: LOW QUALITY PROTEIN: X-ray repair...    164   3e-39    
gb|AAY24231.1|  unknown                                                 163   3e-39    
ref|XP_007737832.1|  ATP-dependent DNA helicase 2 subunit 2             164   4e-39    
ref|XP_008300808.1|  PREDICTED: X-ray repair cross-complementing ...    164   4e-39    
ref|XP_009850863.1|  protein Ku80                                       164   5e-39    
gb|KEQ71575.1|  putative Ku family DNA helicase                         163   1e-38    
dbj|BAE01114.1|  unnamed protein product                                162   1e-38    
ref|XP_010200334.1|  PREDICTED: X-ray repair cross-complementing ...    160   2e-38    
gb|KFP25767.1|  X-ray repair cross-complementing protein 5              160   2e-38    
gb|EXX62612.1|  Yku80p                                                  162   3e-38    
emb|CAA40736.1|  nuclear factor IV                                      160   4e-38    
ref|XP_010610260.1|  PREDICTED: X-ray repair cross-complementing ...    161   6e-38    
gb|KFO20200.1|  X-ray repair cross-complementing protein 5              161   6e-38    
gb|EPS30436.1|  hypothetical protein PDE_05387                          160   1e-37    
ref|XP_007727282.1|  hypothetical protein A1O1_08230                    159   2e-37    
ref|XP_004991077.1|  hypothetical protein PTSG_08056                    157   2e-37    
ref|XP_003351623.1|  hypothetical protein SMAC_00164                    159   2e-37    
ref|XP_009321815.1|  PREDICTED: X-ray repair cross-complementing ...    158   3e-37    
ref|XP_008968153.1|  PREDICTED: X-ray repair cross-complementing ...    157   5e-37    
ref|XP_001391676.2|  ATP-dependent DNA helicase II subunit 2            158   5e-37    
emb|CAK48968.1|  unnamed protein product                                158   6e-37    
ref|XP_009273243.1|  PREDICTED: X-ray repair cross-complementing ...    157   6e-37    
ref|XP_002151653.1|  Ku family DNA helicase, putative                   158   7e-37    
ref|XP_009156701.1|  ATP-dependent DNA helicase 2 subunit 2             157   9e-37    
gb|KEQ62663.1|  SPOC domain-like protein                                157   1e-36    
gb|KFQ82182.1|  X-ray repair cross-complementing protein 5              152   2e-36    
gb|ETS05635.1|  Ku70/Ku80 N-terminal alpha/beta domain-containing...    156   2e-36    
ref|XP_010292677.1|  PREDICTED: X-ray repair cross-complementing ...    152   2e-36    
gb|KDN60584.1|  putative Ku70/Ku80 N-terminal alpha/beta domain-c...    156   2e-36    
emb|CCT66250.1|  related to ATP-dependent DNA helicase II, 80 kDa...    156   2e-36    
ref|XP_007743845.1|  hypothetical protein A1O5_05052                    156   2e-36    
ref|XP_007187943.1|  PREDICTED: X-ray repair cross-complementing ...    155   4e-36    
ref|XP_662156.1|  hypothetical protein AN4552.2                         155   4e-36    
ref|XP_003713796.1|  hypothetical protein MGG_10157                     155   4e-36    
ref|XP_005395746.1|  PREDICTED: X-ray repair cross-complementing ...    154   6e-36    
emb|CCE30988.1|  related to ATP-dependent DNA helicase II, 80 kDa...    155   6e-36    
ref|XP_010741561.1|  PREDICTED: X-ray repair cross-complementing ...    155   7e-36    
gb|EFQ27198.1|  Ku70/Ku80 N-terminal alpha/beta domain-containing...    155   7e-36    
gb|KFD58992.1|  hypothetical protein M513_00155                         154   8e-36    
dbj|GAA85278.1|  ATP-dependent DNA helicase II subunit 2                154   8e-36    
ref|XP_010741569.1|  PREDICTED: X-ray repair cross-complementing ...    154   9e-36    
ref|XP_009486000.1|  PREDICTED: X-ray repair cross-complementing ...    151   1e-35    
ref|XP_002480588.1|  Ku family DNA helicase, putative                   154   1e-35    
gb|EEH09076.1|  conserved hypothetical protein                          154   1e-35    
ref|XP_002151654.1|  Ku family DNA helicase, putative                   154   1e-35    
ref|XP_003239051.1|  hypothetical protein TERG_01036                    154   2e-35    
emb|CCD50910.1|  similar to ATP-dependent DNA helicase II subunit 2     154   2e-35    
gb|EWG44265.1|  ATP-dependent DNA helicase 2 subunit 2                  153   2e-35    
gb|EHA24072.1|  hypothetical protein ASPNIDRAFT_180705                  153   2e-35    
dbj|BAI40068.1|  Ku80                                                   153   3e-35    
ref|XP_001551373.1|  hypothetical protein BC1G_10199                    154   3e-35    
pdb|1JEQ|B  Chain B, Crystal Structure Of The Ku Heterodimer            151   4e-35    
gb|KFQ78331.1|  X-ray repair cross-complementing protein 5              150   4e-35    
ref|XP_001265831.1|  Ku family DNA helicase, putative                   152   6e-35    
emb|CEG74735.1|  hypothetical protein RMATCC62417_09897                 152   6e-35    
dbj|GAM41336.1|  hypothetical protein TCE0_042f14385                    152   7e-35    
ref|XP_011121565.1|  hypothetical protein AOL_s00076g711                151   8e-35    
gb|AAI15209.1|  Xrcc5 protein                                           151   1e-34    
gb|AIL94178.1|  Ku80                                                    151   1e-34    
ref|XP_002847833.1|  conserved hypothetical protein                     151   1e-34    
ref|XP_003176411.1|  Ku80                                               151   1e-34    
gb|EXK41412.1|  ATP-dependent DNA helicase 2 subunit 2                  151   1e-34    
gb|EGC42394.1|  conserved hypothetical protein                          151   1e-34    
gb|EWZ44044.1|  ATP-dependent DNA helicase 2 subunit 2                  151   1e-34    
gb|KFO14497.1|  X-ray repair cross-complementing protein 5              148   2e-34    
gb|EER44165.1|  Ku80                                                    150   2e-34    
gb|EXM04001.1|  ATP-dependent DNA helicase 2 subunit 2                  150   2e-34    
gb|EWY97968.1|  ATP-dependent DNA helicase 2 subunit 2                  150   2e-34    
ref|XP_002480587.1|  Ku family DNA helicase, putative                   150   2e-34    
gb|EPY34772.1|  ATP-dependent DNA helicase 2 subunit 2                  150   3e-34    
emb|CEJ81917.1|  Putative Ku70/Ku80 domain & Ku-core domain conta...    149   4e-34    
gb|KFH62273.1|  hypothetical protein MVEG_11484                         150   5e-34    
gb|EHK16617.1|  hypothetical protein TRIVIDRAFT_232258                  149   5e-34    
gb|KFQ53851.1|  X-ray repair cross-complementing protein 5              145   6e-34    
dbj|BAM36546.1|  ku80 protein                                           149   7e-34    
ref|XP_005800780.1|  PREDICTED: X-ray repair cross-complementing ...    149   7e-34    
emb|CCF39209.1|  Ku70/Ku80 N-terminal alpha/beta domain-containin...    149   8e-34    
gb|KEF52768.1|  hypothetical protein A1O9_11185                         148   8e-34    
gb|EMT64083.1|  ATP-dependent DNA helicase II subunit 2                 148   9e-34    
gb|EXM37226.1|  ATP-dependent DNA helicase 2 subunit 2                  148   9e-34    
ref|XP_003655722.1|  hypothetical protein THITE_2119725                 148   9e-34    
ref|XP_010308056.1|  PREDICTED: X-ray repair cross-complementing ...    145   1e-33    
gb|EGU85850.1|  hypothetical protein FOXB_03698                         148   1e-33    
gb|EHB15760.1|  ATP-dependent DNA helicase 2 subunit 2                  148   1e-33    
ref|XP_003001068.1|  Ku80                                               148   1e-33    
gb|EHK41263.1|  hypothetical protein TRIATDRAFT_295201                  147   2e-33    
ref|XP_002405506.1|  ku P80 DNA helicase, putative                      147   2e-33    
ref|XP_001272945.1|  Ku family DNA helicase, putative                   147   2e-33    
ref|XP_008721100.1|  hypothetical protein HMPREF1541_08559              147   2e-33    
gb|AGT79985.1|  Ku80                                                    147   3e-33    
gb|KDB11177.1|  Ku70/Ku80 domain & Ku-core domain containing protein    146   4e-33    
gb|EFW16589.1|  Ku family DNA helicase                                  146   4e-33    
ref|XP_009657197.1|  Ku80                                               146   5e-33    
ref|XP_006157534.1|  PREDICTED: X-ray repair cross-complementing ...    147   5e-33    
gb|ESZ98043.1|  hypothetical protein SBOR_1574                          146   5e-33    
gb|ENH64268.1|  ATP-dependent DNA helicase II subunit 2                 145   6e-33    
gb|EME48779.1|  hypothetical protein DOTSEDRAFT_67726                   146   6e-33    
gb|KGO44253.1|  DNA helicase, ATP-dependent, Ku type                    145   8e-33    
ref|XP_001248033.1|  hypothetical protein CIMG_01804                    145   8e-33    
ref|XP_008728385.1|  hypothetical protein G647_05837                    145   8e-33    
ref|XP_007805443.1|  ATP-dependent DNA helicase II subunit 2            145   9e-33    
gb|EQL02716.1|  Spen like and like SPOC protein                         145   9e-33    
gb|EQB54732.1|  Ku70/Ku80 N-terminal alpha/beta domain-containing...    145   1e-32    
gb|KHN99599.1|  ATP-dependent DNA helicase II subunit 2                 145   1e-32    
gb|EKG17347.1|  Ku70/Ku80 arm                                           145   1e-32    
gb|EZF33332.1|  hypothetical protein H101_03082                         145   2e-32    
gb|EKV07482.1|  ATP-dependent DNA helicase II subunit 2                 144   2e-32    
ref|XP_007595642.1|  Ku70/Ku80 N-terminal alpha/beta domain-conta...    144   2e-32    
ref|XP_002562026.1|  Pc18g01820                                         144   2e-32    
ref|XP_749397.1|  Ku family DNA helicase                                144   2e-32    
gb|ELQ44459.1|  hypothetical protein OOU_Y34scaffold00087g37            144   2e-32    
ref|XP_007758896.1|  hypothetical protein A1O7_06705                    144   3e-32    
ref|XP_001908293.1|  hypothetical protein                               144   3e-32    
ref|XP_007792533.1|  putative ku family dna protein                     143   4e-32    
ref|XP_010770334.1|  PREDICTED: X-ray repair cross-complementing ...    143   5e-32    
gb|KEY76818.1|  KuDNA helicase                                          143   5e-32    
ref|XP_002629155.1|  protein Ku80                                       143   6e-32    
gb|KHJ46173.1|  Ku70/Ku80 beta-barrel domain protein                    142   6e-32    
ref|XP_001221885.1|  hypothetical protein CHGG_05790                    143   6e-32    
ref|XP_010028126.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    132   8e-32    
ref|XP_005708110.1|  ATP-dependent DNA helicase 2 subunit 2 isofo...    142   9e-32    
ref|XP_010028130.1|  PREDICTED: ATP-dependent DNA helicase 2 subu...    132   1e-31    
emb|CDM33834.1|  ATP-dependent DNA helicase II subunit 2                142   1e-31    
gb|EEH22349.2|  hypothetical protein PABG_04560                         142   1e-31    
ref|XP_007913905.1|  putative ku family dna protein                     142   1e-31    
ref|XP_001944675.1|  PREDICTED: X-ray repair cross-complementing ...    141   2e-31    
ref|XP_010760211.1|  hypothetical protein PADG_04958                    141   2e-31    
ref|XP_001628737.1|  predicted protein                                  138   2e-31    
ref|XP_005708109.1|  ATP-dependent DNA helicase 2 subunit 2 isofo...    140   3e-31    
ref|XP_003189905.1|  ATP-dependent DNA helicase II subunit 2            140   3e-31    
ref|XP_001591682.1|  hypothetical protein SS1G_07128                    140   4e-31    
emb|CCI50557.1|  unnamed protein product                                141   5e-31    
gb|ABW87766.1|  ATP-dependent DNA helicase II                           140   5e-31    



>ref|XP_009789959.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 [Nicotiana 
sylvestris]
Length=711

 Score =  1054 bits (2725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/711 (72%), Positives = 610/711 (86%), Gaps = 14/711 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E ++LVIDVGPSMH VLPEIEKVCS+L++KKLI+S+YDEVG +LFGT +T NELT
Sbjct  1     MARNKEAVVLVIDVGPSMHSVLPEIEKVCSLLIQKKLIFSRYDEVGFVLFGTADTKNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             EE+GGYEHVTVLR+IKVVD+DL+ AL+ LPRG++ GDFLDA++VGMDM+IKK+G TNKGK
Sbjct  61    EEVGGYEHVTVLRNIKVVDEDLVDALQNLPRGNIPGDFLDAIVVGMDMLIKKFGQTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA+ PIKDP+EGTK DQV+TIA QM A GM+MD VIVRMKQDL+    ++ EN
Sbjct  121   KRLCLITNAISPIKDPFEGTKGDQVNTIATQMAAQGMKMDCVIVRMKQDLETNMRVMKEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LLSVFS ++SSK  YVE+ TSL+GA+RTRNI+PVT+YRGDFE+S++LKIKVWVYKKTS
Sbjct  181   DVLLSVFSNKSSSKVVYVENPTSLLGALRTRNISPVTIYRGDFEISSQLKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YS+KAPPTDKFA HEI   YEYK ++DP K VPPEQRIKG+RYGPQVVPIS
Sbjct  241   EEKFPTLKKYSEKAPPTDKFATHEIKVDYEYKSIEDPNKVVPPEQRIKGFRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKF PEK VKLLGFTDASNIMRHYY+KD N+FIA+P N  AILA+SALARAMK+
Sbjct  301   SAEWEAVKFNPEKSVKLLGFTDASNIMRHYYLKDVNIFIAEPGNKMAILALSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQGNV +GVLTP+VSD+ N PDS YFN LPFAEDVREFQFPSFSNLP
Sbjct  361   MNKVAIVRCVWRQGQGNVVVGVLTPSVSDEDNTPDSFYFNILPFAEDVREFQFPSFSNLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SSM PNE+QQEAAD LV+MLDLAP+  QE L P+FT NPVL+RYY YL++KSKH DAAVP
Sbjct  421   SSMQPNEKQQEAADKLVQMLDLAPTGKQEILPPDFTTNPVLERYYRYLDLKSKHPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLDE LR+IT+PD ELLS+NK++++EFRR FELK+NPK+KKS +R+++E+P+GSD EGE 
Sbjct  481   PLDETLRKITEPDVELLSRNKSIIEEFRRSFELKENPKLKKSTRRIMKERPSGSDGEGEE  540

Query  1742  --------------ASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYL  1879
                            S+K K EKIG+INPV+DFE+M+SRRD+P W++KAIQ+MKNK F L
Sbjct  541   FDKDADAKAIDSIGYSSKDKVEKIGDINPVKDFEEMMSRRDNPRWISKAIQDMKNKTFDL  600

Query  1880  VENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHG  2059
             VENS EGDTY KALECLVALR GCI+EQEPKQFND L +LY  C+EKDLRSFC+ L SHG
Sbjct  601   VENSCEGDTYDKALECLVALRRGCILEQEPKQFNDFLCHLYKFCQEKDLRSFCQYLASHG  660

Query  2060  IALITKTEAPDSDVLESEARSFMTESevkaetakkepkeeQDIMSIYLGGK  2212
             + LITKTEAPDS++ E EARSFM + E  ++  + E K E DIMSI+LGGK
Sbjct  661   MNLITKTEAPDSEIPEHEARSFMVKPEPDSQNVESEAKAEDDIMSIFLGGK  711



>ref|XP_009604926.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 [Nicotiana 
tomentosiformis]
Length=697

 Score =  1037 bits (2681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/685 (73%), Positives = 592/685 (86%), Gaps = 14/685 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E ++LVIDVGPSMH VLPEI KVCS+L++KKLI+S+YDEVG +LFGT +T NELT
Sbjct  1     MARNKEAVVLVIDVGPSMHSVLPEIGKVCSLLIQKKLIFSRYDEVGFVLFGTADTKNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             EE+GGYEHVTVLR+IKVVD+DL+ A + LPRGSV GDFLDA++VGMDM+IKK+G TNKGK
Sbjct  61    EEVGGYEHVTVLRNIKVVDEDLVDAPQNLPRGSVPGDFLDAIVVGMDMLIKKFGQTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA+ PIKDP+EGTKEDQV+TIA QM A GM+MD VIVRMKQDL+  + ++ EN
Sbjct  121   KRLCLITNAISPIKDPFEGTKEDQVNTIATQMAAQGMKMDCVIVRMKQDLEMNRRVMKEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LLSVFS ++SSK  YVE+ TSL+GA+RTRNI+PVT+YRGDFE+S++LKIKVWVYKKTS
Sbjct  181   DVLLSVFSNKSSSKIVYVENPTSLLGALRTRNISPVTIYRGDFEISSQLKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YS+KAPPTDKFA HEI   YEYK ++DP K VPPEQRIKG+RYGPQVVPIS
Sbjct  241   EEKFPTLKKYSEKAPPTDKFATHEIKVDYEYKSIEDPNKVVPPEQRIKGFRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEK VKLLGFTDASNIMRHYY+KD N+FIA+P N KAILA+SALARAMK+
Sbjct  301   SAEWEAVKFKPEKSVKLLGFTDASNIMRHYYLKDVNIFIAEPGNKKAILALSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQGNV +GVLTP+VSDK N PDS YFN LPFAEDVREFQFPSFSNLP
Sbjct  361   MNKVAIVRCVWRQGQGNVVVGVLTPSVSDKDNAPDSFYFNILPFAEDVREFQFPSFSNLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SSM PNE+QQEAAD LV+MLDLAP   QE L P+FTPNPVL+RYY YL++KSKH DAAVP
Sbjct  421   SSMQPNEKQQEAADKLVQMLDLAPPGKQEILPPDFTPNPVLERYYRYLDLKSKHPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLDE LR+IT+PD ELLS++K++++EF R FELK+NPK+KKS +R+++E+P GSD EGE 
Sbjct  481   PLDETLRKITEPDVELLSRHKSIIEEFHRSFELKENPKLKKSTRRIMKERPPGSDGEGEE  540

Query  1742  --------------ASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYL  1879
                            S+K K EKIG+INPV+DFE+M+SRRD+  W+NKAIQ+MKNK F L
Sbjct  541   FDKDADAKAIDSIGYSSKDKVEKIGDINPVKDFEEMMSRRDNAGWINKAIQDMKNKTFDL  600

Query  1880  VENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHG  2059
             VENS EGDTY KALECLVALR GCI+EQEPKQFND L +LY  C+EKDLR+FC+ L SHG
Sbjct  601   VENSCEGDTYDKALECLVALRRGCILEQEPKQFNDFLCHLYKFCQEKDLRNFCQYLASHG  660

Query  2060  IALITKTEAPDSDVLESEARSFMTE  2134
             + LITKTEAPD+++ E EARSFM +
Sbjct  661   MTLITKTEAPDNEIPEDEARSFMVK  685



>ref|XP_006339432.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like [Solanum 
tuberosum]
Length=710

 Score =  1033 bits (2671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/711 (72%), Positives = 601/711 (85%), Gaps = 15/711 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E ++LVIDVGPSMH VLPEIEKVCS+L++KKL++S+YDEVG +LFGT +T NEL 
Sbjct  1     MARNKEAVVLVIDVGPSMHSVLPEIEKVCSLLIQKKLVFSRYDEVGFVLFGTADTKNELK  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             EE+GGYEHVTVLR+IKVVD+DL+ ALE+LPRGSV GDFLDA++VGMDM+IKK+G TNK K
Sbjct  61    EEIGGYEHVTVLRNIKVVDEDLVDALEKLPRGSVPGDFLDAIVVGMDMLIKKFGQTNKAK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA+  IKDP+EGTKEDQV+TIA QM A GM+MD VIVRMKQD +  + I++EN
Sbjct  121   KRLCLITNAVSLIKDPFEGTKEDQVNTIATQMTAQGMKMDCVIVRMKQDWETSRRIMEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             DFL+SVFS ++SSK  YVES TSL+GA+RTRNI+PVT+YRGDFE+  +LKIKVWVYKKTS
Sbjct  181   DFLMSVFSNKSSSKVVYVESPTSLLGALRTRNISPVTIYRGDFEIGAQLKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP TDKFA HEI   YEYK ++DP K VPPEQRIKG++YGPQVVPIS
Sbjct  241   EEKFPTLKKYSDKAPSTDKFATHEIKVDYEYKSIEDPNKVVPPEQRIKGFQYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAE EAVKFKPEK VKLLGFTDASN+MRHYY+KD N+FIA+P N KAILA+SALARAMK+
Sbjct  301   SAELEAVKFKPEKSVKLLGFTDASNVMRHYYLKDVNIFIAEPGNKKAILALSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQGNV +GVLTPNVSDK   PDS YFN LPFAEDVREFQFPSFSNLP
Sbjct  361   MNKVAIVRCVWRQGQGNVVVGVLTPNVSDKDITPDSFYFNILPFAEDVREFQFPSFSNLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SSM PNE+QQ+AAD LV+MLDLAP   QE L P+FTPNPVL+RYY YL +KSKH DAAVP
Sbjct  421   SSMQPNEKQQDAADKLVQMLDLAPPGKQEVLPPDFTPNPVLERYYRYLNLKSKHPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEE-GE  1738
             PLDE LR+IT+PD ELLS+NK++++E RR FELKDNPK+KKS +R I+E+P+GSDEE GE
Sbjct  481   PLDETLRKITEPDVELLSRNKSIIEELRRSFELKDNPKLKKSARR-IKERPSGSDEERGE  539

Query  1739  -------------RASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYL  1879
                            S K + EK+G++NPV+DFE+M+SRRD+P+W++KAIQ MKNKIF L
Sbjct  540   FDKDADVKAIDSMEYSAKTEVEKVGDVNPVKDFEEMMSRRDNPKWISKAIQGMKNKIFDL  599

Query  1880  VENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHG  2059
             VENS EGDT+ KAL+CLVALR GCI+EQEPKQFND L +L   C+EKDLRSFC  L SH 
Sbjct  600   VENSCEGDTFHKALQCLVALRKGCILEQEPKQFNDFLCHLSKFCQEKDLRSFCLYLTSHE  659

Query  2060  IALITKTEAPDSDVLESEARSFMTESevkaetakkepkeeQDIMSIYLGGK  2212
                ITK EAPDS++ E EARSFM + E+ ++  K E K E DIMSIYLGGK
Sbjct  660   FTFITKAEAPDSEIPEHEARSFMVKPELDSQNMKSEAKAEDDIMSIYLGGK  710



>emb|CDP17773.1| unnamed protein product [Coffea canephora]
Length=690

 Score =  1029 bits (2661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/686 (72%), Positives = 588/686 (86%), Gaps = 14/686 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+LV+DVGP+MH +LP+IEKVCS+L+EKKLIYSK DEVGV+LFGT  T NELT
Sbjct  1     MARNKEALVLVLDVGPTMHAILPQIEKVCSMLIEKKLIYSKSDEVGVVLFGTEATENELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEH+TVLR IKVVD DLLQAL+ LPR SVDGDFLDA++VGMDM+IKK+G TNKGK
Sbjct  61    KEVGGYEHITVLRHIKVVDGDLLQALQNLPRESVDGDFLDAIVVGMDMLIKKFGPTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA+ PIKDPYEGTKEDQVSTIA+QM A GM+MD VI R+ Q+++A K I++EN
Sbjct  121   KRLCLITNALHPIKDPYEGTKEDQVSTIASQMMAQGMKMDCVIARLTQNMEANKRIMEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL VFS ++S+K  YVE+ T L+GA+RTRNI+PVT+YRGD ELS KL IKVWVYKKTS
Sbjct  181   DLLLRVFSNKSSTKTVYVENPTKLLGALRTRNISPVTIYRGDLELSPKLNIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YS+KAPPTDKFA HE+   YEYK ++DPT+ VPPEQRIKGYRYGPQVVPIS
Sbjct  241   EEKFPTLKRYSNKAPPTDKFATHEVKVDYEYKSIEDPTRVVPPEQRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAE EAVKFKP+K VKLLGF +ASNIMRHYYMKD N+FIA+P N+KAILAVSALARAMK+
Sbjct  301   SAELEAVKFKPDKSVKLLGFANASNIMRHYYMKDVNIFIAEPGNAKAILAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             M +VAIVRCVWRQGQGNV +GVLTPNVSD  N+PDS  FN LPFAEDVREFQFPSFSNLP
Sbjct  361   MMKVAIVRCVWRQGQGNVVVGVLTPNVSDNENIPDSFCFNVLPFAEDVREFQFPSFSNLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SSM PN+QQQEAAD LV+MLDLA    +E L P+FTPNP+L+R+Y YLE+KSK  DAAVP
Sbjct  421   SSMQPNQQQQEAADRLVRMLDLALLGKEEILQPDFTPNPILERFYRYLELKSKDKDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGE-  1738
             PLDE L++IT+PDPE+L QNK+V+++FRRCFELK+NPK+KKS +RL++EKP+GSD+E E 
Sbjct  481   PLDETLKKITEPDPEILFQNKSVIEDFRRCFELKENPKLKKSTRRLLKEKPSGSDDEREV  540

Query  1739  -------------RASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYL  1879
                             +K+K+EKIG+ NPVQDFE M+SRRDSPEWV+KAIQ MK+K+F L
Sbjct  541   LGNGSDAQPMDAIEYPSKIKTEKIGDANPVQDFEAMMSRRDSPEWVSKAIQYMKDKVFEL  600

Query  1880  VENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHG  2059
             VENS EGD+YQKALECL ALR GCI+EQEPKQFND + +LY  C++KDL+SFC+ L SHG
Sbjct  601   VENSCEGDSYQKALECLTALRKGCILEQEPKQFNDFILHLYKFCQQKDLKSFCEYLASHG  660

Query  2060  IALITKTEAPDSDVLESEARSFMTES  2137
             I LI+KTEA DS+V E EA++F+ +S
Sbjct  661   ITLISKTEAADSEVTEDEAKTFIVKS  686



>ref|XP_004229815.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 [Solanum 
lycopersicum]
Length=709

 Score =  1020 bits (2637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/711 (70%), Positives = 599/711 (84%), Gaps = 16/711 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+LVIDVGPSMH VLPEIEKVCS+L++KKL++S+YDEVG +LFGT +T NEL 
Sbjct  1     MARNKEALVLVIDVGPSMHSVLPEIEKVCSLLIQKKLVFSRYDEVGFVLFGTADTKNELK  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             EE+GGYEHVTVLR+IKVVD+DL+ AL++LPRGSV GDFLDA++VG DM+IK +G TNK K
Sbjct  61    EEIGGYEHVTVLRNIKVVDEDLVDALQKLPRGSVPGDFLDAIVVGTDMLIK-FGRTNKAK  119

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +RLCLITNA+  IKDP+EGTKEDQV+TIA QM A G++MD VIVRMKQD +  + I++EN
Sbjct  120   RRLCLITNAVSRIKDPFEGTKEDQVNTIATQMTAQGIKMDCVIVRMKQDRETNRSIMEEN  179

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             DFL+SVFS ++SSK  YVES TSL+GA+RTRNI+PVT+YRGD E+S +LKIKVWVYKKTS
Sbjct  180   DFLMSVFSNKSSSKVVYVESPTSLLGALRTRNISPVTIYRGDLEISAQLKIKVWVYKKTS  239

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YS++ P TDKF  H+I   YE K+++DP K VPPEQRIKG++YGPQVVPIS
Sbjct  240   EEKFPTLKKYSERTPTTDKFGAHDIKVEYENKIIEDPNKVVPPEQRIKGFQYGPQVVPIS  299

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAE EAVKFKPEK VKLLGFTD+SNIMRHYY+KD N+FIA+P N  AILA+SALARAMK+
Sbjct  300   SAELEAVKFKPEKSVKLLGFTDSSNIMRHYYLKDVNIFIAEPGNKNAILALSALARAMKE  359

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQGNV +GVLTPNVSDK N PDS YFN LPFAEDVR+FQFPSFSNLP
Sbjct  360   MNKVAIVRCVWRQGQGNVVVGVLTPNVSDKDNTPDSFYFNILPFAEDVRDFQFPSFSNLP  419

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SSM PNE+QQ+AAD LV+MLDLAP   QE L P+FTPNPVL+RYY YL +KSKH DAAVP
Sbjct  420   SSMQPNEKQQDAADKLVQMLDLAPPGKQEVLSPDFTPNPVLERYYRYLNLKSKHPDAAVP  479

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGE-  1738
             PLDE LR+IT+PD ELLSQNK++++E RR FELKDNPK+KKS +R I+E+P+GSDEE E 
Sbjct  480   PLDETLRKITEPDVELLSQNKSIIEELRRSFELKDNPKLKKSARR-IKERPSGSDEEIEE  538

Query  1739  -------------RASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYL  1879
                            S K + EK+G++NPV+DFEDM+SRRD+P+W++KAIQ+MKN+IF L
Sbjct  539   FNKDADVKAIDSMEYSAKTEVEKVGDVNPVKDFEDMLSRRDNPKWISKAIQDMKNRIFDL  598

Query  1880  VENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHG  2059
             VENS +GDT+ KAL+CLVALR GCI+EQEPKQFND L +L   C+EKDLRSFC  L SH 
Sbjct  599   VENSCDGDTFHKALQCLVALRKGCILEQEPKQFNDFLCHLSKFCQEKDLRSFCLYLTSHE  658

Query  2060  IALITKTEAPDSDVLESEARSFMTESevkaetakkepkeeQDIMSIYLGGK  2212
             I LITK EAPDS++ E EARSFM + E+ ++  K E K E DIMSIYLGGK
Sbjct  659   ITLITKAEAPDSEISEHEARSFMVKPELDSQNMKSEAKAEDDIMSIYLGGK  709



>ref|XP_011090723.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X2 [Sesamum indicum]
Length=702

 Score =  1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/678 (72%), Positives = 575/678 (85%), Gaps = 12/678 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+EGL+LV+DVGPSMH +LPEIEKVCS+LV+KKLIY+KYDEVGV++FGT +T N+LT
Sbjct  1     MARNKEGLVLVLDVGPSMHALLPEIEKVCSMLVQKKLIYNKYDEVGVVVFGTADTKNDLT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYE+V VLR +KVVD DL++A++QLPRGS  GDFLDA++VGMDM+IKKYG TNKGK
Sbjct  61    VEVGGYENVMVLRDVKVVDGDLIEAVQQLPRGSAHGDFLDAIVVGMDMLIKKYGPTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA+ PIKDPYEG+KEDQV+T+AAQM  HGM+MD +I+R  QD    K I+ EN
Sbjct  121   KRLCLITNALTPIKDPYEGSKEDQVNTVAAQMMTHGMKMDCIIIRANQDWGVRKEIVKEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             DFLL VFS  +SSK  YVESATSL+GA+RTRNI+PVT+YRGDFELS+KLKIKVW+YKKTS
Sbjct  181   DFLLDVFSTRSSSKKVYVESATSLLGALRTRNISPVTIYRGDFELSSKLKIKVWIYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FP+LK YSDKAPPTDKFA HEI   YEYK ++DP + VPPEQRIKGYRYGPQVVPIS
Sbjct  241   EEKFPSLKKYSDKAPPTDKFATHEIKVDYEYKSIEDPNRVVPPEQRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGFTD SNIMR YYM+D N+FIA+P N+KA LAVSALARAMKD
Sbjct  301   SAEWEAVKFKPEKGVKLLGFTDVSNIMRQYYMRDVNIFIAEPGNTKATLAVSALARAMKD  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             M++VAI+RCVWRQGQ NV +GVLTPNVS+K N+PDS YFN LPFAEDVREFQFPSFSNLP
Sbjct  361   MDKVAIIRCVWRQGQANVVVGVLTPNVSEKDNIPDSFYFNVLPFAEDVREFQFPSFSNLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S+ PNEQQQ+AAD LV+ML+LAPS  +EAL P  TPNPVL+RYY  LE+KSK  DAA+P
Sbjct  421   PSVQPNEQQQQAADKLVQMLELAPSGKEEALQPNLTPNPVLERYYRSLELKSKDPDAAIP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLDE LR+IT+PD ELL QN+ V++EFR  FELK+NPK+KKS +R++REKP+GS EEGE 
Sbjct  481   PLDETLRKITEPDAELLYQNRAVIEEFRTSFELKENPKLKKSSRRVLREKPSGSSEEGEG  540

Query  1742  AS------------TKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVE  1885
              S            + VK  KIG+ NPVQDFE MISRRDSP+W+ KAIQ MK+KIF LVE
Sbjct  541   VSDVGQAMDAIEYTSNVKVGKIGDSNPVQDFEAMISRRDSPQWITKAIQSMKDKIFDLVE  600

Query  1886  NSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIA  2065
             NS EGDTY+KALECL ALR GCI+EQEPKQFND L +L+  C+EK+L SF + L SH + 
Sbjct  601   NSFEGDTYEKALECLGALRKGCILEQEPKQFNDFLHHLHKFCQEKNLSSFSEYLMSHEMM  660

Query  2066  LITKTEAPDSDVLESEAR  2119
             LI+K EAP+SDV E EAR
Sbjct  661   LISKNEAPESDVPEHEAR  678



>ref|XP_011090712.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X1 [Sesamum indicum]
Length=708

 Score =  1009 bits (2608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/673 (72%), Positives = 570/673 (85%), Gaps = 12/673 (2%)
 Frame = +2

Query  137   EGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelgg  316
             EGL+LV+DVGPSMH +LPEIEKVCS+LV+KKLIY+KYDEVGV++FGT +T N+LT E+GG
Sbjct  12    EGLVLVLDVGPSMHALLPEIEKVCSMLVQKKLIYNKYDEVGVVVFGTADTKNDLTVEVGG  71

Query  317   YEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCL  496
             YE+V VLR +KVVD DL++A++QLPRGS  GDFLDA++VGMDM+IKKYG TNKGKKRLCL
Sbjct  72    YENVMVLRDVKVVDGDLIEAVQQLPRGSAHGDFLDAIVVGMDMLIKKYGPTNKGKKRLCL  131

Query  497   ITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLS  676
             ITNA+ PIKDPYEG+KEDQV+T+AAQM  HGM+MD +I+R  QD    K I+ ENDFLL 
Sbjct  132   ITNALTPIKDPYEGSKEDQVNTVAAQMMTHGMKMDCIIIRANQDWGVRKEIVKENDFLLD  191

Query  677   VFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFP  856
             VFS  +SSK  YVESATSL+GA+RTRNI+PVT+YRGDFELS+KLKIKVW+YKKTSEE+FP
Sbjct  192   VFSTRSSSKKVYVESATSLLGALRTRNISPVTIYRGDFELSSKLKIKVWIYKKTSEEKFP  251

Query  857   TLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWE  1036
             +LK YSDKAPPTDKFA HEI   YEYK ++DP + VPPEQRIKGYRYGPQVVPISSAEWE
Sbjct  252   SLKKYSDKAPPTDKFATHEIKVDYEYKSIEDPNRVVPPEQRIKGYRYGPQVVPISSAEWE  311

Query  1037  AVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVA  1216
             AVKFKPEKGVKLLGFTD SNIMR YYM+D N+FIA+P N+KA LAVSALARAMKDM++VA
Sbjct  312   AVKFKPEKGVKLLGFTDVSNIMRQYYMRDVNIFIAEPGNTKATLAVSALARAMKDMDKVA  371

Query  1217  IVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLP  1396
             I+RCVWRQGQ NV +GVLTPNVS+K N+PDS YFN LPFAEDVREFQFPSFSNLP S+ P
Sbjct  372   IIRCVWRQGQANVVVGVLTPNVSEKDNIPDSFYFNVLPFAEDVREFQFPSFSNLPPSVQP  431

Query  1397  NEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEI  1576
             NEQQQ+AAD LV+ML+LAPS  +EAL P  TPNPVL+RYY  LE+KSK  DAA+PPLDE 
Sbjct  432   NEQQQQAADKLVQMLELAPSGKEEALQPNLTPNPVLERYYRSLELKSKDPDAAIPPLDET  491

Query  1577  LRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERAS---  1747
             LR+IT+PD ELL QN+ V++EFR  FELK+NPK+KKS +R++REKP+GS EEGE  S   
Sbjct  492   LRKITEPDAELLYQNRAVIEEFRTSFELKENPKLKKSSRRVLREKPSGSSEEGEGVSDVG  551

Query  1748  ---------TKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEG  1900
                      + VK  KIG+ NPVQDFE MISRRDSP+W+ KAIQ MK+KIF LVENS EG
Sbjct  552   QAMDAIEYTSNVKVGKIGDSNPVQDFEAMISRRDSPQWITKAIQSMKDKIFDLVENSFEG  611

Query  1901  DTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKT  2080
             DTY+KALECL ALR GCI+EQEPKQFND L +L+  C+EK+L SF + L SH + LI+K 
Sbjct  612   DTYEKALECLGALRKGCILEQEPKQFNDFLHHLHKFCQEKNLSSFSEYLMSHEMMLISKN  671

Query  2081  EAPDSDVLESEAR  2119
             EAP+SDV E EAR
Sbjct  672   EAPESDVPEHEAR  684



>ref|XP_002273349.2| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X1 [Vitis vinifera]
Length=690

 Score =   988 bits (2553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/684 (69%), Positives = 575/684 (84%), Gaps = 13/684 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DV PSMH  LPE+EK+CS+L++KKLIYSK DEVG++LFGT +T NELT
Sbjct  1     MARNKEALLLLLDVSPSMHTFLPEVEKLCSMLLQKKLIYSKNDEVGIVLFGTEDTNNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEHV VLR IKVVD DL++AL+QLPRG+V GDFLDA++VGMDM+IKK+G TNKGK
Sbjct  61    KEVGGYEHVVVLRHIKVVDGDLVEALQQLPRGTVAGDFLDAIVVGMDMLIKKFGSTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLIT+A+CPIKDPYEGTKEDQ+ TIA QM AHGM+++ ++ R +   + +  I+DEN
Sbjct  121   KRLCLITSALCPIKDPYEGTKEDQIGTIAEQMSAHGMKLECIVARGRLSGNVDMRIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL +FS +T++K  YVE+ TSL+GA+RTR+IAPVT++RGD ELS K++IKVWVYKKT+
Sbjct  181   DLLLKLFSTKTTAKTLYVETPTSLLGALRTRSIAPVTIFRGDLELSPKMRIKVWVYKKTA  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EERFPTLK YSD+APPTDKFA HE+   +EYK V++ +K VPPEQRIKGYRYGPQV+PIS
Sbjct  241   EERFPTLKQYSDQAPPTDKFATHEVKVDFEYKSVEESSKVVPPEQRIKGYRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGFTDASN+MRHYYM D N+FIA+P N+KA+LAVSALARAMK+
Sbjct  301   SAEWEAVKFKPEKGVKLLGFTDASNVMRHYYMHDVNIFIAEPSNTKAMLAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQG+V IG+LTPNVSDK ++PDS YFN LP+AEDVREFQFPSFSNLP
Sbjct  361   MNKVAILRCVWRQGQGSVVIGILTPNVSDKDDIPDSFYFNVLPYAEDVREFQFPSFSNLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  PNE+QQEAADNLVKMLDLAPS S+E LLP+ TPNPVL+R+Y +LE+KSKH DAAVP
Sbjct  421   ASWQPNEEQQEAADNLVKMLDLAPSGSKETLLPDLTPNPVLERFYRHLELKSKHPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLDE L++IT+PDP+LLSQNK ++D FRR FELK+NPK+KKS +RL+RE+P+G +EE   
Sbjct  481   PLDESLKKITEPDPKLLSQNKPIIDAFRRRFELKENPKLKKSTRRLLRERPSGLNEEASM  540

Query  1742  A-------------STKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLV  1882
                           ++ V  EKIG+  P+QDFE M+S RDSPEWV KAI EMKNKIF LV
Sbjct  541   GDGSDGQAIKSIENTSTVGVEKIGDSTPIQDFEAMMSCRDSPEWVGKAINEMKNKIFDLV  600

Query  1883  ENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGI  2062
             E+S EGD Y KALE LVALR GC++EQEPKQFND L +LY  C++ +L SFC+ L S  I
Sbjct  601   EDSYEGDNYLKALEYLVALRKGCVLEQEPKQFNDFLHHLYKYCEKHNLNSFCESLASKEI  660

Query  2063  ALITKTEAPDSDVLESEARSFMTE  2134
              LI KTEA DS+V E EARS M +
Sbjct  661   MLINKTEAADSEVTEDEARSLMVK  684



>ref|XP_011034378.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 [Populus 
euphratica]
Length=682

 Score =   983 bits (2541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/676 (70%), Positives = 579/676 (86%), Gaps = 5/676 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+EGL+L++DVGP+MH VLPEI+KVCS+L++KKLIY K+DEVGV++FGT  T NELT
Sbjct  1     MARNKEGLVLLLDVGPTMHGVLPEIKKVCSLLIQKKLIYGKFDEVGVVVFGTQATDNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEHV VLR+IKVVD DL+ A ++LPRG+ DGD+LDA++VGMDM+IKKY  TNKGK
Sbjct  61    KEVGGYEHVVVLRNIKVVDGDLVDAFQELPRGNFDGDYLDAIVVGMDMLIKKYQATNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA+CPIKD  EGTKEDQV+TIAAQM AHGM+M+SVIVR +     ++ I+ EN
Sbjct  121   KRLCLITNALCPIKDSCEGTKEDQVNTIAAQMSAHGMKMESVIVRGRLCGGGDQRIMAEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FS++TS++A YVES T+L+GA++TRNI+PVT++RGD EL +K+KIKVWVYKKTS
Sbjct  181   DQLLNLFSEKTSARAVYVESPTALLGAVKTRNISPVTIFRGDLELGSKMKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAPP+D+FA HE+   YEYK V+DP K VPPEQRIKGYRYGPQVVP+S
Sbjct  241   EEKFPTLKKYSDKAPPSDRFATHEVKVDYEYKSVEDPNKVVPPEQRIKGYRYGPQVVPVS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+AVKFKPEK VKLLGFTDASNIMRHYYMKD NVFI +P N++A LAVSALARAMK+
Sbjct  301   SAEWDAVKFKPEKSVKLLGFTDASNIMRHYYMKDVNVFIPEPGNARAALAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQG+V +GVLTPN+S+K + PDS YFN LPFAEDVREFQFPSFS+ P
Sbjct  361   MNKVAILRCVWRQGQGSVVVGVLTPNISEKDSTPDSFYFNVLPFAEDVREFQFPSFSSFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  PNEQQQEAADNLVKMLDLAPS  QEALLP+FTPNPVL+R+Y +LE+KSKH DAAVP
Sbjct  421   VSWQPNEQQQEAADNLVKMLDLAPSAKQEALLPDFTPNPVLERFYRHLELKSKHPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLDE L+ IT+ DP+LLS+ K V+D F + FELK+NP++KKS KRL+ +KP+GSDE+ + 
Sbjct  481   PLDETLKTITEADPDLLSEKKNVIDAFFKSFELKENPRLKKSSKRLLEKKPSGSDEDYQE  540

Query  1742  ASTK-----VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT  1906
              +       VK EKIG+ +PVQDFE M+SRRDSP+WV+KAIQ+MKNKI+ LVENS +GD 
Sbjct  541   TTNALAINPVKVEKIGDSSPVQDFEAMMSRRDSPDWVSKAIQDMKNKIYSLVENSYDGDN  600

Query  1907  YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEA  2086
             + KALECL+ALR GCI+EQEPKQFND L +L+   +EK LR+FC+ L   G+ LI+K+EA
Sbjct  601   HGKALECLLALRKGCILEQEPKQFNDFLHHLFNVGQEKKLRNFCESLIPKGLTLISKSEA  660

Query  2087  PDSDVLESEARSFMTE  2134
              DS+V + EAR+F+ +
Sbjct  661   IDSEVTDDEARNFLVK  676



>ref|XP_010661636.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X2 [Vitis vinifera]
Length=687

 Score =   981 bits (2537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/680 (69%), Positives = 571/680 (84%), Gaps = 13/680 (2%)
 Frame = +2

Query  134   REGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelg  313
             RE L+L++DV PSMH  LPE+EK+CS+L++KKLIYSK DEVG++LFGT +T NELT+E+G
Sbjct  2     REALLLLLDVSPSMHTFLPEVEKLCSMLLQKKLIYSKNDEVGIVLFGTEDTNNELTKEVG  61

Query  314   gYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLC  493
             GYEHV VLR IKVVD DL++AL+QLPRG+V GDFLDA++VGMDM+IKK+G TNKGKKRLC
Sbjct  62    GYEHVVVLRHIKVVDGDLVEALQQLPRGTVAGDFLDAIVVGMDMLIKKFGSTNKGKKRLC  121

Query  494   LITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLL  673
             LIT+A+CPIKDPYEGTKEDQ+ TIA QM AHGM+++ ++ R +   + +  I+DEND LL
Sbjct  122   LITSALCPIKDPYEGTKEDQIGTIAEQMSAHGMKLECIVARGRLSGNVDMRIMDENDLLL  181

Query  674   SVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERF  853
              +FS +T++K  YVE+ TSL+GA+RTR+IAPVT++RGD ELS K++IKVWVYKKT+EERF
Sbjct  182   KLFSTKTTAKTLYVETPTSLLGALRTRSIAPVTIFRGDLELSPKMRIKVWVYKKTAEERF  241

Query  854   PTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEW  1033
             PTLK YSD+APPTDKFA HE+   +EYK V++ +K VPPEQRIKGYRYGPQV+PISSAEW
Sbjct  242   PTLKQYSDQAPPTDKFATHEVKVDFEYKSVEESSKVVPPEQRIKGYRYGPQVIPISSAEW  301

Query  1034  EAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRV  1213
             EAVKFKPEKGVKLLGFTDASN+MRHYYM D N+FIA+P N+KA+LAVSALARAMK+MN+V
Sbjct  302   EAVKFKPEKGVKLLGFTDASNVMRHYYMHDVNIFIAEPSNTKAMLAVSALARAMKEMNKV  361

Query  1214  AIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSML  1393
             AI+RCVWRQGQG+V IG+LTPNVSDK ++PDS YFN LP+AEDVREFQFPSFSNLP+S  
Sbjct  362   AILRCVWRQGQGSVVIGILTPNVSDKDDIPDSFYFNVLPYAEDVREFQFPSFSNLPASWQ  421

Query  1394  PNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDE  1573
             PNE+QQEAADNLVKMLDLAPS S+E LLP+ TPNPVL+R+Y +LE+KSKH DAAVPPLDE
Sbjct  422   PNEEQQEAADNLVKMLDLAPSGSKETLLPDLTPNPVLERFYRHLELKSKHPDAAVPPLDE  481

Query  1574  ILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERA---  1744
              L++IT+PDP+LLSQNK ++D FRR FELK+NPK+KKS +RL+RE+P+G +EE       
Sbjct  482   SLKKITEPDPKLLSQNKPIIDAFRRRFELKENPKLKKSTRRLLRERPSGLNEEASMGDGS  541

Query  1745  ----------STKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL  1894
                       ++ V  EKIG+  P+QDFE M+S RDSPEWV KAI EMKNKIF LVE+S 
Sbjct  542   DGQAIKSIENTSTVGVEKIGDSTPIQDFEAMMSCRDSPEWVGKAINEMKNKIFDLVEDSY  601

Query  1895  EGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALIT  2074
             EGD Y KALE LVALR GC++EQEPKQFND L +LY  C++ +L SFC+ L S  I LI 
Sbjct  602   EGDNYLKALEYLVALRKGCVLEQEPKQFNDFLHHLYKYCEKHNLNSFCESLASKEIMLIN  661

Query  2075  KTEAPDSDVLESEARSFMTE  2134
             KTEA DS+V E EARS M +
Sbjct  662   KTEAADSEVTEDEARSLMVK  681



>gb|EYU31996.1| hypothetical protein MIMGU_mgv1a022226mg [Erythranthe guttata]
Length=694

 Score =   981 bits (2536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/689 (69%), Positives = 573/689 (83%), Gaps = 22/689 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+EGL+LV+DVG SMH VLPE+EKVCS+L++KKL+Y+KYDEVGV++FGT ET N+LT
Sbjct  1     MARNKEGLVLVLDVGLSMHAVLPEVEKVCSMLIQKKLVYNKYDEVGVVVFGTAETKNDLT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGD------FLDAVIVGMDMMIKKYG  463
              E+GGYE+V VLR IKVVD DL++AL QLPRG+V GD      FLDA++VGMDM+IK YG
Sbjct  61    VEVGGYENVMVLRGIKVVDGDLVEALHQLPRGTVHGDCIQSSAFLDAIVVGMDMIIKMYG  120

Query  464   ITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEK  643
              TNKGKKR+CLITNA+ P KDPYEGTKEDQV T+AAQM  HGM+MDS+I+R KQD + +K
Sbjct  121   TTNKGKKRICLITNAVTPTKDPYEGTKEDQVKTVAAQMITHGMKMDSIIIRTKQDRELDK  180

Query  644   GIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVW  823
              +++ENDFLLSVF   +S    YVESATSL+GA+RTRNI+PVT+YRGD EL++ +KIKVW
Sbjct  181   DVVEENDFLLSVFPNNSSK--VYVESATSLLGALRTRNISPVTIYRGDLELNSDIKIKVW  238

Query  824   VYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGP  1003
             VYKKTSEE+FP+LK YSDKAPPTDKFA HEI   YEYK   D ++ VPPEQRIKGYRYGP
Sbjct  239   VYKKTSEEKFPSLKKYSDKAPPTDKFATHEIKVDYEYKSTGDSSRVVPPEQRIKGYRYGP  298

Query  1004  QVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSAL  1183
             QV+PISSAEW+AVKFKPEKGVKLLGFTDASNIMRHYYMKD N+FIADP N+KAILAVSAL
Sbjct  299   QVIPISSAEWDAVKFKPEKGVKLLGFTDASNIMRHYYMKDVNIFIADPGNTKAILAVSAL  358

Query  1184  ARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFP  1363
             ARAMK+MN+VAIVRCVWRQGQ NV +GVLTPNVS+K + PDS YFN LPFAEDVREFQFP
Sbjct  359   ARAMKEMNKVAIVRCVWRQGQANVVVGVLTPNVSEKASTPDSFYFNVLPFAEDVREFQFP  418

Query  1364  SFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKH  1543
             S S LPSSM PNE+QQEAAD  V+MLDLAP+  +E L P  TPNPVL+RYY  LE+KSK 
Sbjct  419   SLSKLPSSMQPNEKQQEAADKFVEMLDLAPTGREEVLQPNLTPNPVLERYYRSLELKSKD  478

Query  1544  HDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGS  1723
              +AAVPPLDE LR+IT+PD ELLS+N+ V++EFRR FE+K+NPK+KKS +R  REKP+GS
Sbjct  479   PNAAVPPLDETLRKITEPDAELLSENRAVIEEFRRFFEVKENPKLKKSSRR--REKPSGS  536

Query  1724  DEEGE------------RASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNK  1867
             +EE E              ++K+K E+IG  NPV DFE MISRRD P+WV+KAIQ MK+K
Sbjct  537   NEEREGIGAVGEAMDAIEYTSKIKVEEIGASNPVHDFEAMISRRDGPQWVSKAIQSMKDK  596

Query  1868  IFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQL  2047
             I  LVENS +GDTYQKAL+CLVALR  CI+EQEPKQFND L +L   C++++L+SF + L
Sbjct  597   ISNLVENSSQGDTYQKALDCLVALRKACILEQEPKQFNDFLLHLLKLCQKRELKSFSEYL  656

Query  2048  ESHGIALITKTEAPDSDVLESEARSFMTE  2134
              SH + LI+K EAP+SD+LE+EAR+ + +
Sbjct  657   ASHEMTLISKNEAPESDILENEARTLIVK  685



>ref|XP_004506489.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X1 [Cicer arietinum]
Length=696

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/683 (69%), Positives = 567/683 (83%), Gaps = 15/683 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VLPE+EK+CS+LV+KKLIY+KYDEVG++LFG  +T NELT
Sbjct  1     MARNKEALLLLLDVGPSMHSVLPEVEKLCSMLVQKKLIYNKYDEVGIVLFGAQDTDNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGY+HV VL++ KVVD D+++AL+QLPRG+ DGDFLDAVIV MDM+IKK+G TNKGK
Sbjct  61    TEVGGYQHVVVLKNTKVVDGDIVEALQQLPRGTTDGDFLDAVIVAMDMLIKKFGETNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA CPIKDPY+GTKE+QV+TIA  M AHGMRM+S+IVR K   DA K I+DEN
Sbjct  121   KRLCLITNAQCPIKDPYKGTKEEQVTTIAQSMTAHGMRMESIIVRGKLTQDANKEIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSKETS++  YVE   SL GA++TRNI PVT++RGD E S KLKIKV VYKKT 
Sbjct  181   DLLLNIFSKETSTRLLYVEDPISLFGALKTRNITPVTVFRGDLEFSPKLKIKVMVYKKTQ  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EERFPTLK YSDKAP TDKFA HE+   YEYK  +DP K VPP+QRIKGYRYGPQ+VPIS
Sbjct  241   EERFPTLKKYSDKAPQTDKFATHEVKVDYEYKSSEDPDKVVPPDQRIKGYRYGPQIVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+AVKFKPEKGVKLLGFTD+SN++RH+YMKD  VFIA+P N+KA+LAVSAL RAMK+
Sbjct  301   SAEWDAVKFKPEKGVKLLGFTDSSNVLRHHYMKDVYVFIAEPGNTKAMLAVSALTRAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQGNV IGVLTPNVSD+GN+PDS YFN LPFAEDVREFQFPSFSN P
Sbjct  361   MNKVAILRCVWRQGQGNVVIGVLTPNVSDRGNIPDSFYFNVLPFAEDVREFQFPSFSNFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  PNEQQ E+A N +KMLDLAP   +E LLP+FTPNPVL R++HYL++KSKH DAAVP
Sbjct  421   ASCQPNEQQLESAANFIKMLDLAPDGKKEVLLPDFTPNPVLARFFHYLDLKSKHPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD  LR+IT+PD +L+ QN+++ D F R FEL+ NP +KK R RL+REK   SDEEG+ 
Sbjct  481   PLDYTLRKITEPDTDLVLQNQSITDSFHRSFELQGNP-LKKPR-RLLREKI--SDEEGKE  536

Query  1742  -----------ASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVEN  1888
                          T +K EKIG++ PVQDFE MISRRDSP+W+ KAI++MKNKIF LVE+
Sbjct  537   NITAQPVANLIEYTSIKVEKIGDLTPVQDFEAMISRRDSPDWILKAIKDMKNKIFDLVED  596

Query  1889  SLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIAL  2068
             S EGD Y KALECLVALR GCI+EQEPKQFND L+++   C+EK L+SFC+ L S G+ L
Sbjct  597   SHEGDNYNKALECLVALRKGCILEQEPKQFNDFLKHVCKFCQEKSLQSFCEYLASKGLTL  656

Query  2069  ITKTEAPDSDVLESEARSFMTES  2137
             I+KTEA DSDV + EARSF+ +S
Sbjct  657   ISKTEAIDSDVTDEEARSFLVKS  679



>ref|XP_004506490.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X2 [Cicer arietinum]
Length=684

 Score =   971 bits (2511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/683 (69%), Positives = 567/683 (83%), Gaps = 15/683 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VLPE+EK+CS+LV+KKLIY+KYDEVG++LFG  +T NELT
Sbjct  1     MARNKEALLLLLDVGPSMHSVLPEVEKLCSMLVQKKLIYNKYDEVGIVLFGAQDTDNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGY+HV VL++ KVVD D+++AL+QLPRG+ DGDFLDAVIV MDM+IKK+G TNKGK
Sbjct  61    TEVGGYQHVVVLKNTKVVDGDIVEALQQLPRGTTDGDFLDAVIVAMDMLIKKFGETNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA CPIKDPY+GTKE+QV+TIA  M AHGMRM+S+IVR K   DA K I+DEN
Sbjct  121   KRLCLITNAQCPIKDPYKGTKEEQVTTIAQSMTAHGMRMESIIVRGKLTQDANKEIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSKETS++  YVE   SL GA++TRNI PVT++RGD E S KLKIKV VYKKT 
Sbjct  181   DLLLNIFSKETSTRLLYVEDPISLFGALKTRNITPVTVFRGDLEFSPKLKIKVMVYKKTQ  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EERFPTLK YSDKAP TDKFA HE+   YEYK  +DP K VPP+QRIKGYRYGPQ+VPIS
Sbjct  241   EERFPTLKKYSDKAPQTDKFATHEVKVDYEYKSSEDPDKVVPPDQRIKGYRYGPQIVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+AVKFKPEKGVKLLGFTD+SN++RH+YMKD  VFIA+P N+KA+LAVSAL RAMK+
Sbjct  301   SAEWDAVKFKPEKGVKLLGFTDSSNVLRHHYMKDVYVFIAEPGNTKAMLAVSALTRAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQGNV IGVLTPNVSD+GN+PDS YFN LPFAEDVREFQFPSFSN P
Sbjct  361   MNKVAILRCVWRQGQGNVVIGVLTPNVSDRGNIPDSFYFNVLPFAEDVREFQFPSFSNFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  PNEQQ E+A N +KMLDLAP   +E LLP+FTPNPVL R++HYL++KSKH DAAVP
Sbjct  421   ASCQPNEQQLESAANFIKMLDLAPDGKKEVLLPDFTPNPVLARFFHYLDLKSKHPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD  LR+IT+PD +L+ QN+++ D F R FEL+ NP +KK R RL+REK   SDEEG+ 
Sbjct  481   PLDYTLRKITEPDTDLVLQNQSITDSFHRSFELQGNP-LKKPR-RLLREKI--SDEEGKE  536

Query  1742  -----------ASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVEN  1888
                          T +K EKIG++ PVQDFE MISRRDSP+W+ KAI++MKNKIF LVE+
Sbjct  537   NITAQPVANLIEYTSIKVEKIGDLTPVQDFEAMISRRDSPDWILKAIKDMKNKIFDLVED  596

Query  1889  SLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIAL  2068
             S EGD Y KALECLVALR GCI+EQEPKQFND L+++   C+EK L+SFC+ L S G+ L
Sbjct  597   SHEGDNYNKALECLVALRKGCILEQEPKQFNDFLKHVCKFCQEKSLQSFCEYLASKGLTL  656

Query  2069  ITKTEAPDSDVLESEARSFMTES  2137
             I+KTEA DSDV + EARSF+ +S
Sbjct  657   ISKTEAIDSDVTDEEARSFLVKS  679



>ref|XP_007218942.1| hypothetical protein PRUPE_ppa002331mg [Prunus persica]
 gb|EMJ20141.1| hypothetical protein PRUPE_ppa002331mg [Prunus persica]
Length=686

 Score =   963 bits (2490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/681 (69%), Positives = 562/681 (83%), Gaps = 9/681 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN++ ++L+IDV PSMH  LPEIEKVCS+L EKKLIYSKYDEV V+LFGT ET NELT
Sbjct  1     MARNKDAMVLLIDVSPSMHKALPEIEKVCSMLAEKKLIYSKYDEVAVVLFGTEETENELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEHV VL++IKVVD  L++ L+QLPRG+ DGDFLDA+IVGMDM+IKKYG T KGK
Sbjct  61    KEVGGYEHVVVLQNIKVVDGQLVETLQQLPRGTRDGDFLDAIIVGMDMLIKKYGETYKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCL+TNA  PIK P EGTKEDQVSTIA  M  HGMRM+S++VR     +A K ++DEN
Sbjct  121   KRLCLLTNAQFPIKYPLEGTKEDQVSTIAEHMNTHGMRMESIVVRGSLTGEANKSVMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL +FSK+T +K  +VES TSL+GA+RTR I+PVT++RGD ELS K+KIKVWVYKKTS
Sbjct  181   DNLLGIFSKKTCAKLVHVESPTSLLGALRTRKISPVTIFRGDLELSPKMKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAPPTDKFA HE+   +EYK V+DP+K VPP+QRIKGYRYGPQV+PIS
Sbjct  241   EEKFPTLKKYSDKAPPTDKFATHEVKVDFEYKSVEDPSKVVPPDQRIKGYRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+AVKFKPEKGVKLLGF+DA NIMRHYYMKD NVFI +P N++AILAVSALARAM+D
Sbjct  301   SAEWDAVKFKPEKGVKLLGFSDAKNIMRHYYMKDVNVFIPEPGNTRAILAVSALARAMQD  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQGNV +GVLTPNVSD  N+PDS YFN LPFAEDVREFQFPSF+N P
Sbjct  361   MNKVAILRCVWRQGQGNVVVGVLTPNVSDNDNIPDSFYFNVLPFAEDVREFQFPSFNNFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  PNEQQQEAAD+ V+M DLAP   +EAL P  TPNPVL+R+Y +LE+KS+H DAAVP
Sbjct  421   ASWQPNEQQQEAADDFVRMFDLAPPGKEEALPPGLTPNPVLERFYRHLELKSRHPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDE----  1729
             PLDE LR IT+PD ELLSQN +V+D FR  FE+K+NPK+KKS +R +R+KPTGS+E    
Sbjct  481   PLDETLRMITEPDKELLSQNGSVLDVFRSRFEVKENPKLKKSSRRFLRDKPTGSNEGHAD  540

Query  1730  -----EGERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL  1894
                       ++ VK EK+G+  PVQDFE MI+RRDSP+WV KAI++MKNKI  LVE+S 
Sbjct  541   ISDEPNSSEYTSAVKVEKVGDATPVQDFEAMINRRDSPQWVGKAIKDMKNKIHDLVEDSY  600

Query  1895  EGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALIT  2074
             EGD Y KALECL+ALR GCI+EQEPKQFND LR L   C+EK L SFC+ L S  + LI+
Sbjct  601   EGDNYPKALECLIALRKGCILEQEPKQFNDFLRTLCIFCQEKALSSFCEFLASKELTLIS  660

Query  2075  KTEAPDSDVLESEARSFMTES  2137
             KTEA DS+V + EA++F+ +S
Sbjct  661   KTEAIDSEVTDDEAKNFLVKS  681



>emb|CBI38852.3| unnamed protein product [Vitis vinifera]
Length=673

 Score =   963 bits (2489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/667 (69%), Positives = 560/667 (84%), Gaps = 13/667 (2%)
 Frame = +2

Query  173   MHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKV  352
             MH  LPE+EK+CS+L++KKLIYSK DEVG++LFGT +T NELT+E+GGYEHV VLR IKV
Sbjct  1     MHTFLPEVEKLCSMLLQKKLIYSKNDEVGIVLFGTEDTNNELTKEVGGYEHVVVLRHIKV  60

Query  353   VDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPY  532
             VD DL++AL+QLPRG+V GDFLDA++VGMDM+IKK+G TNKGKKRLCLIT+A+CPIKDPY
Sbjct  61    VDGDLVEALQQLPRGTVAGDFLDAIVVGMDMLIKKFGSTNKGKKRLCLITSALCPIKDPY  120

Query  533   EGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLSVFSKETSSKAAY  712
             EGTKEDQ+ TIA QM AHGM+++ ++ R +   + +  I+DEND LL +FS +T++K  Y
Sbjct  121   EGTKEDQIGTIAEQMSAHGMKLECIVARGRLSGNVDMRIMDENDLLLKLFSTKTTAKTLY  180

Query  713   VESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPT  892
             VE+ TSL+GA+RTR+IAPVT++RGD ELS K++IKVWVYKKT+EERFPTLK YSD+APPT
Sbjct  181   VETPTSLLGALRTRSIAPVTIFRGDLELSPKMRIKVWVYKKTAEERFPTLKQYSDQAPPT  240

Query  893   DKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKL  1072
             DKFA HE+   +EYK V++ +K VPPEQRIKGYRYGPQV+PISSAEWEAVKFKPEKGVKL
Sbjct  241   DKFATHEVKVDFEYKSVEESSKVVPPEQRIKGYRYGPQVIPISSAEWEAVKFKPEKGVKL  300

Query  1073  LGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             LGFTDASN+MRHYYM D N+FIA+P N+KA+LAVSALARAMK+MN+VAI+RCVWRQGQG+
Sbjct  301   LGFTDASNVMRHYYMHDVNIFIAEPSNTKAMLAVSALARAMKEMNKVAILRCVWRQGQGS  360

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
             V IG+LTPNVSDK ++PDS YFN LP+AEDVREFQFPSFSNLP+S  PNE+QQEAADNLV
Sbjct  361   VVIGILTPNVSDKDDIPDSFYFNVLPYAEDVREFQFPSFSNLPASWQPNEEQQEAADNLV  420

Query  1433  KMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELL  1612
             KMLDLAPS S+E LLP+ TPNPVL+R+Y +LE+KSKH DAAVPPLDE L++IT+PDP+LL
Sbjct  421   KMLDLAPSGSKETLLPDLTPNPVLERFYRHLELKSKHPDAAVPPLDESLKKITEPDPKLL  480

Query  1613  SQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERA-------------STK  1753
             SQNK ++D FRR FELK+NPK+KKS +RL+RE+P+G +EE                 ++ 
Sbjct  481   SQNKPIIDAFRRRFELKENPKLKKSTRRLLRERPSGLNEEASMGDGSDGQAIKSIENTST  540

Query  1754  VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLV  1933
             V  EKIG+  P+QDFE M+S RDSPEWV KAI EMKNKIF LVE+S EGD Y KALE LV
Sbjct  541   VGVEKIGDSTPIQDFEAMMSCRDSPEWVGKAINEMKNKIFDLVEDSYEGDNYLKALEYLV  600

Query  1934  ALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESE  2113
             ALR GC++EQEPKQFND L +LY  C++ +L SFC+ L S  I LI KTEA DS+V E E
Sbjct  601   ALRKGCVLEQEPKQFNDFLHHLYKYCEKHNLNSFCESLASKEIMLINKTEAADSEVTEDE  660

Query  2114  ARSFMTE  2134
             ARS M +
Sbjct  661   ARSLMVK  667



>ref|XP_002511723.1| ku P80 DNA helicase, putative [Ricinus communis]
 gb|EEF50392.1| ku P80 DNA helicase, putative [Ricinus communis]
Length=684

 Score =   962 bits (2486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/678 (68%), Positives = 571/678 (84%), Gaps = 7/678 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNREGLIL++DVGPSMH VLPEIE++CS+L++KKLIYSK DEVG+++FGT ET NELT
Sbjct  1     MARNREGLILLLDVGPSMHNVLPEIERICSMLIQKKLIYSKSDEVGIVVFGTEETVNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYEHV VL+++KVVD DL++AL  LPRG+V GD+LDA++VGMDMMIKKY +TNKGK
Sbjct  61    VEVGGYEHVLVLQNMKVVDGDLVEALHHLPRGTVAGDYLDAIVVGMDMMIKKYQLTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLIT+A  PIK+PYEGTKEDQVSTIA QM AHG+RM++++VR +   D ++ I+DEN
Sbjct  121   KRLCLITDAGNPIKEPYEGTKEDQVSTIALQMAAHGVRMETIVVRGRPSQDIDQRIVDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL +FS++TS+K  YVES TSL+GA+RTRNI+PVT++RGD E+S KLKIKVWVYKKTS
Sbjct  181   DHLLHLFSEKTSAKTVYVESPTSLLGALRTRNISPVTIFRGDLEISPKLKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK  SDKAPPTDK+A HE+   YEYK V+DP K VPP+QRIKGYRYGPQV+PIS
Sbjct  241   EEKFPTLKKRSDKAPPTDKYATHEVKVDYEYKSVEDPNKVVPPDQRIKGYRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAE +AVKFKPEK VKLLGFTDA+NI+RHYYMKD N+FIA+P N +A +AVSALARAMK+
Sbjct  301   SAELDAVKFKPEKSVKLLGFTDAANILRHYYMKDVNIFIAEPGNMRATIAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             M++VAIVRCVWRQGQG+V +GVLTPN+S+K   PDS YFN LPFAEDVREFQFPSFSN P
Sbjct  361   MDKVAIVRCVWRQGQGSVVVGVLTPNLSEKDKTPDSFYFNVLPFAEDVREFQFPSFSNFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  P+EQQQEAADNLV MLDLA    +E LLP+FTPNP+L+R+YH+LE+KSKH DAAVP
Sbjct  421   ASWQPSEQQQEAADNLVMMLDLATPGKEEVLLPDFTPNPILERFYHHLELKSKHPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD  L++IT+PDPELLS NK+V+D F R FE+K+NPK KKS +R +REKP+GSD++ + 
Sbjct  481   PLDRTLKKITEPDPELLSGNKSVIDAFCRSFEVKENPKRKKSTRRFLREKPSGSDDDRDY  540

Query  1742  ASTK----VKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEG  1900
               +     +KS   EKIG+ NPVQDFE M+SRRD+P+WV KAI++MKNKI+ +VEN  EG
Sbjct  541   GDSSIALAIKSGDVEKIGDSNPVQDFEAMLSRRDNPDWVGKAIKDMKNKIYSIVENCYEG  600

Query  1901  DTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKT  2080
             + Y +ALECL ALR GCI+EQEPKQFND L +L+  C+ K L SFC+ L S  + LI+K+
Sbjct  601   NNYPRALECLAALRKGCILEQEPKQFNDFLHDLFRFCQGKKLGSFCEFLASKELTLISKS  660

Query  2081  EAPDSDVLESEARSFMTE  2134
             EA DS+V + EARSF  +
Sbjct  661   EAIDSEVTDDEARSFFVK  678



>ref|XP_002320725.2| Ku80 family protein [Populus trichocarpa]
 gb|EEE99040.2| Ku80 family protein [Populus trichocarpa]
Length=700

 Score =   960 bits (2482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/694 (68%), Positives = 578/694 (83%), Gaps = 23/694 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+EGL+L++DVGP+M+ VLPEI+KVCS+L++KKLIY K+DEVGV++FGT ET NELT
Sbjct  1     MARNKEGLVLLLDVGPTMYSVLPEIKKVCSMLIQKKLIYGKFDEVGVVVFGTQETDNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDF------------------LDAV  427
             +E+GGYEHV VLR+IKVVD DL+ A ++LPRG+ DGD                   LDA+
Sbjct  61    KEVGGYEHVVVLRNIKVVDGDLVDAFQELPRGNFDGDCIHWIFLYYLFWKFMLCADLDAI  120

Query  428   IVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSV  607
             +VGMDM+IKKY  TNKGKKRLCLITNA+CPIKD  EGTKEDQV+TIAAQM AHGM+M+SV
Sbjct  121   VVGMDMLIKKYQATNKGKKRLCLITNALCPIKDSCEGTKEDQVNTIAAQMSAHGMKMESV  180

Query  608   IVRMKQDLDAEKGIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGD  787
             IVR +     ++ I+ END LL++FS++TS++A YVES T+L+GA++TRNI+PVT++RGD
Sbjct  181   IVRGRLCGGGDQRIMAENDRLLNLFSEKTSARAVYVESPTALLGAVKTRNISPVTIFRGD  240

Query  788   FELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVP  967
              EL +K+KIKVWVYKKTSEE+FPTLK YSDKAPPTD+FA HE+   YEYK V+DP K VP
Sbjct  241   LELGSKMKIKVWVYKKTSEEKFPTLKKYSDKAPPTDRFATHEVKVDYEYKSVEDPNKVVP  300

Query  968   PEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADP  1147
             PEQRIKGYRYGPQVVPISSAEW+AVKFKPEK VKLLGFTDASNIMRHYYMKD NVFI +P
Sbjct  301   PEQRIKGYRYGPQVVPISSAEWDAVKFKPEKSVKLLGFTDASNIMRHYYMKDVNVFIPEP  360

Query  1148  ENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNAL  1327
              N++A LAVSALARAMK+MN+VAI+RCVWRQGQG+V +GVLTPN+S+K + PDS YFN L
Sbjct  361   GNARAALAVSALARAMKEMNKVAILRCVWRQGQGSVVVGVLTPNISEKDSTPDSFYFNVL  420

Query  1328  PFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQ  1507
             PFAEDVREFQFPSFS+ P+S  PNEQQQEAADNLVKMLDLAPS  QEALLP+FTPNPVL+
Sbjct  421   PFAEDVREFQFPSFSSFPASWQPNEQQQEAADNLVKMLDLAPSTKQEALLPDFTPNPVLE  480

Query  1508  RYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKS  1687
             R+Y +LE+KSKH DAAVPPLDE L+ IT+ DP+LLS+ K V+D F + FELK+NP++KKS
Sbjct  481   RFYRHLELKSKHPDAAVPPLDETLKTITEADPDLLSEKKNVMDAFYKSFELKENPRLKKS  540

Query  1688  RKRLIREKPTGSDEEGERASTK-----VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQ  1852
              KRL+ +KP+GSDE+ +  +       VK EKIG+ +PVQDFE M+S RDSP+WV+KAIQ
Sbjct  541   SKRLLEKKPSGSDEDYQDTTNALVVKPVKVEKIGDSSPVQDFEAMMSCRDSPDWVSKAIQ  600

Query  1853  EMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRS  2032
             +MKNKI+ LVENS +GD + KA+ECL+ALR GCI+EQEPKQFND L +L+   +EK  R+
Sbjct  601   DMKNKIYSLVENSYDGDNHGKAMECLLALRKGCILEQEPKQFNDFLHHLFNVRQEKKFRN  660

Query  2033  FCKQLESHGIALITKTEAPDSDVLESEARSFMTE  2134
             FC+ L   G+ LI+K+EA DS+V + EAR+F+ +
Sbjct  661   FCESLIPKGLTLISKSEAIDSEVTDDEARNFLVK  694



>ref|XP_010056303.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X1 [Eucalyptus grandis]
 gb|KCW72968.1| hypothetical protein EUGRSUZ_E01418 [Eucalyptus grandis]
Length=687

 Score =   959 bits (2479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/683 (68%), Positives = 569/683 (83%), Gaps = 12/683 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH +LPE+EK+CS++V+KKL+YSKYDEVGV+LFGT ET NELT
Sbjct  1     MARNKEALVLLLDVGPSMHHLLPEVEKICSMIVQKKLVYSKYDEVGVVLFGTEETENELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYEHV VL++IKVVD DL++ L+Q+PRG+V GDFLDA++VGMDM+IKKY  TNKGK
Sbjct  61    MEVGGYEHVVVLQNIKVVDGDLVETLKQIPRGTVPGDFLDAIVVGMDMLIKKYSSTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCL+TN + PIKDPYEG+KEDQV+ IA QM +HGM+++ V+VR          +++EN
Sbjct  121   KRLCLMTNGLSPIKDPYEGSKEDQVNAIAEQMTSHGMKLECVVVRESVVRGENVSVMEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D +L++F +++ +K  +VES+TSL+GA++TRNI+PVT++RGD E+S KLKIKVWVYKKTS
Sbjct  181   DRILNLFPQKSCAKTIFVESSTSLLGALKTRNISPVTIFRGDLEISPKLKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP TDKFA HE+   YEYK V+D  K VPPEQRIKGYRYGPQVVPIS
Sbjct  241   EEKFPTLKKYSDKAPSTDKFASHEVKVDYEYKSVEDANKVVPPEQRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             + EW+AVKFKPEK VKLLGFTD+SNIMRH+YMKD N+FIADP +  AI+AVSALARAMK+
Sbjct  301   ADEWDAVKFKPEKSVKLLGFTDSSNIMRHHYMKDVNIFIADPGDQNAIVAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             M++VAI+RCVWRQGQGNV +GVLTPNVSD  +VPDS YFN LPFAEDVREFQFPSFSNLP
Sbjct  361   MHKVAILRCVWRQGQGNVVVGVLTPNVSDNDHVPDSFYFNILPFAEDVREFQFPSFSNLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S+LP+E+QQEAADN VKMLDL PSD +E L P+FTPNPVL+R+Y+YLE+KSKH DAAVP
Sbjct  421   ASLLPDEEQQEAADNFVKMLDLTPSDRKEMLQPDFTPNPVLERFYNYLELKSKHPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGE-  1738
             PLD+ L+RIT+PDPELL+Q K+ +D   R FE+K+ PK+KKS +R+ REKP+GSD+E   
Sbjct  481   PLDKTLKRITEPDPELLAQKKSAIDSLLRHFEVKEKPKLKKSTRRM-REKPSGSDDEDNY  539

Query  1739  -RASTKV---------KSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVEN  1888
              R S+K          K EKIG++ PVQDFE M+SRRD+PEWVN+AI EMKNKI  L+E+
Sbjct  540   RRISSKTEVELIENGGKVEKIGDLTPVQDFEAMMSRRDNPEWVNRAITEMKNKIHDLIED  599

Query  1889  SLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIAL  2068
             S EGD Y KAL+ LVALR GCI+EQEPKQFND L  L   C + DLRSFC  L + GI L
Sbjct  600   SYEGDNYAKALDLLVALRKGCILEQEPKQFNDFLHQLCKFCLQNDLRSFCNFLATKGITL  659

Query  2069  ITKTEAPDSDVLESEARSFMTES  2137
             I+KTEA DSDV E EARSF+ +S
Sbjct  660   ISKTEAADSDVTEEEARSFLVKS  682



>ref|XP_008348444.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like [Malus 
domestica]
 ref|XP_008348445.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like [Malus 
domestica]
 ref|XP_008348446.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like [Malus 
domestica]
Length=684

 Score =   951 bits (2459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/675 (69%), Positives = 557/675 (83%), Gaps = 3/675 (0%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN++G++L+IDV PSMH  LPEIEKVCS+LVEKKLIY+KYDEVG +LFGT +T NELT
Sbjct  1     MARNKDGMVLLIDVSPSMHKALPEIEKVCSMLVEKKLIYNKYDEVGAVLFGTEDTENELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGY+HV VL++IKVVD  L++ L+QLPRG+ +GDFLDA+IVG+DM+IKKYG T KGK
Sbjct  61    TEVGGYKHVVVLQNIKVVDGHLVETLQQLPRGTHEGDFLDAIIVGLDMLIKKYGETYKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA  P K P EGTKE+QV+TIA  M  HGMRM+S++VR K   +A+K I+DEN
Sbjct  121   KRLCLITNAQFPTKFPQEGTKEEQVTTIAGHMNKHGMRMESIVVRGKLTGEADKNIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL +FS++T +K  +VES TSL+GA+RTR I+PVT++RGD ELS K+KIKVWVYKKTS
Sbjct  181   DHLLGIFSRKTCAKLVHVESPTSLLGALRTRKISPVTIFRGDLELSPKMKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YS+KAPPTD+FA HE+   +EYK V+DP+K VPP+QRIKGYRYGPQV+PIS
Sbjct  241   EEKFPTLKKYSEKAPPTDRFATHEVKVDFEYKSVEDPSKVVPPDQRIKGYRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+AVKFKPEK VKLLGF+DA NIMRHYYMKD N+FI +P N++AILAVSALARAMKD
Sbjct  301   SAEWDAVKFKPEKSVKLLGFSDAKNIMRHYYMKDVNIFIPEPGNTRAILAVSALARAMKD  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQGNV +GVLTPNVSD  N+PDS YFN LPFAEDVREFQFPSFSN P
Sbjct  361   MNKVAIMRCVWRQGQGNVVVGVLTPNVSDNDNIPDSFYFNVLPFAEDVREFQFPSFSNFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  P+EQQQEAAD LVKMLDLAP   +EALLP  TPNPVL+R+Y +LE+KS+  DA VP
Sbjct  421   ESWQPSEQQQEAADGLVKMLDLAPPGKEEALLPSLTPNPVLERFYRHLELKSRQPDAVVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLDE LR IT+PD EL+SQNK+++D F   FELK+NPK+KKS +R +R+KP+GS E  + 
Sbjct  481   PLDETLRTITEPDKELISQNKSIIDVFHSRFELKENPKLKKSSRRFLRDKPSGSKEGEDH  540

Query  1742  ASTK---VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQ  1912
              S      K EKIG+  PVQDFE MISRRDSP+WV KAI++MKNKI  LVE+S EGD Y 
Sbjct  541   LSITDGPNKVEKIGDTTPVQDFEAMISRRDSPKWVGKAIKDMKNKIHDLVEDSYEGDNYS  600

Query  1913  KALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPD  2092
             KALECL+ALR GCI+EQEPK+FND L NL   C+EK L SFC  L S  + LI K EA D
Sbjct  601   KALECLIALRKGCILEQEPKEFNDFLCNLCKFCEEKALGSFCGFLASKELTLIPKREAID  660

Query  2093  SDVLESEARSFMTES  2137
             S+V + EA+SF+ +S
Sbjct  661   SEVTDDEAKSFLVKS  675



>ref|XP_010056304.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X2 [Eucalyptus grandis]
Length=683

 Score =   950 bits (2455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/678 (68%), Positives = 564/678 (83%), Gaps = 12/678 (2%)
 Frame = +2

Query  137   EGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelgg  316
             E L+L++DVGPSMH +LPE+EK+CS++V+KKL+YSKYDEVGV+LFGT ET NELT E+GG
Sbjct  2     EALVLLLDVGPSMHHLLPEVEKICSMIVQKKLVYSKYDEVGVVLFGTEETENELTMEVGG  61

Query  317   YEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCL  496
             YEHV VL++IKVVD DL++ L+Q+PRG+V GDFLDA++VGMDM+IKKY  TNKGKKRLCL
Sbjct  62    YEHVVVLQNIKVVDGDLVETLKQIPRGTVPGDFLDAIVVGMDMLIKKYSSTNKGKKRLCL  121

Query  497   ITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLS  676
             +TN + PIKDPYEG+KEDQV+ IA QM +HGM+++ V+VR          +++END +L+
Sbjct  122   MTNGLSPIKDPYEGSKEDQVNAIAEQMTSHGMKLECVVVRESVVRGENVSVMEENDRILN  181

Query  677   VFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFP  856
             +F +++ +K  +VES+TSL+GA++TRNI+PVT++RGD E+S KLKIKVWVYKKTSEE+FP
Sbjct  182   LFPQKSCAKTIFVESSTSLLGALKTRNISPVTIFRGDLEISPKLKIKVWVYKKTSEEKFP  241

Query  857   TLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWE  1036
             TLK YSDKAP TDKFA HE+   YEYK V+D  K VPPEQRIKGYRYGPQVVPIS+ EW+
Sbjct  242   TLKKYSDKAPSTDKFASHEVKVDYEYKSVEDANKVVPPEQRIKGYRYGPQVVPISADEWD  301

Query  1037  AVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVA  1216
             AVKFKPEK VKLLGFTD+SNIMRH+YMKD N+FIADP +  AI+AVSALARAMK+M++VA
Sbjct  302   AVKFKPEKSVKLLGFTDSSNIMRHHYMKDVNIFIADPGDQNAIVAVSALARAMKEMHKVA  361

Query  1217  IVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLP  1396
             I+RCVWRQGQGNV +GVLTPNVSD  +VPDS YFN LPFAEDVREFQFPSFSNLP+S+LP
Sbjct  362   ILRCVWRQGQGNVVVGVLTPNVSDNDHVPDSFYFNILPFAEDVREFQFPSFSNLPASLLP  421

Query  1397  NEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEI  1576
             +E+QQEAADN VKMLDL PSD +E L P+FTPNPVL+R+Y+YLE+KSKH DAAVPPLD+ 
Sbjct  422   DEEQQEAADNFVKMLDLTPSDRKEMLQPDFTPNPVLERFYNYLELKSKHPDAAVPPLDKT  481

Query  1577  LRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGE--RAST  1750
             L+RIT+PDPELL+Q K+ +D   R FE+K+ PK+KKS +R+ REKP+GSD+E    R S+
Sbjct  482   LKRITEPDPELLAQKKSAIDSLLRHFEVKEKPKLKKSTRRM-REKPSGSDDEDNYRRISS  540

Query  1751  KV---------KSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGD  1903
             K          K EKIG++ PVQDFE M+SRRD+PEWVN+AI EMKNKI  L+E+S EGD
Sbjct  541   KTEVELIENGGKVEKIGDLTPVQDFEAMMSRRDNPEWVNRAITEMKNKIHDLIEDSYEGD  600

Query  1904  TYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTE  2083
              Y KAL+ LVALR GCI+EQEPKQFND L  L   C + DLRSFC  L + GI LI+KTE
Sbjct  601   NYAKALDLLVALRKGCILEQEPKQFNDFLHQLCKFCLQNDLRSFCNFLATKGITLISKTE  660

Query  2084  APDSDVLESEARSFMTES  2137
             A DSDV E EARSF+ +S
Sbjct  661   AADSDVTEEEARSFLVKS  678



>ref|XP_010106185.1| hypothetical protein L484_009609 [Morus notabilis]
 gb|EXC08466.1| hypothetical protein L484_009609 [Morus notabilis]
Length=685

 Score =   949 bits (2452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/686 (68%), Positives = 558/686 (81%), Gaps = 20/686 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L+IDVGPSMH VLPEIE+VCS L+EKKLIYSKYDEVGVILFGT +T NELT
Sbjct  1     MARNKEALLLLIDVGPSMHNVLPEIERVCSTLIEKKLIYSKYDEVGVILFGTQDTKNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEHV VLR+I VVD ++L+ L+ LPRG+  GDFLDA+IVGMDM+IKKYG TN GK
Sbjct  61    KEVGGYEHVMVLRNIGVVDGNVLEVLQPLPRGTFPGDFLDAIIVGMDMLIKKYGPTNMGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA CP KDPYEGTKEDQV+ IA QM A  M+M+S++VR +   +A + I+DEN
Sbjct  121   KRLCLITNAQCPTKDPYEGTKEDQVTIIADQMTAQAMKMESIVVRGRIGAEANEKIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSK T +K  +VES  SL+GA++TRNI PVT++RGD E+S K+KIK+WVYKKT+
Sbjct  181   DRLLNIFSKRTRAKLVHVESPISLLGALKTRNINPVTIFRGDLEVSPKMKIKIWVYKKTT  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+ PTLK YSD+APPTDKFA HE+   Y+YK V+DP K VPPEQRIKGYRYGPQVVPIS
Sbjct  241   EEKIPTLKKYSDRAPPTDKFATHEVKVDYQYKRVEDPNKFVPPEQRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+AVKFKPEK VKLLGFTDA NIMRHYYMKD N+FI +P N++AILAVSALARAMK+
Sbjct  301   SAEWDAVKFKPEKSVKLLGFTDAENIMRHYYMKDVNIFIPEPGNTRAILAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
              N+VAIVRCVWRQGQG+V +GVLTPN+S + N+PDS YFN LPFAEDVREFQFPSFSN P
Sbjct  361   ANKVAIVRCVWRQGQGSVVVGVLTPNISGRENIPDSFYFNVLPFAEDVREFQFPSFSNFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S LP EQQQEAADN V+M DLAP   +EAL P+ TPNPVL+R+Y  LE+K  + DAAVP
Sbjct  421   DSWLPTEQQQEAADNFVRMFDLAPPGKEEALPPDLTPNPVLERFYRCLEVKWNNPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGS------  1723
             PLDE LR+IT+ DPELLS N++V+DEFRR FELK+N       K+L+REKP+GS      
Sbjct  481   PLDETLRKITESDPELLSHNESVLDEFRRAFELKEN------FKQLLREKPSGSNGGEDC  534

Query  1724  --------DEEGERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYL  1879
                     + +   A++ +K EK+G+I P+QDFE MISRRD P WV+KAI EMKNKIFYL
Sbjct  535   AMIHVQSANRDTNEATSSIKIEKVGDITPIQDFEAMISRRDGPNWVDKAITEMKNKIFYL  594

Query  1880  VENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHG  2059
             VE+S +GD Y KA ECLVA+R  CI+EQEPKQFND LR+L   CKEK+LRSF + L +  
Sbjct  595   VEDSYDGDNYPKAAECLVAIRKACILEQEPKQFNDFLRHLCKFCKEKNLRSFNEFLAAKE  654

Query  2060  IALITKTEAPDSDVLESEARSFMTES  2137
             + LI+K+EAPDS+V E EARSF+ +S
Sbjct  655   LTLISKSEAPDSEVTEDEARSFVVKS  680



>ref|XP_004513141.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like [Cicer 
arietinum]
Length=684

 Score =   945 bits (2443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/683 (68%), Positives = 559/683 (82%), Gaps = 15/683 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VLPE+EK+CS+LV+KKLIY+KYDEVG++LFG  +T NELT
Sbjct  1     MARNKEALLLLLDVGPSMHSVLPEVEKLCSMLVQKKLIYNKYDEVGIVLFGAQDTDNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGY+HV VL++ KVVD D+++AL+QLPRG+ DGDFLDAVIV MDM+IKK+G TNKGK
Sbjct  61    TEVGGYQHVVVLKNTKVVDGDIVEALQQLPRGTTDGDFLDAVIVAMDMLIKKFGETNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA CPIKDPY+GTKE+QV+TIA  M AHGMRM+S+IVR K   DA K I++EN
Sbjct  121   KRLCLITNAQCPIKDPYKGTKEEQVTTIAKSMTAHGMRMESIIVRGKLSQDANKEIMEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSKETS++  YVE   SL GA++TRNI PVT++RGD E S KLKIKV VYKKT 
Sbjct  181   DLLLNIFSKETSTRLLYVEDPISLFGALKTRNITPVTVFRGDLEFSPKLKIKVMVYKKTQ  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EERFPTLK YSDKAP TDKFA HE+   YEYK  +D  K VPP+QRIKGYRYGPQ++PIS
Sbjct  241   EERFPTLKKYSDKAPQTDKFATHEVKVDYEYKSSEDLDKVVPPDQRIKGYRYGPQIIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGFTD+SN++RH+YMKD  VFIA+P N+KA+LAVSAL RAMK+
Sbjct  301   SAEWEAVKFKPEKGVKLLGFTDSSNVLRHHYMKDVYVFIAEPGNTKAVLAVSALTRAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQGNV IGVLTPNVSD+ N+PDS YFN LPFAEDVREFQFPSFSN P
Sbjct  361   MNKVAILRCVWRQGQGNVVIGVLTPNVSDRRNIPDSFYFNVLPFAEDVREFQFPSFSNFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  PNEQQ E+A N +KMLDLAP   +E L+P+FT NPVL R++HYL++KS H DAAVP
Sbjct  421   ASCQPNEQQLESAANFIKMLDLAPDGKKEILIPDFTSNPVLARFFHYLDLKSNHPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD  LR+IT+PD +L+ +N+++ D FRR FEL+ NP +K+ R  L REK   SDEEG+ 
Sbjct  481   PLDYTLRKITEPDTDLVLRNQSITDLFRRSFELQGNP-LKRPRHSL-REKI--SDEEGKE  536

Query  1742  -----------ASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVEN  1888
                          T +K EKIG++ PVQDFE MISRRDSP+W+  AI++MKNKIF LVE+
Sbjct  537   NITAQPVANLIEYTSIKVEKIGDLTPVQDFEAMISRRDSPDWILTAIKDMKNKIFDLVED  596

Query  1889  SLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIAL  2068
             S EGD Y KALECLVALR GCI+EQEPK FND L+ +   C+EK+L+SFC+ L S G+ L
Sbjct  597   SHEGDNYNKALECLVALRKGCILEQEPKLFNDFLKYVCKFCQEKNLQSFCEYLASKGLTL  656

Query  2069  ITKTEAPDSDVLESEARSFMTES  2137
             I+KTEA DSDV + EARSF  +S
Sbjct  657   ISKTEAIDSDVTDEEARSFSVKS  679



>ref|XP_008232669.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent DNA helicase 2 
subunit KU80 [Prunus mume]
Length=686

 Score =   944 bits (2440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/681 (68%), Positives = 556/681 (82%), Gaps = 9/681 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN++ ++L+IDV PSMH  LPEIEKVCS+L EKKLIYSKYDEV V+LFGT ET NELT
Sbjct  1     MARNKDAMVLLIDVSPSMHKALPEIEKVCSMLAEKKLIYSKYDEVAVVLFGTEETENELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEHV VL++IKVVD  L++ L+QLPRG+ DGDFLDA+IVGMDM+IKKYG T KGK
Sbjct  61    KEVGGYEHVVVLQNIKVVDGQLVETLQQLPRGTRDGDFLDAIIVGMDMLIKKYGETYKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCL+TNA  PIK P EGTKEDQVSTIA  M  HGMRM+S++VR     +A K ++DEN
Sbjct  121   KRLCLLTNAQFPIKYPLEGTKEDQVSTIAEHMNTHGMRMESIVVRGSLTGEANKSVMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL +FSK+T +K  +VES TSL+GA+RTR I+PVT++RGD ELS K+KIKV    K S
Sbjct  181   DNLLGIFSKKTCAKLVHVESPTSLLGALRTRKISPVTIFRGDLELSPKMKIKVXXXXKAS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             E +FP LK YSDKAPPTDKFA HE+   +EYK V+DP K VPP+QRIKGYRYGPQV+PIS
Sbjct  241   EXKFPALKKYSDKAPPTDKFATHEVKVDFEYKSVEDPNKVVPPDQRIKGYRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+AVKFKPEK VKLLGF+DA NIMRHYYMKD NVFI +P N++AILAVSALARAM+D
Sbjct  301   SAEWDAVKFKPEKSVKLLGFSDAKNIMRHYYMKDVNVFIPEPGNTRAILAVSALARAMQD  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQGNV +GVLTPNVSD  N+PDS YFN LPFAEDVREFQFPSF+N P
Sbjct  361   MNKVAILRCVWRQGQGNVVVGVLTPNVSDNDNIPDSFYFNVLPFAEDVREFQFPSFNNFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  PNEQQQEAAD+ V+M DLAP   +EAL P+ TPNPVL+R+Y +LE++S+H DAAVP
Sbjct  421   ASWQPNEQQQEAADDFVRMFDLAPPGKEEALQPDLTPNPVLERFYRHLELRSRHPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDE----  1729
             PLDE LR IT+PD ELLSQN++V+D FR  FE+K+NPK+KKS +R +R+KP+GS+E    
Sbjct  481   PLDETLRMITEPDKELLSQNRSVLDVFRSRFEVKENPKLKKSSRRFLRDKPSGSNEGHAD  540

Query  1730  -----EGERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL  1894
                  +    ++ VK EK+G+  PVQDFE MI+RRDSP+WV KAI++MKNKI  LVE+S 
Sbjct  541   ISDEPKSSGYTSAVKVEKVGDATPVQDFEAMINRRDSPQWVGKAIKDMKNKIHDLVEDSY  600

Query  1895  EGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALIT  2074
             EGD Y KALECL+ALR GCI+EQEPKQFND LR L   C+EK L SFC+ L S  + LI+
Sbjct  601   EGDNYPKALECLIALRKGCILEQEPKQFNDFLRTLCIFCQEKALSSFCEFLASKELTLIS  660

Query  2075  KTEAPDSDVLESEARSFMTES  2137
             KTEA DS+V + EAR+F+ +S
Sbjct  661   KTEAIDSEVTDDEARNFLVKS  681



>ref|XP_010277368.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 [Nelumbo 
nucifera]
Length=689

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/685 (67%), Positives = 563/685 (82%), Gaps = 14/685 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L+IDV PSMH +L E+E+VCS+L+EKKLIYSK DEVGVILFGT ET N+LT
Sbjct  1     MARNKEALLLLIDVSPSMHNLLTEVERVCSMLIEKKLIYSKSDEVGVILFGTDETNNDLT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEH+ VL+ IKVVD+D ++ L++LPRG+  GDFLDA++VGMDM+IKK+G TNKGK
Sbjct  61    KEVGGYEHIVVLQQIKVVDEDTIETLQKLPRGTSPGDFLDAIVVGMDMLIKKFGPTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCL+T+A   IK+PYEGTKEDQ+  I+AQM A+GM+++ +IVR K   DA + I+DEN
Sbjct  121   KRLCLLTSAQYRIKEPYEGTKEDQIDMISAQMNANGMKLECIIVRGKLTGDANRRIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL+ FSK++ +K  YVES TSL+GAIRTRNI+PVT++RGD ELS ++KIKVWVYKKTS
Sbjct  181   DLLLNRFSKKSCAKTIYVESPTSLLGAIRTRNISPVTIFRGDLELSPRMKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EERFP LK YSDKAPPTD+FA HE+   YEY+ V DP+K VPPEQRIKGYRYGPQV+PIS
Sbjct  241   EERFPRLKKYSDKAPPTDRFATHEVKVDYEYRRVDDPSKVVPPEQRIKGYRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+AVKFKPE+ VKLLGFTD+SNI+RHYYM+D N+FIA+P N++AILAVSALARAM+D
Sbjct  301   SAEWDAVKFKPERSVKLLGFTDSSNILRHYYMRDVNIFIAEPGNTRAILAVSALARAMQD  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWR GQGNV +GVLTPNVS + N+PDS YFN LPFAED+REFQFPSF  LP
Sbjct  361   MNKVAILRCVWRHGQGNVVVGVLTPNVSHRDNIPDSFYFNVLPFAEDIREFQFPSFKYLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  PN QQQ+AAD+LVKMLDL  S  +E L P+ TPNP+L+R+Y +LE+KSK  DA VP
Sbjct  421   SSCQPNAQQQKAADSLVKMLDLG-SPGKEVLQPDLTPNPILERFYCFLELKSKQPDATVP  479

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDE----  1729
              LD  L+ IT+PDPELLSQNK+ +DEF + FEL +N K+KKS +RL REKP+GS+E    
Sbjct  480   LLDNTLKLITEPDPELLSQNKSFIDEFSKQFELMENIKIKKSSRRLWREKPSGSNEGEGA  539

Query  1730  ---------EGERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLV  1882
                      E  +  + VK +KIG++ PVQDFE M+SRRDS EWVNKAI++MKN IF LV
Sbjct  540   GDVSDAQAVESTKNESAVKVDKIGDLTPVQDFEAMMSRRDSTEWVNKAIKDMKNIIFDLV  599

Query  1883  ENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGI  2062
             ENS EGDTYQKA+ECL+A R GCI+EQEPKQFND LR+L   C++KDL SFC+ L S  I
Sbjct  600   ENSYEGDTYQKAVECLIAFRKGCILEQEPKQFNDFLRHLCKFCRKKDLSSFCEFLTSKQI  659

Query  2063  ALITKTEAPDSDVLESEARSFMTES  2137
              LITKTEA DSD  E EARSF+ +S
Sbjct  660   TLITKTEAVDSDATEEEARSFLVKS  684



>gb|KDP28751.1| hypothetical protein JCGZ_14522 [Jatropha curcas]
Length=685

 Score =   939 bits (2428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/680 (66%), Positives = 565/680 (83%), Gaps = 9/680 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNREGL+L++DVGPSMH VLPE+E++CS+L++KKLIYSK DEVGV++FGT +T NELT
Sbjct  1     MARNREGLVLLLDVGPSMHSVLPEVERICSMLIQKKLIYSKSDEVGVVVFGTEDTDNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYE+V VLR IKVVD DL++AL+QLP+G+V GD+LDA++VGMDM+IKKY +TNKGK
Sbjct  61    TEVGGYENVVVLRKIKVVDGDLVEALQQLPQGTVPGDYLDAIVVGMDMLIKKYQLTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLIT+A  P KDP EGTK DQV  IA QM AHG++M++++VR + +   ++ I++EN
Sbjct  121   KRLCLITDARNPTKDPCEGTKADQVRVIAEQMAAHGVKMETIVVRERLNEYTDQRIVEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL +FS++T +K  +VES TS +GA++TR I PVT++RGD E+S++LKIKVWVYKKTS
Sbjct  181   DHLLHLFSEKTRAKTVHVESPTSFLGALKTRKITPVTIFRGDLEISSELKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTL+ YSDKAPPTDK+A HE+   YEYK + DP+K VPPEQRIKGYRYGPQV+PIS
Sbjct  241   EEKFPTLEKYSDKAPPTDKYATHEVKVDYEYKSIDDPSKVVPPEQRIKGYRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+A KFKPEKGVKLLGFTDASNI+RHYYMKD N+FIA+P N +A +AVSALARAMK+
Sbjct  301   SAEWDAFKFKPEKGVKLLGFTDASNILRHYYMKDVNIFIAEPGNLRATIAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             M++VAIVRCVWRQGQG V +GVLTPN+SDK N PDS YFN LPFAEDVREFQF SFSN P
Sbjct  361   MDKVAIVRCVWRQGQGTVVVGVLTPNLSDKENTPDSFYFNVLPFAEDVREFQFASFSNFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  P++QQQEAADNLV MLDLA    +EALLP+FTPNP+L+R+YH+LE+KSK+ DAAVP
Sbjct  421   ASWQPSKQQQEAADNLVMMLDLAQPGREEALLPDFTPNPILERFYHHLELKSKNPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD  L++IT+PDP+LLS+NK+ +D F + FE+K+NPK+KKS +R +REKP+GSD+E + 
Sbjct  481   PLDRTLKKITEPDPQLLSENKSFIDAFCKSFEVKENPKLKKSTRRFLREKPSGSDDERDY  540

Query  1742  A---------STKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL  1894
                       S + + EKIG+  PVQDFE M+SRRDSP+WV KAI+ +KNKI+ LV+N  
Sbjct  541   VNASDALAVKSAESQVEKIGDSTPVQDFEAMMSRRDSPDWVVKAIEGIKNKIYSLVQNHC  600

Query  1895  EGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALIT  2074
               D Y KALECL ALR GCI+EQEPKQFND LR+L   C+EK L SFC+ L S+ + LI+
Sbjct  601   GVDNYPKALECLAALRKGCIIEQEPKQFNDFLRHLIRFCQEKKLGSFCEFLMSNELTLIS  660

Query  2075  KTEAPDSDVLESEARSFMTE  2134
             K+EA DSDV + EARSF+ +
Sbjct  661   KSEAEDSDVTDGEARSFLVK  680



>ref|XP_008438156.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 [Cucumis 
melo]
Length=691

 Score =   938 bits (2424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/680 (67%), Positives = 567/680 (83%), Gaps = 12/680 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNRE L+LV+DVGPSMH +LPE+EKVCS+LVEKKL+Y+KYDEVG++LFGT +T NELT
Sbjct  1     MARNREILVLVLDVGPSMHSILPEVEKVCSMLVEKKLLYNKYDEVGIVLFGTEDTKNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             EE+GGY+HV VL+++KVVD DL+  L+Q+PRG+V GDFLDA+I+GMDM+IKK+G T +GK
Sbjct  61    EEVGGYQHVVVLQNMKVVDGDLVDVLKQIPRGTVSGDFLDAIIIGMDMLIKKFGETERGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCL+T+A+ PIK+PYEGTKEDQV+TIA QM  HG++MDSV+VR +   DA +  ++EN
Sbjct  121   KRLCLVTDALFPIKEPYEGTKEDQVTTIAQQMTKHGIKMDSVVVRGRFGQDANEKTMNEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FS++T++K  YVES TSL+GAIRTR+IAPVT++RGD E+S+ +KIKVWVYKKTS
Sbjct  181   DLLLNIFSQKTNAKMVYVESPTSLLGAIRTRSIAPVTIFRGDLEISSVIKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP TDKFA HE+   YEYK  ++P+K VPPE RIKGYRYGPQVVPIS
Sbjct  241   EEKFPTLKRYSDKAPLTDKFATHEVKVDYEYKSAEEPSKVVPPEHRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             +AEW+AVKFK EK VKLLGFT+ASNIMRHYYMKD NVFIA+P N ++I+AVSALARAMK+
Sbjct  301   TAEWDAVKFKTEKSVKLLGFTNASNIMRHYYMKDVNVFIAEPGNKRSIVAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             M++VAIVRCVWRQGQG+V +GVLTPN+S+K  + DSL+FN LPFAEDVREFQFPSFSNLP
Sbjct  361   MDKVAIVRCVWRQGQGSVVVGVLTPNISEKDGIADSLFFNVLPFAEDVREFQFPSFSNLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             + M P+E+QQEAAD+ VKMLDLAP   +E L P+FTPNPVL+R+Y +LE+KSK  DAAVP
Sbjct  421   AFMQPSEEQQEAADDFVKMLDLAPDGREEILQPDFTPNPVLERFYRHLELKSKDPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSD--EEG  1735
             PLD  L++IT+PDP+L SQNK V++ F R FELK+NPK+KKSR+  +REK +GS   E+ 
Sbjct  481   PLDGTLQKITEPDPDLFSQNKAVINTFHRRFELKENPKLKKSRRHYLREKASGSSDKEDN  540

Query  1736  ERASTK----------VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVE  1885
             E  S +          VK EK+G+  P++DFE M+SRRDSPEW++KAI  MK+KIF L+E
Sbjct  541   EEISAQIVESVANMPIVKVEKVGDSTPLEDFEAMMSRRDSPEWISKAINGMKSKIFDLIE  600

Query  1886  NSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIA  2065
             NS +GD+Y KA+E L ALR GCI+EQEPKQFND LR+L   C EK+L +FC+ L S  I+
Sbjct  601   NSSDGDSYTKAIEYLRALRKGCIIEQEPKQFNDFLRHLRNFCPEKNLHTFCEFLASQQIS  660

Query  2066  LITKTEAPDSDVLESEARSF  2125
             LI+K EA DS+V + EAR F
Sbjct  661   LISKEEAADSEVADDEARRF  680



>ref|XP_010661637.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X3 [Vitis vinifera]
Length=659

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/653 (69%), Positives = 545/653 (83%), Gaps = 13/653 (2%)
 Frame = +2

Query  215   LVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPR  394
             +   KLIYSK DEVG++LFGT +T NELT+E+GGYEHV VLR IKVVD DL++AL+QLPR
Sbjct  1     MARNKLIYSKNDEVGIVLFGTEDTNNELTKEVGGYEHVVVLRHIKVVDGDLVEALQQLPR  60

Query  395   GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQ  574
             G+V GDFLDA++VGMDM+IKK+G TNKGKKRLCLIT+A+CPIKDPYEGTKEDQ+ TIA Q
Sbjct  61    GTVAGDFLDAIVVGMDMLIKKFGSTNKGKKRLCLITSALCPIKDPYEGTKEDQIGTIAEQ  120

Query  575   MKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTR  754
             M AHGM+++ ++ R +   + +  I+DEND LL +FS +T++K  YVE+ TSL+GA+RTR
Sbjct  121   MSAHGMKLECIVARGRLSGNVDMRIMDENDLLLKLFSTKTTAKTLYVETPTSLLGALRTR  180

Query  755   NIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEY  934
             +IAPVT++RGD ELS K++IKVWVYKKT+EERFPTLK YSD+APPTDKFA HE+   +EY
Sbjct  181   SIAPVTIFRGDLELSPKMRIKVWVYKKTAEERFPTLKQYSDQAPPTDKFATHEVKVDFEY  240

Query  935   KVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYY  1114
             K V++ +K VPPEQRIKGYRYGPQV+PISSAEWEAVKFKPEKGVKLLGFTDASN+MRHYY
Sbjct  241   KSVEESSKVVPPEQRIKGYRYGPQVIPISSAEWEAVKFKPEKGVKLLGFTDASNVMRHYY  300

Query  1115  MKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKG  1294
             M D N+FIA+P N+KA+LAVSALARAMK+MN+VAI+RCVWRQGQG+V IG+LTPNVSDK 
Sbjct  301   MHDVNIFIAEPSNTKAMLAVSALARAMKEMNKVAILRCVWRQGQGSVVIGILTPNVSDKD  360

Query  1295  NVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEAL  1474
             ++PDS YFN LP+AEDVREFQFPSFSNLP+S  PNE+QQEAADNLVKMLDLAPS S+E L
Sbjct  361   DIPDSFYFNVLPYAEDVREFQFPSFSNLPASWQPNEEQQEAADNLVKMLDLAPSGSKETL  420

Query  1475  LPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCF  1654
             LP+ TPNPVL+R+Y +LE+KSKH DAAVPPLDE L++IT+PDP+LLSQNK ++D FRR F
Sbjct  421   LPDLTPNPVLERFYRHLELKSKHPDAAVPPLDESLKKITEPDPKLLSQNKPIIDAFRRRF  480

Query  1655  ELKDNPKMKKSRKRLIREKPTGSDEEGERA-------------STKVKSEKIGNINPVQD  1795
             ELK+NPK+KKS +RL+RE+P+G +EE                 ++ V  EKIG+  P+QD
Sbjct  481   ELKENPKLKKSTRRLLRERPSGLNEEASMGDGSDGQAIKSIENTSTVGVEKIGDSTPIQD  540

Query  1796  FEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQ  1975
             FE M+S RDSPEWV KAI EMKNKIF LVE+S EGD Y KALE LVALR GC++EQEPKQ
Sbjct  541   FEAMMSCRDSPEWVGKAINEMKNKIFDLVEDSYEGDNYLKALEYLVALRKGCVLEQEPKQ  600

Query  1976  FNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMTE  2134
             FND L +LY  C++ +L SFC+ L S  I LI KTEA DS+V E EARS M +
Sbjct  601   FNDFLHHLYKYCEKHNLNSFCESLASKEIMLINKTEAADSEVTEDEARSLMVK  653



>ref|XP_003605072.1| ATP-dependent DNA helicase 2 subunit [Medicago truncatula]
 gb|AES87269.1| ATP-dependent DNA helicase 2 subunit Ku80 [Medicago truncatula]
Length=683

 Score =   935 bits (2417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/682 (68%), Positives = 565/682 (83%), Gaps = 14/682 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VLPE+EKVCS+LV+KKLIY+KYDEVG++LFGT +T NELT
Sbjct  1     MARNKEALLLLLDVGPSMHPVLPEVEKVCSMLVQKKLIYNKYDEVGIVLFGTEDTDNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGY+HV V ++ KVVD D+++AL+QLPRG+ DGDFLDAVIV MDM+IKK+G TNKGK
Sbjct  61    TEVGGYQHVVVSKNSKVVDGDIVEALQQLPRGTTDGDFLDAVIVAMDMLIKKFGDTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA CPIKDPYEG+KE+QV+TIA QM AHGM+M+S+IVR K   DA K I+DEN
Sbjct  121   KRLCLITNAQCPIKDPYEGSKEEQVTTIAKQMTAHGMKMESIIVRGKLSQDANKEIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSKET ++  YVE   SL GA++TRNI PVT++RGD ELS KL+IKV VYKKT 
Sbjct  181   DRLLNIFSKETQTRLLYVEDPISLFGALKTRNITPVTVFRGDLELSPKLRIKVMVYKKTQ  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK +SDKAP TDKFA HE+   YEYK   DP K VPP+QRIKGYRYGPQ++PIS
Sbjct  241   EEKFPTLKKFSDKAPQTDKFATHEVKVDYEYKSSADPDKVVPPDQRIKGYRYGPQIIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+AVKFKPEKGVKLLGFTD+SNI+RH YMKD  VFIA+P N+KA+LAVSAL+RAMK+
Sbjct  301   SAEWDAVKFKPEKGVKLLGFTDSSNILRHQYMKDVYVFIAEPGNTKAVLAVSALSRAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQ NV IGVLTPNVSD+ N+PDS YFN LPFAEDVREFQFPSFS+ P
Sbjct  361   MNKVAILRCVWRQGQANVVIGVLTPNVSDRENLPDSFYFNILPFAEDVREFQFPSFSSFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  PNEQQ E+A N +KMLDLAP   QE LLP+FTPNPVL R+YHYL++KSKH DA+VP
Sbjct  421   ASCQPNEQQLESAANFIKMLDLAPDGKQEVLLPDFTPNPVLARFYHYLDLKSKHPDASVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD  LR+IT+P+ +L+ QN++V+D +RR FE++ NP +KK R R +R K   SDEEG+ 
Sbjct  481   PLDYTLRKITEPETDLVLQNQSVIDSYRRSFEMQGNP-LKKPR-RFLRGK--TSDEEGKE  536

Query  1742  ----------ASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENS  1891
                         T +K EKIG++ PVQDFE MISRRDSP+WV KAI++MK+KIF +VE+S
Sbjct  537   NITAPPANLIEYTSIKVEKIGDLTPVQDFEAMISRRDSPDWVVKAIKDMKDKIFDMVEDS  596

Query  1892  LEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALI  2071
              EGD Y KAL+CLVALR GCI+EQEPKQFND L++L   C+EK+L+SFC+ L + G+ LI
Sbjct  597   HEGDNYPKALDCLVALRKGCILEQEPKQFNDFLKHLCNFCQEKNLQSFCEHLAAKGLTLI  656

Query  2072  TKTEAPDSDVLESEARSFMTES  2137
              KTEA DSDV + EARSF+ +S
Sbjct  657   PKTEAIDSDVSDEEARSFLVKS  678



>gb|AAL87543.1|AF293343_1 KAP-2 [Medicago truncatula]
Length=683

 Score =   932 bits (2409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/682 (68%), Positives = 564/682 (83%), Gaps = 14/682 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VLPE+EKVCS+LV+KKLIY+KYDEVG++LFGT +T NELT
Sbjct  1     MARNKEALLLLLDVGPSMHPVLPEVEKVCSMLVQKKLIYNKYDEVGIVLFGTEDTDNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGY+HV V ++ KVVD D+++AL+QLPRG+ DGDFLDAVIV MDM+IKK+G TNKGK
Sbjct  61    TEVGGYQHVVVSKNSKVVDGDIVEALQQLPRGTTDGDFLDAVIVAMDMLIKKFGDTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA CPIKDPYEG+KE+QV+TIA QM AHGM+M+S+IVR K   DA K I+DEN
Sbjct  121   KRLCLITNAQCPIKDPYEGSKEEQVTTIAKQMTAHGMKMESIIVRGKLSQDANKEIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSKET ++  YVE   SL GA++TRNI PVT++RGD ELS KL+IKV VYKKT 
Sbjct  181   DRLLNIFSKETQTRLLYVEDPISLFGALKTRNITPVTVFRGDLELSPKLRIKVMVYKKTQ  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK +SDKAP TDKFA HE+   YEYK   DP   VPP+QRIKGYRYGPQ++PIS
Sbjct  241   EEKFPTLKKFSDKAPQTDKFATHEVKVDYEYKSSADPDIVVPPDQRIKGYRYGPQIIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+AVKFKPEKGVKLLGFTD+SNI+RH YMKD  VFIA+P N+KA+LAVSAL+RAMK+
Sbjct  301   SAEWDAVKFKPEKGVKLLGFTDSSNILRHQYMKDVYVFIAEPGNTKAVLAVSALSRAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQ NV IGVLTPNVSD+ N+PDS YFN LPFAEDVREFQFPSFS+ P
Sbjct  361   MNKVAILRCVWRQGQANVVIGVLTPNVSDRENLPDSFYFNILPFAEDVREFQFPSFSSFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  PNEQQ E+A N +KMLDLAP   QE LLP+FTPNPVL R+YHYL++KSKH DA+VP
Sbjct  421   ASCQPNEQQLESAANFIKMLDLAPDGKQEVLLPDFTPNPVLARFYHYLDLKSKHPDASVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD  LR+IT+P+ +L+ QN++V+D +RR FE++ NP +KK R R +R K   SDEEG+ 
Sbjct  481   PLDYTLRKITEPETDLVLQNQSVIDSYRRSFEMQGNP-LKKPR-RFLRGK--TSDEEGKE  536

Query  1742  ----------ASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENS  1891
                         T +K EKIG++ PVQDFE MISRRDSP+WV KAI++MK+KIF +VE+S
Sbjct  537   NITAPPANLIEYTSIKVEKIGDLTPVQDFEAMISRRDSPDWVVKAIKDMKDKIFDMVEDS  596

Query  1892  LEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALI  2071
              EGD Y KAL+CLVALR GCI+EQEPKQFND L++L   C+EK+L+SFC+ L + G+ LI
Sbjct  597   HEGDNYPKALDCLVALRKGCILEQEPKQFNDFLKHLCNFCQEKNLQSFCEHLAAKGLTLI  656

Query  2072  TKTEAPDSDVLESEARSFMTES  2137
              KTEA DSDV + EARSF+ +S
Sbjct  657   PKTEAIDSDVSDEEARSFLVKS  678



>ref|XP_010056306.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X4 [Eucalyptus grandis]
Length=670

 Score =   930 bits (2404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/666 (68%), Positives = 553/666 (83%), Gaps = 12/666 (2%)
 Frame = +2

Query  173   MHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKV  352
             MH +LPE+EK+CS++V+KKL+YSKYDEVGV+LFGT ET NELT E+GGYEHV VL++IKV
Sbjct  1     MHHLLPEVEKICSMIVQKKLVYSKYDEVGVVLFGTEETENELTMEVGGYEHVVVLQNIKV  60

Query  353   VDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPY  532
             VD DL++ L+Q+PRG+V GDFLDA++VGMDM+IKKY  TNKGKKRLCL+TN + PIKDPY
Sbjct  61    VDGDLVETLKQIPRGTVPGDFLDAIVVGMDMLIKKYSSTNKGKKRLCLMTNGLSPIKDPY  120

Query  533   EGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLSVFSKETSSKAAY  712
             EG+KEDQV+ IA QM +HGM+++ V+VR          +++END +L++F +++ +K  +
Sbjct  121   EGSKEDQVNAIAEQMTSHGMKLECVVVRESVVRGENVSVMEENDRILNLFPQKSCAKTIF  180

Query  713   VESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPT  892
             VES+TSL+GA++TRNI+PVT++RGD E+S KLKIKVWVYKKTSEE+FPTLK YSDKAP T
Sbjct  181   VESSTSLLGALKTRNISPVTIFRGDLEISPKLKIKVWVYKKTSEEKFPTLKKYSDKAPST  240

Query  893   DKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKL  1072
             DKFA HE+   YEYK V+D  K VPPEQRIKGYRYGPQVVPIS+ EW+AVKFKPEK VKL
Sbjct  241   DKFASHEVKVDYEYKSVEDANKVVPPEQRIKGYRYGPQVVPISADEWDAVKFKPEKSVKL  300

Query  1073  LGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             LGFTD+SNIMRH+YMKD N+FIADP +  AI+AVSALARAMK+M++VAI+RCVWRQGQGN
Sbjct  301   LGFTDSSNIMRHHYMKDVNIFIADPGDQNAIVAVSALARAMKEMHKVAILRCVWRQGQGN  360

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
             V +GVLTPNVSD  +VPDS YFN LPFAEDVREFQFPSFSNLP+S+LP+E+QQEAADN V
Sbjct  361   VVVGVLTPNVSDNDHVPDSFYFNILPFAEDVREFQFPSFSNLPASLLPDEEQQEAADNFV  420

Query  1433  KMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELL  1612
             KMLDL PSD +E L P+FTPNPVL+R+Y+YLE+KSKH DAAVPPLD+ L+RIT+PDPELL
Sbjct  421   KMLDLTPSDRKEMLQPDFTPNPVLERFYNYLELKSKHPDAAVPPLDKTLKRITEPDPELL  480

Query  1613  SQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEG--ERASTKV---------K  1759
             +Q K+ +D   R FE+K+ PK+KKS +R+ REKP+GSD+E    R S+K          K
Sbjct  481   AQKKSAIDSLLRHFEVKEKPKLKKSTRRM-REKPSGSDDEDNYRRISSKTEVELIENGGK  539

Query  1760  SEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVAL  1939
              EKIG++ PVQDFE M+SRRD+PEWVN+AI EMKNKI  L+E+S EGD Y KAL+ LVAL
Sbjct  540   VEKIGDLTPVQDFEAMMSRRDNPEWVNRAITEMKNKIHDLIEDSYEGDNYAKALDLLVAL  599

Query  1940  RNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEAR  2119
             R GCI+EQEPKQFND L  L   C + DLRSFC  L + GI LI+KTEA DSDV E EAR
Sbjct  600   RKGCILEQEPKQFNDFLHQLCKFCLQNDLRSFCNFLATKGITLISKTEAADSDVTEEEAR  659

Query  2120  SFMTES  2137
             SF+ +S
Sbjct  660   SFLVKS  665



>ref|XP_010056305.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X3 [Eucalyptus grandis]
Length=674

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/683 (66%), Positives = 558/683 (82%), Gaps = 25/683 (4%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH +LPE+EK+CS++V+KKL+YSKYDEVGV+LFGT ET NELT
Sbjct  1     MARNKEALVLLLDVGPSMHHLLPEVEKICSMIVQKKLVYSKYDEVGVVLFGTEETENELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYEHV VL++IKVVD DL++ L+Q+PRG+V GDFLDA++VGMDM+IKKY  TNKGK
Sbjct  61    MEVGGYEHVVVLQNIKVVDGDLVETLKQIPRGTVPGDFLDAIVVGMDMLIKKYSSTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCL+TN + PIKDPYEG+KEDQV+ IA QM +HGM+++ V+VR          +++EN
Sbjct  121   KRLCLMTNGLSPIKDPYEGSKEDQVNAIAEQMTSHGMKLECVVVRESVVRGENVSVMEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D +L++F +++ +K  +VES+TSL+GA++TRNI+PVT++RGD E+S KLKIKVWVYKKTS
Sbjct  181   DRILNLFPQKSCAKTIFVESSTSLLGALKTRNISPVTIFRGDLEISPKLKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP TDKFA HE+   YEYK V+D  K VPPEQRIKGYRYGPQVVPIS
Sbjct  241   EEKFPTLKKYSDKAPSTDKFASHEVKVDYEYKSVEDANKVVPPEQRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             + EW+AVKFKPEK VKLLGFTD+SNIMRH+YMKD N+FIADP +  AI+AVSALARAMK+
Sbjct  301   ADEWDAVKFKPEKSVKLLGFTDSSNIMRHHYMKDVNIFIADPGDQNAIVAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             M++VAI+RCVWRQGQGNV +GVLTPNVSD  +V             DVREFQFPSFSNLP
Sbjct  361   MHKVAILRCVWRQGQGNVVVGVLTPNVSDNDHV-------------DVREFQFPSFSNLP  407

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S+LP+E+QQEAADN VKMLDL PSD +E L P+FTPNPVL+R+Y+YLE+KSKH DAAVP
Sbjct  408   ASLLPDEEQQEAADNFVKMLDLTPSDRKEMLQPDFTPNPVLERFYNYLELKSKHPDAAVP  467

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGE-  1738
             PLD+ L+RIT+PDPELL+Q K+ +D   R FE+K+ PK+KKS +R+ REKP+GSD+E   
Sbjct  468   PLDKTLKRITEPDPELLAQKKSAIDSLLRHFEVKEKPKLKKSTRRM-REKPSGSDDEDNY  526

Query  1739  -RASTKV---------KSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVEN  1888
              R S+K          K EKIG++ PVQDFE M+SRRD+PEWVN+AI EMKNKI  L+E+
Sbjct  527   RRISSKTEVELIENGGKVEKIGDLTPVQDFEAMMSRRDNPEWVNRAITEMKNKIHDLIED  586

Query  1889  SLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIAL  2068
             S EGD Y KAL+ LVALR GCI+EQEPKQFND L  L   C + DLRSFC  L + GI L
Sbjct  587   SYEGDNYAKALDLLVALRKGCILEQEPKQFNDFLHQLCKFCLQNDLRSFCNFLATKGITL  646

Query  2069  ITKTEAPDSDVLESEARSFMTES  2137
             I+KTEA DSDV E EARSF+ +S
Sbjct  647   ISKTEAADSDVTEEEARSFLVKS  669



>ref|XP_010692265.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 [Beta vulgaris 
subsp. vulgaris]
Length=709

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/703 (64%), Positives = 565/703 (80%), Gaps = 34/703 (5%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGP MH VLP+++KVC++L+EKKLIY+K+DEVG++LFGT ET NELT
Sbjct  1     MARNKESLVLLLDVGPKMHGVLPQVKKVCAMLLEKKLIYNKFDEVGIVLFGTAETNNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYE++ VLR IKVVD DL+ ALE+LP+G+V GDFLDA++VGMDM+IKKYG TNKGK
Sbjct  61    AEVGGYENIVVLRGIKVVDGDLVDALEELPQGTVRGDFLDAIVVGMDMVIKKYGPTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA+  ++DPYEGTKEDQVSTIA QM    ++++ V+VR +   DA+K ++DEN
Sbjct  121   KRLCLITNALSHLRDPYEGTKEDQVSTIALQMTEQAIKLECVVVRGELSGDADKNVMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++F+K T +K  YVE+ TSL+GA+RTR+IAP+T++RGD E+S++LKIKVWVYKKTS
Sbjct  181   DKLLNLFTKRTWAKTVYVETPTSLLGALRTRSIAPITIFRGDLEVSSRLKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EERFPTLK YSDKAP TDKFA HEI   YEY+ + +P K VPPEQRIKGYRYGP+VVPIS
Sbjct  241   EERFPTLKKYSDKAPCTDKFATHEIKVDYEYRSIHEPDKVVPPEQRIKGYRYGPEVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             S  WEAVKFKPEKG+KLLGF+DA NI+R YYMKD N+FI +P   +A++AVSALARAMK+
Sbjct  301   SDAWEAVKFKPEKGLKLLGFSDAKNILRQYYMKDVNLFIGEPGKREAVIAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             +N+VAIVRCVWRQGQ  V IGVL+PNVS K N+PDSLYFN LPFAEDVREFQFPSF NLP
Sbjct  361   LNKVAIVRCVWRQGQAGVVIGVLSPNVSMKDNIPDSLYFNVLPFAEDVREFQFPSFKNLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             ++  PN++QQEAADNLV+MLDLAP   +E L P+ TPNPVL+R+YH+L++K+K+ DAA+P
Sbjct  421   ATFQPNDEQQEAADNLVRMLDLAPPAKEEILKPDLTPNPVLERFYHFLDLKTKNPDAAIP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLDE L+RIT+PD ELLS+NK+V+DEFRRCFE+K+N K KKS  R  +EKP+GSD+E E 
Sbjct  481   PLDEALKRITEPDAELLSKNKSVIDEFRRCFEVKENFKRKKS-ARSYKEKPSGSDDEKEA  539

Query  1742  A----------------STKVKS-----------------EKIGNINPVQDFEDMISRRD  1822
             A                + K+++                 EKIGNI+PVQDFE M+S RD
Sbjct  540   AEDVNMEKTLKTTDNDSAVKIQNSDDKPSSALANNSLAIVEKIGNISPVQDFEAMLSHRD  599

Query  1823  SPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLY  2002
             +P+WV+KAI+ +K+KI  LVE+S+ G+ Y KA+ECLVALR GC++EQEP QFN+ L+ LY
Sbjct  600   NPDWVSKAIKGLKSKILELVEDSVAGNNYDKAVECLVALRKGCVLEQEPTQFNNFLQYLY  659

Query  2003  ASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
               CKE +L  FC+ L   G+ LITK+EA DSDV +  ARSF+ 
Sbjct  660   RFCKEHELNDFCELLVLKGMTLITKSEAEDSDVADEAARSFLV  702



>ref|XP_004169630.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like [Cucumis 
sativus]
Length=691

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/680 (66%), Positives = 561/680 (83%), Gaps = 12/680 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNRE L+LV+DVGPSMH +LPE+EKVCS+LVEKKL+Y+KYDEVG++LF T +T NELT
Sbjct  1     MARNREILVLVLDVGPSMHSILPEVEKVCSMLVEKKLLYNKYDEVGIVLFRTEDTKNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             EE+GGY+HV VL+ +KVVD DL+  L+ +PRG+V GDFLDA+IVGMDM+IKK+G T +GK
Sbjct  61    EEVGGYQHVVVLQKMKVVDGDLVDVLKHIPRGTVSGDFLDAIIVGMDMLIKKFGETERGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCL+T+A+ PIK+PYEGTKEDQV+TIA QM  HG+RMDSV+VR +   DA +  ++EN
Sbjct  121   KRLCLVTDALFPIKEPYEGTKEDQVTTIAQQMTKHGIRMDSVVVRGRFGQDAIEKTMNEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FS++T++K  YVES TSL+GAIRTR+IAPVT++RGD E+S+ +KIKVWVYKKTS
Sbjct  181   DLLLNIFSRKTNAKMVYVESPTSLLGAIRTRSIAPVTIFRGDLEISSVIKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP TDKFA HE+   YEYK  ++P+K VPPE RIKGYRYGPQVVPIS
Sbjct  241   EEKFPTLKRYSDKAPLTDKFATHEVKVDYEYKSAEEPSKVVPPELRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             +AEW+AVKFK EK VKLLGFT+A +IMRHYYMKD NVFIA+P N ++I+AVSALARAMK+
Sbjct  301   TAEWDAVKFKTEKSVKLLGFTNAFHIMRHYYMKDVNVFIAEPGNKRSIVAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             M++VAIVRCVWRQGQG+V +GVLTPN+S+K  + DSL+FN LPFAEDVREFQFPSFSNLP
Sbjct  361   MDKVAIVRCVWRQGQGSVVVGVLTPNISEKDGIADSLFFNVLPFAEDVREFQFPSFSNLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             + M P+E+QQEAAD+ VKMLDLAP   +E L P+FTPNPVL+R+Y +LE+KSK  DAAVP
Sbjct  421   ALMQPSEEQQEAADDFVKMLDLAPDGREEILQPDFTPNPVLERFYRHLEVKSKDPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSD--EEG  1735
             PLD  L++IT+PDP+L SQN++V++ F + FELK+NPK+KKSR+  +REK +GS   E+ 
Sbjct  481   PLDGTLQKITEPDPDLFSQNQSVINTFHKRFELKENPKLKKSRRHYLREKASGSSDKEDN  540

Query  1736  ERASTK----------VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVE  1885
             E  S +          VK EKIG+  P++DFE M+SRRDSPEW++KAI  M +KIF L++
Sbjct  541   EEISAQIVESVANMPTVKVEKIGDTTPLEDFEAMMSRRDSPEWISKAISGMMSKIFDLIK  600

Query  1886  NSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIA  2065
             NS +G +Y KA+E L ALR GCI+EQEPKQFND LR+L     EK+L +FC+ L S  I+
Sbjct  601   NSSDGHSYTKAIEYLRALRKGCIIEQEPKQFNDFLRHLRNFYPEKNLHTFCEFLASQQIS  660

Query  2066  LITKTEAPDSDVLESEARSF  2125
             LI+K EA DS+V + EAR F
Sbjct  661   LISKEEAADSEVGDDEARRF  680



>ref|XP_004134348.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like [Cucumis 
sativus]
 gb|KGN56598.1| hypothetical protein Csa_3G126130 [Cucumis sativus]
Length=691

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/680 (66%), Positives = 562/680 (83%), Gaps = 12/680 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNRE L+LV+DVGPSMH +LPE+EKVCS+LVEKKL+Y+KYDEVG++LFGT +T NELT
Sbjct  1     MARNREILVLVLDVGPSMHSILPEVEKVCSMLVEKKLLYNKYDEVGIVLFGTEDTKNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             EE+GGY+HV VL+ +KVVD DL+  L+ +PRG+V GDFLDA+IVGMDM+IKK+G T +GK
Sbjct  61    EEVGGYQHVVVLQKMKVVDGDLVDVLKHIPRGTVSGDFLDAIIVGMDMLIKKFGETERGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCL+T+A+ PIK+PYEGTKEDQV+TIA QM  HG+RMDSV+VR +   DA +  ++EN
Sbjct  121   KRLCLVTDALFPIKEPYEGTKEDQVTTIAQQMTKHGIRMDSVVVRGRFGQDAIEKTMNEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FS++T++K  YVES TSL+GAIRTR+IAPVT++RGD E+S+ +KIKVWVYKKTS
Sbjct  181   DLLLNIFSRKTNAKMVYVESPTSLLGAIRTRSIAPVTIFRGDLEISSVIKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP TDKFA HE+   YEYK  ++P+K VPPE RIKGYRYGPQVVPIS
Sbjct  241   EEKFPTLKRYSDKAPLTDKFATHEVKVDYEYKSAEEPSKVVPPELRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             +AEW+AVKFK EK VKLLGFT+A +IMRHYYMKD NVFIA+P N ++I+AVSALARAMK+
Sbjct  301   TAEWDAVKFKTEKSVKLLGFTNAFHIMRHYYMKDVNVFIAEPGNKRSIVAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             M++VAIVRCVWRQGQG+V +GVLTPN+S+K  + DSL+FN LPFAEDVREFQFPSFSNLP
Sbjct  361   MDKVAIVRCVWRQGQGSVVVGVLTPNISEKDGIADSLFFNVLPFAEDVREFQFPSFSNLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             + M P+E+QQEAAD+ VKMLDLAP   +E L P+FTPNPVL+R+Y +LE+KSK  DAAVP
Sbjct  421   ALMQPSEEQQEAADDFVKMLDLAPDGREEILQPDFTPNPVLERFYRHLEVKSKDPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSD--EEG  1735
             PLD  L++IT+PDP+L SQN++V++ F + FELK+NPK+KKSR+  +REK +GS   E+ 
Sbjct  481   PLDGTLQKITEPDPDLFSQNQSVINTFHKRFELKENPKLKKSRRHYLREKASGSSDKEDN  540

Query  1736  ERASTK----------VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVE  1885
             E  S +          VK EKIG+  P++DFE M+SRRDSPEW++KAI  M +KIF L++
Sbjct  541   EEISAQIVESVANMPTVKVEKIGDTTPLEDFEAMMSRRDSPEWISKAISGMMSKIFDLIK  600

Query  1886  NSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIA  2065
             NS +G +Y KA+E L ALR GCI+EQEPKQFND LR+L     EK+L +FC+ L S  I+
Sbjct  601   NSSDGHSYTKAIEYLRALRKGCIIEQEPKQFNDFLRHLRNFYPEKNLHTFCEFLASQQIS  660

Query  2066  LITKTEAPDSDVLESEARSF  2125
             LI+K EA DS+V + EAR F
Sbjct  661   LISKEEAADSEVGDDEARRF  680



>ref|XP_004306918.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like [Fragaria 
vesca subsp. vesca]
Length=688

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/683 (64%), Positives = 549/683 (80%), Gaps = 11/683 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             M+R ++G +LVIDVGPSMH  LPEIE++CS+LVEKKLIYSK DEVGV+LFGT  T N LT
Sbjct  1     MSRGKDGTVLVIDVGPSMHKALPEIERLCSMLVEKKLIYSKSDEVGVVLFGTEGTENVLT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGY+H+TVL+ IKVVD+DL+QA+EQLPRG+ +GDFLDAVIVGMDM+IKKYG TNKGK
Sbjct  61    REVGGYDHITVLQDIKVVDEDLIQAVEQLPRGTHNGDFLDAVIVGMDMLIKKYGETNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCL TNA  P K P EG+KEDQV  IA  M   GMR++S+++R     +A+K I+DEN
Sbjct  121   KRLCLFTNAHYPTKAPLEGSKEDQVIAIAGHMNTQGMRLESIVIRGGLTGEAKKSIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL +FSK T +K  +VE+ TSL+GA+RTR ++PVT++RGD EL+ K+KIKVWVYKKTS
Sbjct  181   DHLLDIFSKRTCAKLVHVETPTSLLGALRTRKVSPVTIFRGDLELTPKMKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             E++FPTLK YSD+A PTDK+A HE+   +EYK  +D +K VPPEQRIKGYRYGPQV+PIS
Sbjct  241   EDKFPTLKKYSDRAAPTDKYATHEVKVEFEYKSAEDLSKVVPPEQRIKGYRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+AVKFKPEK VKLLGF+DA NI+RHYYMKD N+FI +P N+KAI+AVSALARAMKD
Sbjct  301   SAEWDAVKFKPEKSVKLLGFSDAQNILRHYYMKDVNIFIPEPGNTKAIIAVSALARAMKD  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQ +V +G L PNVSD  N+PDS YFN LPF ED+REFQFPSF+N P
Sbjct  361   MNKVAIVRCVWRQGQASVVVGALIPNVSDNDNIPDSFYFNVLPFTEDIREFQFPSFNNFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             ++  PNEQQQEAAD+ V+M DLAP   QE L P+ TPNPVL+R++ +LE+KS+  D AVP
Sbjct  421   AAWQPNEQQQEAADDFVRMFDLAPPGKQEILPPDLTPNPVLERFFRHLELKSRDPDTAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             P+DE LR+I++PD EL++ NK+V+D FR  FE+K+NPK+KKS +RL++EKP+ SDE  + 
Sbjct  481   PIDETLRKISEPDKELIAANKSVIDAFRSRFEVKENPKLKKSSRRLLKEKPSASDEREDH  540

Query  1742  A-----------STKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVEN  1888
                         ++ +K   IG+  PVQDFE M+SRRDSPEWV KAI++MKNKI  LVE+
Sbjct  541   MDISDQPNSNEHTSGIKVTTIGDSAPVQDFEAMMSRRDSPEWVGKAIKDMKNKIHDLVED  600

Query  1889  SLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIAL  2068
             S EGD Y KALECL+ALR GCI+EQEP +FND LR+L   C++K L SFC+ L +  + L
Sbjct  601   SHEGDNYPKALECLIALRKGCILEQEPNKFNDFLRSLCKFCQDKYLSSFCEFLATKELTL  660

Query  2069  ITKTEAPDSDVLESEARSFMTES  2137
             I KTEA DS+V ++EARSF+ +S
Sbjct  661   IPKTEAIDSEVTDAEARSFLVKS  683



>ref|XP_007052049.1| Ku80 family protein isoform 1 [Theobroma cacao]
 gb|EOX96206.1| Ku80 family protein isoform 1 [Theobroma cacao]
Length=769

 Score =   909 bits (2348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/685 (64%), Positives = 555/685 (81%), Gaps = 13/685 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VLPE+EKVCS+LVEKKLI+ K DEVGV++FGT ET N+LT
Sbjct  79    MARNKEKLVLLLDVGPSMHSVLPEVEKVCSMLVEKKLIFRKNDEVGVVVFGTEETNNDLT  138

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGY+H+ VL  IKVVD DL+  L++LPRG+VDGDFLDA++VGMDM+IKKY   +KGK
Sbjct  139   KEVGGYDHIVVLEDIKVVDGDLIDTLQKLPRGTVDGDFLDAIVVGMDMLIKKYKDIHKGK  198

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA+ PIKD  EGTKEDQV TIAAQM A GM+M+SV+VR +   DA K I+DEN
Sbjct  199   KRLCLITNAVHPIKDSLEGTKEDQVETIAAQMTAQGMKMESVVVRGRLSQDANKRIMDEN  258

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LLS+FSK+T ++  YV+S TSL+GA++TR I PVT++RGD ELS  +KIKVWVYK+T 
Sbjct  259   DRLLSIFSKQTLTRTVYVDSPTSLLGALKTRRITPVTVFRGDLELSPDMKIKVWVYKRTQ  318

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YS+KAP T+KFA H++   YEYK V   +K VPPEQRIKGYRYGPQVVPIS
Sbjct  319   EEKFPTLKKYSEKAPQTNKFATHQVKVDYEYKTVDGASKVVPPEQRIKGYRYGPQVVPIS  378

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             +AEW+AVKFKPEKGVKLLGFTDASNIMRHYYMKD  +FIA+P N++AIL+VSA+ARAMK+
Sbjct  379   AAEWDAVKFKPEKGVKLLGFTDASNIMRHYYMKDVYLFIAEPGNTRAILSVSAIARAMKE  438

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQ NV +GVLTPN+S    +PDS YFN LPF EDVRE+QFPSF++ P
Sbjct  439   MNKVAILRCVWRQGQQNVVLGVLTPNISQNDKLPDSFYFNVLPFIEDVREYQFPSFNSFP  498

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  PNEQQQ+AAD LV+ML+LAPS  +EALLP++TPNPVL+R+Y +LE+KSK  DAAVP
Sbjct  499   VSWQPNEQQQKAADELVQMLNLAPSGKEEALLPDYTPNPVLERFYRHLELKSKQPDAAVP  558

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD  L+RIT+PDPEL  +NK+V+D  R+ FELK+NPK+KKS +RL+REKP+GS++E   
Sbjct  559   PLDGTLKRITEPDPELFFENKSVIDALRKHFELKENPKLKKSARRLLREKPSGSNDEDGD  618

Query  1742  ASTK-------------VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLV  1882
             A                VK EKIG++ PVQDFE ++SRRDSPEWV KAI+EM++KI  L+
Sbjct  619   ADVSDAQAVNSIEKALVVKIEKIGDLTPVQDFEVILSRRDSPEWVGKAIKEMRDKILGLL  678

Query  1883  ENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGI  2062
              +S EGD +  A+EC+ ALR GCI+EQEP+ +N+ LR L   C++K + +F + L S  +
Sbjct  679   SDSHEGDNHLIAVECIAALRKGCILEQEPEPYNNFLRYLNLYCQQKGMSNFWQLLASRKL  738

Query  2063  ALITKTEAPDSDVLESEARSFMTES  2137
              L++K+EA DSDV ++EAR F  ++
Sbjct  739   TLVSKSEAADSDVTDNEARRFFVKT  763



>ref|XP_003524779.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X1 [Glycine max]
Length=687

 Score =   904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/683 (65%), Positives = 553/683 (81%), Gaps = 12/683 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH  L EIEKVCS+LV KKLIYSKYDEVG++LFGT +T NELT
Sbjct  1     MARNKEALLLLLDVGPSMHPALSEIEKVCSMLVHKKLIYSKYDEVGIVLFGTEDTNNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGY+HV VL++IKVVD D+++AL+QLPRG+ DGDFLDAVIVGMD+++KK+G+TNKGK
Sbjct  61    TEVGGYQHVVVLKNIKVVDGDIVEALQQLPRGTTDGDFLDAVIVGMDVLVKKFGVTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KR+CLITNA C IK+  EGTKE+QV+TIA QM AHG++M+S+I+R K   DA KGI+DEN
Sbjct  121   KRVCLITNAQCQIKESDEGTKEEQVTTIAKQMTAHGIKMESIIMRGKLSQDANKGIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSKETS++  YVE+  SL GA+RTRNIA VT++RG  E+S KL IKV VYKKT+
Sbjct  181   DRLLNIFSKETSTRLLYVENPISLFGALRTRNIALVTVFRGHLEISPKLSIKVMVYKKTT  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FP++K YSDKAPP DKFAKHE+   YE+K  +DP K VPP+QRIKGY YGPQ+VPIS
Sbjct  241   EEKFPSMKKYSDKAPPNDKFAKHEVKIDYEHKSSKDPDKVVPPDQRIKGYPYGPQIVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKL+GFTD+SN+ RH+YMKD  VF+ +P N++A++AVSA+ARAMK+
Sbjct  301   SAEWEAVKFKPEKGVKLMGFTDSSNVFRHHYMKDVYVFLPEPGNTRAMIAVSAVARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQ NV IGVLTPN+SDK N+PDS Y N LPFAEDVREFQFPSF+N P
Sbjct  361   MNKVAIVRCVWRQGQANVVIGVLTPNLSDKENIPDSFYLNVLPFAEDVREFQFPSFTNFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  PN QQ EAA NL+K LDLAP   +E LLP+FTPNPVL+R+Y YLE+KSK  D AVP
Sbjct  421   ASWQPNGQQLEAAANLIKTLDLAPHGQEEVLLPDFTPNPVLERFYRYLELKSKDPDVAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGE-  1738
             PLD  L++IT+PD +LL QNK+ +D F R FELK NP +KKSR+ L  ++   +DEE + 
Sbjct  481   PLDGTLKKITEPDTDLLLQNKSEIDSFCRSFELKGNP-LKKSRRLLGGKRSFSNDEEVKG  539

Query  1739  ---------RASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENS  1891
                        +  V   KIG++ PVQ FE +ISRRDSP+WV KAI EMKNKIF LVE+S
Sbjct  540   NITAQPANLTGNASVNVGKIGDLTPVQYFEALISRRDSPDWVVKAINEMKNKIFDLVEDS  599

Query  1892  LEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALI  2071
              EGD Y KALECLVALR GCI+EQEP+QFND L++L+  C+EK+L SFC+ L S  + LI
Sbjct  600   HEGDNYPKALECLVALRKGCILEQEPEQFNDFLKHLWNFCQEKNLPSFCEYLASKELTLI  659

Query  2072  TKTEAPDSDVLESEAR-SFMTES  2137
             +KTEA DS+  + +AR  F+ +S
Sbjct  660   SKTEAIDSENTDDKARKGFLVKS  682



>ref|XP_006445252.1| hypothetical protein CICLE_v10019016mg [Citrus clementina]
 gb|ESR58492.1| hypothetical protein CICLE_v10019016mg [Citrus clementina]
Length=736

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/685 (65%), Positives = 549/685 (80%), Gaps = 13/685 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MAR RE L+L++DV PSMH VLP++EK+CS L++KKLIY K  EVGVILFGT ET NELT
Sbjct  46    MARTREALLLLLDVSPSMHSVLPDVEKLCSRLIQKKLIYGKNHEVGVILFGTEETENELT  105

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEHV VL+ IKVVD  L+Q+L+ LP+G+  GDFLDA++VG+DM+IKKYG T KGK
Sbjct  106   KEVGGYEHVKVLQDIKVVDGHLVQSLKHLPQGTCAGDFLDAIVVGVDMLIKKYGETYKGK  165

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             K LCLIT+A+CP+KDP  GTKEDQVSTIA QM A G+RM +++VR     +    +I EN
Sbjct  166   KHLCLITDALCPLKDPDVGTKEDQVSTIARQMVAFGLRMKNIVVRASLSGEPHMRVIIEN  225

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSK++S+K  +V+S TSL GA +TR+I+PVT++RGD ELS K+KIKVWVYKKT 
Sbjct  226   DNLLNIFSKKSSAKTLFVDSTTSLRGARKTRDISPVTIFRGDLELSEKMKIKVWVYKKTG  285

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP TDKFA HE+   YEYK V+DP+K VPPEQRIKGYRYGPQVVPIS
Sbjct  286   EEKFPTLKKYSDKAPSTDKFATHEVKVDYEYKSVEDPSKVVPPEQRIKGYRYGPQVVPIS  345

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEK VKLLGFTDASNI+RHYYMKD N+FIA+P NS+A +AVSALARAMK+
Sbjct  346   SAEWEAVKFKPEKSVKLLGFTDASNILRHYYMKDVNLFIAEPGNSRATVAVSALARAMKE  405

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQ +V +GVLTPNVS+K N+PDS YFN LPFAEDVREFQFPSFS  P
Sbjct  406   MNKVAIVRCVWRQGQQSVVVGVLTPNVSEKINIPDSFYFNVLPFAEDVREFQFPSFSKFP  465

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  PNEQQQEAADNLVKMLDLAPS   E L PE TPNP L+R+YH+LE+KS+H DAA P
Sbjct  466   VSWQPNEQQQEAADNLVKMLDLAPSGKGEILQPELTPNPALERFYHHLELKSEHQDAAPP  525

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD+ L++IT+PDP LL+++++ +D F   F +K+NPK+KKS +R +REKP+GSDE    
Sbjct  526   PLDDSLKKITEPDPTLLAESQSAIDAFCGQFVIKENPKLKKSTRRFLREKPSGSDEPNGD  585

Query  1742  ASTK-------------VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLV  1882
              S               V  +KIG++ P+QDFE M+SRRD P+WV+KAI++MKNKIF L+
Sbjct  586   GSVSDAQAVNSMESKPVVTVDKIGDLTPIQDFEAMMSRRDCPDWVDKAIEDMKNKIFGLL  645

Query  1883  ENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGI  2062
             ENS EG  Y KA+E LVALR GCI+EQEPKQFND+L  +   C++++  +F   L S  +
Sbjct  646   ENSNEGINYPKAVELLVALRKGCILEQEPKQFNDVLEKVCKICRKRNFSTFFDFLMSKKL  705

Query  2063  ALITKTEAPDSDVLESEARSFMTES  2137
             +LI+K+EA DSD+ + EA SF+ +S
Sbjct  706   SLISKSEAVDSDITDDEAGSFIVKS  730



>ref|XP_006386572.1| hypothetical protein POPTR_0002s14910g [Populus trichocarpa]
 gb|ERP64369.1| hypothetical protein POPTR_0002s14910g [Populus trichocarpa]
Length=656

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/678 (64%), Positives = 535/678 (79%), Gaps = 35/678 (5%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN EGL+L++DVGP+MH VLP+I+K CS+LV+KK       EVG              
Sbjct  1     MARNSEGLVLLLDVGPTMHNVLPQIQKFCSMLVQKKTDNVLTKEVG--------------  46

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
                 GYEHV VLR I+VV+ DL+ AL++LPRG+ DGD+LDA++VGMDM+IKKY  TNKGK
Sbjct  47    ----GYEHVVVLRDIEVVNGDLVDALQELPRGTFDGDYLDAIVVGMDMLIKKYQATNKGK  102

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA+CP+K PYEGT+EDQV+TIAAQM A G++M+S+I R + +    + I++EN
Sbjct  103   KRLCLITNALCPVKYPYEGTREDQVNTIAAQMSARGVKMESIIARGRLNGGGNQRIMEEN  162

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FS++TS+KA YVE+ T+L+GA+RTRNI+PVT++RGD ELS+K+KIKVWVYKKT 
Sbjct  163   DQLLNLFSEKTSAKAVYVETPTALLGALRTRNISPVTIFRGDLELSSKMKIKVWVYKKTI  222

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EERFPTLK YSDKAPPT++FA HE+   YEYK V+DP+K VPPEQRIKGYRYGPQVVPIS
Sbjct  223   EERFPTLKKYSDKAPPTNRFATHEVKLDYEYKSVEDPSKVVPPEQRIKGYRYGPQVVPIS  282

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+ VKFKPEK  KLLGF DASNIMRHYYMKD N+FI +P N+ A  AVSALARAMK+
Sbjct  283   SAEWDVVKFKPEKSAKLLGFADASNIMRHYYMKDVNIFIPEPGNTCAAFAVSALARAMKE  342

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN VAI+R VWRQ Q N  +GVLTPN+S+K   PDS YFN LPFAEDVREFQFPSFSN P
Sbjct  343   MNNVAILRFVWRQHQRNAVVGVLTPNISEKDGTPDSFYFNVLPFAEDVREFQFPSFSNFP  402

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S LPNEQQQEAADNLVKMLDLAPS  QEALLP+FTPNP+L+R+YH+LE+KSKH DAAVP
Sbjct  403   ASWLPNEQQQEAADNLVKMLDLAPSGKQEALLPDFTPNPILERFYHHLELKSKHSDAAVP  462

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSD-EEGE  1738
             PLDE L+ IT+PDP+LLS NK VVD F + FELK++P+ KKS K+L+REKP G D EEG 
Sbjct  463   PLDETLKTITEPDPDLLSANKNVVDAFCKSFELKEHPRQKKSSKQLLREKPPGLDEEEGY  522

Query  1739  RASTK------VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEG  1900
               +T       VK +KIG+ +PVQDFE M+S RDSP+WV K           LVENS EG
Sbjct  523   EGATNALSPKPVKIKKIGDSSPVQDFEVMMSGRDSPDWVGKN----------LVENSYEG  572

Query  1901  DTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKT  2080
             D + K LECL+ALR GC++EQEPKQFND L +L+  C+EK L +FC+ L S G+ LI+K+
Sbjct  573   DNHGKTLECLLALRKGCMLEQEPKQFNDFLHHLFNICREKKLGNFCESLVSEGLTLISKS  632

Query  2081  EAPDSDVLESEARSFMTE  2134
             EA D +  + EA+SF+ +
Sbjct  633   EAMDREFTDDEAKSFLVK  650



>ref|XP_006490926.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like [Citrus 
sinensis]
 gb|KDO85829.1| hypothetical protein CISIN_1g005544mg [Citrus sinensis]
Length=691

 Score =   901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/685 (65%), Positives = 549/685 (80%), Gaps = 13/685 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MAR RE L+L++DV PSMH VLP++EK+CS L++KKLIY K  EVGVILFGT ET NELT
Sbjct  1     MARTREALLLLLDVSPSMHSVLPDVEKLCSRLIQKKLIYGKNHEVGVILFGTEETENELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEHV VL+ IKVVD  L+Q+L+ LP+G+  GDFLDA++VG+DM+IKKYG T KGK
Sbjct  61    KEVGGYEHVKVLQDIKVVDGHLVQSLKHLPQGTCAGDFLDAIVVGVDMLIKKYGETYKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             K LCLIT+A+CP+KDP  GTKEDQVSTIA QM A G+RM +++VR     +    +I EN
Sbjct  121   KHLCLITDALCPLKDPDVGTKEDQVSTIARQMVAFGLRMKNIVVRASLSGEPHMRVIIEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSK++S+K  +V+S TSL GA +TR+I+PVT++RGD ELS K+KIKVWVYKKT 
Sbjct  181   DNLLNIFSKKSSAKTLFVDSTTSLRGARKTRDISPVTIFRGDLELSEKMKIKVWVYKKTG  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP TDKFA HE+   YEYK V+DP+K VPPEQRIKGYRYGPQVVPIS
Sbjct  241   EEKFPTLKKYSDKAPSTDKFATHEVKVDYEYKSVEDPSKVVPPEQRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEK VKLLGFTDASNI+RHYYMKD N+FIA+P NS+A +AVSALARAMK+
Sbjct  301   SAEWEAVKFKPEKSVKLLGFTDASNILRHYYMKDVNLFIAEPGNSRATVAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQ +V +GVLTPNVS+K N+PDS YFN LPFAEDVREFQFPSFS  P
Sbjct  361   MNKVAIVRCVWRQGQQSVVVGVLTPNVSEKINIPDSFYFNVLPFAEDVREFQFPSFSKFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  PNEQQQEAADNLVKMLDLAPS   E L PE TPNP L+R+YH+LE+KS+H DAA P
Sbjct  421   VSWQPNEQQQEAADNLVKMLDLAPSGKGEILQPELTPNPALERFYHHLELKSEHQDAAPP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD+ L++IT+PDP LL+++++ +D F   F +K+NPK+KKS +R +REKP+GSDE    
Sbjct  481   PLDDSLKKITEPDPTLLAESQSAIDAFCGQFVIKENPKLKKSTRRFLREKPSGSDEPNGD  540

Query  1742  ASTK-------------VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLV  1882
              S               V  +KIG++ P+QDFE M+SRRD P+WV+KAI++MKNKIF L+
Sbjct  541   GSVSDAQAVNSMESKPVVTVDKIGDLTPIQDFEAMMSRRDCPDWVDKAIEDMKNKIFGLL  600

Query  1883  ENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGI  2062
             ENS EG  Y KA+E LVALR GCI+EQEPKQFND+L  +   C++++  +F   L S  +
Sbjct  601   ENSNEGINYPKAVELLVALRKGCILEQEPKQFNDVLEKVCKICRKRNFSTFFDFLMSKKL  660

Query  2063  ALITKTEAPDSDVLESEARSFMTES  2137
             +LI+K+EA DSD+ + EA SF+ +S
Sbjct  661   SLISKSEAVDSDITDDEAGSFIVKS  685



>ref|XP_006580031.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X3 [Glycine max]
Length=687

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/683 (65%), Positives = 551/683 (81%), Gaps = 12/683 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             M + +E L+L++DVGPSMH  L EIEKVCS+LV KKLIYSKYDEVG++LFGT +T NELT
Sbjct  1     MVKKQEALLLLLDVGPSMHPALSEIEKVCSMLVHKKLIYSKYDEVGIVLFGTEDTNNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGY+HV VL++IKVVD D+++AL+QLPRG+ DGDFLDAVIVGMD+++KK+G+TNKGK
Sbjct  61    TEVGGYQHVVVLKNIKVVDGDIVEALQQLPRGTTDGDFLDAVIVGMDVLVKKFGVTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KR+CLITNA C IK+  EGTKE+QV+TIA QM AHG++M+S+I+R K   DA KGI+DEN
Sbjct  121   KRVCLITNAQCQIKESDEGTKEEQVTTIAKQMTAHGIKMESIIMRGKLSQDANKGIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSKETS++  YVE+  SL GA+RTRNIA VT++RG  E+S KL IKV VYKKT+
Sbjct  181   DRLLNIFSKETSTRLLYVENPISLFGALRTRNIALVTVFRGHLEISPKLSIKVMVYKKTT  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FP++K YSDKAPP DKFAKHE+   YE+K  +DP K VPP+QRIKGY YGPQ+VPIS
Sbjct  241   EEKFPSMKKYSDKAPPNDKFAKHEVKIDYEHKSSKDPDKVVPPDQRIKGYPYGPQIVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKL+GFTD+SN+ RH+YMKD  VF+ +P N++A++AVSA+ARAMK+
Sbjct  301   SAEWEAVKFKPEKGVKLMGFTDSSNVFRHHYMKDVYVFLPEPGNTRAMIAVSAVARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQ NV IGVLTPN+SDK N+PDS Y N LPFAEDVREFQFPSF+N P
Sbjct  361   MNKVAIVRCVWRQGQANVVIGVLTPNLSDKENIPDSFYLNVLPFAEDVREFQFPSFTNFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  PN QQ EAA NL+K LDLAP   +E LLP+FTPNPVL+R+Y YLE+KSK  D AVP
Sbjct  421   ASWQPNGQQLEAAANLIKTLDLAPHGQEEVLLPDFTPNPVLERFYRYLELKSKDPDVAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGE-  1738
             PLD  L++IT+PD +LL QNK+ +D F R FELK NP +KKSR+ L  ++   +DEE + 
Sbjct  481   PLDGTLKKITEPDTDLLLQNKSEIDSFCRSFELKGNP-LKKSRRLLGGKRSFSNDEEVKG  539

Query  1739  ---------RASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENS  1891
                        +  V   KIG++ PVQ FE +ISRRDSP+WV KAI EMKNKIF LVE+S
Sbjct  540   NITAQPANLTGNASVNVGKIGDLTPVQYFEALISRRDSPDWVVKAINEMKNKIFDLVEDS  599

Query  1892  LEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALI  2071
              EGD Y KALECLVALR GCI+EQEP+QFND L++L+  C+EK+L SFC+ L S  + LI
Sbjct  600   HEGDNYPKALECLVALRKGCILEQEPEQFNDFLKHLWNFCQEKNLPSFCEYLASKELTLI  659

Query  2072  TKTEAPDSDVLESEAR-SFMTES  2137
             +KTEA DS+  + +AR  F+ +S
Sbjct  660   SKTEAIDSENTDDKARKGFLVKS  682



>ref|XP_006580030.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X2 [Glycine max]
Length=691

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/687 (65%), Positives = 553/687 (80%), Gaps = 16/687 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH  L EIEKVCS+LV KKLIYSKYDEVG++LFGT +T NELT
Sbjct  1     MARNKEALLLLLDVGPSMHPALSEIEKVCSMLVHKKLIYSKYDEVGIVLFGTEDTNNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGY+HV VL++IKVVD D+++AL+QLPRG+ DGDFLDAVIVGMD+++KK+G+TNKGK
Sbjct  61    TEVGGYQHVVVLKNIKVVDGDIVEALQQLPRGTTDGDFLDAVIVGMDVLVKKFGVTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KR+CLITNA C IK+  EGTKE+QV+TIA QM AHG++M+S+I+R K   DA KGI+DEN
Sbjct  121   KRVCLITNAQCQIKESDEGTKEEQVTTIAKQMTAHGIKMESIIMRGKLSQDANKGIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSKETS++  YVE+  SL GA+RTRNIA VT++RG  E+S KL IKV VYKKT+
Sbjct  181   DRLLNIFSKETSTRLLYVENPISLFGALRTRNIALVTVFRGHLEISPKLSIKVMVYKKTT  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FP++K YSDKAPP DKFAKHE+   YE+K  +DP K VPP+QRIKGY YGPQ+VPIS
Sbjct  241   EEKFPSMKKYSDKAPPNDKFAKHEVKIDYEHKSSKDPDKVVPPDQRIKGYPYGPQIVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKL+GFTD+SN+ RH+YMKD  VF+ +P N++A++AVSA+ARAMK+
Sbjct  301   SAEWEAVKFKPEKGVKLMGFTDSSNVFRHHYMKDVYVFLPEPGNTRAMIAVSAVARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNV----PDSLYFNALPFAEDVREFQFPSF  1369
             MN+VAIVRCVWRQGQ NV IGVLTPN+SDK N+    PDS Y N LPFAEDVREFQFPSF
Sbjct  361   MNKVAIVRCVWRQGQANVVIGVLTPNLSDKENIFSVQPDSFYLNVLPFAEDVREFQFPSF  420

Query  1370  SNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHD  1549
             +N P+S  PN QQ EAA NL+K LDLAP   +E LLP+FTPNPVL+R+Y YLE+KSK  D
Sbjct  421   TNFPASWQPNGQQLEAAANLIKTLDLAPHGQEEVLLPDFTPNPVLERFYRYLELKSKDPD  480

Query  1550  AAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDE  1729
              AVPPLD  L++IT+PD +LL QNK+ +D F R FELK NP +KKSR+ L  ++   +DE
Sbjct  481   VAVPPLDGTLKKITEPDTDLLLQNKSEIDSFCRSFELKGNP-LKKSRRLLGGKRSFSNDE  539

Query  1730  EGE----------RASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYL  1879
             E +            +  V   KIG++ PVQ FE +ISRRDSP+WV KAI EMKNKIF L
Sbjct  540   EVKGNITAQPANLTGNASVNVGKIGDLTPVQYFEALISRRDSPDWVVKAINEMKNKIFDL  599

Query  1880  VENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHG  2059
             VE+S EGD Y KALECLVALR GCI+EQEP+QFND L++L+  C+EK+L SFC+ L S  
Sbjct  600   VEDSHEGDNYPKALECLVALRKGCILEQEPEQFNDFLKHLWNFCQEKNLPSFCEYLASKE  659

Query  2060  IALITKTEAPDSDVLESEAR-SFMTES  2137
             + LI+KTEA DS+  + +AR  F+ +S
Sbjct  660   LTLISKTEAIDSENTDDKARKGFLVKS  686



>ref|XP_007159070.1| hypothetical protein PHAVU_002G205800g [Phaseolus vulgaris]
 gb|AAL87544.1|AF293344_1 KAP-2 [Phaseolus vulgaris]
 gb|ESW31064.1| hypothetical protein PHAVU_002G205800g [Phaseolus vulgaris]
Length=686

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/679 (64%), Positives = 543/679 (80%), Gaps = 12/679 (2%)
 Frame = +2

Query  134   REGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelg  313
             ++ L+L++DVGPSMH VLPEIEK CS+LV+KKL++SK DEVG++LFGT +T NELT E+G
Sbjct  5     KDALLLLLDVGPSMHYVLPEIEKACSLLVQKKLVFSKNDEVGIVLFGTEDTDNELTTEVG  64

Query  314   gYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLC  493
             GY+HV VL++ KVVD D+++AL+ LPRG+ DGDF+DAVIVGM+++IKK+G TNKGKKR+C
Sbjct  65    GYQHVVVLKNTKVVDGDIVEALQHLPRGTTDGDFVDAVIVGMNLLIKKFGQTNKGKKRIC  124

Query  494   LITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLL  673
             LITNA CPIK+ YEGTKE+QV+TIA Q+ AHGM+M+S+IVR K   DA KGI+DEND LL
Sbjct  125   LITNAQCPIKESYEGTKEEQVTTIAKQLTAHGMKMESIIVRGKLSQDANKGIMDENDRLL  184

Query  674   SVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERF  853
             ++FSKETS++  Y+E+  SL GA++TRNI  VT++RGD E+S KL IKV VYKKT+EE+F
Sbjct  185   NIFSKETSTRLLYLENPISLFGALKTRNITLVTVFRGDLEISPKLSIKVMVYKKTAEEKF  244

Query  854   PTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTK-QVPPEQRIKGYRYGPQVVPISSAE  1030
             PTLK Y+DKAPP DKFA  E+   YEYK  +DP K  VPP+QRI+GY YGPQ+VP+S++ 
Sbjct  245   PTLKKYTDKAPPNDKFATREVKIDYEYKSSEDPDKVVVPPDQRIRGYPYGPQIVPLSTSH  304

Query  1031  WEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNR  1210
             W+A KF PEKGVKLLGFTD+SN+ RH+YMKD  VF+  P N++A+LAVS+LARAMK+M++
Sbjct  305   WDAFKFLPEKGVKLLGFTDSSNVFRHHYMKDVYVFLPQPGNTRAMLAVSSLARAMKEMDK  364

Query  1211  VAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSM  1390
             VAI+RCVWRQGQ NV IGVLTPN+SDK N+PDS Y N LPFAEDVREFQF SFSN P+S 
Sbjct  365   VAILRCVWRQGQANVVIGVLTPNLSDKENIPDSFYLNVLPFAEDVREFQFHSFSNFPASW  424

Query  1391  LPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLD  1570
             LPN QQ EAA NLVK LDLAP   +E LLP+FT NPVL+R+Y +LE KSK  D AVPPLD
Sbjct  425   LPNGQQLEAAANLVKALDLAPDGQEEVLLPDFTANPVLERFYRFLEQKSKDPDIAVPPLD  484

Query  1571  EILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERAST  1750
             + L++IT+PD +LL QNK+V+D F R FELK NP +KKSR+    ++   +DEE +   T
Sbjct  485   DTLKKITEPDADLLLQNKSVIDSFCRSFELKGNP-LKKSRRLFGGKRSFSNDEEIKENIT  543

Query  1751  ----------KVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEG  1900
                        VK EKIG++ P QDFE +ISRRDSP+WV KAI EMKNKIF LVE+S EG
Sbjct  544   AEPPNLIENASVKVEKIGDLTPAQDFEALISRRDSPDWVVKAINEMKNKIFDLVEDSHEG  603

Query  1901  DTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKT  2080
             D Y KALECLV LR GCI+EQEPKQFND L++L   C+EK L SFC+ L S  + LI+KT
Sbjct  604   DNYPKALECLVVLRKGCILEQEPKQFNDFLKHLCNFCQEKSLHSFCQYLASKDLTLISKT  663

Query  2081  EAPDSDVLESEARSFMTES  2137
             EA DSDV + EARSF+ +S
Sbjct  664   EAVDSDVTDEEARSFLVKS  682



>ref|XP_010056307.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X5 [Eucalyptus grandis]
Length=627

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/618 (67%), Positives = 509/618 (82%), Gaps = 12/618 (2%)
 Frame = +2

Query  317   YEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCL  496
             YEHV VL++IKVVD DL++ L+Q+PRG+V GDFLDA++VGMDM+IKKY  TNKGKKRLCL
Sbjct  6     YEHVVVLQNIKVVDGDLVETLKQIPRGTVPGDFLDAIVVGMDMLIKKYSSTNKGKKRLCL  65

Query  497   ITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLS  676
             +TN + PIKDPYEG+KEDQV+ IA QM +HGM+++ V+VR          +++END +L+
Sbjct  66    MTNGLSPIKDPYEGSKEDQVNAIAEQMTSHGMKLECVVVRESVVRGENVSVMEENDRILN  125

Query  677   VFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFP  856
             +F +++ +K  +VES+TSL+GA++TRNI+PVT++RGD E+S KLKIKVWVYKKTSEE+FP
Sbjct  126   LFPQKSCAKTIFVESSTSLLGALKTRNISPVTIFRGDLEISPKLKIKVWVYKKTSEEKFP  185

Query  857   TLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWE  1036
             TLK YSDKAP TDKFA HE+   YEYK V+D  K VPPEQRIKGYRYGPQVVPIS+ EW+
Sbjct  186   TLKKYSDKAPSTDKFASHEVKVDYEYKSVEDANKVVPPEQRIKGYRYGPQVVPISADEWD  245

Query  1037  AVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVA  1216
             AVKFKPEK VKLLGFTD+SNIMRH+YMKD N+FIADP +  AI+AVSALARAMK+M++VA
Sbjct  246   AVKFKPEKSVKLLGFTDSSNIMRHHYMKDVNIFIADPGDQNAIVAVSALARAMKEMHKVA  305

Query  1217  IVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLP  1396
             I+RCVWRQGQGNV +GVLTPNVSD  +VPDS YFN LPFAEDVREFQFPSFSNLP+S+LP
Sbjct  306   ILRCVWRQGQGNVVVGVLTPNVSDNDHVPDSFYFNILPFAEDVREFQFPSFSNLPASLLP  365

Query  1397  NEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEI  1576
             +E+QQEAADN VKMLDL PSD +E L P+FTPNPVL+R+Y+YLE+KSKH DAAVPPLD+ 
Sbjct  366   DEEQQEAADNFVKMLDLTPSDRKEMLQPDFTPNPVLERFYNYLELKSKHPDAAVPPLDKT  425

Query  1577  LRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEG--ERAST  1750
             L+RIT+PDPELL+Q K+ +D   R FE+K+ PK+KKS +R+ REKP+GSD+E    R S+
Sbjct  426   LKRITEPDPELLAQKKSAIDSLLRHFEVKEKPKLKKSTRRM-REKPSGSDDEDNYRRISS  484

Query  1751  KV---------KSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGD  1903
             K          K EKIG++ PVQDFE M+SRRD+PEWVN+AI EMKNKI  L+E+S EGD
Sbjct  485   KTEVELIENGGKVEKIGDLTPVQDFEAMMSRRDNPEWVNRAITEMKNKIHDLIEDSYEGD  544

Query  1904  TYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTE  2083
              Y KAL+ LVALR GCI+EQEPKQFND L  L   C + DLRSFC  L + GI LI+KTE
Sbjct  545   NYAKALDLLVALRKGCILEQEPKQFNDFLHQLCKFCLQNDLRSFCNFLATKGITLISKTE  604

Query  2084  APDSDVLESEARSFMTES  2137
             A DSDV E EARSF+ +S
Sbjct  605   AADSDVTEEEARSFLVKS  622



>gb|KDO85828.1| hypothetical protein CISIN_1g005544mg [Citrus sinensis]
Length=682

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/685 (64%), Positives = 540/685 (79%), Gaps = 22/685 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MAR RE L+L++DV PSMH VLP++EK+CS L++KKLIY K  EVGVILFGT ET NELT
Sbjct  1     MARTREALLLLLDVSPSMHSVLPDVEKLCSRLIQKKLIYGKNHEVGVILFGTEETENELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEHV VL+ IKVVD  L+Q+L+ LP+G+  GD+         M+IKKYG T KGK
Sbjct  61    KEVGGYEHVKVLQDIKVVDGHLVQSLKHLPQGTCAGDY---------MLIKKYGETYKGK  111

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             K LCLIT+A+CP+KDP  GTKEDQVSTIA QM A G+RM +++VR     +    +I EN
Sbjct  112   KHLCLITDALCPLKDPDVGTKEDQVSTIARQMVAFGLRMKNIVVRASLSGEPHMRVIIEN  171

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSK++S+K  +V+S TSL GA +TR+I+PVT++RGD ELS K+KIKVWVYKKT 
Sbjct  172   DNLLNIFSKKSSAKTLFVDSTTSLRGARKTRDISPVTIFRGDLELSEKMKIKVWVYKKTG  231

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP TDKFA HE+   YEYK V+DP+K VPPEQRIKGYRYGPQVVPIS
Sbjct  232   EEKFPTLKKYSDKAPSTDKFATHEVKVDYEYKSVEDPSKVVPPEQRIKGYRYGPQVVPIS  291

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEK VKLLGFTDASNI+RHYYMKD N+FIA+P NS+A +AVSALARAMK+
Sbjct  292   SAEWEAVKFKPEKSVKLLGFTDASNILRHYYMKDVNLFIAEPGNSRATVAVSALARAMKE  351

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQ +V +GVLTPNVS+K N+PDS YFN LPFAEDVREFQFPSFS  P
Sbjct  352   MNKVAIVRCVWRQGQQSVVVGVLTPNVSEKINIPDSFYFNVLPFAEDVREFQFPSFSKFP  411

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  PNEQQQEAADNLVKMLDLAPS   E L PE TPNP L+R+YH+LE+KS+H DAA P
Sbjct  412   VSWQPNEQQQEAADNLVKMLDLAPSGKGEILQPELTPNPALERFYHHLELKSEHQDAAPP  471

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD+ L++IT+PDP LL+++++ +D F   F +K+NPK+KKS +R +REKP+GSDE    
Sbjct  472   PLDDSLKKITEPDPTLLAESQSAIDAFCGQFVIKENPKLKKSTRRFLREKPSGSDEPNGD  531

Query  1742  ASTK-------------VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLV  1882
              S               V  +KIG++ P+QDFE M+SRRD P+WV+KAI++MKNKIF L+
Sbjct  532   GSVSDAQAVNSMESKPVVTVDKIGDLTPIQDFEAMMSRRDCPDWVDKAIEDMKNKIFGLL  591

Query  1883  ENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGI  2062
             ENS EG  Y KA+E LVALR GCI+EQEPKQFND+L  +   C++++  +F   L S  +
Sbjct  592   ENSNEGINYPKAVELLVALRKGCILEQEPKQFNDVLEKVCKICRKRNFSTFFDFLMSKKL  651

Query  2063  ALITKTEAPDSDVLESEARSFMTES  2137
             +LI+K+EA DSD+ + EA SF+ +S
Sbjct  652   SLISKSEAVDSDITDDEAGSFIVKS  676



>ref|XP_010479215.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like [Camelina 
sativa]
Length=681

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/675 (62%), Positives = 535/675 (79%), Gaps = 8/675 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNREGL+L+IDVGP+MH VLP++EK CS+L++KKLIY+KYDEVG+++FGT ET NEL 
Sbjct  1     MARNREGLVLLIDVGPAMHSVLPDVEKACSLLLQKKLIYNKYDEVGIVVFGTEETGNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYEHV VLR+I+VVD+ + + ++QLPRG+V GDFLDAVIVGMDM+IK Y    KGK
Sbjct  61    REIGGYEHVKVLRNIRVVDEVVAEHVKQLPRGTVAGDFLDAVIVGMDMLIKMYSGGQKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KR+CLITNA CP KDP+EGTK+DQVSTIA +M A G++M+S+++R     DA + +I+EN
Sbjct  121   KRMCLITNAACPTKDPFEGTKDDQVSTIATKMAAEGIKMESIVMRSNLIGDAHEKVIEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FS    +K   VES  SL+G+++TR +APVTL+RGD E++  +KIKVWVYKK +
Sbjct  181   DHLLNLFSSNAIAKTVNVESPLSLLGSLKTRRVAPVTLFRGDLEINPTMKIKVWVYKKVA  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EER PTL++YSDKAPPTDKFAKHE+   Y+YKV  + T+ + PE+R+KG+RYGPQV+PIS
Sbjct  241   EERLPTLQLYSDKAPPTDKFAKHEVKIDYDYKVTAESTQVIAPEERVKGFRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
               E E +KFK +KG+KLLGFT+ASNI+RHYYMKD N+ + DP   K++LAVSA+AR MK+
Sbjct  301   PDEIETLKFKTDKGMKLLGFTEASNILRHYYMKDVNIVVPDPSKEKSVLAVSAIAREMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
              N+VAIVRCVWR GQGNV +GVLTPNVS++ + PDS YFN LPFAEDVREF FPSF+ LP
Sbjct  361   TNKVAIVRCVWRNGQGNVVVGVLTPNVSERNDTPDSFYFNVLPFAEDVREFPFPSFNKLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  P+EQQQ  ADNLVKMLDLAPS  +E LLP+ TPNPVLQR+Y YLE+KS+  DAA+P
Sbjct  421   SSWKPDEQQQAVADNLVKMLDLAPSAKEEVLLPDLTPNPVLQRFYEYLELKSRSTDAALP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             P+DE  +RI + DPEL S NK+++D FR  FE+K+NPK+KK+ KRL+R+KP+GSD+E  R
Sbjct  481   PMDETFKRIMEQDPELSSNNKSIMDAFRASFEVKENPKLKKASKRLLRDKPSGSDDEDNR  540

Query  1742  ASTKVKSEK----IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL-EGDT  1906
               T   +E     +G++NP+QDFE MISRRD+ +W  KAI +MKN+I  LVEN   EGD 
Sbjct  541   MITYDANENKIDVVGDVNPIQDFEAMISRRDNHDWATKAITQMKNRIVKLVENCTDEGD-  599

Query  1907  YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEA  2086
               KALEC++ALR GC++EQEPKQFN+ L +L+  C+E+ L  F K   S  I LI K+EA
Sbjct  600   --KALECVLALRKGCVLEQEPKQFNEFLNHLFELCQERKLSHFLKHFTSKKITLIPKSEA  657

Query  2087  PDSDVLESEARSFMT  2131
             PDSDV++  A  + T
Sbjct  658   PDSDVVDENAGDYFT  672



>ref|XP_010461606.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 [Camelina 
sativa]
Length=681

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/675 (62%), Positives = 535/675 (79%), Gaps = 8/675 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNREGL+L+IDVGP+MH VLP++EK CS+L++KKLIY+KYDEVG+++FGT ET NEL 
Sbjct  1     MARNREGLVLLIDVGPAMHSVLPDVEKACSLLLQKKLIYNKYDEVGIVVFGTEETGNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYEHVTVLR+I+VVD+ + + ++QLPRG+V GDFLDAVIVGMDM+IK Y    KGK
Sbjct  61    REIGGYEHVTVLRNIRVVDEVVAEHVKQLPRGTVAGDFLDAVIVGMDMLIKMYSGGQKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KR+CLITNA CP KDP+EGTK+DQVSTIA +M A G++M+S+++R     DA + +I+EN
Sbjct  121   KRMCLITNAACPTKDPFEGTKDDQVSTIATKMAAEGIKMESIVMRSNLIGDAHEKVIEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FS    +K   VES  SL+G+++TR +APVTL+RGD E++  +KIKVWVYKK +
Sbjct  181   DHLLNLFSSNAIAKTVNVESPLSLLGSLKTRRVAPVTLFRGDLEINPTMKIKVWVYKKVA  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EER PTL++YSDKAPPTDKFAKHE+   Y+YKV  + T+ + PE+R+KG+RYGPQV+PIS
Sbjct  241   EERLPTLQLYSDKAPPTDKFAKHEVKIDYDYKVTAESTQVIAPEERVKGFRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
               E E +KFK +KG+KLLGFT+ASNI+RHYYMKD N+ + DP   K++LAVSA+AR MK+
Sbjct  301   PDEIETLKFKTDKGMKLLGFTEASNILRHYYMKDVNIVVPDPNKEKSVLAVSAIAREMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
              N+VAIVRCVWR GQGNV +GVLTPNVS++ + PDS YFN LPFAEDVREF FPSF+ LP
Sbjct  361   TNKVAIVRCVWRNGQGNVVVGVLTPNVSEREDTPDSFYFNVLPFAEDVREFPFPSFNKLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  P+EQQQ  ADNLVKMLDLAPS  +E LLP+ TPNPVLQR+Y YLE+KSK  DAA+P
Sbjct  421   ASWKPDEQQQAVADNLVKMLDLAPSAKEEVLLPDLTPNPVLQRFYEYLELKSKFTDAALP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             P+DE  +RI + DPEL S NK+++D FR  FE+K+NPK+KK+ KRL+R+KP+GSD+E  R
Sbjct  481   PMDETFKRIMEQDPELSSNNKSIMDAFRGSFEVKENPKLKKASKRLLRDKPSGSDDEDNR  540

Query  1742  ASTKVKSEK----IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL-EGDT  1906
               T   +E     +G+ NP+QDFE MISRRD+ +W  KAI +MKN+I  LVEN   EGD 
Sbjct  541   MITYDANENKIDIVGDTNPIQDFEAMISRRDNHDWATKAITQMKNRIVKLVENCTDEGD-  599

Query  1907  YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEA  2086
               KALEC++ALR GC++EQEPKQFN+ L +L+  C+E+ L  F K   S  I LI K+EA
Sbjct  600   --KALECVLALRKGCVLEQEPKQFNEFLNHLFELCQERKLPHFLKHFTSKKITLIPKSEA  657

Query  2087  PDSDVLESEARSFMT  2131
             PDSDV++  A  + T
Sbjct  658   PDSDVVDENAGDYFT  672



>ref|XP_010934679.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X2 [Elaeis guineensis]
Length=690

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/682 (63%), Positives = 543/682 (80%), Gaps = 15/682 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E ++L++DVGPSMH VLPE+E+VCS+LV+KKLI+ K DEVG +LFGT +T NEL 
Sbjct  1     MARNKEAVVLLLDVGPSMHSVLPEVERVCSMLVQKKLIFGKSDEVGFVLFGTDDTYNELQ  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEH+ VLR+I VVD + +  L+ LPRG+  GDF+DA++VG+D++IKK+G TNKGK
Sbjct  61    KEVGGYEHIVVLRNIGVVDGNAVGFLQNLPRGNFPGDFIDAIVVGIDLLIKKFGPTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +R+CLIT+A  PIK+PYEGTKEDQV+TI+  M+ HG+R+D +++R K    A+  +++EN
Sbjct  121   QRICLITDAKYPIKEPYEGTKEDQVNTISQMMQTHGIRLDCIVIREKLP-GADLRVMEEN  179

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  FS++  +K  +V+S TSL+GA++TRNI+PVT++RGD ELS+ +KIKVWVYKKTS
Sbjct  180   DSLLDQFSRKAIAKIVHVDSPTSLLGALKTRNISPVTVFRGDLELSSTMKIKVWVYKKTS  239

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YS KA  +DKFA +E+   YEYK ++DP K VPPEQRI+GYRYGPQVVPIS
Sbjct  240   EEKFPTLKKYSGKAHSSDKFATYEVKVDYEYKSMEDPDKVVPPEQRIRGYRYGPQVVPIS  299

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGFTDASNI+RHYYMKD  +FI +P N KAI+AVSA+ARAMKD
Sbjct  300   SAEWEAVKFKPEKGVKLLGFTDASNILRHYYMKDVYIFIPEPGNQKAIVAVSAIARAMKD  359

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+ AI+RCVWRQGQGNV IGVL PN+S   N+PDS YFN LPF EDVREFQFPSF + P
Sbjct  360   MNKSAILRCVWRQGQGNVVIGVLRPNISSVDNIPDSFYFNVLPFVEDVREFQFPSFRSFP  419

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  PNEQQQEAADNLVKMLDL PS+ +E L P++TPNPVL+R+YH+L++KSK  DA VP
Sbjct  420   SSWQPNEQQQEAADNLVKMLDLTPSEGEEVLQPDYTPNPVLERFYHFLDLKSKQPDADVP  479

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEE---  1732
             PLD  LR IT+PDP + S +K+V+D F + FELK+ PK KKS KR  R KP+ S EE   
Sbjct  480   PLDRNLRGITEPDPAVFSCHKSVIDNFHKNFELKEKPKKKKSSKRAWRGKPSASSEEEGV  539

Query  1733  -GE----------RASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYL  1879
              GE          + S+ +  EKIGN+NPVQDFE M++RRDS +WV+KAI+EM+N +  L
Sbjct  540   DGEASGFQSSNLMKDSSNINVEKIGNLNPVQDFEAMMARRDSSKWVSKAIKEMQNHVSDL  599

Query  1880  VENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHG  2059
             +ENS EGD Y KA+ECL+ALR GCI+EQEPK+FN  L  LY   K+ DL +F + L S  
Sbjct  600   LENSYEGDAYSKAIECLLALRKGCILEQEPKEFNRFLLGLYEKWKDTDLANFFELLSSKN  659

Query  2060  IALITKTEAPDSDVLESEARSF  2125
             I LI++ EAPDS+V E +A++F
Sbjct  660   ITLISQKEAPDSNVTEEDAKNF  681



>ref|XP_010544652.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 [Tarenaya 
hassleriana]
Length=668

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/672 (63%), Positives = 528/672 (79%), Gaps = 18/672 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNREGL+L++DVGP MH +LPE+EK CS+L+EKKLI++KYDEVGVI FGT ET NEL 
Sbjct  1     MARNREGLVLLLDVGPPMHGILPEVEKACSLLIEKKLIFNKYDEVGVIFFGTEETRNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              ++GGYEHV V R IK VD++L++ ++QLPRG+V  DFLDA+IVGMDMMIKKYG T KGK
Sbjct  61    RDIGGYEHVIVSRQIKAVDENLVEDIQQLPRGTVAADFLDALIVGMDMMIKKYGPTEKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA+CP KDP+EGTKEDQVSTIA +M A G++M+S++VR     D+++ I+DEN
Sbjct  121   KRLCLITNAVCPTKDPFEGTKEDQVSTIATKMAAEGIKMESIVVRGNLSGDSDQKIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL + S   S++  YVES  SL+GA++TR IAPVT++RGD E++ +LKIKVWVYKK S
Sbjct  181   DHLLKLLSSRASARIVYVESPLSLLGALKTRRIAPVTVFRGDLEINPELKIKVWVYKKVS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EER PTLK YSDKAPPTD+FA+HE+   YEYKV  + ++ + PE+RIKGYRYGPQVVPIS
Sbjct  241   EERLPTLKKYSDKAPPTDEFAQHEVKVDYEYKVSGESSQALAPEERIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             S + EA+KFKPEKG+KLLGFTDASNI RH           +P  +K++LA SA+ARAM  
Sbjct  301   SDQMEALKFKPEKGIKLLGFTDASNIFRH-----------EPGKTKSVLAASAIARAMSQ  349

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
              N+VAI+RCVWR+GQGNV IGVLTPNVSD+ + PDS YFN LPFAEDVREF FPSFS LP
Sbjct  350   ANKVAILRCVWRKGQGNVVIGVLTPNVSDRADTPDSFYFNVLPFAEDVREFPFPSFSRLP  409

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S+ P+EQQQ AADNLVKMLDLAPS  +E L P+ TPNPVLQR+Y +LE+KSK  DAA+P
Sbjct  410   ASLKPDEQQQAAADNLVKMLDLAPSGREEVLKPDLTPNPVLQRFYRFLELKSKSPDAALP  469

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD+ L+ I D D ELL ++K ++D FR  FELK+NP++KK+ K L+REKP+GSD+E +R
Sbjct  470   PLDKTLKGIMDQDSELLLKSKFILDAFRGSFELKENPRLKKASKLLLREKPSGSDDENDR  529

Query  1742  ----ASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTY  1909
                 A  K   +KI + NPVQDFE M+SRRDSP+WV+KAI EMKNKI  L+E   E D  
Sbjct  530   MDVEAENKSLVDKIRDANPVQDFEAMMSRRDSPDWVDKAIVEMKNKILKLIE---EPDGE  586

Query  1910  QKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAP  2089
              KAL CL++LR  C++EQEPKQFN+ LR+LY  C EK+L  F K L    + LI K+EA 
Sbjct  587   DKALACLLSLRKSCVLEQEPKQFNNFLRHLYQLCVEKNLTCFLKHLTCKKVMLIPKSEAE  646

Query  2090  DSDVLESEARSF  2125
             DSDV + EA+ F
Sbjct  647   DSDVADEEAKDF  658



>gb|AAX43993.1| Ku80-like [Vigna radiata]
Length=673

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/668 (65%), Positives = 534/668 (80%), Gaps = 4/668 (1%)
 Frame = +2

Query  134   REGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelg  313
             ++ L+L++DVGPSMH VLPEIEK CS+LV+KK+IYSK DEVG++LFG  +T NELT E+G
Sbjct  5     KDALLLLLDVGPSMHSVLPEIEKACSLLVQKKMIYSKNDEVGIVLFGAEDTDNELTTEVG  64

Query  314   gYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLC  493
             GY+HV VL+ IKVVD D+L+AL+QLPRG+ D DFLDAVIVGMDM+IKK+  TNKGKKRLC
Sbjct  65    GYQHVVVLKKIKVVDGDILEALQQLPRGTTDADFLDAVIVGMDMLIKKFDQTNKGKKRLC  124

Query  494   LITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLL  673
             LITNA CPIK+PYEGTKE+QV+ IA Q+ AHGM+M+S+I R K   DA + I+DEND LL
Sbjct  125   LITNAQCPIKEPYEGTKEEQVTIIAKQLTAHGMKMESIIFRGKLGQDANREIMDENDHLL  184

Query  674   SVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERF  853
             ++FSKETS++  Y+E+  SL GA+RTRNI  VT +RGD E+S KL IKV VYKKT+EE+F
Sbjct  185   NIFSKETSTRLLYLENPISLFGALRTRNITLVTTFRGDLEISPKLSIKVMVYKKTAEEKF  244

Query  854   PTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEW  1033
             PTLK YSDKAP   ++A  E+   YEYK  +D  K + P+QRIKGY YGPQ+VPIS +EW
Sbjct  245   PTLKKYSDKAPTNAQYATRELKIDYEYKSSEDRDKVLSPDQRIKGYPYGPQIVPISRSEW  304

Query  1034  EAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRV  1213
             +AVKF+PEKGVKLLGFTD+SNI RH+YMKD  VF+  P N+ A+LA+SALARAMK+M++V
Sbjct  305   DAVKFQPEKGVKLLGFTDSSNIFRHHYMKDVYVFLPQPGNTGAMLALSALARAMKEMDKV  364

Query  1214  AIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSML  1393
             AI+RCVWR+GQ NV+IGVLTPN+SDK N+PDS Y N LPFAEDVREFQFPSFSN P+S  
Sbjct  365   AILRCVWRKGQSNVSIGVLTPNLSDKENIPDSFYLNVLPFAEDVREFQFPSFSNFPASWK  424

Query  1394  PNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDE  1573
             PN QQ EAA NL+K LDLAP    E LLP+FT NPVL+R+Y +LE+KSK  D AVPP+D+
Sbjct  425   PNGQQLEAAANLIKTLDLAPHGQAEVLLPDFTSNPVLERFYRFLELKSKDPDVAVPPIDD  484

Query  1574  ILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTK  1753
              L++IT+PD +LL QNK+V+D F R FELK  P +KKSR RL   K + +++  E AS K
Sbjct  485   TLKKITEPDADLLLQNKSVIDSFCRSFELKGQP-LKKSR-RLWEGKRSSTNDIIENASVK  542

Query  1754  VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLV  1933
             V  EKIG++ P QDFE +ISRRDSP+WV KAI EMKNKIF LVE+S EGD Y KA ECLV
Sbjct  543   V--EKIGDLTPAQDFEALISRRDSPDWVVKAINEMKNKIFDLVEDSHEGDNYPKAFECLV  600

Query  1934  ALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESE  2113
              LR GCI+EQEPKQFND L+++   C+E  L SFC+ L S  + LI+KTEA DSDV + E
Sbjct  601   VLRKGCILEQEPKQFNDFLKHICNFCRENRLHSFCQYLASKDLTLISKTEAVDSDVTDEE  660

Query  2114  ARSFMTES  2137
             ARSF+ ES
Sbjct  661   ARSFLVES  668



>ref|XP_002273329.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X1 [Vitis vinifera]
Length=688

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/687 (62%), Positives = 542/687 (79%), Gaps = 21/687 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             M RN+E L+L++DV P MH  LPE+EK+C +L++KKLIY+K D VG++LFGT  T NELT
Sbjct  1     MIRNQEALVLLLDVSPPMHNFLPEVEKLCFMLLQKKLIYNKKDLVGIVLFGTKVTKNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +++GGY++V V + IKVVD DL++A+ +LPRG+  GDFLDA++VGMDM+IKK+ +T +GK
Sbjct  61    KKVGGYKYVLVSQDIKVVDGDLVEAVRELPRGTFAGDFLDAIVVGMDMLIKKFLLTKRGK  120

Query  482   --KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIID  655
               KRLCLIT+A+CP K PY+G KED++ TIA QM AHG+R++ ++ R +   +    I++
Sbjct  121   IKKRLCLITSALCPTKGPYKGAKEDEIGTIAEQMTAHGIRLECIVARGRLSGNMNMRIME  180

Query  656   ENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKK  835
             END LL +FSK+T +K  YVES TSL+GA+RTRN+APVT++RGD ELS K++IKVWVYKK
Sbjct  181   ENDLLLKLFSKKTIAKTVYVESPTSLLGALRTRNVAPVTIFRGDLELSPKMEIKVWVYKK  240

Query  836   TSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVP  1015
             ++EE  P LK+YSD+APPTDKFA HE+  + +YK V+DPTK VP  QRI+GY YGPQVVP
Sbjct  241   SAEE-LPVLKLYSDEAPPTDKFATHEVRVNLQYKSVEDPTKVVPLTQRIQGYSYGPQVVP  299

Query  1016  ISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAM  1195
             ISSAEWEAVKF+PEKGVKLLGFTDASNIMRHYY KD N+FIA+P N+KAILAVSALARAM
Sbjct  300   ISSAEWEAVKFEPEKGVKLLGFTDASNIMRHYYKKDVNIFIAEPGNTKAILAVSALARAM  359

Query  1196  KDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSN  1375
             K+MN+VAI+RCVWR+ Q NV IG+LTPNVS+K +VPDS YFN LP+AEDV+EFQFPSFSN
Sbjct  360   KEMNKVAILRCVWRRKQRNVIIGILTPNVSEKDSVPDSFYFNVLPYAEDVQEFQFPSFSN  419

Query  1376  LPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAA  1555
             LP S  PNE+QQEAAD+LV+ML LAP   +E+LLP+ TPNPVL+R+Y YLE+KSK   AA
Sbjct  420   LPLSWQPNEEQQEAADDLVQMLYLAPFGREESLLPDVTPNPVLERFYRYLELKSKKPYAA  479

Query  1556  VPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEG  1735
             VPP+D+ L+ IT+PDP+LL+QNK+++DEF+R FELK NPK+KKS     R++ +G  EE 
Sbjct  480   VPPVDKTLKTITEPDPKLLAQNKSIIDEFKRRFELKQNPKLKKS----TRDRQSGVKEEA  535

Query  1736  --------------ERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIF  1873
                           E  S     +KIG+  P+QDFE M+S R+SPEWV KAI+EMKNKIF
Sbjct  536   NIGESSDAGAINSVENTSVITMVKKIGDSTPIQDFEAMMSHRESPEWVGKAIKEMKNKIF  595

Query  1874  YLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLES  2053
              LV+NS E D + KAL+CLVA R GCI+EQ+P +FN+ L ++Y  CK  +L SFC+ L S
Sbjct  596   DLVQNSNERDNHLKALDCLVAFRKGCILEQKPTEFNNFLLHIYKFCKYHNLNSFCESLAS  655

Query  2054  HGIALITKTEAPDSDVLESEARSFMTE  2134
             + I LI KTE  DS+V E  AR+FM +
Sbjct  656   NEIMLIPKTEVTDSEVTEDGARNFMVK  682



>ref|XP_007052052.1| Ku80 family protein isoform 4 [Theobroma cacao]
 gb|EOX96209.1| Ku80 family protein isoform 4 [Theobroma cacao]
Length=654

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/627 (67%), Positives = 516/627 (82%), Gaps = 13/627 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VLPE+EKVCS+LVEKKLI+ K DEVGV++FGT ET N+LT
Sbjct  1     MARNKEKLVLLLDVGPSMHSVLPEVEKVCSMLVEKKLIFRKNDEVGVVVFGTEETNNDLT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGY+H+ VL  IKVVD DL+  L++LPRG+VDGDFLDA++VGMDM+IKKY   +KGK
Sbjct  61    KEVGGYDHIVVLEDIKVVDGDLIDTLQKLPRGTVDGDFLDAIVVGMDMLIKKYKDIHKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA+ PIKD  EGTKEDQV TIAAQM A GM+M+SV+VR +   DA K I+DEN
Sbjct  121   KRLCLITNAVHPIKDSLEGTKEDQVETIAAQMTAQGMKMESVVVRGRLSQDANKRIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LLS+FSK+T ++  YV+S TSL+GA++TR I PVT++RGD ELS  +KIKVWVYK+T 
Sbjct  181   DRLLSIFSKQTLTRTVYVDSPTSLLGALKTRRITPVTVFRGDLELSPDMKIKVWVYKRTQ  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YS+KAP T+KFA H++   YEYK V   +K VPPEQRIKGYRYGPQVVPIS
Sbjct  241   EEKFPTLKKYSEKAPQTNKFATHQVKVDYEYKTVDGASKVVPPEQRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             +AEW+AVKFKPEKGVKLLGFTDASNIMRHYYMKD  +FIA+P N++AIL+VSA+ARAMK+
Sbjct  301   AAEWDAVKFKPEKGVKLLGFTDASNIMRHYYMKDVYLFIAEPGNTRAILSVSAIARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQ NV +GVLTPN+S    +PDS YFN LPF EDVRE+QFPSF++ P
Sbjct  361   MNKVAILRCVWRQGQQNVVLGVLTPNISQNDKLPDSFYFNVLPFIEDVREYQFPSFNSFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  PNEQQQ+AAD LV+ML+LAPS  +EALLP++TPNPVL+R+Y +LE+KSK  DAAVP
Sbjct  421   VSWQPNEQQQKAADELVQMLNLAPSGKEEALLPDYTPNPVLERFYRHLELKSKQPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD  L+RIT+PDPEL  +NK+V+D  R+ FELK+NPK+KKS +RL+REKP+GS++E   
Sbjct  481   PLDGTLKRITEPDPELFFENKSVIDALRKHFELKENPKLKKSARRLLREKPSGSNDEDGD  540

Query  1742  ASTK-------------VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLV  1882
             A                VK EKIG++ PVQDFE ++SRRDSPEWV KAI+EM++KI  L+
Sbjct  541   ADVSDAQAVNSIEKALVVKIEKIGDLTPVQDFEVILSRRDSPEWVGKAIKEMRDKILGLL  600

Query  1883  ENSLEGDTYQKALECLVALRNGCIVEQ  1963
              +S EGD +  A+EC+ ALR GCI+EQ
Sbjct  601   SDSHEGDNHLIAVECIAALRKGCILEQ  627



>ref|XP_010500317.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like [Camelina 
sativa]
Length=681

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/675 (61%), Positives = 532/675 (79%), Gaps = 8/675 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNREGL+L+IDVGP+MH VLP++EK CS+L++KKLIY+KYDEVG+++FGT ET NEL 
Sbjct  1     MARNREGLVLLIDVGPAMHSVLPDVEKACSLLLQKKLIYNKYDEVGIVVFGTEETGNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYEHVTVLR+I+VVD+ + + ++QLPRG+V GDFLDAVIV MDM+IK Y    KGK
Sbjct  61    REIGGYEHVTVLRNIRVVDEVVAEHVKQLPRGTVAGDFLDAVIVEMDMLIKMYSAGQKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KR+CLITNA CP KDP+EGTK+DQVSTIA +M A G++M+S+++R     DA + +I+EN
Sbjct  121   KRMCLITNAACPTKDPFEGTKDDQVSTIATKMAAEGIKMESIVMRSNLIGDAHEKVIEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FS    +K   VES  SL+G+++TR +APVTL+RGD E++  +KIKVWVYKK +
Sbjct  181   DHLLNLFSSNAIAKTVNVESPLSLLGSLKTRRVAPVTLFRGDLEINPTMKIKVWVYKKVA  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EER  TL++YSDKAPPTDKFAKHE+   Y+YKV  + T+ + PE+R+KG+RYGPQV+PIS
Sbjct  241   EERLSTLQLYSDKAPPTDKFAKHEVKIDYDYKVTAESTQVIAPEERVKGFRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
               E E +KFK +KG+KLLGFT+ASNI+RHYYMKD N+ + DP   K++LAVSA+AR MK+
Sbjct  301   PDEIETLKFKTDKGMKLLGFTEASNILRHYYMKDVNIVVPDPSKEKSVLAVSAIAREMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
              N+VAIVRCVWR GQ NV +GVLTPNVS++ + PDS YFN LPFAEDVREF FPSF+ LP
Sbjct  361   TNKVAIVRCVWRNGQDNVVVGVLTPNVSEREDTPDSFYFNVLPFAEDVREFPFPSFNKLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  P+EQQQ  ADNLVKMLDLAPS  +E LLP+ TPNPVLQR+Y YLE+KSK  DAA+P
Sbjct  421   SSWKPDEQQQAVADNLVKMLDLAPSAKEEVLLPDLTPNPVLQRFYEYLELKSKSTDAALP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             P+DE  +RI + DPEL S NK+++D FR  FE+K+NPK+KK+ KRL+R+KP+GSD+E  R
Sbjct  481   PMDETFKRIMEQDPELSSNNKSIMDAFRGSFEVKENPKLKKASKRLLRDKPSGSDDEDNR  540

Query  1742  AST----KVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL-EGDT  1906
               T    K K + +G+ NP+QDFE MISRRD+ +W  KAI +MK +I  LVEN   EGD 
Sbjct  541   MITYDANKHKIDIVGDANPIQDFEAMISRRDNHDWAIKAITQMKKRIVKLVENCTDEGD-  599

Query  1907  YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEA  2086
               KALEC++ALR GC++EQEPKQFN+ L +L+  C+E+ L  F K   S  I LI K+EA
Sbjct  600   --KALECVLALRKGCVLEQEPKQFNEFLNHLFELCQERKLSHFLKHFTSKKITLIPKSEA  657

Query  2087  PDSDVLESEARSFMT  2131
             PDSDV++  A  + T
Sbjct  658   PDSDVVDENADDYFT  672



>ref|XP_007052050.1| Ku80 family protein isoform 2 [Theobroma cacao]
 gb|EOX96207.1| Ku80 family protein isoform 2 [Theobroma cacao]
Length=646

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/628 (66%), Positives = 516/628 (82%), Gaps = 13/628 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VLPE+EKVCS+LVEKKLI+ K DEVGV++FGT ET N+LT
Sbjct  1     MARNKEKLVLLLDVGPSMHSVLPEVEKVCSMLVEKKLIFRKNDEVGVVVFGTEETNNDLT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGY+H+ VL  IKVVD DL+  L++LPRG+VDGDFLDA++VGMDM+IKKY   +KGK
Sbjct  61    KEVGGYDHIVVLEDIKVVDGDLIDTLQKLPRGTVDGDFLDAIVVGMDMLIKKYKDIHKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA+ PIKD  EGTKEDQV TIAAQM A GM+M+SV+VR +   DA K I+DEN
Sbjct  121   KRLCLITNAVHPIKDSLEGTKEDQVETIAAQMTAQGMKMESVVVRGRLSQDANKRIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LLS+FSK+T ++  YV+S TSL+GA++TR I PVT++RGD ELS  +KIKVWVYK+T 
Sbjct  181   DRLLSIFSKQTLTRTVYVDSPTSLLGALKTRRITPVTVFRGDLELSPDMKIKVWVYKRTQ  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YS+KAP T+KFA H++   YEYK V   +K VPPEQRIKGYRYGPQVVPIS
Sbjct  241   EEKFPTLKKYSEKAPQTNKFATHQVKVDYEYKTVDGASKVVPPEQRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             +AEW+AVKFKPEKGVKLLGFTDASNIMRHYYMKD  +FIA+P N++AIL+VSA+ARAMK+
Sbjct  301   AAEWDAVKFKPEKGVKLLGFTDASNIMRHYYMKDVYLFIAEPGNTRAILSVSAIARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQ NV +GVLTPN+S    +PDS YFN LPF EDVRE+QFPSF++ P
Sbjct  361   MNKVAILRCVWRQGQQNVVLGVLTPNISQNDKLPDSFYFNVLPFIEDVREYQFPSFNSFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  PNEQQQ+AAD LV+ML+LAPS  +EALLP++TPNPVL+R+Y +LE+KSK  DAAVP
Sbjct  421   VSWQPNEQQQKAADELVQMLNLAPSGKEEALLPDYTPNPVLERFYRHLELKSKQPDAAVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD  L+RIT+PDPEL  +NK+V+D  R+ FELK+NPK+KKS +RL+REKP+GS++E   
Sbjct  481   PLDGTLKRITEPDPELFFENKSVIDALRKHFELKENPKLKKSARRLLREKPSGSNDEDGD  540

Query  1742  ASTK-------------VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLV  1882
             A                VK EKIG++ PVQDFE ++SRRDSPEWV KAI+EM++KI  L+
Sbjct  541   ADVSDAQAVNSIEKALVVKIEKIGDLTPVQDFEVILSRRDSPEWVGKAIKEMRDKILGLL  600

Query  1883  ENSLEGDTYQKALECLVALRNGCIVEQE  1966
              +S EGD +  A+EC+ ALR GCI+E +
Sbjct  601   SDSHEGDNHLIAVECIAALRKGCILESQ  628



>gb|KFK36112.1| hypothetical protein AALP_AA4G079700 [Arabis alpina]
Length=681

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/672 (61%), Positives = 525/672 (78%), Gaps = 5/672 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNREGL+L++DVGP+MH +LP +EK CS+L++KKLIY+K+DEVG+++FGT  T NEL 
Sbjct  1     MARNREGLVLLLDVGPAMHDILPHVEKACSLLLQKKLIYNKFDEVGIVVFGTQGTQNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYEHVTVLR+I+ VD+ +++ ++ LPRG+V GDFLDA+IVGMDM+IK Y  T KGK
Sbjct  61    TEIGGYEHVTVLRNIRAVDEAVVEYVKWLPRGTVAGDFLDALIVGMDMLIKMYAATQKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA CP K+P+EGTK+DQVSTIA +M A G++M+S+++R     D  +  IDEN
Sbjct  121   KRLCLITNAACPTKNPFEGTKDDQVSTIAMKMAAEGIKMESIVMRTDLSGDVYENTIDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FS    +K  YV+S  SL+G+ +TR +APVTL+RGD E++  +KIKVWVYKK +
Sbjct  181   DHLLNLFSSNAIAKTVYVDSPLSLLGSFKTRRVAPVTLFRGDLEINPTMKIKVWVYKKVA  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EER PTLKMYSDKAPPTDKFAKHE+   Y+YKV  + ++ + PE+RIKG+RYGPQVVPIS
Sbjct  241   EERLPTLKMYSDKAPPTDKFAKHEVKIDYDYKVTAESSEVLAPEERIKGFRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
               E E +KFKP+KG+KLLGFT+ASNI+RHYYMKD N+ + DP   K+++AVSALAR MK 
Sbjct  301   PEEMETLKFKPDKGMKLLGFTEASNILRHYYMKDVNIVVPDPSKEKSVIAVSALAREMKQ  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
              N+VAIVRCVWR GQGNV +GVLTPNVS++ + PDS YFN LPFAEDVREF FPSFS LP
Sbjct  361   TNKVAIVRCVWRNGQGNVVVGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFSRLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  P+EQQQ  ADN VKMLDLAPS+ +E L P+ TPNPVLQR+Y YLE+KS+  DAA+P
Sbjct  421   ASWKPDEQQQAVADNFVKMLDLAPSEKEEVLKPDLTPNPVLQRFYEYLELKSRSADAALP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             P+DE  +RI + DPEL S NK+++D  R  FE+K+NPK+KKS KRL+R+KP+GSD+E  R
Sbjct  481   PIDEAFKRIMEQDPELSSNNKSIMDALRGNFEVKENPKLKKSSKRLLRDKPSGSDDEDNR  540

Query  1742  ASTKVKS----EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTY  1909
               T   S    + IG+  P+QDFE MISRRD+ +W++KAI +MK +I  LVE     D  
Sbjct  541   MITYHTSDNKIDNIGDGTPIQDFEAMISRRDNHDWIDKAITQMKTRIMKLVEED-STDEN  599

Query  1910  QKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAP  2089
              +ALECL+ALR GC++EQEPKQFN+ L++LY  C+E++L  F     S  I LI K+EA 
Sbjct  600   DRALECLLALRKGCVLEQEPKQFNEFLKHLYELCRERNLSHFLIHFTSKKITLIPKSEAA  659

Query  2090  DSDVLESEARSF  2125
             DSDV + EA  F
Sbjct  660   DSDVTDEEAGCF  671



>ref|XP_006445251.1| hypothetical protein CICLE_v10019016mg [Citrus clementina]
 gb|ESR58491.1| hypothetical protein CICLE_v10019016mg [Citrus clementina]
Length=707

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/627 (67%), Positives = 509/627 (81%), Gaps = 13/627 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MAR RE L+L++DV PSMH VLP++EK+CS L++KKLIY K  EVGVILFGT ET NELT
Sbjct  46    MARTREALLLLLDVSPSMHSVLPDVEKLCSRLIQKKLIYGKNHEVGVILFGTEETENELT  105

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEHV VL+ IKVVD  L+Q+L+ LP+G+  GDFLDA++VG+DM+IKKYG T KGK
Sbjct  106   KEVGGYEHVKVLQDIKVVDGHLVQSLKHLPQGTCAGDFLDAIVVGVDMLIKKYGETYKGK  165

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             K LCLIT+A+CP+KDP  GTKEDQVSTIA QM A G+RM +++VR     +    +I EN
Sbjct  166   KHLCLITDALCPLKDPDVGTKEDQVSTIARQMVAFGLRMKNIVVRASLSGEPHMRVIIEN  225

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSK++S+K  +V+S TSL GA +TR+I+PVT++RGD ELS K+KIKVWVYKKT 
Sbjct  226   DNLLNIFSKKSSAKTLFVDSTTSLRGARKTRDISPVTIFRGDLELSEKMKIKVWVYKKTG  285

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP TDKFA HE+   YEYK V+DP+K VPPEQRIKGYRYGPQVVPIS
Sbjct  286   EEKFPTLKKYSDKAPSTDKFATHEVKVDYEYKSVEDPSKVVPPEQRIKGYRYGPQVVPIS  345

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEK VKLLGFTDASNI+RHYYMKD N+FIA+P NS+A +AVSALARAMK+
Sbjct  346   SAEWEAVKFKPEKSVKLLGFTDASNILRHYYMKDVNLFIAEPGNSRATVAVSALARAMKE  405

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQ +V +GVLTPNVS+K N+PDS YFN LPFAEDVREFQFPSFS  P
Sbjct  406   MNKVAIVRCVWRQGQQSVVVGVLTPNVSEKINIPDSFYFNVLPFAEDVREFQFPSFSKFP  465

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  PNEQQQEAADNLVKMLDLAPS   E L PE TPNP L+R+YH+LE+KS+H DAA P
Sbjct  466   VSWQPNEQQQEAADNLVKMLDLAPSGKGEILQPELTPNPALERFYHHLELKSEHQDAAPP  525

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD+ L++IT+PDP LL+++++ +D F   F +K+NPK+KKS +R +REKP+GSDE    
Sbjct  526   PLDDSLKKITEPDPTLLAESQSAIDAFCGQFVIKENPKLKKSTRRFLREKPSGSDEPNGD  585

Query  1742  ASTK-------------VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLV  1882
              S               V  +KIG++ P+QDFE M+SRRD P+WV+KAI++MKNKIF L+
Sbjct  586   GSVSDAQAVNSMESKPVVTVDKIGDLTPIQDFEAMMSRRDCPDWVDKAIEDMKNKIFGLL  645

Query  1883  ENSLEGDTYQKALECLVALRNGCIVEQ  1963
             ENS EG  Y KA+E LVALR GCI+EQ
Sbjct  646   ENSNEGINYPKAVELLVALRKGCILEQ  672



>ref|XP_002891405.1| hypothetical protein ARALYDRAFT_891612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67664.1| hypothetical protein ARALYDRAFT_891612 [Arabidopsis lyrata subsp. 
lyrata]
Length=680

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/673 (61%), Positives = 528/673 (78%), Gaps = 8/673 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNREGL+LV+DVGP+MH VLP++EK CS+L++KKLIY+KYDEVG+++FGT ET NEL 
Sbjct  1     MARNREGLVLVLDVGPAMHSVLPDVEKACSMLLQKKLIYNKYDEVGIVVFGTEETGNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYE+VTVLR+I+VVD+ + + ++QLPRG+V GDFLDA+IVGMDM+IK YG   KGK
Sbjct  61    REIGGYENVTVLRNIRVVDEVVAEHVKQLPRGTVAGDFLDALIVGMDMLIKMYGNAQKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA CP KDP+EGTK+DQVSTIA +M A G++M+S+++R     DA + +I+EN
Sbjct  121   KRLCLITNAACPTKDPFEGTKDDQVSTIAMKMAAEGIKMESIVMRSNLSGDAHERVIEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FS    +K   VES  SL+G+++TR +APVTL+RGD E++  +KIKVWVYKK +
Sbjct  181   DHLLNLFSSNAIAKTVNVESPLSLLGSLKTRRVAPVTLFRGDLEINPTMKIKVWVYKKVA  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EER PTLKMYSDKAPPTDKFAKHE+   Y+YKV  + T+ + PE+RIKG+RYG QV+PIS
Sbjct  241   EERLPTLKMYSDKAPPTDKFAKHEVKIDYDYKVTAESTEVIAPEERIKGFRYGRQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
               + E +KFK +KG+KLLGFT+ASNI+RHYYMKD N+ + DP   K++LAVSA+AR MK 
Sbjct  301   PDQIETLKFKTDKGMKLLGFTEASNILRHYYMKDVNIVVPDPSKEKSVLAVSAIAREMKQ  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
              N VAIVRCVWR GQGN  +GVLTPNVS++ + PDS YFN LPFAEDVREF FPSF+ LP
Sbjct  361   TNMVAIVRCVWRNGQGNAVVGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFNKLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  P+EQQQ  ADNLVKMLDLAPS  +E L P+ TPNPVLQR+Y YLE+KSK  D+A+P
Sbjct  421   SSWKPDEQQQAVADNLVKMLDLAPSAKEEVLKPDLTPNPVLQRFYEYLELKSKSTDSALP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             P+DE  +R+ + DPEL+S NK+++D FR  FE+K+NPK+KK+ KRL+R+KP+GSD+E  R
Sbjct  481   PMDETFKRLIEQDPELISNNKSIMDSFRGSFEVKENPKLKKASKRLLRDKPSGSDDEDNR  540

Query  1742  ASTKVKSEK----IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL-EGDT  1906
               T   +EK    +G+ NP+QDFE MISRRD  +W  KAI +MKN I  LVEN   EGD 
Sbjct  541   MITYEPNEKKIDVVGDANPIQDFEAMISRRDKTDWTEKAITQMKNLIMKLVENCTDEGD-  599

Query  1907  YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEA  2086
               KALEC++ALR GC++EQEPKQFN+ L +L+  C+E+ L    +   S  I LI K+EA
Sbjct  600   --KALECVLALRKGCVLEQEPKQFNEFLNHLFKVCQERKLSHLLEHFTSKKITLIPKSEA  657

Query  2087  PDSDVLESEARSF  2125
              DSDV++  +  F
Sbjct  658   ADSDVVDENSGDF  670



>gb|KDO85830.1| hypothetical protein CISIN_1g005544mg [Citrus sinensis]
Length=662

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/627 (67%), Positives = 509/627 (81%), Gaps = 13/627 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MAR RE L+L++DV PSMH VLP++EK+CS L++KKLIY K  EVGVILFGT ET NELT
Sbjct  1     MARTREALLLLLDVSPSMHSVLPDVEKLCSRLIQKKLIYGKNHEVGVILFGTEETENELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEHV VL+ IKVVD  L+Q+L+ LP+G+  GDFLDA++VG+DM+IKKYG T KGK
Sbjct  61    KEVGGYEHVKVLQDIKVVDGHLVQSLKHLPQGTCAGDFLDAIVVGVDMLIKKYGETYKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             K LCLIT+A+CP+KDP  GTKEDQVSTIA QM A G+RM +++VR     +    +I EN
Sbjct  121   KHLCLITDALCPLKDPDVGTKEDQVSTIARQMVAFGLRMKNIVVRASLSGEPHMRVIIEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSK++S+K  +V+S TSL GA +TR+I+PVT++RGD ELS K+KIKVWVYKKT 
Sbjct  181   DNLLNIFSKKSSAKTLFVDSTTSLRGARKTRDISPVTIFRGDLELSEKMKIKVWVYKKTG  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP TDKFA HE+   YEYK V+DP+K VPPEQRIKGYRYGPQVVPIS
Sbjct  241   EEKFPTLKKYSDKAPSTDKFATHEVKVDYEYKSVEDPSKVVPPEQRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEK VKLLGFTDASNI+RHYYMKD N+FIA+P NS+A +AVSALARAMK+
Sbjct  301   SAEWEAVKFKPEKSVKLLGFTDASNILRHYYMKDVNLFIAEPGNSRATVAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQ +V +GVLTPNVS+K N+PDS YFN LPFAEDVREFQFPSFS  P
Sbjct  361   MNKVAIVRCVWRQGQQSVVVGVLTPNVSEKINIPDSFYFNVLPFAEDVREFQFPSFSKFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  PNEQQQEAADNLVKMLDLAPS   E L PE TPNP L+R+YH+LE+KS+H DAA P
Sbjct  421   VSWQPNEQQQEAADNLVKMLDLAPSGKGEILQPELTPNPALERFYHHLELKSEHQDAAPP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD+ L++IT+PDP LL+++++ +D F   F +K+NPK+KKS +R +REKP+GSDE    
Sbjct  481   PLDDSLKKITEPDPTLLAESQSAIDAFCGQFVIKENPKLKKSTRRFLREKPSGSDEPNGD  540

Query  1742  ASTK-------------VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLV  1882
              S               V  +KIG++ P+QDFE M+SRRD P+WV+KAI++MKNKIF L+
Sbjct  541   GSVSDAQAVNSMESKPVVTVDKIGDLTPIQDFEAMMSRRDCPDWVDKAIEDMKNKIFGLL  600

Query  1883  ENSLEGDTYQKALECLVALRNGCIVEQ  1963
             ENS EG  Y KA+E LVALR GCI+EQ
Sbjct  601   ENSNEGINYPKAVELLVALRKGCILEQ  627



>ref|NP_564520.1| ATP-dependent DNA helicase 2 subunit KU80 [Arabidopsis thaliana]
 sp|Q9FQ09.1|KU80_ARATH RecName: Full=ATP-dependent DNA helicase 2 subunit KU80; AltName: 
Full=ATP-dependent DNA helicase 2 subunit 2; AltName: Full=ATP-dependent 
DNA helicase II 80 kDa subunit [Arabidopsis 
thaliana]
 gb|AAG44851.1|AF283758_1 Ku80-like protein [Arabidopsis thaliana]
 gb|AEE32242.1| Ku80 family protein [Arabidopsis thaliana]
Length=680

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/676 (61%), Positives = 531/676 (79%), Gaps = 8/676 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNREGL+LV+DVGP+M  VLP++EK CS+L++KKLIY+KYDEVG+++FGT ET NEL 
Sbjct  1     MARNREGLVLVLDVGPAMRSVLPDVEKACSMLLQKKLIYNKYDEVGIVVFGTEETGNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYE+VTVLR+I+VVD+   + ++QLPRG+V GDFLDA+IVGMDM+IK YG  +KGK
Sbjct  61    REIGGYENVTVLRNIRVVDELAAEHVKQLPRGTVAGDFLDALIVGMDMLIKMYGNAHKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KR+CLITNA CP KDP+EGTK+DQVSTIA +M A G++M+S+++R     DA + +I+EN
Sbjct  121   KRMCLITNAACPTKDPFEGTKDDQVSTIAMKMAAEGIKMESIVMRSNLSGDAHERVIEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FS    +K   V+S  SL+G+++TR +APVTL+RGD E++  +KIKVWVYKK +
Sbjct  181   DHLLTLFSSNAIAKTVNVDSPLSLLGSLKTRRVAPVTLFRGDLEINPTMKIKVWVYKKVA  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EER PTLKMYSDKAPPTDKFAKHE+   Y+YKV  + T+ + PE+RIKG+RYGPQV+PIS
Sbjct  241   EERLPTLKMYSDKAPPTDKFAKHEVKVDYDYKVTAESTEVIAPEERIKGFRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
               + E +KFK +KG+KLLGFT+ASNI+RHYYMKD N+ + DP   K++LAVSA+AR MK+
Sbjct  301   PDQIETLKFKTDKGMKLLGFTEASNILRHYYMKDVNIVVPDPSKEKSVLAVSAIAREMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
              N+VAIVRCVWR GQGNV +GVLTPNVS++ + PDS YFN LPFAEDVREF FPSF+ LP
Sbjct  361   TNKVAIVRCVWRNGQGNVVVGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFNKLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  P+EQQQ  ADNLVKMLDLAPS  +E L P+ TPNPVLQR+Y YLE+KSK  DA +P
Sbjct  421   SSWKPDEQQQAVADNLVKMLDLAPSAEEEVLKPDLTPNPVLQRFYEYLELKSKSTDATLP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             P+D   +R+ + DPEL S NK+++D FR  FE+K+NPK+KK+ KRL+R+KP+GSD+E  R
Sbjct  481   PMDGTFKRLMEQDPELSSNNKSIMDTFRGSFEVKENPKLKKASKRLLRDKPSGSDDEDNR  540

Query  1742  AST----KVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL-EGDT  1906
               T    + K + +G+ NP+QDFE MISRRD  +W  KAI +MKN I  LVEN   EGD 
Sbjct  541   MITYDAKENKIDIVGDANPIQDFEAMISRRDKTDWTEKAITQMKNLIMKLVENCTDEGD-  599

Query  1907  YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEA  2086
               KALEC++ALR GC++EQEPKQFN+ L +L+  C+E++L    +   S  I LI K+EA
Sbjct  600   --KALECVLALRKGCVLEQEPKQFNEFLNHLFKLCQERNLSHLLEHFMSKKITLIPKSEA  657

Query  2087  PDSDVLESEARSFMTE  2134
              DSD+++  A  F+ +
Sbjct  658   ADSDIVDENAGDFIVK  673



>ref|XP_010934678.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X1 [Elaeis guineensis]
Length=708

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/700 (61%), Positives = 543/700 (78%), Gaps = 33/700 (5%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E ++L++DVGPSMH VLPE+E+VCS+LV+KKLI+ K DEVG +LFGT +T NEL 
Sbjct  1     MARNKEAVVLLLDVGPSMHSVLPEVERVCSMLVQKKLIFGKSDEVGFVLFGTDDTYNELQ  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEH+ VLR+I VVD + +  L+ LPRG+  GDF+DA++VG+D++IKK+G TNKGK
Sbjct  61    KEVGGYEHIVVLRNIGVVDGNAVGFLQNLPRGNFPGDFIDAIVVGIDLLIKKFGPTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +R+CLIT+A  PIK+PYEGTKEDQV+TI+  M+ HG+R+D +++R K    A+  +++EN
Sbjct  121   QRICLITDAKYPIKEPYEGTKEDQVNTISQMMQTHGIRLDCIVIREKLP-GADLRVMEEN  179

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  FS++  +K  +V+S TSL+GA++TRNI+PVT++RGD ELS+ +KIKVWVYKKTS
Sbjct  180   DSLLDQFSRKAIAKIVHVDSPTSLLGALKTRNISPVTVFRGDLELSSTMKIKVWVYKKTS  239

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YS KA  +DKFA +E+   YEYK ++DP K VPPEQRI+GYRYGPQVVPIS
Sbjct  240   EEKFPTLKKYSGKAHSSDKFATYEVKVDYEYKSMEDPDKVVPPEQRIRGYRYGPQVVPIS  299

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGFTDASNI+RHYYMKD  +FI +P N KAI+AVSA+ARAMKD
Sbjct  300   SAEWEAVKFKPEKGVKLLGFTDASNILRHYYMKDVYIFIPEPGNQKAIVAVSAIARAMKD  359

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+ AI+RCVWRQGQGNV IGVL PN+S   N+PDS YFN LPF EDVREFQFPSF + P
Sbjct  360   MNKSAILRCVWRQGQGNVVIGVLRPNISSVDNIPDSFYFNVLPFVEDVREFQFPSFRSFP  419

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQ------------------  1507
             SS  PNEQQQEAADNLVKMLDL PS+ +E L P++TPNPVL+                  
Sbjct  420   SSWQPNEQQQEAADNLVKMLDLTPSEGEEVLQPDYTPNPVLEVSYCFTQTVSPTCYDKIR  479

Query  1508  RYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKS  1687
             R+YH+L++KSK  DA VPPLD  LR IT+PDP + S +K+V+D F + FELK+ PK KKS
Sbjct  480   RFYHFLDLKSKQPDADVPPLDRNLRGITEPDPAVFSCHKSVIDNFHKNFELKEKPKKKKS  539

Query  1688  RKRLIREKPTGSDEE----GE----------RASTKVKSEKIGNINPVQDFEDMISRRDS  1825
              KR  R KP+ S EE    GE          + S+ +  EKIGN+NPVQDFE M++RRDS
Sbjct  540   SKRAWRGKPSASSEEEGVDGEASGFQSSNLMKDSSNINVEKIGNLNPVQDFEAMMARRDS  599

Query  1826  PEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYA  2005
              +WV+KAI+EM+N +  L+ENS EGD Y KA+ECL+ALR GCI+EQEPK+FN  L  LY 
Sbjct  600   SKWVSKAIKEMQNHVSDLLENSYEGDAYSKAIECLLALRKGCILEQEPKEFNRFLLGLYE  659

Query  2006  SCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSF  2125
               K+ DL +F + L S  I LI++ EAPDS+V E +A++F
Sbjct  660   KWKDTDLANFFELLSSKNITLISQKEAPDSNVTEEDAKNF  699



>ref|XP_008791289.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X1 [Phoenix dactylifera]
Length=689

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/683 (62%), Positives = 543/683 (80%), Gaps = 17/683 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E ++L++DVGPSMH VL E+E VCS+LV+KKLI+ K DEVGV+L GT +T NEL 
Sbjct  1     MARNKEAVVLLLDVGPSMHSVLSEVESVCSMLVQKKLIFGKSDEVGVVLLGTDDTCNELQ  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEH+ VLR+I VVD + +  L+ LPRG+  GDF+DA +VG+D++IKK+G TNKGK
Sbjct  61    KEVGGYEHIVVLRNISVVDGNAVDFLQNLPRGNFRGDFIDATVVGIDLLIKKFGPTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +R+CL+T+A  PIK PYEGTKEDQV+TI+  M+ HG+R+D +++R K   +A+  +++EN
Sbjct  121   QRICLMTDARYPIKAPYEGTKEDQVNTISQMMQTHGIRLDCIVIREKLP-EADLRVMEEN  179

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  FS++  +K  +V+S+TSL+GA++TRNI+PVT++RGD ELS+ +KIKVWVYKKTS
Sbjct  180   DNLLDQFSRKAIAKIVHVDSSTSLLGALKTRNISPVTVFRGDLELSSTMKIKVWVYKKTS  239

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP +DKFA +E+   YEYK ++DP K VPPEQRI+GYRYGPQVVPIS
Sbjct  240   EEKFPTLKKYSDKAPSSDKFATYEVKVDYEYKSMEDPDKVVPPEQRIRGYRYGPQVVPIS  299

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGFTDASNI+RHYYMKD  +F+ +P N KAI+AVSA+ARAMKD
Sbjct  300   SAEWEAVKFKPEKGVKLLGFTDASNILRHYYMKDVYIFVPEPGNKKAIVAVSAIARAMKD  359

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+ AI+RCVWRQGQGNV IGVL PN+S   N+PDS YFN LPF EDVREFQFPSFS+ P
Sbjct  360   MNKSAILRCVWRQGQGNVVIGVLRPNISSVDNIPDSFYFNVLPFVEDVREFQFPSFSSFP  419

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  PNEQQQEAADNLVKMLDLAPS S+E L P++TPNPVL+R+YH+LE+KSK  DA VP
Sbjct  420   SSWQPNEQQQEAADNLVKMLDLAPS-SKEVLQPDYTPNPVLERFYHFLELKSKQPDADVP  478

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGE-  1738
             PLD  L+RIT+P+P + S +K+V+D F + FELK+NPK KKS KR  R KP+   E+ E 
Sbjct  479   PLDGSLKRITEPNPAVFSHHKSVIDNFCKNFELKENPKKKKSSKRAWRGKPSTFSEKEEG  538

Query  1739  --------------RASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFY  1876
                           + S+ +  EKIGN+NPVQDFE M++RRDS +WV+KAI++M+N +  
Sbjct  539   VDGEASDIQSSNLMKDSSNINVEKIGNLNPVQDFEAMMARRDSSKWVSKAIKDMQNHVSD  598

Query  1877  LVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESH  2056
             L+ENS +GD Y KA+ECLVALR GCI+EQEPK+FN  L  LY   K+ DL +F + L S 
Sbjct  599   LLENSYDGDAYSKAIECLVALRKGCILEQEPKEFNRYLLGLYEKWKDTDLANFFELLSSK  658

Query  2057  GIALITKTEAPDSDVLESEARSF  2125
              + LI++ EA DS+V E  A++F
Sbjct  659   SLTLISQKEASDSNVTEEAAKNF  681



>ref|XP_010661632.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X2 [Vitis vinifera]
Length=671

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/675 (62%), Positives = 534/675 (79%), Gaps = 21/675 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             M RN+E L+L++DV P MH  LPE+EK+C +L++KKLIY+K D VG++LFGT  T NELT
Sbjct  1     MIRNQEALVLLLDVSPPMHNFLPEVEKLCFMLLQKKLIYNKKDLVGIVLFGTKVTKNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +++GGY++V V + IKVVD DL++A+ +LPRG+  GDFLDA++VGMDM+IKK+ +T +GK
Sbjct  61    KKVGGYKYVLVSQDIKVVDGDLVEAVRELPRGTFAGDFLDAIVVGMDMLIKKFLLTKRGK  120

Query  482   --KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIID  655
               KRLCLIT+A+CP K PY+G KED++ TIA QM AHG+R++ ++ R +   +    I++
Sbjct  121   IKKRLCLITSALCPTKGPYKGAKEDEIGTIAEQMTAHGIRLECIVARGRLSGNMNMRIME  180

Query  656   ENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKK  835
             END LL +FSK+T +K  YVES TSL+GA+RTRN+APVT++RGD ELS K++IKVWVYKK
Sbjct  181   ENDLLLKLFSKKTIAKTVYVESPTSLLGALRTRNVAPVTIFRGDLELSPKMEIKVWVYKK  240

Query  836   TSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVP  1015
             ++EE  P LK+YSD+APPTDKFA HE+  + +YK V+DPTK VP  QRI+GY YGPQVVP
Sbjct  241   SAEE-LPVLKLYSDEAPPTDKFATHEVRVNLQYKSVEDPTKVVPLTQRIQGYSYGPQVVP  299

Query  1016  ISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAM  1195
             ISSAEWEAVKF+PEKGVKLLGFTDASNIMRHYY KD N+FIA+P N+KAILAVSALARAM
Sbjct  300   ISSAEWEAVKFEPEKGVKLLGFTDASNIMRHYYKKDVNIFIAEPGNTKAILAVSALARAM  359

Query  1196  KDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSN  1375
             K+MN+VAI+RCVWR+ Q NV IG+LTPNVS+K +VPDS YFN LP+AEDV+EFQFPSFSN
Sbjct  360   KEMNKVAILRCVWRRKQRNVIIGILTPNVSEKDSVPDSFYFNVLPYAEDVQEFQFPSFSN  419

Query  1376  LPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAA  1555
             LP S  PNE+QQEAAD+LV+ML LAP   +E+LLP+ TPNPVL+R+Y YLE+KSK   AA
Sbjct  420   LPLSWQPNEEQQEAADDLVQMLYLAPFGREESLLPDVTPNPVLERFYRYLELKSKKPYAA  479

Query  1556  VPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEG  1735
             VPP+D+ L+ IT+PDP+LL+QNK+++DEF+R FELK NPK+KKS     R++ +G  EE 
Sbjct  480   VPPVDKTLKTITEPDPKLLAQNKSIIDEFKRRFELKQNPKLKKS----TRDRQSGVKEEA  535

Query  1736  --------------ERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIF  1873
                           E  S     +KIG+  P+QDFE M+S R+SPEWV KAI+EMKNKIF
Sbjct  536   NIGESSDAGAINSVENTSVITMVKKIGDSTPIQDFEAMMSHRESPEWVGKAIKEMKNKIF  595

Query  1874  YLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLES  2053
              LV+NS E D + KAL+CLVA R GCI+EQ+P +FN+ L ++Y  CK  +L SFC+ L S
Sbjct  596   DLVQNSNERDNHLKALDCLVAFRKGCILEQKPTEFNNFLLHIYKFCKYHNLNSFCESLAS  655

Query  2054  HGIALITKTEAPDSD  2098
             + I LI KTE  DS+
Sbjct  656   NEIMLIPKTEVTDSN  670



>ref|XP_006303163.1| hypothetical protein CARUB_v10008497mg [Capsella rubella]
 gb|EOA36061.1| hypothetical protein CARUB_v10008497mg [Capsella rubella]
Length=678

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/673 (61%), Positives = 525/673 (78%), Gaps = 8/673 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNREGL+L++DVGP+MH VLP++EK CS+L++KKLIY+KYDEVG+++FGT ETANEL 
Sbjct  1     MARNREGLVLLLDVGPAMHSVLPDVEKACSLLLQKKLIYNKYDEVGIVVFGTEETANELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYEHV VLR+I+VVD+ + + ++ LPRG+V GDFLDA+IVGMDM+IK Y    KGK
Sbjct  61    TEIGGYEHVKVLRNIRVVDEVVAEHVKHLPRGTVAGDFLDALIVGMDMLIKIYSGGQKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KR+CLITNA CP KDP+EGTK+DQVSTIA +M A G++M+S+++R     DA + +I+EN
Sbjct  121   KRMCLITNAACPTKDPFEGTKDDQVSTIAMKMAAEGIKMESIVMRSSLSGDAHEKVIEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FS    +K  YVES  SL+G+++TR +APVTL+RGD E++  +KIKVWVYKK +
Sbjct  181   DHLLNLFSSNAIAKTVYVESPLSLLGSLKTRRVAPVTLFRGDLEINPTMKIKVWVYKKVA  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EER PTLKMYSDKAPPTDKFAKHE+   Y+YK+  + T+ + PE+R+KG+RYGPQV+PIS
Sbjct  241   EERLPTLKMYSDKAPPTDKFAKHEVKIDYDYKLTAESTQVIAPEERVKGFRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
               E E +KFK +KG+KLLGFT+ASNI+RHYYMKD N+ + DP   K++LAVSA+AR MK 
Sbjct  301   PDEIETLKFKTDKGMKLLGFTEASNILRHYYMKDVNIVVPDPSKEKSVLAVSAIAREMKQ  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
              N+VAIVRCVWR GQGNV +GVLTPNVS++ + PDS YFN LPFAEDVREF FPSF+ LP
Sbjct  361   TNKVAIVRCVWRNGQGNVVVGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFNKLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  P+EQQQ  ADN VKMLDLAPS  +E L P+ TPNPVLQR+Y YLE+KS   DA +P
Sbjct  421   SSWKPDEQQQAVADNFVKMLDLAPSPKEEVLNPDLTPNPVLQRFYEYLELKSNSTDAVLP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             P+DE  +RI + DPEL S NK+++D F   F++K NPK+KK+ KRL+R+KP+GSD+E  R
Sbjct  481   PMDETFKRIMEQDPELSSNNKSIMDAFCGSFDVKKNPKLKKASKRLLRDKPSGSDDEDNR  540

Query  1742  AST----KVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL-EGDT  1906
               T    + K + +G+ NP+QDFE MISRRD+ +W NKAI +MK +I  LVEN   EGD 
Sbjct  541   MITYDAKENKIDIVGDANPIQDFEAMISRRDNQDWTNKAITQMKTQILKLVENCTDEGD-  599

Query  1907  YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEA  2086
               KALECL+ALR GC++EQEPKQFN+ L +L+  C+E+    F K   S  I LI K+EA
Sbjct  600   --KALECLLALRKGCVLEQEPKQFNEFLNHLFKLCQERKSSHFLKHFTSKKITLIPKSEA  657

Query  2087  PDSDVLESEARSF  2125
              DSDV++     F
Sbjct  658   ADSDVVDENVGDF  670



>ref|XP_009107395.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 [Brassica 
rapa]
Length=682

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/672 (61%), Positives = 526/672 (78%), Gaps = 4/672 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNREGL+L++D+GP+MH VLP++EK CS+L++KKLIY+K+DEVG+++FGT ET NEL 
Sbjct  1     MARNREGLVLLVDIGPAMHSVLPDVEKTCSLLMQKKLIYNKFDEVGIVVFGTQETENELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              ++GGYE++ VLR+IKVVD+ ++  +++LPRG V GDFLDA+IVGMDM+IK YG   KGK
Sbjct  61    RDIGGYENIKVLRNIKVVDELVVDLVKRLPRGPVAGDFLDALIVGMDMLIKMYGAGQKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA CP KDP+EGTK++QVSTIA +M A G++M+S+++R     D ++ II+EN
Sbjct  121   KRLCLITNAACPTKDPFEGTKDEQVSTIAVKMAAEGIKMESIVMRADASGDVDERIIEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FS    +K  YVES  SL+G+++TR +APVTL+RGD E++  +KIKVWVYKK +
Sbjct  181   DHLLTLFSTNAIAKTVYVESPLSLLGSLKTRRVAPVTLFRGDLEINASMKIKVWVYKKVA  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EER PTLKMYSDKAPP+DKFAKHE+   Y+YKV  + ++ + PE+RIKG+RYGP V+PIS
Sbjct  241   EERLPTLKMYSDKAPPSDKFAKHEVKIDYDYKVTAETSEVLAPEERIKGFRYGPHVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
               E E +KFK EKG+KLLGFTDASNI+RHYYMKD N+ + DP   K+++AVSALAR M+ 
Sbjct  301   PDEMETLKFKTEKGMKLLGFTDASNILRHYYMKDVNIVVPDPSKEKSVIAVSALAREMRQ  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
              N+VAIVRCVWR GQGNV +GVLTPNVS++ + PDS YFN LPFAEDVREF FPSFS  P
Sbjct  361   TNKVAIVRCVWRNGQGNVVVGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFSRFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S+ P+EQQQ  ADNLVKMLDLAPS  +E L PE TPNPVLQR+Y YLE+KSK  DAA+P
Sbjct  421   ASLKPDEQQQAVADNLVKMLDLAPSPKEEVLKPELTPNPVLQRFYEYLELKSKSTDAALP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             P++E  +RI + DPEL S NK+++D F   FE+K+NPK++K+ KRL+R+KP+GSD+E  R
Sbjct  481   PMNEAFKRIMEQDPELSSSNKSIMDSFSGSFEVKENPKLRKASKRLLRDKPSGSDDEDNR  540

Query  1742  ASTKVKSEK----IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTY  1909
               T   +E     +G+ NPVQDFE MISRRD  +W +KAI EMK +I  LVE+S   D  
Sbjct  541   MITYNPNENSIDTVGDANPVQDFEAMISRRDGNDWTDKAISEMKKRIVKLVEDSSTTDEG  600

Query  1910  QKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAP  2089
              KALECL++LR  C++EQEPKQFN+ L +LY  C+EK L  F +   S  I +I K+EA 
Sbjct  601   DKALECLLSLRKCCVLEQEPKQFNEFLNHLYELCQEKKLSHFLEHFTSKKITMIPKSEAA  660

Query  2090  DSDVLESEARSF  2125
             DSDV + EA  F
Sbjct  661   DSDVADEEAADF  672



>emb|CDY65827.1| BnaA08g29690D [Brassica napus]
Length=690

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/670 (60%), Positives = 524/670 (78%), Gaps = 9/670 (1%)
 Frame = +2

Query  134   REGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelg  313
             +EGL+L++D+GP+MH VLP++EK CS+L++KKLIY+K+DEVG+++FGT ET NEL  ++G
Sbjct  14    QEGLVLLVDIGPAMHSVLPDVEKTCSLLMQKKLIYNKFDEVGIVVFGTQETENELARDIG  73

Query  314   gYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLC  493
             GYE++ VLR+IKVVD+ ++  +++LPRG V GDFLDA+IVGMDM+IK YG   KGKKRLC
Sbjct  74    GYENIKVLRNIKVVDELVVDLVKRLPRGPVAGDFLDALIVGMDMLIKMYGAGQKGKKRLC  133

Query  494   LITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLL  673
             LITNA CP KDP+EGTK++QVSTIA +M A G++M+S+++R     D ++ II+END LL
Sbjct  134   LITNAACPTKDPFEGTKDEQVSTIAVKMAAEGIKMESIVMRADASGDVDERIIEENDHLL  193

Query  674   SVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERF  853
             ++FS    +K  YVES  SL+G+++TR +APVTL+RGD E++  +KIKVWVYKK +EER 
Sbjct  194   TLFSTNAIAKTVYVESPLSLLGSLKTRRVAPVTLFRGDLEINASMKIKVWVYKKVAEERL  253

Query  854   PTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEW  1033
             PTLKMYSDKAPP+DKFAKHE+   Y+YKV  + ++ + PE+RIKG+RYGP V+PIS  E 
Sbjct  254   PTLKMYSDKAPPSDKFAKHEVKIDYDYKVTAETSEVLAPEERIKGFRYGPHVIPISPDEM  313

Query  1034  EAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRV  1213
             E +KFK EKG+KLLGFTDASNI+RHYYMKD N+ + DP   K+++AVSALAR M+  N+V
Sbjct  314   ETLKFKTEKGMKLLGFTDASNILRHYYMKDVNIVVPDPSKEKSVIAVSALAREMRQTNKV  373

Query  1214  AIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSML  1393
             AIVRCVWR GQGNV +GVLTPNVS++ + PDS YFN LPFAEDVREF FPSFS  P+S+ 
Sbjct  374   AIVRCVWRNGQGNVVVGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFSRFPASLK  433

Query  1394  PNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDE  1573
             P+EQQQ  ADNLVKMLDLAPS  +E L PE TPNPVLQR+Y YLE+KSK  DAA+PP++E
Sbjct  434   PDEQQQAVADNLVKMLDLAPSPKEEVLKPELTPNPVLQRFYEYLELKSKSTDAALPPMNE  493

Query  1574  ILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTK  1753
               +RI + DPEL S NK+++D F   FE+K+NPK++K+ KRL+R+KP+GSD+E  R  T 
Sbjct  494   AFKRIMEQDPELSSSNKSIMDSFSGSFEVKENPKLRKASKRLLRDKPSGSDDEDNRMITY  553

Query  1754  VKSEK----IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL--EGDTYQK  1915
               +E     +G+ NPVQ+FE M+SRRD  +W +KAI EMK +I  LVE+S   EGD   K
Sbjct  554   NANENSIDTVGDANPVQNFEAMMSRRDGSDWTDKAISEMKKRIVKLVEDSTTDEGD---K  610

Query  1916  ALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDS  2095
             ALECL++LR  C++EQEPKQFN+ L +LY  C+EK L  F +   S  I +I K+EA DS
Sbjct  611   ALECLLSLRKCCVLEQEPKQFNEFLNHLYELCQEKKLSHFLEHFTSKKITMIPKSEAADS  670

Query  2096  DVLESEARSF  2125
             DV + EA  F
Sbjct  671   DVADEEAADF  680



>ref|XP_010934680.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X3 [Elaeis guineensis]
Length=678

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/686 (61%), Positives = 528/686 (77%), Gaps = 35/686 (5%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E ++L++DVGPSMH VLPE+E+VCS+LV+KKLI+ K DEVG +LFGT +T NEL 
Sbjct  1     MARNKEAVVLLLDVGPSMHSVLPEVERVCSMLVQKKLIFGKSDEVGFVLFGTDDTYNELQ  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEH+ VLR+I VVD + +  L+ LPRG+  GDF+DA++VG+D++IKK+G TNKGK
Sbjct  61    KEVGGYEHIVVLRNIGVVDGNAVGFLQNLPRGNFPGDFIDAIVVGIDLLIKKFGPTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +R+CLIT+A  PIK+PYEGTKEDQV+TI+  M+ HG+R+D +++R K    A+  +++EN
Sbjct  121   QRICLITDAKYPIKEPYEGTKEDQVNTISQMMQTHGIRLDCIVIREKLP-GADLRVMEEN  179

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  FS++  +K  +V+S TSL+GA++TRNI+PVT++RGD ELS+ +KIKVWVYKKTS
Sbjct  180   DSLLDQFSRKAIAKIVHVDSPTSLLGALKTRNISPVTVFRGDLELSSTMKIKVWVYKKTS  239

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YS KA  +DKFA +E+   YEYK ++DP K VPPEQRI+GYRYGPQVVPIS
Sbjct  240   EEKFPTLKKYSGKAHSSDKFATYEVKVDYEYKSMEDPDKVVPPEQRIRGYRYGPQVVPIS  299

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGFTDASNI+RHYYMKD  +FI +P N KAI+AVSA+ARAMKD
Sbjct  300   SAEWEAVKFKPEKGVKLLGFTDASNILRHYYMKDVYIFIPEPGNQKAIVAVSAIARAMKD  359

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+ AI+RCVWRQGQGNV IGVL PN+S   N+PDS YFN LPF EDVREFQFPSF + P
Sbjct  360   MNKSAILRCVWRQGQGNVVIGVLRPNISSVDNIPDSFYFNVLPFVEDVREFQFPSFRSFP  419

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQ------------------  1507
             SS  PNEQQQEAADNLVKMLDL PS+ +E L P++TPNPVL+                  
Sbjct  420   SSWQPNEQQQEAADNLVKMLDLTPSEGEEVLQPDYTPNPVLEVSYCFTQTVSPTCYDKIR  479

Query  1508  RYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKS  1687
             R+YH+L++KSK  DA VPPLD  LR IT+PDP + S +K+V+D F + FELK+ PK KKS
Sbjct  480   RFYHFLDLKSKQPDADVPPLDRNLRGITEPDPAVFSCHKSVIDNFHKNFELKEKPKKKKS  539

Query  1688  RKRLIREKPTGSDEEGERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNK  1867
              KR  R KP+ S EE                  V DFE M++RRDS +WV+KAI+EM+N 
Sbjct  540   SKRAWRGKPSASSEE----------------EGVDDFEAMMARRDSSKWVSKAIKEMQNH  583

Query  1868  IFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQL  2047
             +  L+ENS EGD Y KA+ECL+ALR GCI+EQEPK+FN  L  LY   K+ DL +F + L
Sbjct  584   VSDLLENSYEGDAYSKAIECLLALRKGCILEQEPKEFNRFLLGLYEKWKDTDLANFFELL  643

Query  2048  ESHGIALITKTEAPDSDVLESEARSF  2125
              S  I LI++ EAPDS+V E +A++F
Sbjct  644   SSKNITLISQKEAPDSNVTEEDAKNF  669



>ref|XP_008791290.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X2 [Phoenix dactylifera]
Length=659

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/668 (62%), Positives = 530/668 (79%), Gaps = 17/668 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E ++L++DVGPSMH VL E+E VCS+LV+KKLI+ K DEVGV+L GT +T NEL 
Sbjct  1     MARNKEAVVLLLDVGPSMHSVLSEVESVCSMLVQKKLIFGKSDEVGVVLLGTDDTCNELQ  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEH+ VLR+I VVD + +  L+ LPRG+  GDF+DA +VG+D++IKK+G TNKGK
Sbjct  61    KEVGGYEHIVVLRNISVVDGNAVDFLQNLPRGNFRGDFIDATVVGIDLLIKKFGPTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +R+CL+T+A  PIK PYEGTKEDQV+TI+  M+ HG+R+D +++R K   +A+  +++EN
Sbjct  121   QRICLMTDARYPIKAPYEGTKEDQVNTISQMMQTHGIRLDCIVIREKLP-EADLRVMEEN  179

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  FS++  +K  +V+S+TSL+GA++TRNI+PVT++RGD ELS+ +KIKVWVYKKTS
Sbjct  180   DNLLDQFSRKAIAKIVHVDSSTSLLGALKTRNISPVTVFRGDLELSSTMKIKVWVYKKTS  239

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP +DKFA +E+   YEYK ++DP K VPPEQRI+GYRYGPQVVPIS
Sbjct  240   EEKFPTLKKYSDKAPSSDKFATYEVKVDYEYKSMEDPDKVVPPEQRIRGYRYGPQVVPIS  299

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGFTDASNI+RHYYMKD  +F+ +P N KAI+AVSA+ARAMKD
Sbjct  300   SAEWEAVKFKPEKGVKLLGFTDASNILRHYYMKDVYIFVPEPGNKKAIVAVSAIARAMKD  359

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+ AI+RCVWRQGQGNV IGVL PN+S   N+PDS YFN LPF EDVREFQFPSFS+ P
Sbjct  360   MNKSAILRCVWRQGQGNVVIGVLRPNISSVDNIPDSFYFNVLPFVEDVREFQFPSFSSFP  419

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  PNEQQQEAADNLVKMLDLAPS S+E L P++TPNPVL+R+YH+LE+KSK  DA VP
Sbjct  420   SSWQPNEQQQEAADNLVKMLDLAPS-SKEVLQPDYTPNPVLERFYHFLELKSKQPDADVP  478

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD  L+RIT+P+P + S +K+V+D F + FELK+NPK KKS KR  R KP+   E+ E 
Sbjct  479   PLDGSLKRITEPNPAVFSHHKSVIDNFCKNFELKENPKKKKSSKRAWRGKPSTFSEKEEG  538

Query  1742  ASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKAL  1921
                            V DFE M++RRDS +WV+KAI++M+N +  L+ENS +GD Y KA+
Sbjct  539   ---------------VDDFEAMMARRDSSKWVSKAIKDMQNHVSDLLENSYDGDAYSKAI  583

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
             ECLVALR GCI+EQEPK+FN  L  LY   K+ DL +F + L S  + LI++ EA DS+V
Sbjct  584   ECLVALRKGCILEQEPKEFNRYLLGLYEKWKDTDLANFFELLSSKSLTLISQKEASDSNV  643

Query  2102  LESEARSF  2125
              E  A++F
Sbjct  644   TEEAAKNF  651



>emb|CDX77346.1| BnaC08g03910D [Brassica napus]
Length=742

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/668 (60%), Positives = 520/668 (78%), Gaps = 5/668 (1%)
 Frame = +2

Query  134   REGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelg  313
             +EGL+L++D+GP+MH VLP++EK CS+L++KKLIY+K+DEVG+++FGT ET NEL  ++G
Sbjct  66    QEGLVLLVDIGPAMHSVLPDVEKTCSLLMQKKLIYNKFDEVGIVVFGTQETENELARDIG  125

Query  314   gYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLC  493
             GYE+V VLR+IKVVD+ ++  +++LPRG V GDFLDA+IVGMDM+IK YG   KGKKRLC
Sbjct  126   GYENVKVLRNIKVVDELVVDLVKRLPRGPVAGDFLDALIVGMDMLIKMYGAGQKGKKRLC  185

Query  494   LITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLL  673
             LITNA CP KDP+EGTK++QVSTIA +M A G++M+S+++R     D ++ II+END LL
Sbjct  186   LITNAACPTKDPFEGTKDEQVSTIAVKMAAEGIKMESIVMRADASGDIDERIIEENDHLL  245

Query  674   SVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERF  853
             S FS    +K  YVES  SL+G+++TR +APVTL+RGD E++  +KIKVWVYKK +EER 
Sbjct  246   SFFSTNAIAKTVYVESPLSLLGSLKTRRVAPVTLFRGDLEINPSMKIKVWVYKKVAEERL  305

Query  854   PTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEW  1033
             PTLKMYSDKAPP+DKFAKHE+   Y+YKV  + ++ + PE+RIKG+RYGP V+PIS  E 
Sbjct  306   PTLKMYSDKAPPSDKFAKHEVKIDYDYKVTAETSEVLAPEERIKGFRYGPHVIPISPDEM  365

Query  1034  EAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRV  1213
             E +KFK EKG+KLLGFTDASNI+RHYYMKD N+ + DP   K+++AVSALAR MK  N+V
Sbjct  366   ETLKFKTEKGMKLLGFTDASNILRHYYMKDVNIVVPDPSKEKSVIAVSALAREMKQTNKV  425

Query  1214  AIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSML  1393
             AIVRCVWR GQGNV +GVLTPNVS++ + PDS YFN LPFAEDVREF FPSFS  P+S+ 
Sbjct  426   AIVRCVWRNGQGNVVVGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFSRFPASLK  485

Query  1394  PNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDE  1573
             P+EQQQ  +DNLVKMLDLAPS  +E L PE TPNPVLQR+Y YLE+KSK  DAA+PP++E
Sbjct  486   PDEQQQAVSDNLVKMLDLAPSPKEEVLKPELTPNPVLQRFYEYLELKSKSTDAALPPMNE  545

Query  1574  ILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTK  1753
               +RI + DPEL S NK+++D F   FE+K+NPK++K+ KRL+R+KP+GSD+E  R  T 
Sbjct  546   AFKRIMEQDPELSSSNKSIMDSFSGSFEVKENPKLRKASKRLLRDKPSGSDDEDNRMITY  605

Query  1754  VKSEK----IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKAL  1921
               +E     +G+ NPVQDFE MISRRD  +W +KAI EMK +I  LVE+S   D   KAL
Sbjct  606   NANENSIDTVGDANPVQDFEAMISRRDGNDWTDKAISEMKKRIVKLVEDST-TDEVDKAL  664

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
             ECL++LR  C++EQEPKQFN+ L +LY  C+EK L  F     S  I +I K+EA DSDV
Sbjct  665   ECLLSLRKCCVLEQEPKQFNEFLNHLYELCQEKKLSHFLAHFTSKKITMIPKSEAADSDV  724

Query  2102  LESEARSF  2125
              + EA  F
Sbjct  725   ADEEAADF  732



>gb|AAG51535.1|AC051631_15 hypothetical protein; 39910-36975 [Arabidopsis thaliana]
Length=663

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/659 (60%), Positives = 514/659 (78%), Gaps = 8/659 (1%)
 Frame = +2

Query  173   MHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKV  352
             M  VLP++EK CS+L++KKLIY+KYDEVG+++FGT ET NEL  E+GGYE+VTVLR+I+V
Sbjct  1     MRSVLPDVEKACSMLLQKKLIYNKYDEVGIVVFGTEETGNELAREIGGYENVTVLRNIRV  60

Query  353   VDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPY  532
             VD+   + ++QLPRG+V GDFLDA+IVGMDM+IK YG  +KGKKR+CLITNA CP KDP+
Sbjct  61    VDELAAEHVKQLPRGTVAGDFLDALIVGMDMLIKMYGNAHKGKKRMCLITNAACPTKDPF  120

Query  533   EGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLSVFSKETSSKAAY  712
             EGTK+DQVSTIA +M A G++M+S+++R     DA + +I+END LL++FS    +K   
Sbjct  121   EGTKDDQVSTIAMKMAAEGIKMESIVMRSNLSGDAHERVIEENDHLLTLFSSNAIAKTVN  180

Query  713   VESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPT  892
             V+S  SL+G+++TR +APVTL+RGD E++  +KIKVWVYKK +EER PTLKMYSDKAPPT
Sbjct  181   VDSPLSLLGSLKTRRVAPVTLFRGDLEINPTMKIKVWVYKKVAEERLPTLKMYSDKAPPT  240

Query  893   DKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKL  1072
             DKFAKHE+   Y+YKV  + T+ + PE+RIKG+RYGPQV+PIS  + E +KFK +KG+KL
Sbjct  241   DKFAKHEVKVDYDYKVTAESTEVIAPEERIKGFRYGPQVIPISPDQIETLKFKTDKGMKL  300

Query  1073  LGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             LGFT+ASNI+RHYYMKD N+ + DP   K++LAVSA+AR MK+ N+VAIVRCVWR GQGN
Sbjct  301   LGFTEASNILRHYYMKDVNIVVPDPSKEKSVLAVSAIAREMKETNKVAIVRCVWRNGQGN  360

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
             V +GVLTPNVS++ + PDS YFN LPFAEDVREF FPSF+ LPSS  P+EQQQ  ADNLV
Sbjct  361   VVVGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFNKLPSSWKPDEQQQAVADNLV  420

Query  1433  KMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELL  1612
             KMLDLAPS  +E L P+ TPNPVLQR+Y YLE+KSK  DA +PP+D   +R+ + DPEL 
Sbjct  421   KMLDLAPSAEEEVLKPDLTPNPVLQRFYEYLELKSKSTDATLPPMDGTFKRLMEQDPELS  480

Query  1613  SQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERAST----KVKSEKIGNI  1780
             S NK+++D FR  FE+K+NPK+KK+ KRL+R+KP+GSD+E  R  T    + K + +G+ 
Sbjct  481   SNNKSIMDTFRGSFEVKENPKLKKASKRLLRDKPSGSDDEDNRMITYDAKENKIDIVGDA  540

Query  1781  NPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL-EGDTYQKALECLVALRNGCIV  1957
             NP+QDFE MISRRD  +W  KAI +MKN I  LVEN   EGD   KALEC++ALR GC++
Sbjct  541   NPIQDFEAMISRRDKTDWTEKAITQMKNLIMKLVENCTDEGD---KALECVLALRKGCVL  597

Query  1958  EQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMTE  2134
             EQEPKQFN+ L +L+  C+E++L    +   S  I LI K+EA DSD+++  A  F+ +
Sbjct  598   EQEPKQFNEFLNHLFKLCQERNLSHLLEHFMSKKITLIPKSEAADSDIVDENAGDFIVK  656



>emb|CBI38851.3| unnamed protein product [Vitis vinifera]
Length=690

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/653 (62%), Positives = 514/653 (79%), Gaps = 21/653 (3%)
 Frame = +2

Query  224   KKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPRGSV  403
             + LIY+K D VG++LFGT  T NELT+++GGY++V V + IKVVD DL++A+ +LPRG+ 
Sbjct  37    RHLIYNKKDLVGIVLFGTKVTKNELTKKVGGYKYVLVSQDIKVVDGDLVEAVRELPRGTF  96

Query  404   DGDFLDAVIVGMDMMIKKYGITNKGK--KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQM  577
              GDFLDA++VGMDM+IKK+ +T +GK  KRLCLIT+A+CP K PY+G KED++ TIA QM
Sbjct  97    AGDFLDAIVVGMDMLIKKFLLTKRGKIKKRLCLITSALCPTKGPYKGAKEDEIGTIAEQM  156

Query  578   KAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRN  757
              AHG+R++ ++ R +   +    I++END LL +FSK+T +K  YVES TSL+GA+RTRN
Sbjct  157   TAHGIRLECIVARGRLSGNMNMRIMEENDLLLKLFSKKTIAKTVYVESPTSLLGALRTRN  216

Query  758   IAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYK  937
             +APVT++RGD ELS K++IKVWVYKK++EE  P LK+YSD+APPTDKFA HE+  + +YK
Sbjct  217   VAPVTIFRGDLELSPKMEIKVWVYKKSAEE-LPVLKLYSDEAPPTDKFATHEVRVNLQYK  275

Query  938   VVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYM  1117
              V+DPTK VP  QRI+GY YGPQVVPISSAEWEAVKF+PEKGVKLLGFTDASNIMRHYY 
Sbjct  276   SVEDPTKVVPLTQRIQGYSYGPQVVPISSAEWEAVKFEPEKGVKLLGFTDASNIMRHYYK  335

Query  1118  KDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGN  1297
             KD N+FIA+P N+KAILAVSALARAMK+MN+VAI+RCVWR+ Q NV IG+LTPNVS+K +
Sbjct  336   KDVNIFIAEPGNTKAILAVSALARAMKEMNKVAILRCVWRRKQRNVIIGILTPNVSEKDS  395

Query  1298  VPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALL  1477
             VPDS YFN LP+AEDV+EFQFPSFSNLP S  PNE+QQEAAD+LV+ML LAP   +E+LL
Sbjct  396   VPDSFYFNVLPYAEDVQEFQFPSFSNLPLSWQPNEEQQEAADDLVQMLYLAPFGREESLL  455

Query  1478  PEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFE  1657
             P+ TPNPVL+R+Y YLE+KSK   AAVPP+D+ L+ IT+PDP+LL+QNK+++DEF+R FE
Sbjct  456   PDVTPNPVLERFYRYLELKSKKPYAAVPPVDKTLKTITEPDPKLLAQNKSIIDEFKRRFE  515

Query  1658  LKDNPKMKKSRKRLIREKPTGSDEEG--------------ERASTKVKSEKIGNINPVQD  1795
             LK NPK+KKS     R++ +G  EE               E  S     +KIG+  P+QD
Sbjct  516   LKQNPKLKKS----TRDRQSGVKEEANIGESSDAGAINSVENTSVITMVKKIGDSTPIQD  571

Query  1796  FEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQ  1975
             FE M+S R+SPEWV KAI+EMKNKIF LV+NS E D + KAL+CLVA R GCI+EQ+P +
Sbjct  572   FEAMMSHRESPEWVGKAIKEMKNKIFDLVQNSNERDNHLKALDCLVAFRKGCILEQKPTE  631

Query  1976  FNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMTE  2134
             FN+ L ++Y  CK  +L SFC+ L S+ I LI KTE  DS+V E  AR+FM +
Sbjct  632   FNNFLLHIYKFCKYHNLNSFCESLASNEIMLIPKTEVTDSEVTEDGARNFMVK  684



>ref|XP_006580032.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X4 [Glycine max]
Length=635

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/677 (61%), Positives = 513/677 (76%), Gaps = 52/677 (8%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH  L EIEKVCS+LV KKLIYSKYDEVG++LFGT +T NELT
Sbjct  1     MARNKEALLLLLDVGPSMHPALSEIEKVCSMLVHKKLIYSKYDEVGIVLFGTEDTNNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGY+HV VL++IKVVD D+++AL+QLPRG+ DGDFLDAVIVGMD+++KK+G+TNKGK
Sbjct  61    TEVGGYQHVVVLKNIKVVDGDIVEALQQLPRGTTDGDFLDAVIVGMDVLVKKFGVTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KR+CLITNA C IK+  EGTKE+QV+TIA QM AHG++M+S+I+R K   DA KGI+DEN
Sbjct  121   KRVCLITNAQCQIKESDEGTKEEQVTTIAKQMTAHGIKMESIIMRGKLSQDANKGIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSKETS++  YVE+  SL GA+RTRNIA VT++RG  E+S KL IKV VYKKT+
Sbjct  181   DRLLNIFSKETSTRLLYVENPISLFGALRTRNIALVTVFRGHLEISPKLSIKVMVYKKTT  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FP++K YSDKAPP DKFAKHE+   YE+K  +DP K VPP+QRIKGY YGPQ+VPIS
Sbjct  241   EEKFPSMKKYSDKAPPNDKFAKHEVKIDYEHKSSKDPDKVVPPDQRIKGYPYGPQIVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKL+GFTD+SN+ RH+YMKD  VF+ +P N++A++AVSA+ARAMK+
Sbjct  301   SAEWEAVKFKPEKGVKLMGFTDSSNVFRHHYMKDVYVFLPEPGNTRAMIAVSAVARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNV----PDSLYFNALPFAEDVREFQFPSF  1369
             MN+VAIVRCVWRQGQ NV IGVLTPN+SDK N+    PDS Y N LPFAEDVREFQFPSF
Sbjct  361   MNKVAIVRCVWRQGQANVVIGVLTPNLSDKENIFSVQPDSFYLNVLPFAEDVREFQFPSF  420

Query  1370  SNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHD  1549
             +N P+S  PN QQ EAA NL+K LDLAP   +E LLP+FTPNPVL++       KS+   
Sbjct  421   TNFPASWQPNGQQLEAAANLIKTLDLAPHGQEEVLLPDFTPNPVLEK-------KSRR--  471

Query  1550  AAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDE  1729
                                LL   ++    F    E+K N          I  +P     
Sbjct  472   -------------------LLGGKRS----FSNDEEVKGN----------ITAQPANL--  496

Query  1730  EGERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTY  1909
                  +  V   KIG++ PVQ FE +ISRRDSP+WV KAI EMKNKIF LVE+S EGD Y
Sbjct  497   ---TGNASVNVGKIGDLTPVQYFEALISRRDSPDWVVKAINEMKNKIFDLVEDSHEGDNY  553

Query  1910  QKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAP  2089
              KALECLVALR GCI+EQEP+QFND L++L+  C+EK+L SFC+ L S  + LI+KTEA 
Sbjct  554   PKALECLVALRKGCILEQEPEQFNDFLKHLWNFCQEKNLPSFCEYLASKELTLISKTEAI  613

Query  2090  DSDVLESEAR-SFMTES  2137
             DS+  + +AR  F+ +S
Sbjct  614   DSENTDDKARKGFLVKS  630



>ref|XP_009399523.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=692

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/683 (60%), Positives = 538/683 (79%), Gaps = 15/683 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L+IDVGPS+H VL ++E VCS+LV+KKLI+SK DEVG++LFGT +T NEL 
Sbjct  1     MARNKESLVLLIDVGPSIHSVLQDVEGVCSMLVQKKLIFSKSDEVGIVLFGTEDTNNELE  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEHV VLR I+VVDDD +  L+ LP+G+  GDFLDA++VGMDM+IKK+G+++KGK
Sbjct  61    KEVGGYEHVAVLRDIRVVDDDAVVVLKNLPKGTFPGDFLDAIVVGMDMLIKKFGVSDKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRL LIT+A    K+PYEGTKEDQV TI+ QMK  G+R++ +I+R K       G IDEN
Sbjct  121   KRLYLITDARFSTKEPYEGTKEDQVDTISQQMKVLGIRLNCLIIREKICSTEHLGAIDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  FS++  +K  +V+ ATSL+GAI+TRN+ PVT++RGD ELS+ +KIKVWVYKKTS
Sbjct  181   DKLLDQFSRKAMAKTVHVDCATSLLGAIKTRNVVPVTVFRGDLELSSMMKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP +DKFA HE+   +EYK  QDP K VPPEQRIKGYRYGPQVVPIS
Sbjct  241   EEKFPTLKKYSDKAPASDKFATHEVKVDFEYKSSQDPDKVVPPEQRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFK EKGVKLLGFTD SNI+RHYYM+D  +FI +P N+KAI+AVSALA+AMK+
Sbjct  301   SAEWEAVKFKSEKGVKLLGFTDVSNILRHYYMRDVYIFIPEPGNTKAIIAVSALAKAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+ A++RCVWRQGQGNV++GVLTPN+S   N+PDS YFN LPFAEDVREFQFPSFS+ P
Sbjct  361   MNKSAVLRCVWRQGQGNVSVGVLTPNLSSIDNIPDSFYFNILPFAEDVREFQFPSFSSFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  P++ QQEAAD+LV+MLDLAP D +E L P++TPNPVL+R+Y +L +KSK  +  VP
Sbjct  421   SSWQPDQHQQEAADDLVRMLDLAPFDRKEVLQPDYTPNPVLERFYQFLHLKSKAPEIDVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEG--  1735
              LD  L+RI +PDP+ LS++ ++++ F+  FELK+NPK KK  ++  REKP+ S++E   
Sbjct  481   QLDRSLKRIAEPDPDFLSRHNSIINNFQERFELKENPKKKKLSRQAWREKPSASNDEKVG  540

Query  1736  -ERASTKVKS------------EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFY  1876
              +    KV+S            EKIG++NPVQDFE M++RRDS +W+ +AI++M++ I++
Sbjct  541   VDGVVPKVQSSSLKKSLSSLEVEKIGDLNPVQDFEAMMARRDSSKWITEAIKDMQHYIYH  600

Query  1877  LVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESH  2056
             L+ENS EG++Y KA+ECL+ALR GCI+EQEPK+FN  + ++    +  DL  F + L S 
Sbjct  601   LLENSYEGNSYPKAIECLMALRKGCILEQEPKEFNRFMLDICKKFRRSDLADFLELLYSK  660

Query  2057  GIALITKTEAPDSDVLESEARSF  2125
              I LI+K+EA DSD+ E EA++ 
Sbjct  661   KIPLISKSEAADSDLTEEEAKNL  683



>ref|XP_010661633.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X3 [Vitis vinifera]
 ref|XP_010661634.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X3 [Vitis vinifera]
Length=658

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/629 (63%), Positives = 503/629 (80%), Gaps = 21/629 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             M RN+E L+L++DV P MH  LPE+EK+C +L++KKLIY+K D VG++LFGT  T NELT
Sbjct  1     MIRNQEALVLLLDVSPPMHNFLPEVEKLCFMLLQKKLIYNKKDLVGIVLFGTKVTKNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +++GGY++V V + IKVVD DL++A+ +LPRG+  GDFLDA++VGMDM+IKK+ +T +GK
Sbjct  61    KKVGGYKYVLVSQDIKVVDGDLVEAVRELPRGTFAGDFLDAIVVGMDMLIKKFLLTKRGK  120

Query  482   --KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIID  655
               KRLCLIT+A+CP K PY+G KED++ TIA QM AHG+R++ ++ R +   +    I++
Sbjct  121   IKKRLCLITSALCPTKGPYKGAKEDEIGTIAEQMTAHGIRLECIVARGRLSGNMNMRIME  180

Query  656   ENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKK  835
             END LL +FSK+T +K  YVES TSL+GA+RTRN+APVT++RGD ELS K++IKVWVYKK
Sbjct  181   ENDLLLKLFSKKTIAKTVYVESPTSLLGALRTRNVAPVTIFRGDLELSPKMEIKVWVYKK  240

Query  836   TSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVP  1015
             ++EE  P LK+YSD+APPTDKFA HE+  + +YK V+DPTK VP  QRI+GY YGPQVVP
Sbjct  241   SAEE-LPVLKLYSDEAPPTDKFATHEVRVNLQYKSVEDPTKVVPLTQRIQGYSYGPQVVP  299

Query  1016  ISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAM  1195
             ISSAEWEAVKF+PEKGVKLLGFTDASNIMRHYY KD N+FIA+P N+KAILAVSALARAM
Sbjct  300   ISSAEWEAVKFEPEKGVKLLGFTDASNIMRHYYKKDVNIFIAEPGNTKAILAVSALARAM  359

Query  1196  KDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSN  1375
             K+MN+VAI+RCVWR+ Q NV IG+LTPNVS+K +VPDS YFN LP+AEDV+EFQFPSFSN
Sbjct  360   KEMNKVAILRCVWRRKQRNVIIGILTPNVSEKDSVPDSFYFNVLPYAEDVQEFQFPSFSN  419

Query  1376  LPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAA  1555
             LP S  PNE+QQEAAD+LV+ML LAP   +E+LLP+ TPNPVL+R+Y YLE+KSK   AA
Sbjct  420   LPLSWQPNEEQQEAADDLVQMLYLAPFGREESLLPDVTPNPVLERFYRYLELKSKKPYAA  479

Query  1556  VPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEG  1735
             VPP+D+ L+ IT+PDP+LL+QNK+++DEF+R FELK NPK+KKS     R++ +G  EE 
Sbjct  480   VPPVDKTLKTITEPDPKLLAQNKSIIDEFKRRFELKQNPKLKKS----TRDRQSGVKEEA  535

Query  1736  --------------ERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIF  1873
                           E  S     +KIG+  P+QDFE M+S R+SPEWV KAI+EMKNKIF
Sbjct  536   NIGESSDAGAINSVENTSVITMVKKIGDSTPIQDFEAMMSHRESPEWVGKAIKEMKNKIF  595

Query  1874  YLVENSLEGDTYQKALECLVALRNGCIVE  1960
              LV+NS E D + KAL+CLVA R GCI+E
Sbjct  596   DLVQNSNERDNHLKALDCLVAFRKGCILE  624



>gb|KHN25856.1| ATP-dependent DNA helicase 2 subunit KU80 [Glycine soja]
Length=642

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/683 (60%), Positives = 514/683 (75%), Gaps = 57/683 (8%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH  L EIEKVCS+LV KKLIYSKYDEVG++LFGT +T NELT
Sbjct  1     MARNKEALLLLLDVGPSMHPALSEIEKVCSMLVHKKLIYSKYDEVGIVLFGTEDTNNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGY+HV VL++IKVVD D+++AL+QLPRG+ DGDFLDAVIVGMD+++KK+G+TNKGK
Sbjct  61    TEVGGYQHVVVLKNIKVVDGDIVEALQQLPRGTTDGDFLDAVIVGMDVLVKKFGVTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KR+CLITNA C IK+  EGTKE+QV+TIA QM AHG++M+S+I+R K   DA KGI+DEN
Sbjct  121   KRVCLITNAQCQIKESDEGTKEEQVTTIAKQMTAHGIKMESIIMRGKLSQDANKGIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSKETS++  YVE+  SL GA+RTRNIA VT++RG  E+S KL IKV VYKKT+
Sbjct  181   DRLLNIFSKETSTRLLYVENPISLFGALRTRNIALVTVFRGHLEISPKLSIKVMVYKKTT  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FP++K YSDKAPP DKFAKHE+   YE+K  +DP K VPP+QRIKGY YGPQ+VPIS
Sbjct  241   EEKFPSMKKYSDKAPPNDKFAKHEVKIDYEHKSSKDPDKVVPPDQRIKGYPYGPQIVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKL+GFTD+SN+ RH+YMKD  VF+ +P N++A++AVSA+ARAMK+
Sbjct  301   SAEWEAVKFKPEKGVKLMGFTDSSNVFRHHYMKDVYVFLPEPGNTRAMIAVSAVARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIV CVW                                      EFQFPSF+N P
Sbjct  361   MNKVAIVCCVW-------------------------------------GEFQFPSFTNFP  383

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  PN QQ EA  NL+K LDLAP   +E LLP+FTPNPVL+R+YHYLE+KSK  D AVP
Sbjct  384   ASWQPNGQQLEATANLIKKLDLAPHGQEEVLLPDFTPNPVLERFYHYLELKSKDPDVAVP  443

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGE-  1738
             PLD  L++IT+PD +LL QNK+ +D F R FELK NP +KKSR+ L  ++   +DEE + 
Sbjct  444   PLDGTLKKITEPDTDLLLQNKSEIDSFCRSFELKGNP-LKKSRRLLGGKRSFSNDEEVKG  502

Query  1739  ---------RASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENS  1891
                        +  VK  KIG++ PVQ FE +ISRRDSP+WV KAI EMKNKIF LVE+S
Sbjct  503   NITAQPANLTGNASVKVGKIGDLTPVQYFEALISRRDSPDWVVKAINEMKNKIFDLVEDS  562

Query  1892  LEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALI  2071
              EGD Y KALECLVAL        EP+QFND L++L+  C+EK+L SFC+ L S  + LI
Sbjct  563   HEGDNYLKALECLVAL--------EPEQFNDFLKHLWNFCQEKNLPSFCEYLASKELTLI  614

Query  2072  TKTEAPDSDVLESEAR-SFMTES  2137
             +KTEA DS+  + +AR  F+ +S
Sbjct  615   SKTEAIDSENTDDKARKGFLVKS  637



>ref|XP_010661635.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X4 [Vitis vinifera]
Length=657

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/687 (58%), Positives = 516/687 (75%), Gaps = 52/687 (8%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             M RN+E L+L++DV P MH  LPE+EK+C +L++KKLIY+K D VG++LFGT  T NELT
Sbjct  1     MIRNQEALVLLLDVSPPMHNFLPEVEKLCFMLLQKKLIYNKKDLVGIVLFGTKVTKNELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +++GGY++V V + IKVVD DL++A+ +LPRG+  GDFLDA++VGMDM+IKK+ +T +GK
Sbjct  61    KKVGGYKYVLVSQDIKVVDGDLVEAVRELPRGTFAGDFLDAIVVGMDMLIKKFLLTKRGK  120

Query  482   --KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIID  655
               KRLCLIT+A+CP K PY+G KED++ TIA QM AHG+R++ ++ R +   +    I++
Sbjct  121   IKKRLCLITSALCPTKGPYKGAKEDEIGTIAEQMTAHGIRLECIVARGRLSGNMNMRIME  180

Query  656   ENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKK  835
             END LL +FSK+T +K  YVES TSL+GA+RTRN+APVT++RGD ELS K++IKVWVYKK
Sbjct  181   ENDLLLKLFSKKTIAKTVYVESPTSLLGALRTRNVAPVTIFRGDLELSPKMEIKVWVYKK  240

Query  836   TSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVP  1015
             ++EE  P LK+YSD+APPTDKFA HE+  + +YK V+DPTK VP  QRI+GY YGPQVVP
Sbjct  241   SAEE-LPVLKLYSDEAPPTDKFATHEVRVNLQYKSVEDPTKVVPLTQRIQGYSYGPQVVP  299

Query  1016  ISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAM  1195
             ISSAEWEAVKF+PEKGVKLLGFTDASNIMRHYY KD N+FIA+P N+KAILAVSALARAM
Sbjct  300   ISSAEWEAVKFEPEKGVKLLGFTDASNIMRHYYKKDVNIFIAEPGNTKAILAVSALARAM  359

Query  1196  KDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSN  1375
             K+MN+VAI+RCVWR+ Q NV IG+LTPNVS+K +V                         
Sbjct  360   KEMNKVAILRCVWRRKQRNVIIGILTPNVSEKDSV-------------------------  394

Query  1376  LPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAA  1555
                   PNE+QQEAAD+LV+ML LAP   +E+LLP+ TPNPVL+R+Y YLE+KSK   AA
Sbjct  395   ------PNEEQQEAADDLVQMLYLAPFGREESLLPDVTPNPVLERFYRYLELKSKKPYAA  448

Query  1556  VPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEG  1735
             VPP+D+ L+ IT+PDP+LL+QNK+++DEF+R FELK NPK+KKS     R++ +G  EE 
Sbjct  449   VPPVDKTLKTITEPDPKLLAQNKSIIDEFKRRFELKQNPKLKKS----TRDRQSGVKEEA  504

Query  1736  --------------ERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIF  1873
                           E  S     +KIG+  P+QDFE M+S R+SPEWV KAI+EMKNKIF
Sbjct  505   NIGESSDAGAINSVENTSVITMVKKIGDSTPIQDFEAMMSHRESPEWVGKAIKEMKNKIF  564

Query  1874  YLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLES  2053
              LV+NS E D + KAL+CLVA R GCI+EQ+P +FN+ L ++Y  CK  +L SFC+ L S
Sbjct  565   DLVQNSNERDNHLKALDCLVAFRKGCILEQKPTEFNNFLLHIYKFCKYHNLNSFCESLAS  624

Query  2054  HGIALITKTEAPDSDVLESEARSFMTE  2134
             + I LI KTE  DS+V E  AR+FM +
Sbjct  625   NEIMLIPKTEVTDSEVTEDGARNFMVK  651



>ref|XP_007052051.1| Ku80 family protein isoform 3 [Theobroma cacao]
 gb|EOX96208.1| Ku80 family protein isoform 3 [Theobroma cacao]
Length=713

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/672 (59%), Positives = 504/672 (75%), Gaps = 43/672 (6%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VLPE+EKVCS+LVEKKLI+ K DEVGV++FGT ET N+LT
Sbjct  79    MARNKEKLVLLLDVGPSMHSVLPEVEKVCSMLVEKKLIFRKNDEVGVVVFGTEETNNDLT  138

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGY+H+ VL  IKVVD DL+  L++LPRG+VDGDFLDA++VGMDM+IKKY   +KGK
Sbjct  139   KEVGGYDHIVVLEDIKVVDGDLIDTLQKLPRGTVDGDFLDAIVVGMDMLIKKYKDIHKGK  198

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA+ PIKD  EGTKEDQV TIAAQM A GM+M+SV+VR +   DA K I+DEN
Sbjct  199   KRLCLITNAVHPIKDSLEGTKEDQVETIAAQMTAQGMKMESVVVRGRLSQDANKRIMDEN  258

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LLS+FSK+T ++  YV+S TSL+GA++TR I PVT++RGD ELS  +KIKVWVYK+T 
Sbjct  259   DRLLSIFSKQTLTRTVYVDSPTSLLGALKTRRITPVTVFRGDLELSPDMKIKVWVYKRTQ  318

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YS+KAP T+KFA H++   YEYK V   +K VPPEQRIKGYRYGPQVVPIS
Sbjct  319   EEKFPTLKKYSEKAPQTNKFATHQVKVDYEYKTVDGASKVVPPEQRIKGYRYGPQVVPIS  378

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             +AEW+AVKFKPEKGVKLLGFTDASNIMRHYYMKD  +FIA+P N++AIL+VSA+ARAMK+
Sbjct  379   AAEWDAVKFKPEKGVKLLGFTDASNIMRHYYMKDVYLFIAEPGNTRAILSVSAIARAMKE  438

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQ NV +GVLTPN+S    +PDS YFN LPF EDVRE+QFPSF++ P
Sbjct  439   MNKVAILRCVWRQGQQNVVLGVLTPNISQNDKLPDSFYFNVLPFIEDVREYQFPSFNSFP  498

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  PNEQQQ+AAD LV+ML+LAPS  +EALLP++TPNPVL+                  
Sbjct  499   VSWQPNEQQQKAADELVQMLNLAPSGKEEALLPDYTPNPVLE------------------  540

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
              L +  RR+    P   +      D       + D   +    K L+             
Sbjct  541   -LKKSARRLLREKPSGSNDEDGDAD-------VSDAQAVNSIEKALV-------------  579

Query  1742  ASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKAL  1921
                 VK EKIG++ PVQDFE ++SRRDSPEWV KAI+EM++KI  L+ +S EGD +  A+
Sbjct  580   ----VKIEKIGDLTPVQDFEVILSRRDSPEWVGKAIKEMRDKILGLLSDSHEGDNHLIAV  635

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
             EC+ ALR GCI+EQEP+ +N+ LR L   C++K + +F + L S  + L++K+EA DSDV
Sbjct  636   ECIAALRKGCILEQEPEPYNNFLRYLNLYCQQKGMSNFWQLLASRKLTLVSKSEAADSDV  695

Query  2102  LESEARSFMTES  2137
              ++EAR F  ++
Sbjct  696   TDNEARRFFVKT  707



>gb|AAF79532.1|AC023673_20 F21D18.26 [Arabidopsis thaliana]
Length=707

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/703 (56%), Positives = 513/703 (73%), Gaps = 52/703 (7%)
 Frame = +2

Query  173   MHCVLPEIEKVCSVLVEKK--------------------------LIYSKYDEVGVILFg  274
             M  VLP++EK CS+L++KK                          LIY+KYDEVG+++FG
Sbjct  1     MRSVLPDVEKACSMLLQKKVYDLFLLKLLFMNFGSFLIGFGLLLQLIYNKYDEVGIVVFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGD-----FLDAVIVGM  439
             T ET NEL  E+GGYE+VTVLR+I+VVD+   + ++QLPRG+V GD      LDA+IVGM
Sbjct  61    TEETGNELAREIGGYENVTVLRNIRVVDELAAEHVKQLPRGTVAGDCILLAILDALIVGM  120

Query  440   DMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRM  619
             DM+IK YG  +KGKKR+CLITNA CP KDP+EGTK+DQVSTIA +M A G++M+S+++R 
Sbjct  121   DMLIKMYGNAHKGKKRMCLITNAACPTKDPFEGTKDDQVSTIAMKMAAEGIKMESIVMRS  180

Query  620   KQDLDAEKGIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELS  799
                 DA + +I+END LL++FS    +K   V+S  SL+G+++TR +APVTL+RGD E++
Sbjct  181   NLSGDAHERVIEENDHLLTLFSSNAIAKTVNVDSPLSLLGSLKTRRVAPVTLFRGDLEIN  240

Query  800   TKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQR  979
               +KIKVWVYKK +EER PTLKMYSDKAPPTDKFAKHE+   Y+YKV  + T+ + PE+R
Sbjct  241   PTMKIKVWVYKKVAEERLPTLKMYSDKAPPTDKFAKHEVKVDYDYKVTAESTEVIAPEER  300

Query  980   IKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSK  1159
             IKG+RYGPQV+PIS  + E +KFK +KG+KLLGFT+ASNI+RHYYMKD N+ + DP   K
Sbjct  301   IKGFRYGPQVIPISPDQIETLKFKTDKGMKLLGFTEASNILRHYYMKDVNIVVPDPSKEK  360

Query  1160  AILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAE  1339
             ++LAVSA+AR MK+ N+VAIVRCVWR GQGNV +GVLTPNVS++ + PDS YFN LPFAE
Sbjct  361   SVLAVSAIAREMKETNKVAIVRCVWRNGQGNVVVGVLTPNVSERDDTPDSFYFNVLPFAE  420

Query  1340  DVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVL-----  1504
             DVREF FPSF+ LPSS  P+EQQQ  ADNLVKMLDLAPS  +E L P+ TPNPVL     
Sbjct  421   DVREFPFPSFNKLPSSWKPDEQQQAVADNLVKMLDLAPSAEEEVLKPDLTPNPVLQVICQ  480

Query  1505  --------QRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL  1660
                     QR+Y YLE+KSK  DA +PP+D   +R+ + DPEL S NK+++D FR  FE+
Sbjct  481   LILMKYFYQRFYEYLELKSKSTDATLPPMDGTFKRLMEQDPELSSNNKSIMDTFRGSFEV  540

Query  1661  KDNPKMKKSRKRLIREKPTGSDEEGERAST----KVKSEKIGNINPVQDFEDMISRRDSP  1828
             K+NPK+KK+ KRL+R+KP+GSD+E  R  T    + K + +G+ NP+QDFE MISRRD  
Sbjct  541   KENPKLKKASKRLLRDKPSGSDDEDNRMITYDAKENKIDIVGDANPIQDFEAMISRRDKT  600

Query  1829  EWVNKAIQEMKNKIFYLVENSL-EGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYA  2005
             +W  KAI +MKN I  LVEN   EGD   KALEC++ALR GC++EQEPKQFN+ L +L+ 
Sbjct  601   DWTEKAITQMKNLIMKLVENCTDEGD---KALECVLALRKGCVLEQEPKQFNEFLNHLFK  657

Query  2006  SCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMTE  2134
              C+E++L    +   S  I LI K+EA DSD+++  A  F+ +
Sbjct  658   LCQERNLSHLLEHFMSKKITLIPKSEAADSDIVDENAGDFIVK  700



>ref|XP_004980986.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X2 [Setaria italica]
Length=687

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/683 (59%), Positives = 511/683 (75%), Gaps = 20/683 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VL E++ +CS LV KKL+Y++ DEVG++LFGT ET NEL 
Sbjct  1     MARNKEALVLLLDVGPSMHGVLQEVKNICSTLVHKKLVYNRSDEVGIVLFGTKETCNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +ELGGY+HVTV   IKVVD+   QAL+ LP GSV GDFLDAV+VG+DM+I+KYG T KGK
Sbjct  61    KELGGYKHVTVAHDIKVVDEGTSQALQNLPAGSVPGDFLDAVVVGLDMLIRKYGNT-KGK  119

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +RLCLIT+A   ++DP EGTKEDQV TIA QMK H ++M+ ++ R  +       ++DEN
Sbjct  120   RRLCLITSAQHRLRDPPEGTKEDQVDTIADQMKRHDIKMECIVFR--EPGIHHNAVMDEN  177

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D+LL  F   + +K   V+S TSL+GA++TRN+ PVT++RGD E+S+  KIKVWVYKKT+
Sbjct  178   DWLLYQFRNRSVAKVVQVDSPTSLLGALKTRNVLPVTVFRGDLEVSSNFKIKVWVYKKTA  237

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAPP+DKFA HE+   YEYK V +P K VPP+QRIKGY YGPQVVPIS
Sbjct  238   EEKFPTLKKYSDKAPPSDKFASHEVKVDYEYKSVVEPDKVVPPDQRIKGYLYGPQVVPIS  297

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGFTD S+I+RH++MKD  +FI +P N+KA LAVSA+ARAM  
Sbjct  298   SAEWEAVKFKPEKGVKLLGFTDRSSILRHHFMKDVCLFIPEPGNTKATLAVSAIARAMHQ  357

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQGNV  GVLTPN+S   N+ DS YFN LPFAED+REFQF SFS+LP
Sbjct  358   MNKVAIVRCVWRQGQGNVAFGVLTPNISSVNNIQDSFYFNVLPFAEDIREFQFRSFSSLP  417

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  P ++QQEAADNLVKMLDLAP   +E L PEFTPNP+L+R+Y YL++K+K  DA VP
Sbjct  418   SSSQPTDEQQEAADNLVKMLDLAPP-GREVLKPEFTPNPMLERFYSYLDLKAKQPDANVP  476

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PL+  LRRIT+PDP+++ Q   ++    + FELK+NPK KK+R +  R   TG+ ++ + 
Sbjct  477   PLERCLRRITEPDPDVIDQQTPLIQNLGKAFELKENPKKKKARTQ-DRLAYTGAGDQAKS  535

Query  1742  ASTKVK------------SEKIGNI---NPVQDFEDMISRRDSPEWVNKAIQEMKNKIFY  1876
              +                +E IG I   +PVQDFE M+++R S  WV KAI+EM+     
Sbjct  536   VAEPSAEKDGVLVVLYPPTENIGEIRDLHPVQDFEAMLAKRSSSTWVQKAIEEMQKYTTA  595

Query  1877  LVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESH  2056
             L+ENS +GD Y KALEC  ALR  CI+EQEP++FN  L   Y   K+ D+ +F + L S 
Sbjct  596   LLENSRDGDNYSKALECFAALRKACIIEQEPEEFNQFLTKTYERLKKGDVANFFQLLSSK  655

Query  2057  GIALITKTEAPDSDVLESEARSF  2125
              I+LI+K EAPDSDV E  ARSF
Sbjct  656   NISLISKGEAPDSDVTEEMARSF  678



>ref|XP_003559791.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 [Brachypodium 
distachyon]
Length=689

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/684 (58%), Positives = 509/684 (74%), Gaps = 20/684 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+EGL+L++DVGPSMH  L E+E VCS L+ KKL+Y++ DEVG++LFGT ET N+L 
Sbjct  1     MARNKEGLVLLLDVGPSMHGALQEVENVCSTLLRKKLVYNRSDEVGIVLFGTKETCNDLA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGY+HV V   IKVV++    AL+ LPRG+  GDFLDA++VG+DM+IK++G T KGK
Sbjct  61    KEIGGYKHVVVKHDIKVVEEGTKDALQNLPRGTAPGDFLDAIVVGLDMLIKRFGNT-KGK  119

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
              RLCLIT++  P++DP EGTKEDQV TIA QMK H ++MD ++ R  +       ++DEN
Sbjct  120   HRLCLITDSQHPLRDPPEGTKEDQVDTIAEQMKKHDIKMDCIVFR--ESGVQHNSVMDEN  177

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F   + +K   V++ TSL+GA++TR + PVT++RGD E+S+ LKIKVWVYKKTS
Sbjct  178   DQLLYHFRDRSVAKVVQVDTPTSLLGALKTRIVLPVTIFRGDLEVSSNLKIKVWVYKKTS  237

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSD+APP+DKFA HE+   +EYK + +P   VPP+QRIKGY YGPQVVPIS
Sbjct  238   EEKFPTLKKYSDQAPPSDKFASHEVKVDFEYKSILEPDTVVPPDQRIKGYLYGPQVVPIS  297

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGF D S+I RHY+MKD N F+ +P N KA +AVSA+ARAM++
Sbjct  298   SAEWEAVKFKPEKGVKLLGFADRSSIPRHYFMKDVNSFVPEPGNKKATVAVSAIARAMQE  357

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQGNV  GVLTPN+S   NVPDS +FN LPF+ED+REFQF SFS+LP
Sbjct  358   MNKVAILRCVWRQGQGNVAFGVLTPNISSVNNVPDSFFFNILPFSEDIREFQFRSFSSLP  417

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  P E+QQEAAD+LVKMLDLAP   +E L P+FTPNP+L+R+Y +L++KSK  DA  P
Sbjct  418   SSSQPTEEQQEAADSLVKMLDLAPPGREEILRPDFTPNPMLERFYSFLDLKSKEPDANAP  477

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PLD+ LRRIT+PD +++     ++    + FELKDNPK KK+R +  R   T +D++ ++
Sbjct  478   PLDKCLRRITEPDSDIIDYQAPLIQNLGKAFELKDNPKRKKARTQE-RLNYTAADDQTKK  536

Query  1742  AS---------------TKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFY  1876
             ++               +  K  KIG++NPVQDFE M++ R S  WV KAI+EM+     
Sbjct  537   SADPYAEKAKAIEVLYPSAEKVGKIGDLNPVQDFEAMLTERSSSIWVQKAIEEMQKYTTV  596

Query  1877  LVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKE-KDLRSFCKQLES  2053
             L+ENS +GD YQKALEC+VALR  CI+EQEP +FN  L  LY   K   D+  F + L S
Sbjct  597   LIENSPQGDYYQKALECIVALRKACIIEQEPNEFNQFLTKLYKRLKNVDDVAKFFQLLSS  656

Query  2054  HGIALITKTEAPDSDVLESEARSF  2125
               ++LI+K EAPDSDV E  ARSF
Sbjct  657   KNVSLISKEEAPDSDVTEEMARSF  680



>ref|XP_006650927.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like [Oryza 
brachyantha]
Length=685

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/687 (58%), Positives = 508/687 (74%), Gaps = 22/687 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VL ++E VCS LV KKL+Y++ DE+GV+LFGT ET NEL 
Sbjct  1     MARNKEALVLLLDVGPSMHGVLQQVENVCSTLVLKKLVYNRSDEIGVVLFGTKETCNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +ELGGY+HV V R IKVVD++   AL+ LPRG+  GDFLDA++VG+DM+I+K+G   KGK
Sbjct  61    KELGGYKHVVVARDIKVVDEETTHALQNLPRGTSPGDFLDAIVVGLDMLIRKFG-NMKGK  119

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +R+CLIT+A  P++DP +GTK++QV TIA QMK H M+MD ++ R    L     ++DEN
Sbjct  120   QRMCLITDAQHPLRDPPQGTKKEQVDTIADQMKKHEMKMDCIVFRESGVL--HNAVMDEN  177

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F + + +K   V+S TSL+GA+RTRNI PVT++RGD E+S+  KIKVWVYKKTS
Sbjct  178   DQLLYHFRERSVAKVVQVDSPTSLLGALRTRNILPVTVFRGDLEVSSNFKIKVWVYKKTS  237

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FP+LK YSDKAP +DKFA HE+   YEYK V +P   VPP+QRIKGY YGPQVVPIS
Sbjct  238   EEKFPSLKKYSDKAPASDKFATHEVKVDYEYKSVLEPDTVVPPDQRIKGYLYGPQVVPIS  297

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGFTD S+I RHY+MKD   F+ +P N KA +AVSALARAM +
Sbjct  298   SAEWEAVKFKPEKGVKLLGFTDRSSIFRHYFMKDVFSFVPEPGNRKAAVAVSALARAMSE  357

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             M++V I+RCVWRQGQGNV +GVLTPN+S   NVPDS YFN LPFAED+REFQF SFS+LP
Sbjct  358   MDKVGILRCVWRQGQGNVALGVLTPNISSVRNVPDSFYFNILPFAEDIREFQFRSFSSLP  417

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  P E+QQEAADNLVKMLDLAP   +E L P+FTPNP+L+R+Y +L++KSK  DA VP
Sbjct  418   ASSQPTEEQQEAADNLVKMLDLAPPGREEILKPDFTPNPMLERFYSFLDLKSKQPDANVP  477

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEE---  1732
             PL++ L+RIT+P   ++     ++ +    FELK+NPK KK+R +  R   TG+D++   
Sbjct  478   PLNKCLKRITEP---VIDYQAPLIKKLGNAFELKENPKKKKARTQ-DRLTYTGADDQTKS  533

Query  1733  -----GERAST-------KVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFY  1876
                   E+A         K K   IG+ +PVQDFE M+S+R S  WV KAI+EM+  I  
Sbjct  534   LDELSAEKAGVLEALYPPKEKVGGIGDHSPVQDFEAMLSQRSSSAWVQKAIEEMQKYITA  593

Query  1877  LVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESH  2056
             L+++S +GD ++KALECL ALR  CI+EQEPK++N  L  L    +  D   F + L S 
Sbjct  594   LIQDSPDGDYHRKALECLAALRKACIIEQEPKEYNGFLTKLCQEFRAVDDAKFFQLLLSK  653

Query  2057  GIALITKTEAPDSDVLESEARSFMTES  2137
               +LI+K EAPDSDV E  AR+F  +S
Sbjct  654   NASLISKEEAPDSDVTEEMARNFCLKS  680



>gb|ADO00729.1| Ku80 [Triticum aestivum]
Length=706

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/704 (56%), Positives = 508/704 (72%), Gaps = 35/704 (5%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+EGL+L++DVGPSMH  LPE+E VC+ LV KKL++ + DEVGV+LFG  ET N+L 
Sbjct  1     MARNKEGLVLLLDVGPSMHRALPEVENVCTTLVRKKLVFHRSDEVGVVLFGAKETHNDLA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              ELGGY+HV V   IKVVD++   ALE LPRG+  GDFLDA++VG+DM+IK++G T K K
Sbjct  61    RELGGYKHVLVKHDIKVVDEETKDALENLPRGTAPGDFLDAIVVGLDMLIKRFGDT-KAK  119

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +RLCLIT+A   ++DP +GTKEDQV TIA QMK H ++MD ++ R  +       ++DEN
Sbjct  120   QRLCLITDAQHLLRDPPQGTKEDQVDTIADQMKKHDIKMDCIVFR--ESGVQHNSVMDEN  177

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F   + +K   V++ T+L+GA++TRN+ PVT++RGD E+S+  KIKVW YKKTS
Sbjct  178   DRLLYHFRDRSVAKVVQVDTPTALLGALKTRNVLPVTIFRGDLEVSSTFKIKVWAYKKTS  237

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAPP+D+FA HE+   YEYK + +P   +PP+QRIKGY YGPQVVPIS
Sbjct  238   EEKFPTLKKYSDKAPPSDQFASHEVKVDYEYKSILEPDTVIPPDQRIKGYLYGPQVVPIS  297

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGF D S+I R Y+MKD N F+ +P N+KA++AVSALARAM++
Sbjct  298   SAEWEAVKFKPEKGVKLLGFADRSSIPRSYFMKDVNSFVPEPGNTKAMVAVSALARAMQE  357

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQ Q NV  GVLTPN+S   NVPDS YFN LPFAED+R+F F SFS+LP
Sbjct  358   MNKVAILRCVWRQNQANVAFGVLTPNISSVNNVPDSFYFNILPFAEDIRDFPFRSFSSLP  417

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  P E+QQEAADNLVKMLDLAP   +E L P+FTPNP+L+R+Y YL +KSK  DA  P
Sbjct  418   PSSQPTEEQQEAADNLVKMLDLAPPGREEILRPDFTPNPMLERFYSYLGLKSKQPDANPP  477

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSR--KRLI-----------  1702
             PLD  LRRIT+PDP++++    ++    + FELK+NPK KK+R  +RL            
Sbjct  478   PLDSCLRRITEPDPDVINYRVPLIQNLGKSFELKENPKRKKARTQERLAYTDPDDQAKSS  537

Query  1703  ---REKPTGSDEEGERA----STKVK--------SEKIG---NINPVQDFEDMISRRDSP  1828
                 EK T +D + ++     + K +        +EK+G   ++NPV+DFE M++ R S 
Sbjct  538   ENNAEKATAADGQAKKPEDPYAEKARAIEVMFPSTEKVGKIEDVNPVKDFEAMLAERSSS  597

Query  1829  EWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYAS  2008
              WV KAI+EMK     LVENSL+GD Y+KAL+C VALR  CI+EQEP+++N  +  LY  
Sbjct  598   IWVQKAIEEMKKYTTNLVENSLQGDYYEKALKCFVALRKACIIEQEPEEYNQFVTKLYER  657

Query  2009  CKE-KDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMTES  2137
              K+  D+  F + L S  + LI K EAPDSDV E  ARSF  ++
Sbjct  658   LKKVDDVVKFFQLLSSKNVLLICKEEAPDSDVTEEMARSFFLKT  701



>ref|XP_004980985.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like isoform 
X1 [Setaria italica]
Length=698

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/672 (59%), Positives = 503/672 (75%), Gaps = 20/672 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VL E++ +CS LV KKL+Y++ DEVG++LFGT ET NEL 
Sbjct  1     MARNKEALVLLLDVGPSMHGVLQEVKNICSTLVHKKLVYNRSDEVGIVLFGTKETCNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +ELGGY+HVTV   IKVVD+   QAL+ LP GSV GDFLDAV+VG+DM+I+KYG T KGK
Sbjct  61    KELGGYKHVTVAHDIKVVDEGTSQALQNLPAGSVPGDFLDAVVVGLDMLIRKYGNT-KGK  119

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +RLCLIT+A   ++DP EGTKEDQV TIA QMK H ++M+ ++ R  +       ++DEN
Sbjct  120   RRLCLITSAQHRLRDPPEGTKEDQVDTIADQMKRHDIKMECIVFR--EPGIHHNAVMDEN  177

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D+LL  F   + +K   V+S TSL+GA++TRN+ PVT++RGD E+S+  KIKVWVYKKT+
Sbjct  178   DWLLYQFRNRSVAKVVQVDSPTSLLGALKTRNVLPVTVFRGDLEVSSNFKIKVWVYKKTA  237

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAPP+DKFA HE+   YEYK V +P K VPP+QRIKGY YGPQVVPIS
Sbjct  238   EEKFPTLKKYSDKAPPSDKFASHEVKVDYEYKSVVEPDKVVPPDQRIKGYLYGPQVVPIS  297

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGFTD S+I+RH++MKD  +FI +P N+KA LAVSA+ARAM  
Sbjct  298   SAEWEAVKFKPEKGVKLLGFTDRSSILRHHFMKDVCLFIPEPGNTKATLAVSAIARAMHQ  357

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQGNV  GVLTPN+S   N+ DS YFN LPFAED+REFQF SFS+LP
Sbjct  358   MNKVAIVRCVWRQGQGNVAFGVLTPNISSVNNIQDSFYFNVLPFAEDIREFQFRSFSSLP  417

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  P ++QQEAADNLVKMLDLAP   +E L PEFTPNP+L+R+Y YL++K+K  DA VP
Sbjct  418   SSSQPTDEQQEAADNLVKMLDLAPP-GREVLKPEFTPNPMLERFYSYLDLKAKQPDANVP  476

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PL+  LRRIT+PDP+++ Q   ++    + FELK+NPK KK+R +  R   TG+ ++ + 
Sbjct  477   PLERCLRRITEPDPDVIDQQTPLIQNLGKAFELKENPKKKKARTQ-DRLAYTGAGDQAKS  535

Query  1742  ASTKVK------------SEKIGNI---NPVQDFEDMISRRDSPEWVNKAIQEMKNKIFY  1876
              +                +E IG I   +PVQDFE M+++R S  WV KAI+EM+     
Sbjct  536   VAEPSAEKDGVLVVLYPPTENIGEIRDLHPVQDFEAMLAKRSSSTWVQKAIEEMQKYTTA  595

Query  1877  LVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESH  2056
             L+ENS +GD Y KALEC  ALR  CI+EQEP++FN  L   Y   K+ D+ +F + L S 
Sbjct  596   LLENSRDGDNYSKALECFAALRKACIIEQEPEEFNQFLTKTYERLKKGDVANFFQLLSSK  655

Query  2057  GIALITKTEAPD  2092
              I+LI+K EAPD
Sbjct  656   NISLISKGEAPD  667



>dbj|BAJ95046.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=701

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/699 (56%), Positives = 501/699 (72%), Gaps = 30/699 (4%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+EGL+L++DVGPSMH  L EIE VC+ LV KKL++ + DEVGV+LFGT ET N+L 
Sbjct  1     MARNKEGLVLLLDVGPSMHRALQEIENVCTTLVRKKLVFHRSDEVGVVLFGTKETHNDLA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              ELGGY+HV V   IKVVD++   ALE LPRG+  GDFLDA++VG+DM+IK++G T K K
Sbjct  61    RELGGYKHVLVKHDIKVVDEETKDALENLPRGTAPGDFLDAIVVGLDMLIKRFGDT-KAK  119

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +RLCLIT+A   ++DP +GTKEDQV TIA QMK H ++MD ++ R  +       ++DEN
Sbjct  120   QRLCLITDAQHLLRDPPQGTKEDQVDTIADQMKKHDIKMDCIVFR--EAGVQHNSVMDEN  177

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F   + +K   V++ T+L+GA++TRN+ PVT++RGD E+++  KIKVW YKKTS
Sbjct  178   DRLLYHFRDRSVAKVVQVDTPTALLGALKTRNVLPVTIFRGDLEVNSTFKIKVWAYKKTS  237

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAPP+D+FA HE+   YEYK + +P   VPP+QRIKGY YGPQVVPIS
Sbjct  238   EEKFPTLKKYSDKAPPSDQFASHEVKVDYEYKSILEPDTVVPPDQRIKGYLYGPQVVPIS  297

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGF D S++ R Y+MKD N F+ +P N+KAI+AVSALARAM+D
Sbjct  298   SAEWEAVKFKPEKGVKLLGFADRSSVPRSYFMKDVNSFVPEPGNTKAIVAVSALARAMQD  357

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQ Q NV  GVLTPN+S   NVPDS YFN LPFAEDVR+F F SFS+LP
Sbjct  358   MNKVAILRCVWRQNQANVAFGVLTPNISSVNNVPDSFYFNILPFAEDVRDFPFRSFSSLP  417

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  P E+QQEAADNLVKMLDLAP   +E L P+FTPNP+L+R+Y YL++KSK  DA  P
Sbjct  418   PSSQPTEEQQEAADNLVKMLDLAPPGREEILRPDFTPNPMLERFYSYLDLKSKQPDANPP  477

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSR--KRLIREKP-------  1714
             PL   LRRIT+PDP++++    ++    + F+LK+NPK KK+R  +RL    P       
Sbjct  478   PLHSCLRRITEPDPDVINYRAPLIQNLGKAFDLKENPKRKKARTQERLAYAGPDDQAKKS  537

Query  1715  ------------TGSDEEGERA-----STKVKSEKIGNINPVQDFEDMISRRDSPEWVNK  1843
                            D E  RA      +  K  KIG++NPV+DFE M++ R S  WV K
Sbjct  538   EDDAGKAMAIDDQAKDAEKARAIEVLFPSTEKVGKIGDVNPVKDFEAMLAERSSSTWVQK  597

Query  1844  AIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKE-K  2020
             A++EMK     L+ENS +GD Y+KALEC VALR  CI+EQEP+++N  +  LY   K+  
Sbjct  598   AMEEMKKYTTALIENSPQGDYYEKALECFVALRKACIIEQEPEEYNQFVTKLYERLKKVD  657

Query  2021  DLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMTES  2137
             D+  F + L S  + LI K EAPDSDV E  ARSF  ++
Sbjct  658   DVVKFFQLLSSKNVLLICKEEAPDSDVTEEMARSFFLKT  696



>sp|Q75IP6.1|KU80_ORYSJ RecName: Full=ATP-dependent DNA helicase 2 subunit KU80; AltName: 
Full=ATP-dependent DNA helicase 2 subunit 2; AltName: Full=ATP-dependent 
DNA helicase II 80 kDa subunit [Oryza sativa 
Japonica Group]
 gb|AAS01977.1| putative H-box binding protein, KAP2, with alternative splicing 
isoforms [Oryza sativa Japonica Group]
 gb|ABF99985.1| KAP-2, putative, expressed [Oryza sativa Japonica Group]
Length=688

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/683 (58%), Positives = 513/683 (75%), Gaps = 19/683 (3%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VL E+E +CS LV KKL+Y++ DE+GV+LFGT ET+NEL 
Sbjct  1     MARNKEALVLLLDVGPSMHGVLQEVENICSTLVHKKLVYNRSDEIGVVLFGTKETSNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +ELGGY+HV V R IKVVD++   AL+ LPRG+  GDFLDA++VG+DM+I+K+G   KGK
Sbjct  61    KELGGYKHVVVARDIKVVDEETTNALQNLPRGTSPGDFLDAIVVGLDMLIRKFG-NIKGK  119

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +R+CL+T+A  P++DP +GTK+DQV TIA QMK H ++MD +I R  +       ++DEN
Sbjct  120   QRMCLVTDAQHPLRDPPQGTKKDQVDTIADQMKRHEIKMDCIIFR--ESGVRHNAVMDEN  177

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F + + +K  +V+S TSL+GA+RTRN+ PVT++RGD E+S+  KIKVWVYKKTS
Sbjct  178   DQLLYHFRERSVTKVVHVDSPTSLLGALRTRNVLPVTVFRGDLEVSSSFKIKVWVYKKTS  237

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP +DKFA HE+   YEYK V +P   VPP+QRIKGY YGPQVVPIS
Sbjct  238   EEKFPTLKKYSDKAPASDKFASHEVKVDYEYKSVLEPDTVVPPDQRIKGYLYGPQVVPIS  297

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGFTD S+I RHY+MKD   F+ +P N+KA+ AVSALARAM +
Sbjct  298   SAEWEAVKFKPEKGVKLLGFTDRSSISRHYFMKDVFSFVPEPGNTKAVAAVSALARAMSE  357

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQGNV +GVLTPN+S   NV DS YFN LPFAED+REFQF SFS+LP
Sbjct  358   MNKVAILRCVWRQGQGNVALGVLTPNISSAKNVLDSFYFNILPFAEDIREFQFRSFSSLP  417

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  P ++QQEAADNLVKMLDLAP   +E L P+FTPNP+L+R+Y YL++KSK  DA VP
Sbjct  418   SSSQPTKEQQEAADNLVKMLDLAPPGREEILKPDFTPNPMLERFYRYLDLKSKQPDANVP  477

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEG--  1735
             PLD+ L++IT+PDP+++     ++ +    FELK+NPK KK+R +  R   TG+D++   
Sbjct  478   PLDKCLKKITEPDPDVIDYQAPLIKKLGNVFELKENPKKKKARTQ-DRLTYTGADDQAKL  536

Query  1736  --ERASTKV-----------KSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFY  1876
               E ++ KV           K+ +IG+ NPVQDFE M+++R S  WV  AI+EM+  I  
Sbjct  537   LEEPSAEKVGVSEALYPPKKKAGEIGDHNPVQDFEAMLTQRSSSTWVQTAIEEMQKYITA  596

Query  1877  LVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESH  2056
             L+++S + D +QKALECLVALR  CI+EQEP ++N  +  L    +    + F + L S 
Sbjct  597   LIQDSCDRDNHQKALECLVALRKACIIEQEPNEYNGFVTKLCQKFRPAGDKIFLQLLSSK  656

Query  2057  GIALITKTEAPDSDVLESEARSF  2125
               +LI+K EAPDSDV E  AR+F
Sbjct  657   KASLISKEEAPDSDVTEEMARNF  679



>tpg|DAA52573.1| TPA: KAP-2 [Zea mays]
Length=681

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/677 (58%), Positives = 501/677 (74%), Gaps = 14/677 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNRE +IL++DVGPSMH VL E++ VC  LV KKL+Y++ DEVG++LFGT  T NEL 
Sbjct  1     MARNREVVILLLDVGPSMHGVLLEVKNVCLTLVHKKLVYNRSDEVGIVLFGTKGTCNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +++GGY+HVTV+  IKVVD+   QAL+ LP GS  GDFLD+++VG+DM+I+K+GIT KGK
Sbjct  61    KDIGGYKHVTVIHDIKVVDEGTAQALQNLPLGSAPGDFLDSIVVGLDMVIRKFGIT-KGK  119

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +RLCLIT A   ++DP EGTKEDQV TIA  +K H ++M+ +I R  +       +++EN
Sbjct  120   RRLCLITGAQELLRDPPEGTKEDQVDTIANMLKKHNIKMECIIFR--EPGVHHNDVMEEN  177

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F   + +K   V++ TSL+GA++TRN+ PVT++RGD E+++  KIKVWVYKKT+
Sbjct  178   DRLLHQFRNRSVAKVVQVDNPTSLLGALKTRNVLPVTVFRGDLEVNSNFKIKVWVYKKTA  237

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAPP DKFA HE+   YEYK V +P K VPP+QRIKGY YGPQV+P+S
Sbjct  238   EEKFPTLKKYSDKAPPNDKFASHEVKVDYEYKSVVEPDKVVPPDQRIKGYLYGPQVIPVS  297

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             +AEWEAVKFKPEKGVKLLGFTD S++ RH +MKD  +FI +P N KA LAVSA+ARAM  
Sbjct  298   NAEWEAVKFKPEKGVKLLGFTDRSSVPRHQFMKDVCLFIPEPGNMKASLAVSAIARAMHQ  357

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQGNV IGVLTPN+S   N+ DS YFN LPFAED+REFQF SFS+LP
Sbjct  358   MNKVAIVRCVWRQGQGNVAIGVLTPNISSVNNIQDSFYFNVLPFAEDIREFQFRSFSSLP  417

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  P E+QQEAADNLVKMLDLAP   +E L PEFTPNP+L+R+Y YL++KSK  DA VP
Sbjct  418   SSSQPTEEQQEAADNLVKMLDLAPP-GREVLKPEFTPNPILERFYSYLDLKSKQPDANVP  476

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PL+  LRRIT+PDP+++ Q   ++    + F LKDNPK KK+R + +    TG+ ++ + 
Sbjct  477   PLERSLRRITEPDPDVVGQQTQLIQNLSKAFVLKDNPKKKKARTQDMLAY-TGAGDQAKS  535

Query  1742  ASTKV------KSEKIGNI---NPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL  1894
                +V       +E +  I   NPVQDFE M+++R S  W  KAI +M+N I  L++NS 
Sbjct  536   VEDRVLENTHPSTENVVAIRDSNPVQDFEAMLAKRSSSTWTQKAIGDMQNYIAALLQNSS  595

Query  1895  EGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALIT  2074
             +G  YQKALEC  +LR  CI+EQEP++FN  L  +Y   KE D   F + L S  I+LI 
Sbjct  596   DGGNYQKALECFASLRKACIIEQEPQEFNQFLTKIYERLKEGDAAKFFQLLSSKNISLIN  655

Query  2075  KTEAPDSDVLESEARSF  2125
             K EAPDSDV E  ARSF
Sbjct  656   KEEAPDSDVTEEMARSF  672



>ref|NP_001147945.1| LOC100281554 [Zea mays]
 gb|ACG29200.1| KAP-2 [Zea mays]
Length=681

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/677 (58%), Positives = 503/677 (74%), Gaps = 14/677 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNRE +IL++DVGPSMH VL E++ VC  LV KKL+Y++ DEVG++LFGT  T NEL 
Sbjct  1     MARNREVVILLLDVGPSMHGVLLEVKNVCLTLVHKKLVYNRSDEVGIVLFGTKGTCNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +++GGY+HVTV+  IKVVD+   QAL+ LP GS  GDFLD+++VG+DM+I+K+GIT KGK
Sbjct  61    KDIGGYKHVTVIHDIKVVDEGTAQALQNLPLGSAPGDFLDSIVVGLDMVIRKFGIT-KGK  119

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +RLCLIT+A   ++DP EGTKEDQV TIA  +K H ++M+ +I R  +       +++EN
Sbjct  120   RRLCLITSAQELLRDPPEGTKEDQVDTIADMLKKHNIKMECIIFR--EPGVHHNDVMEEN  177

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F   + +K   V++ TSL+GA++TRN+ PVT++RGD E+++  KIKVWVYKKT+
Sbjct  178   DRLLHQFRNRSVAKVVQVDNPTSLLGALKTRNVLPVTVFRGDLEVNSNFKIKVWVYKKTA  237

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAPP+DKFA HE+   YEYK V +P K VPP+QRIKGY YGPQV+P+S
Sbjct  238   EEKFPTLKKYSDKAPPSDKFASHEVKVDYEYKSVVEPDKVVPPDQRIKGYLYGPQVIPVS  297

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             +AEWEAVKFKPEKGVKLLGFTD S++ RH +MKD  +FI +P N KA LAVSA+ARAM  
Sbjct  298   NAEWEAVKFKPEKGVKLLGFTDRSSVPRHQFMKDVCLFIPEPGNMKASLAVSAIARAMHQ  357

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQGNV IGVLTPN+S    + DS YFN LPFAED+REFQF SFS+LP
Sbjct  358   MNKVAIVRCVWRQGQGNVAIGVLTPNISSVNTIQDSFYFNVLPFAEDIREFQFRSFSSLP  417

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  P E+QQEAADNLVKMLDLAP   +E L PEFTPNP+L+R+Y YL++KSK  DA VP
Sbjct  418   SSSQPTEEQQEAADNLVKMLDLAPP-GREVLKPEFTPNPILERFYSYLDLKSKQPDANVP  476

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PL+  LRRIT+PDP+++ Q   ++    + F LK+NPK KK+R + +    TG+ ++ + 
Sbjct  477   PLERSLRRITEPDPDVVGQQTQLIQNLSKAFVLKENPKKKKARTQELLAY-TGAGDQAKS  535

Query  1742  ASTKV------KSEKIGNI---NPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL  1894
                +V       +E +  I   NPVQDFE M+++R S  W  KAI +M+N I  L++NS 
Sbjct  536   VEDRVLENTHPSTENVVAIRDSNPVQDFEAMLAKRSSSTWTQKAIGDMQNYIAALLQNSS  595

Query  1895  EGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALIT  2074
             +G  YQKALEC  +LR  CI+EQEP++FN  L N+Y   KE D   F + L S  I+LI 
Sbjct  596   DGGNYQKALECFASLRKACIIEQEPQEFNQFLTNIYERLKEGDAAKFFQLLSSKNISLIN  655

Query  2075  KTEAPDSDVLESEARSF  2125
             K EAPDSDV E  ARSF
Sbjct  656   KEEAPDSDVTEEMARSF  672



>gb|AEO86624.1| Ku80 [Hordeum vulgare subsp. vulgare]
Length=701

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/699 (56%), Positives = 497/699 (71%), Gaps = 30/699 (4%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+EGL+L++DVGPSMH  L EIE VC+ LV KKL++ + DEVGV+LFGT ET N+L 
Sbjct  1     MARNKEGLVLLLDVGPSMHRALQEIENVCTTLVRKKLVFHRSDEVGVVLFGTKETHNDLA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              ELGGY+HV V   IKVVD++   ALE LPRG+  GDFLDA++VG+DM+IK++G T K K
Sbjct  61    RELGGYKHVLVKHDIKVVDEETKDALENLPRGTAPGDFLDAIVVGLDMLIKRFGDT-KAK  119

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +RLCLIT+A   ++DP +GTKEDQV TIA QMK    +M  ++ R  +       +I EN
Sbjct  120   QRLCLITDAQHLLRDPPQGTKEDQVDTIADQMKRRATKMGCIVFR--EAGVQHNSVICEN  177

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F   + +K   V++ T+L+GA++TRN+ PVT++RGD E+++  KIKVW YKKTS
Sbjct  178   DRLLYHFRDRSVAKVVQVDTPTALLGALKTRNVLPVTIFRGDLEVNSTFKIKVWAYKKTS  237

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAPP+D+FA HE+   YEYK + +P   VPP+QRIKGY YGPQVVPIS
Sbjct  238   EEKFPTLKKYSDKAPPSDQFASHEVKVDYEYKSILEPDTVVPPDQRIKGYLYGPQVVPIS  297

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGF D S++ R Y+MKD N F+ +P N+KAI+AVSALARAM+D
Sbjct  298   SAEWEAVKFKPEKGVKLLGFADRSSVPRSYFMKDVNSFVPEPGNTKAIVAVSALARAMQD  357

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQ Q NV  GVLTPN+S   NVPDS YFN LPFAEDVR+F F SFS+LP
Sbjct  358   MNKVAILRCVWRQNQANVAFGVLTPNISSVNNVPDSFYFNILPFAEDVRDFPFRSFSSLP  417

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  P E+QQEAADNLVKMLDLAP   +E L P+FTPNP+L+R+Y YL++KSK  DA  P
Sbjct  418   PSSQPTEEQQEAADNLVKMLDLAPPGREEILRPDFTPNPMLERFYSYLDLKSKQPDANPP  477

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSR--KRLIREKP-------  1714
             PL   LRRIT+PDP++++    ++    + F+LK+NPK KK+R  +RL    P       
Sbjct  478   PLHSCLRRITEPDPDVINYRAPLIQNLGKAFDLKENPKRKKARTQERLAYAGPDDQAKKS  537

Query  1715  ------------TGSDEEGERA-----STKVKSEKIGNINPVQDFEDMISRRDSPEWVNK  1843
                            D E  RA      +  K  KIG++NPV+DFE M++ R S  WV K
Sbjct  538   EDDAGKAMAIDDQAKDAEKARAIEVLFPSTEKVGKIGDVNPVKDFEAMLAERSSSTWVQK  597

Query  1844  AIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKE-K  2020
             A++EMK     L+ENS +GD Y+KALEC VALR  CI+EQEP+++N  +  LY   K+  
Sbjct  598   AMEEMKKYTTALIENSPQGDYYEKALECFVALRKACIIEQEPEEYNQFVTKLYERLKKVD  657

Query  2021  DLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMTES  2137
             D+  F + L S  + LI K EAPDSDV E  ARSF  ++
Sbjct  658   DVVKFFQLLSSKNVLLICKEEAPDSDVTEEMARSFFLKT  696



>ref|XP_009399514.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=661

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/652 (60%), Positives = 508/652 (78%), Gaps = 15/652 (2%)
 Frame = +2

Query  215   LVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPR  394
             +   KLI+SK DEVG++LFGT +T NEL +E+GGYEHV VLR I+VVDDD +  L+ LP+
Sbjct  1     MARNKLIFSKSDEVGIVLFGTEDTNNELEKEVGGYEHVAVLRDIRVVDDDAVVVLKNLPK  60

Query  395   GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQ  574
             G+  GDFLDA++VGMDM+IKK+G+++KGKKRL LIT+A    K+PYEGTKEDQV TI+ Q
Sbjct  61    GTFPGDFLDAIVVGMDMLIKKFGVSDKGKKRLYLITDARFSTKEPYEGTKEDQVDTISQQ  120

Query  575   MKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTR  754
             MK  G+R++ +I+R K       G IDEND LL  FS++  +K  +V+ ATSL+GAI+TR
Sbjct  121   MKVLGIRLNCLIIREKICSTEHLGAIDENDKLLDQFSRKAMAKTVHVDCATSLLGAIKTR  180

Query  755   NIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEY  934
             N+ PVT++RGD ELS+ +KIKVWVYKKTSEE+FPTLK YSDKAP +DKFA HE+   +EY
Sbjct  181   NVVPVTVFRGDLELSSMMKIKVWVYKKTSEEKFPTLKKYSDKAPASDKFATHEVKVDFEY  240

Query  935   KVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYY  1114
             K  QDP K VPPEQRIKGYRYGPQVVPISSAEWEAVKFK EKGVKLLGFTD SNI+RHYY
Sbjct  241   KSSQDPDKVVPPEQRIKGYRYGPQVVPISSAEWEAVKFKSEKGVKLLGFTDVSNILRHYY  300

Query  1115  MKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKG  1294
             M+D  +FI +P N+KAI+AVSALA+AMK+MN+ A++RCVWRQGQGNV++GVLTPN+S   
Sbjct  301   MRDVYIFIPEPGNTKAIIAVSALAKAMKEMNKSAVLRCVWRQGQGNVSVGVLTPNLSSID  360

Query  1295  NVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEAL  1474
             N+PDS YFN LPFAEDVREFQFPSFS+ PSS  P++ QQEAAD+LV+MLDLAP D +E L
Sbjct  361   NIPDSFYFNILPFAEDVREFQFPSFSSFPSSWQPDQHQQEAADDLVRMLDLAPFDRKEVL  420

Query  1475  LPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCF  1654
              P++TPNPVL+R+Y +L +KSK  +  VP LD  L+RI +PDP+ LS++ ++++ F+  F
Sbjct  421   QPDYTPNPVLERFYQFLHLKSKAPEIDVPQLDRSLKRIAEPDPDFLSRHNSIINNFQERF  480

Query  1655  ELKDNPKMKKSRKRLIREKPTGSDEEG---ERASTKVKS------------EKIGNINPV  1789
             ELK+NPK KK  ++  REKP+ S++E    +    KV+S            EKIG++NPV
Sbjct  481   ELKENPKKKKLSRQAWREKPSASNDEKVGVDGVVPKVQSSSLKKSLSSLEVEKIGDLNPV  540

Query  1790  QDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEP  1969
             QDFE M++RRDS +W+ +AI++M++ I++L+ENS EG++Y KA+ECL+ALR GCI+EQEP
Sbjct  541   QDFEAMMARRDSSKWITEAIKDMQHYIYHLLENSYEGNSYPKAIECLMALRKGCILEQEP  600

Query  1970  KQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSF  2125
             K+FN  + ++    +  DL  F + L S  I LI+K+EA DSD+ E EA++ 
Sbjct  601   KEFNRFMLDICKKFRRSDLADFLELLYSKKIPLISKSEAADSDLTEEEAKNL  652



>gb|AEW90637.1| KU80-like protein [Pinus sylvestris]
Length=710

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/685 (55%), Positives = 500/685 (73%), Gaps = 15/685 (2%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++D+ PSMH  L  +E+  S LV +K+ +SK DEVG++LFG  E  N+L 
Sbjct  1     MARNKESLVLLLDISPSMHNHLHYVERAMSTLVRRKVYFSKSDEVGLVLFGAEEPDNDLQ  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYE+V V R IKVVD+D+L+AL +LPRG   GDFLDA++VGMD++IKK G  +KG 
Sbjct  61    KEVGGYENVVVFRPIKVVDEDILEALSRLPRGMAPGDFLDAIVVGMDLLIKKLGKGSKGN  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLIT A   IK+P EGTKEDQV  IA QMK HGM++D V+ R +     +  +  EN
Sbjct  121   KRLCLITGAQSFIKEPDEGTKEDQVDIIANQMKEHGMKLDVVVFRQRMPGQTKSELFSEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
               LL+ FS+ T ++   VES TSL+GA++ RNI+P T++RGD EL+  +KIKVWVYKKT 
Sbjct  181   LSLLNRFSRRTEAEVIVVESPTSLLGAVKVRNISPFTIFRGDLELTPIMKIKVWVYKKTY  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             +ER PTLK YSDKAPP D +A  E+    EYK  ++P K +PPEQRIKG+ YGPQVVPIS
Sbjct  241   QERIPTLKKYSDKAPPNDPYATREVKMDIEYKSREEPDKTIPPEQRIKGFNYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
              AE E +KFKPEKGVKLLGFTDAS+I RH YMKD ++ IA+P N+KAILAVSA+ARAM++
Sbjct  301   MAEQETLKFKPEKGVKLLGFTDASSIPRHSYMKDTSILIAEPGNTKAILAVSAVARAMEE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
               +VAI+RCVWR+ Q NV +GVLTPN+S+K N  DS YFN +PF ED+REF F SF + P
Sbjct  361   TKKVAILRCVWRERQANVILGVLTPNISNKSNAADSFYFNIIPFVEDIREFPFASFDSFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             +S  PN  QQEAADN V+MLDLAP   +EALLPE T NP+L+R+Y +L+ KS+  DA VP
Sbjct  421   ASQQPNIVQQEAADNFVQMLDLAPPGREEALLPELTLNPILERFYSFLDTKSRRSDADVP  480

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDE-EGE  1738
             P+D+ ++ I +PDPEL+++N+  +D F   F+LK NPK   + K+  R+KP+ S+E  G+
Sbjct  481   PVDDAVKSIIEPDPELIAKNE--LDRFCSQFQLKMNPKKDNASKKFWRDKPSLSEEAAGK  538

Query  1739  RASTKV------------KSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLV  1882
              A   V            K+E+IG++ PVQDFE M++RRDS EWV KAI+EMK  I  L+
Sbjct  539   EAGDDVQDGISFDSLAARKTEQIGSLTPVQDFEAMLARRDSDEWVPKAIREMKKLITDLL  598

Query  1883  ENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGI  2062
             ++S +G+TY KA++CLVALRNGC+ ++EP +FN+ +R L  +C+ K L  F + + S   
Sbjct  599   DSSYKGNTYHKAMDCLVALRNGCVQQEEPIEFNNFMRELGNNCQGKRLNDFWELIVSKNF  658

Query  2063  ALITKTEAPDSDVLESEARSFMTES  2137
             +LI K EA DSDV E EA+ F+ ++
Sbjct  659   SLINKNEAADSDVTEEEAKEFLAKA  683



>gb|ACN25700.1| unknown [Zea mays]
 tpg|DAA52572.1| TPA: hypothetical protein ZEAMMB73_970034 [Zea mays]
Length=669

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/677 (57%), Positives = 493/677 (73%), Gaps = 26/677 (4%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARNRE +IL++DVGPSMH VL E            L+Y++ DEVG++LFGT  T NEL 
Sbjct  1     MARNREVVILLLDVGPSMHGVLLE------------LVYNRSDEVGIVLFGTKGTCNELA  48

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +++GGY+HVTV+  IKVVD+   QAL+ LP GS  GDFLD+++VG+DM+I+K+GIT KGK
Sbjct  49    KDIGGYKHVTVIHDIKVVDEGTAQALQNLPLGSAPGDFLDSIVVGLDMVIRKFGIT-KGK  107

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +RLCLIT A   ++DP EGTKEDQV TIA  +K H ++M+ +I R  +       +++EN
Sbjct  108   RRLCLITGAQELLRDPPEGTKEDQVDTIANMLKKHNIKMECIIFR--EPGVHHNDVMEEN  165

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F   + +K   V++ TSL+GA++TRN+ PVT++RGD E+++  KIKVWVYKKT+
Sbjct  166   DRLLHQFRNRSVAKVVQVDNPTSLLGALKTRNVLPVTVFRGDLEVNSNFKIKVWVYKKTA  225

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAPP DKFA HE+   YEYK V +P K VPP+QRIKGY YGPQV+P+S
Sbjct  226   EEKFPTLKKYSDKAPPNDKFASHEVKVDYEYKSVVEPDKVVPPDQRIKGYLYGPQVIPVS  285

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             +AEWEAVKFKPEKGVKLLGFTD S++ RH +MKD  +FI +P N KA LAVSA+ARAM  
Sbjct  286   NAEWEAVKFKPEKGVKLLGFTDRSSVPRHQFMKDVCLFIPEPGNMKASLAVSAIARAMHQ  345

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQGNV IGVLTPN+S   N+ DS YFN LPFAED+REFQF SFS+LP
Sbjct  346   MNKVAIVRCVWRQGQGNVAIGVLTPNISSVNNIQDSFYFNVLPFAEDIREFQFRSFSSLP  405

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
             SS  P E+QQEAADNLVKMLDLAP   +E L PEFTPNP+L+R+Y YL++KSK  DA VP
Sbjct  406   SSSQPTEEQQEAADNLVKMLDLAPP-GREVLKPEFTPNPILERFYSYLDLKSKQPDANVP  464

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER  1741
             PL+  LRRIT+PDP+++ Q   ++    + F LKDNPK KK+R + +    TG+ ++ + 
Sbjct  465   PLERSLRRITEPDPDVVGQQTQLIQNLSKAFVLKDNPKKKKARTQDMLAY-TGAGDQAKS  523

Query  1742  ASTKV------KSEKIGNI---NPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL  1894
                +V       +E +  I   NPVQDFE M+++R S  W  KAI +M+N I  L++NS 
Sbjct  524   VEDRVLENTHPSTENVVAIRDSNPVQDFEAMLAKRSSSTWTQKAIGDMQNYIAALLQNSS  583

Query  1895  EGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALIT  2074
             +G  YQKALEC  +LR  CI+EQEP++FN  L  +Y   KE D   F + L S  I+LI 
Sbjct  584   DGGNYQKALECFASLRKACIIEQEPQEFNQFLTKIYERLKEGDAAKFFQLLSSKNISLIN  643

Query  2075  KTEAPDSDVLESEARSF  2125
             K EAPDSDV E  ARSF
Sbjct  644   KEEAPDSDVTEEMARSF  660



>ref|XP_002466067.1| hypothetical protein SORBIDRAFT_01g000620 [Sorghum bicolor]
 gb|EER93065.1| hypothetical protein SORBIDRAFT_01g000620 [Sorghum bicolor]
Length=670

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/665 (57%), Positives = 486/665 (73%), Gaps = 18/665 (3%)
 Frame = +2

Query  173   MHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKV  352
             MH VL E++ +CS LV KKL+Y++ DEVG++LFGT  T NEL +ELGGY+HVTV R IKV
Sbjct  1     MHGVLQEVKNICSTLVHKKLVYNRSDEVGIVLFGTKGTCNELAKELGGYKHVTVTRDIKV  60

Query  353   VDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPY  532
             VD+   QAL+ LP GS  GDFLD+++VG+DM+++K+G T KGK+RLCLIT+A   ++DP 
Sbjct  61    VDEGAAQALQNLPLGSAPGDFLDSIVVGLDMVMRKFGNT-KGKRRLCLITSAQDLLRDPP  119

Query  533   EGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLSVFSKETSSKAAY  712
             EGTKE+QV TIA  +K H ++++ +I R    L     +++END LL  F   + +K   
Sbjct  120   EGTKEEQVDTIADMLKKHSIKLECIIFREPGVL--RNAVMEENDRLLYQFRNRSVAKVVQ  177

Query  713   VESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPT  892
             V+S TSL+GA++TRN+ PVT++RGD E+++  KIKVWVYKKT+EE+FPTLK YSDKAPP+
Sbjct  178   VDSPTSLLGALKTRNVLPVTVFRGDLEVNSNFKIKVWVYKKTAEEKFPTLKKYSDKAPPS  237

Query  893   DKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKL  1072
             DK A HE+   YEYK V +P K VPP+QRIKGY YGPQV+P+S+AEWEAVKFKPEKGVKL
Sbjct  238   DKLASHEVKVDYEYKSVVEPDKIVPPDQRIKGYLYGPQVIPVSNAEWEAVKFKPEKGVKL  297

Query  1073  LGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             LGFTD SN+ RH++MKD  +FI +P N KA LAVSA+ARAM  MN+ AIVRCVWRQGQGN
Sbjct  298   LGFTDRSNVPRHHFMKDVCLFIPEPGNIKATLAVSAIARAMHQMNKAAIVRCVWRQGQGN  357

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
             V +GVLTPN+S   NV DS YFN LPFAED+REFQF SFS+LPSS  P E+QQEAADNLV
Sbjct  358   VALGVLTPNISAVDNVQDSFYFNVLPFAEDIREFQFRSFSSLPSSSQPTEEQQEAADNLV  417

Query  1433  KMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELL  1612
             KMLDLAP   +E L PEFTPNP+L+R+Y YL++KSK  DA VPPLD  LRRIT+PDP ++
Sbjct  418   KMLDLAPP-GREVLKPEFTPNPMLERFYSYLDLKSKQPDANVPPLDRSLRRITEPDPNVV  476

Query  1613  SQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDE---------EGERA--STKVK  1759
              Q   ++    + FELK+NPK KK+R + I       D+         E +R   +T   
Sbjct  477   GQQTQLIQNLGKAFELKENPKKKKARGQDILAYTGAGDQAKSVEEPSVEKDRVLENTHPP  536

Query  1760  SEKIGNI---NPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECL  1930
             +E +G I   NPV DFE M++ R S  WV KAI++M+N    L++ S +G  YQKALEC 
Sbjct  537   TENVGAIRDSNPVHDFEAMLANRSSSTWVQKAIEDMQNYTAALLQKSHDGSNYQKALECF  596

Query  1931  VALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLES  2110
              ALR  CI+EQEP++FN+ L  +Y   KE D   F + L S  I+LI+K EAPDSDV E 
Sbjct  597   AALRKACIIEQEPQEFNEFLTKIYERLKEGDAAKFFQLLSSKNISLISKEEAPDSDVTEE  656

Query  2111  EARSF  2125
              A+SF
Sbjct  657   MAKSF  661



>gb|EMT04533.1| ATP-dependent DNA helicase 2 subunit ku80 [Aegilops tauschii]
Length=778

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/704 (55%), Positives = 494/704 (70%), Gaps = 49/704 (7%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+EGL+L++DVGPSMH  L E            L++ + DEVGV+LFGT ET N+L 
Sbjct  87    MARNKEGLVLLLDVGPSMHRALQE------------LVFHRSDEVGVVLFGTKETHNDLA  134

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              ELGGY+HV V   IKVVD++   ALE LPRG+     LDA++VG+DM+IK++G T K K
Sbjct  135   RELGGYKHVLVKHDIKVVDEETKNALENLPRGT--APVLDAIVVGLDMLIKRFGDT-KAK  191

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +RLCLIT+A   ++DP +GTKEDQV TIA QMK H ++MD ++ R  +       ++DEN
Sbjct  192   QRLCLITDAQHLLRDPPQGTKEDQVDTIADQMKKHDIKMDCIVFR--ESGVQHNSVMDEN  249

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F   + +K   V++ T+L+GA++TRN+ PVT++RGD E+S+  KIKVW YKKTS
Sbjct  250   DRLLYHFRDRSVAKVVQVDTPTALLGALKTRNVLPVTIFRGDLEVSSTFKIKVWAYKKTS  309

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAPP+D+FA HE+   YEYK + +P   VPP+QRIKGY YGPQVVPIS
Sbjct  310   EEKFPTLKKYSDKAPPSDQFASHEVKVDYEYKSILEPDTVVPPDQRIKGYLYGPQVVPIS  369

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGF D S+I R Y+MKD N F+ +P N+KAI+AVSALARAM++
Sbjct  370   SAEWEAVKFKPEKGVKLLGFADRSSIPRSYFMKDVNSFVPEPGNTKAIVAVSALARAMQE  429

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQ Q NV  GVLTPN+S   NVPDS YFN LPFAED+R+F F SFS+LP
Sbjct  430   MNKVAILRCVWRQNQANVAFGVLTPNISSVNNVPDSFYFNILPFAEDIRDFPFRSFSSLP  489

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVP  1561
              S  P E+QQEAADNLVKMLDLAP   +E L P+FTPNP+L+R+Y YL++KSK  DA  P
Sbjct  490   PSSQPTEEQQEAADNLVKMLDLAPPGREEILRPDFTPNPMLERFYSYLDLKSKQPDANPP  549

Query  1562  PLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSR--KRLI-----------  1702
             PLD  LRRIT+PDP++++    ++    + FELK+NPK KK+R  +RL            
Sbjct  550   PLDSCLRRITEPDPDVINYRAPLIQNLGKSFELKENPKRKKARTQERLAYTDPDDQAKSS  609

Query  1703  ---REKPTGSDEEGERAS---------------TKVKSEKIGNINPVQDFEDMISRRDSP  1828
                 EK T +D + ++                 +  K  KIG++NPV+DFE M++ R S 
Sbjct  610   ENNAEKATAADGQAKKPEDPYAEKARAIEVLFPSTEKVGKIGDVNPVKDFEAMLAERSSS  669

Query  1829  EWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYAS  2008
              WV KAI+EMK     LV+NSL+GD Y+KALEC VALR  CI+EQEP+++N  +  LY  
Sbjct  670   IWVQKAIEEMKKYTTNLVQNSLQGDYYEKALECFVALRKACIIEQEPEEYNQFVTKLYER  729

Query  2009  CKE-KDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMTES  2137
              K+  D+  F + L S  + LI K EAPDSDV E  ARSF  ++
Sbjct  730   LKKVDDVVKFFQLLSSKNVLLICKEEAPDSDVTEEMARSFFMKT  773



>gb|EPS71667.1| hypothetical protein M569_03092, partial [Genlisea aurea]
Length=864

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/648 (57%), Positives = 487/648 (75%), Gaps = 11/648 (2%)
 Frame = +2

Query  119   QMARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
             ++   +E ++ V+DVGP +H VL ++EK CS+L + KLIY+KYDEVGV+LFGT +T N+L
Sbjct  215   KLRSKKECMVFVLDVGPKLHPVLSDVEKACSLLAQLKLIYNKYDEVGVVLFGTEDTKNDL  274

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKG  478
                +GGY++V VL+ + VVD +L++ L++LPRG+V GDF    +VG+DM+I+KYG T KG
Sbjct  275   ALTVGGYQNVMVLQDMNVVDGELVELLQKLPRGTVHGDF----VVGLDMLIQKYGPTFKG  330

Query  479   KKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDE  658
             KK L LIT+A+ PIK PYEGTKE+QV TIA QM  HG+RMD   +R++QD  +   +++E
Sbjct  331   KKHLYLITDALSPIKVPYEGTKEEQVITIAEQMVVHGIRMDCFTLRLQQDFSSNNEVMEE  390

Query  659   NDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKT  838
             NDFLLS+FS + + K  +V++A SL   +  R I+PVT+YRGDFELS      VWVYKKT
Sbjct  391   NDFLLSLFSTKFAMKHVFVKNAASLFSHLGKRRISPVTIYRGDFELSP-----VWVYKKT  445

Query  839   SEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPI  1018
             SEERFPTLK YSDKAP +DK A  EI   YEY+  ++P+  VPPEQRIK ++YGPQVVPI
Sbjct  446   SEERFPTLKSYSDKAPESDKSATREIKIGYEYRCSKNPSTVVPPEQRIKSFQYGPQVVPI  505

Query  1019  SSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMK  1198
             SSAE +A+KFKPEKGVKLLGFTDASNIMRH+YM+D N+F+ADP +  AI A+SALARAMK
Sbjct  506   SSAELDAMKFKPEKGVKLLGFTDASNIMRHHYMRDVNLFLADPGSVPAIKAISALARAMK  565

Query  1199  DMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNL  1378
             +MN+VAIVRCVWRQGQ +V IGVLTPN+S   N+PD+ YFN LPFAED+REF FPSFS++
Sbjct  566   EMNKVAIVRCVWRQGQASVVIGVLTPNLSGSDNIPDTFYFNVLPFAEDLREFHFPSFSSM  625

Query  1379  PSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAV  1558
             P SM PNE+QQ+AAD LV+MLDLAP   +EAL P FT NPVLQR+Y  L+ KS++ DAA+
Sbjct  626   PPSMQPNEKQQDAADKLVQMLDLAPEGEEEALQPVFTLNPVLQRFYATLDAKSRNPDAAI  685

Query  1559  PPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGE  1738
             PP+++ LR+  +PDPELLS++   ++EFR  FE+K N ++KKS +    E+      +G 
Sbjct  686   PPVEDTLRKTIEPDPELLSRSTAAIEEFRNAFEIKRNLELKKSSRSSSDEELETLSTDGI  745

Query  1739  RASTKVKSEKIGNINPVQDFEDMIS-RRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQK  1915
               S+  K E IG+ +PV+DFE MI    D P+ V +A++ M+NKIF LVE+S EGDT++K
Sbjct  746   EYSSTKKEESIGDDDPVKDFEAMIRPPGDDPKRVKRAMRLMRNKIFDLVESSFEGDTFEK  805

Query  1916  ALECLVALRNGCIV-EQEPKQFNDLLRNLYASCKEKDLRSFCKQLESH  2056
             AL+C V+LR  CI  EQE ++F+  L+ L   C E  L+SF   +E H
Sbjct  806   ALQCAVSLRKCCISREQEAEEFDAFLKRLKEFCSENYLKSFVDYMEEH  853



>ref|XP_008380667.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80 [Malus domestica]
Length=502

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/462 (73%), Positives = 399/462 (86%), Gaps = 0/462 (0%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN++G++L+IDV PSMH  LPEIEKVCS+LVEKKLIY+KYDEVGV+LFGT +T NELT
Sbjct  1     MARNKDGMVLLIDVSPSMHKALPEIEKVCSMLVEKKLIYNKYDEVGVVLFGTEDTENELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGY+HV VL++IKVVD  L++ L+QLPRG+ +GDFLDA+IVG+DM+IKKYG T KGK
Sbjct  61    TEVGGYKHVVVLQNIKVVDGHLVETLQQLPRGTHEGDFLDAIIVGLDMLIKKYGETYKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCLITNA  P K P EGTKE+QV+TIA  M  HGMRM+S++VR K   +A+K I+DEN
Sbjct  121   KRLCLITNAQFPTKFPQEGTKEEQVTTIAGHMNKHGMRMESIVVRGKLTGEADKNIMDEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL +FS++T +K  +VES TSL+GA+RTR I+PVT++RGD ELS K+KIKVWVYKKTS
Sbjct  181   DHLLGIFSRKTCAKLVHVESPTSLLGALRTRKISPVTIFRGDLELSPKMKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YS+KAPPTD+FA HE+   +EYK V+DP+K VPP+QRIKGYRYGPQV+PIS
Sbjct  241   EEKFPTLKKYSEKAPPTDRFATHEVKVDFEYKSVEDPSKVVPPDQRIKGYRYGPQVIPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEW+AVKFKPEK VKLLGF+DA NIMRHYYMKD N+FI +P N++AILAVSALARAMKD
Sbjct  301   SAEWDAVKFKPEKSVKLLGFSDAKNIMRHYYMKDVNIFIPEPGNTRAILAVSALARAMKD  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQGQGNV +GVLTPNVSD  N+PDS YFN LPFAEDVREFQFPSFSN P
Sbjct  361   MNKVAIMRCVWRQGQGNVVVGVLTPNVSDNDNIPDSFYFNVLPFAEDVREFQFPSFSNFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQ  1507
              S  P+EQQQEAAD LVKMLDLAP   +EALLP  TPNPVL+
Sbjct  421   ESWQPSEQQQEAADGLVKMLDLAPPGKEEALLPSLTPNPVLE  462



>gb|KCW72969.1| hypothetical protein EUGRSUZ_E01418 [Eucalyptus grandis]
Length=525

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/462 (71%), Positives = 402/462 (87%), Gaps = 0/462 (0%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH +LPE+EK+CS++V+KKL+YSKYDEVGV+LFGT ET NELT
Sbjct  1     MARNKEALVLLLDVGPSMHHLLPEVEKICSMIVQKKLVYSKYDEVGVVLFGTEETENELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              E+GGYEHV VL++IKVVD DL++ L+Q+PRG+V GDFLDA++VGMDM+IKKY  TNKGK
Sbjct  61    MEVGGYEHVVVLQNIKVVDGDLVETLKQIPRGTVPGDFLDAIVVGMDMLIKKYSSTNKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             KRLCL+TN + PIKDPYEG+KEDQV+ IA QM +HGM+++ V+VR          +++EN
Sbjct  121   KRLCLMTNGLSPIKDPYEGSKEDQVNAIAEQMTSHGMKLECVVVRESVVRGENVSVMEEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D +L++F +++ +K  +VES+TSL+GA++TRNI+PVT++RGD E+S KLKIKVWVYKKTS
Sbjct  181   DRILNLFPQKSCAKTIFVESSTSLLGALKTRNISPVTIFRGDLEISPKLKIKVWVYKKTS  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP TDKFA HE+   YEYK V+D  K VPPEQRIKGYRYGPQVVPIS
Sbjct  241   EEKFPTLKKYSDKAPSTDKFASHEVKVDYEYKSVEDANKVVPPEQRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             + EW+AVKFKPEK VKLLGFTD+SNIMRH+YMKD N+FIADP +  AI+AVSALARAMK+
Sbjct  301   ADEWDAVKFKPEKSVKLLGFTDSSNIMRHHYMKDVNIFIADPGDQNAIVAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             M++VAI+RCVWRQGQGNV +GVLTPNVSD  +VPDS YFN LPFAEDVREFQFPSFSNLP
Sbjct  361   MHKVAILRCVWRQGQGNVVVGVLTPNVSDNDHVPDSFYFNILPFAEDVREFQFPSFSNLP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQ  1507
             +S+LP+E+QQEAADN VKMLDL PSD +E L P+FTPNPVL+
Sbjct  421   ASLLPDEEQQEAADNFVKMLDLTPSDRKEMLQPDFTPNPVLE  462


 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  1955  VEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMTE  2134
             V +EPKQFND L  L   C + DLRSFC  L + GI LI+KTEA DSDV E EARSF+ +
Sbjct  460   VLEEPKQFNDFLHQLCKFCLQNDLRSFCNFLATKGITLISKTEAADSDVTEEEARSFLVK  519

Query  2135  S  2137
             S
Sbjct  520   S  520



>gb|KDO85831.1| hypothetical protein CISIN_1g005544mg [Citrus sinensis]
Length=475

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/475 (70%), Positives = 394/475 (83%), Gaps = 5/475 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MAR RE L+L++DV PSMH VLP++EK+CS L++KKLIY K  EVGVILFGT ET NELT
Sbjct  1     MARTREALLLLLDVSPSMHSVLPDVEKLCSRLIQKKLIYGKNHEVGVILFGTEETENELT  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +E+GGYEHV VL+ IKVVD  L+Q+L+ LP+G+  GDFLDA++VG+DM+IKKYG T KGK
Sbjct  61    KEVGGYEHVKVLQDIKVVDGHLVQSLKHLPQGTCAGDFLDAIVVGVDMLIKKYGETYKGK  120

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             K LCLIT+A+CP+KDP  GTKEDQVSTIA QM A G+RM +++VR     +    +I EN
Sbjct  121   KHLCLITDALCPLKDPDVGTKEDQVSTIARQMVAFGLRMKNIVVRASLSGEPHMRVIIEN  180

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL++FSK++S+K  +V+S TSL GA +TR+I+PVT++RGD ELS K+KIKVWVYKKT 
Sbjct  181   DNLLNIFSKKSSAKTLFVDSTTSLRGARKTRDISPVTIFRGDLELSEKMKIKVWVYKKTG  240

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP TDKFA HE+   YEYK V+DP+K VPPEQRIKGYRYGPQVVPIS
Sbjct  241   EEKFPTLKKYSDKAPSTDKFATHEVKVDYEYKSVEDPSKVVPPEQRIKGYRYGPQVVPIS  300

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEK VKLLGFTDASNI+RHYYMKD N+FIA+P NS+A +AVSALARAMK+
Sbjct  301   SAEWEAVKFKPEKSVKLLGFTDASNILRHYYMKDVNLFIAEPGNSRATVAVSALARAMKE  360

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAIVRCVWRQGQ +V +GVLTPNVS+K N+PDS YFN LPFAEDVREFQFPSFS  P
Sbjct  361   MNKVAIVRCVWRQGQQSVVVGVLTPNVSEKINIPDSFYFNVLPFAEDVREFQFPSFSKFP  420

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQ-----RYYHYLEM  1531
              S  PNEQQQEAADNLVKMLDLAPS   E L PE TPNP L+      Y+ +L++
Sbjct  421   VSWQPNEQQQEAADNLVKMLDLAPSGKGEILQPELTPNPALEVLNICGYFGFLDV  475



>gb|EEC76568.1| hypothetical protein OsI_14396 [Oryza sativa Indica Group]
Length=643

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/680 (53%), Positives = 473/680 (70%), Gaps = 61/680 (9%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VL E+E +CS LV KKL+Y++ DE+GV+LFGT ET+NEL 
Sbjct  1     MARNKEALVLLLDVGPSMHGVLQEVENICSTLVHKKLVYNRSDEIGVVLFGTKETSNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +ELGGY+HV V R IKVVD++   AL+ LPRG                       T+ GK
Sbjct  61    KELGGYKHVVVARDIKVVDEETTNALQNLPRG-----------------------TSPGK  97

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +R+CL+T+A  P++DP +GTK+DQV TIA QMK H ++MD +I R  +       ++DEN
Sbjct  98    QRMCLVTDAQHPLRDPPQGTKKDQVDTIADQMKRHEIKMDCIIFR--ESGVRHNAVMDEN  155

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F + + +K  +V+S TSL+GA+RTRN+ PVT++RGD E        VWVYKKTS
Sbjct  156   DQLLYHFRERSVTKVVHVDSPTSLLGALRTRNVLPVTVFRGDLE--------VWVYKKTS  207

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP +DKFA HE+   YEYK V +P   VPP+QRIKGY YGPQVVPIS
Sbjct  208   EEKFPTLKKYSDKAPASDKFASHEVKVDYEYKSVLEPDTVVPPDQRIKGYLYGPQVVPIS  267

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASN--------IMRHYYMKDANVFIADPENSKAILAVS  1177
             SAEWEAVKFKPEK ++     D SN          RHY+MKD   F+ +P N+KA+ AVS
Sbjct  268   SAEWEAVKFKPEKVLR----PDVSNGDTVHLFYFNRHYFMKDVFSFVPEPGNTKAVAAVS  323

Query  1178  ALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQ  1357
             ALARAM +MN+VAI+RCVWRQGQGNV +GVLTPN+S   NV DS YFN LPFAED+REFQ
Sbjct  324   ALARAMSEMNKVAILRCVWRQGQGNVALGVLTPNISSAKNVLDSFYFNILPFAEDIREFQ  383

Query  1358  FPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKS  1537
             F SFS+LPSS  P ++QQEAADNLVKMLDLAP   +E L P+FTPNP+L+R+Y YL++KS
Sbjct  384   FRSFSSLPSSSQPTKEQQEAADNLVKMLDLAPPGREEILKPDFTPNPMLERFYRYLDLKS  443

Query  1538  KHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPT  1717
             K  DA VPPLD+ L++IT+PDP+++     ++ +    FELK+NPK KK+R +  R   T
Sbjct  444   KQPDANVPPLDKCLKKITEPDPDVIDYQAPLIKKLGNVFELKENPKKKKARTQ-DRLTYT  502

Query  1718  GSDEEG----ERASTKV-----------KSEKIGNINPVQDFEDMISRRDSPEWVNKAIQ  1852
             G+D++     E ++ KV           K+ +IG+ NPVQDFE M+++R S  WV  AI+
Sbjct  503   GADDQAKLLEEPSAEKVGVSEALYPPKKKAGEIGDHNPVQDFEAMLTQRSSSTWVQTAIE  562

Query  1853  EMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRS  2032
             EM+  I  L+++S + D +QKALECLVALR  CI+EQEP ++N  +  L    +    + 
Sbjct  563   EMQKYITALIQDSCDRDNHQKALECLVALRKACIIEQEPNEYNGFVTKLCQKFRPAGDKI  622

Query  2033  FCKQLESHGIALITKTEAPD  2092
             F + L S   +LI+K EAPD
Sbjct  623   FLQLLSSKNASLISKEEAPD  642



>gb|EEE60332.1| hypothetical protein OsJ_13430 [Oryza sativa Japonica Group]
Length=643

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/680 (53%), Positives = 473/680 (70%), Gaps = 61/680 (9%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VL E+E +CS LV KKL+Y++ DE+GV+LFGT ET+NEL 
Sbjct  1     MARNKEALVLLLDVGPSMHGVLQEVENICSTLVHKKLVYNRSDEIGVVLFGTKETSNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +ELGGY+HV V R IKVVD++   AL+ LPRG                       T+ GK
Sbjct  61    KELGGYKHVVVARDIKVVDEETTNALQNLPRG-----------------------TSPGK  97

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +R+CL+T+A  P++DP +GTK+DQV TIA QMK H ++MD +I R  +       ++DEN
Sbjct  98    QRMCLVTDAQHPLRDPPQGTKKDQVDTIADQMKRHEIKMDCIIFR--ESGVRHNAVMDEN  155

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F + + +K  +V+S TSL+GA+RTRN+ PVT++RGD E        VWVYKKTS
Sbjct  156   DQLLYHFRERSVTKVVHVDSPTSLLGALRTRNVLPVTVFRGDLE--------VWVYKKTS  207

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP +DKFA HE+   YEYK V +P   VPP+QRIKGY YGPQVVPIS
Sbjct  208   EEKFPTLKKYSDKAPASDKFASHEVKVDYEYKSVLEPDTVVPPDQRIKGYLYGPQVVPIS  267

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASN--------IMRHYYMKDANVFIADPENSKAILAVS  1177
             SAEWEAVKFKPEK ++     D SN          RHY+MKD   F+ +P N+KA+ AVS
Sbjct  268   SAEWEAVKFKPEKVLR----PDVSNGDTVHLFYFNRHYFMKDVFSFVPEPGNTKAVAAVS  323

Query  1178  ALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQ  1357
             ALARAM +MN+VAI+RCVWRQGQGNV +GVLTPN+S   NV DS YFN LPFAED+REFQ
Sbjct  324   ALARAMSEMNKVAILRCVWRQGQGNVALGVLTPNISSAKNVLDSFYFNILPFAEDIREFQ  383

Query  1358  FPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKS  1537
             F SFS+LPSS  P ++QQEAADNLVKMLDLAP   +E L P+FTPNP+L+R+Y YL++KS
Sbjct  384   FRSFSSLPSSSQPTKEQQEAADNLVKMLDLAPPGREEILKPDFTPNPMLERFYRYLDLKS  443

Query  1538  KHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPT  1717
             K  DA VPPLD+ L++IT+PDP+++     ++ +    FELK+NPK KK+R +  R   T
Sbjct  444   KQPDANVPPLDKCLKKITEPDPDVIDYQAPLIKKLGNVFELKENPKKKKARTQ-DRLTYT  502

Query  1718  GSDEEG----ERASTKV-----------KSEKIGNINPVQDFEDMISRRDSPEWVNKAIQ  1852
             G+D++     E ++ KV           K+ +IG+ NPVQDFE M+++R S  WV  AI+
Sbjct  503   GADDQAKLLEEPSAEKVGVSEALYPPKKKAGEIGDHNPVQDFEAMLTQRSSSTWVQTAIE  562

Query  1853  EMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRS  2032
             EM+  I  L+++S + D +QKALECLVALR  CI+EQEP ++N  +  L    +    + 
Sbjct  563   EMQKYITALIQDSCDRDNHQKALECLVALRKACIIEQEPNEYNGFVTKLCQKFRPAGDKI  622

Query  2033  FCKQLESHGIALITKTEAPD  2092
             F + L S   +LI+K EAPD
Sbjct  623   FLQLLSSKKASLISKEEAPD  642



>emb|CAN68627.1| hypothetical protein VITISV_004463 [Vitis vinifera]
Length=812

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/438 (70%), Positives = 362/438 (83%), Gaps = 13/438 (3%)
 Frame = +2

Query  818   VWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRY  997
             VWVYKKT+E RFPTLK YSD+APPTDKFA HE+   +EYK V++ +K VPPEQRIKGYRY
Sbjct  348   VWVYKKTAEXRFPTLKQYSDQAPPTDKFATHEVKVDFEYKSVEESSKVVPPEQRIKGYRY  407

Query  998   GPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVS  1177
             GPQV+PISSAEWEAVKFKPEKGVKLLGFTDASN+MRHYYM D N+FIA+P N+KA+L VS
Sbjct  408   GPQVIPISSAEWEAVKFKPEKGVKLLGFTDASNVMRHYYMHDVNIFIAEPGNTKAMLTVS  467

Query  1178  ALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQ  1357
             ALARAMK+MN+VAI+RCVWRQGQG+V IG+LTPNVSDK ++PDS YFN LP+AEDVREFQ
Sbjct  468   ALARAMKEMNKVAILRCVWRQGQGSVVIGILTPNVSDKDDIPDSFYFNVLPYAEDVREFQ  527

Query  1358  FPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKS  1537
             FPSFSNLP+S  PNE+QQEAADNLVKMLDLAPS S+E LLP+ TPNPVL+R+Y +LE+KS
Sbjct  528   FPSFSNLPASWQPNEEQQEAADNLVKMLDLAPSGSRETLLPDLTPNPVLERFYRHLELKS  587

Query  1538  KHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPT  1717
             KH DAAVPPLDE L++IT+PDP+LLSQNK ++D FRR FELK+NPK+KKS +RL R +P+
Sbjct  588   KHPDAAVPPLDESLKKITEPDPKLLSQNKPIIDAFRRRFELKENPKLKKSTRRLXRXRPS  647

Query  1718  GSDEEGERA-------------STKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEM  1858
             G +EE                 ++ V  EKIG+  P+QDFE M+SRRDSPEWV KAI EM
Sbjct  648   GLNEEASMGDGSDGQAIKSIENTSTVGVEKIGDSTPIQDFEAMMSRRDSPEWVGKAINEM  707

Query  1859  KNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFC  2038
             KNKIF LVE+S EGD Y KALE LVALR GC++EQEPKQFND L +LY  C++ +L SFC
Sbjct  708   KNKIFDLVEDSYEGDNYLKALEYLVALRKGCVLEQEPKQFNDFLHHLYKYCEKHNLNSFC  767

Query  2039  KQLESHGIALITKTEAPD  2092
             + L S  I LI KTEA D
Sbjct  768   ESLASKEIMLINKTEAAD  785


 Score =   252 bits (643),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 167/198 (84%), Gaps = 2/198 (1%)
 Frame = +2

Query  227  KLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVD  406
            KLIYSK DEVG++LFGT +T NELT+E+GGYEHV VLR IKVVD DL++AL+QLPRG+V 
Sbjct  13   KLIYSKNDEVGIVLFGTEDTNNELTKEVGGYEHVVVLRHIKVVDGDLVEALQQLPRGTVA  72

Query  407  GDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAH  586
               LDA++VGMDM+IKK+G TNKGKKRLCLIT+A+CPIKDPYEGTKEDQ+ TIA QM AH
Sbjct  73   --VLDAIVVGMDMLIKKFGSTNKGKKRLCLITSALCPIKDPYEGTKEDQIGTIAEQMSAH  130

Query  587  GMRMDSVIVRMKQDLDAEKGIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAP  766
            GM+++ ++ R +   + +  I+DEND LL +FS +T++K  YVE+ TSL+GA+RTR+IAP
Sbjct  131  GMKLECIVARGRLSGNVDMRIMDENDLLLKLFSTKTTAKTLYVETPTSLLGALRTRSIAP  190

Query  767  VTLYRGDFELSTKLKIKV  820
            VT++RGD ELS K++IK+
Sbjct  191  VTIFRGDLELSPKMRIKL  208



>ref|XP_001770110.1| predicted protein [Physcomitrella patens]
 gb|EDQ65092.1| predicted protein [Physcomitrella patens]
Length=708

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/683 (48%), Positives = 461/683 (67%), Gaps = 23/683 (3%)
 Frame = +2

Query  146   ILVIDVGPSMHCVLPEIEKVCSVLVEKKLIY-SKYDEVGVILFgttetanelteelggYE  322
             +L++DVGPSMH  L ++ K  + L+ +K IY  K DEVGV+ FGTTET NEL +E+ GY 
Sbjct  1     MLLLDVGPSMHPYLADVSKCMTTLIHRKAIYQGKNDEVGVVYFGTTETDNELNKEMEGYH  60

Query  323   HVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLIT  502
             ++ V+  I VV  DL   LE +P G    DFLD ++VG DM++KK G   KG KRLCL+T
Sbjct  61    NIVVVEPIAVVSQDLAHRLENIPCGFGSSDFLDVIVVGCDMLMKKLGENKKGNKRLCLVT  120

Query  503   NAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLSVF  682
             +A  P+++P EGT EDQV  IA +M   G+++D V+VR+ Q+         +ND LL +F
Sbjct  121   DAASPVREPSEGTVEDQVRNIAERMGEQGIKLDVVVVRVGQNFLINSTGQHQNDVLLDLF  180

Query  683   SKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTL  862
                T ++     +ATS++G IR R ++P TLYRGDFEL+  L+IKVWVYKKTS+E+ PTL
Sbjct  181   KLHTQAEIGIARTATSMLGIIRPRAVSPTTLYRGDFELTPDLRIKVWVYKKTSQEKLPTL  240

Query  863   KMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAV  1042
             K YS++AP +D  A  E+    EYK   +P   VPPEQR K Y+YG   +PISS+  +++
Sbjct  241   KKYSNEAPASDSHATREVKIDTEYKSSDNPDVSVPPEQRTKAYKYGKNFIPISSSMEDSL  300

Query  1043  KFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIV  1222
             KFKPEKGVKL GF   S+I RHY++K++++F+ +P + K+I+AVSALARAMK+ +  A+V
Sbjct  301   KFKPEKGVKLKGFVKRSDIPRHYFLKESSIFLPEPGHQKSIVAVSALARAMKEHDYAAVV  360

Query  1223  RCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNE  1402
             RCVWRQGQ NV +G+L P VS + NV D  YFN +PF +D+REF+F SFS++P S+ P+ 
Sbjct  361   RCVWRQGQTNVVMGILLPFVSAQENVADGFYFNVIPFLDDMREFRFTSFSSMPESLQPSC  420

Query  1403  QQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILR  1582
             +QQEAA NLV+MLDL+PS+ +E L PE T NPVLQR+Y++L ++S + +A VPPLDE LR
Sbjct  421   EQQEAAYNLVRMLDLSPSEDEELLQPEQTINPVLQRFYYFLHLRSLNPEAKVPPLDESLR  480

Query  1583  RITDPDPELLSQNKTVVDEFRRCFELKDNPK------MKKSRKR-----LIREKPT----  1717
              I +PD   L +N+  +++F +   L  N +        K  +R      I+++P     
Sbjct  481   CIVEPDLLRLDENQYAINQFSQQLTLTPNIQENGKKSFWKGERRDGNVLQIKDEPAFMDV  540

Query  1718  -----GSDEEGERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLV  1882
                  GS      AS KV  E+IG+ NPV DFE +++RRDSPEWV KAIQ MK  I+ L+
Sbjct  541   DMKNPGSVSFNSLASRKV--EEIGSANPVADFEALMARRDSPEWVGKAIQGMKKMIYDLL  598

Query  1883  ENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGI  2062
             +++  G+TY+KAL CL++LR GC++++EP +FN  LR+L        L+ F +Q+    I
Sbjct  599   DSAYNGNTYEKALACLISLRLGCVIQEEPLEFNFFLRDLKTKGSTIRLQDFWQQVMGKKI  658

Query  2063  ALITKTEAPDSDVLESEARSFMT  2131
              LI+K EAPDS+V  +EA SF+T
Sbjct  659   TLISKDEAPDSNVGAAEAASFLT  681



>gb|EMS53802.1| ATP-dependent DNA helicase 2 subunit KU80 [Triticum urartu]
Length=756

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/705 (48%), Positives = 434/705 (62%), Gaps = 119/705 (17%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+EGL+L++DVGPSMH  L E+E VC+ LV KK            LF          
Sbjct  133   MARNKEGLVLLLDVGPSMHRALQEVENVCTTLVRKK--------ASGTLF----------  174

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMM-IKKYGITNKG  478
                                          P G++   F+ A  +G+  + +KK+ +T++G
Sbjct  175   -----------------------------PSGTLCWFFIGATRLGLSCLELKKHTMTSRG  205

Query  479   KKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDE  658
                  L   +MC     +E                 G++ +SV+              DE
Sbjct  206   N----LGAISMC-----WES----------------GVQHNSVM--------------DE  226

Query  659   NDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKT  838
             ND LL  F   + +K   V++ T+L+GA++TRN+ PVT++RGD E+S+  KIKVW YKKT
Sbjct  227   NDRLLYHFRDRSVAKVVQVDTPTALLGALKTRNVLPVTIFRGDLEVSSTFKIKVWAYKKT  286

Query  839   SEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPI  1018
             SEE+FPTLK YSDKAPP+D+FA HE+   YEYK + +P   VPP+QRIKGY YGPQVVPI
Sbjct  287   SEEKFPTLKKYSDKAPPSDQFASHEVKVDYEYKSILEPDTVVPPDQRIKGYLYGPQVVPI  346

Query  1019  SSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMK  1198
             SSAEWEAVKFKPEKGVKLLGF D S+I R Y+MKD N F+ +P N+KAI+AVSALARAM+
Sbjct  347   SSAEWEAVKFKPEKGVKLLGFADRSSIPRFYFMKDVNSFVPEPGNTKAIVAVSALARAMQ  406

Query  1199  DMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNL  1378
             +MN+VAI+RCVWRQ Q NV  GVLTPN+S   NVPDS YFN LPFAED+R+F F SFS+L
Sbjct  407   EMNKVAILRCVWRQNQANVAFGVLTPNISSVNNVPDSFYFNILPFAEDIRDFPFRSFSSL  466

Query  1379  PSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAV  1558
             P S  P E+QQEAADNLVKMLDLAP   +E L P+FTPNP+L+R+Y YL++KSK  DA  
Sbjct  467   PPSSQPTEEQQEAADNLVKMLDLAPPGREEILRPDFTPNPMLERFYSYLDLKSKQPDANP  526

Query  1559  PPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSR--KRLIREKPTGSDEE  1732
             PPLD  LRRIT+PDP++++    ++    + FELK+NPK KK+R  +RL    P    + 
Sbjct  527   PPLDSCLRRITEPDPDVINYRAPLIQNLGKSFELKENPKRKKARTQERLAYTDPDDQAKS  586

Query  1733  GERASTKV-----------------------------KSEKIGNINPVQDFEDMISRRDS  1825
              E  + K                              K  KIG++NPV+DFE M++ R S
Sbjct  587   SENNAGKATVADGQAKKPEDPYAEKARAIEVMFPSTEKVGKIGDVNPVKDFEAMLAERSS  646

Query  1826  PEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYA  2005
               WV KAI+EMK     LVENSL+GD Y+KALEC VALR  CI+EQEP+++N  +  LY 
Sbjct  647   SIWVQKAIEEMKKYTTNLVENSLQGDYYEKALECFVALRKACIIEQEPEEYNQFVTKLYE  706

Query  2006  SCKE-KDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMTES  2137
               K+  D+  F + L S  + LI K EAPDSDV E  A+SF  ++
Sbjct  707   RLKKVDDVVKFFQLLSSKNVLLICKEEAPDSDVTEEMAKSFFLKT  751



>ref|XP_006847691.1| hypothetical protein AMTR_s00149p00057710 [Amborella trichopoda]
 gb|ERN09272.1| hypothetical protein AMTR_s00149p00057710 [Amborella trichopoda]
Length=471

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/458 (63%), Positives = 364/458 (79%), Gaps = 0/458 (0%)
 Frame = +2

Query  134   REGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelg  313
             +E L+ ++DV PSMH +LP++ K+C +++E+K   +K DEV V+LFGT +T NEL +E+G
Sbjct  3     QEALVFLLDVSPSMHNLLPDVSKLCHMIIERKFFDNKSDEVAVVLFGTQDTNNELEKEVG  62

Query  314   gYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLC  493
             GYEHV V+R+IKV+ DD+ + L  LPRG+  GDFLDA++VGMD++IKK+G TNKGKKRLC
Sbjct  63    GYEHVVVVRAIKVIADDIFEVLSDLPRGTTPGDFLDAIVVGMDLLIKKFGPTNKGKKRLC  122

Query  494   LITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLL  673
             L+TNA  PIK+P EGTK+DQ+  +  Q+KAHGM+++ ++ R K    A+K I++END+LL
Sbjct  123   LVTNAQHPIKEPDEGTKDDQIDALCEQLKAHGMKLECIVARGKFTGVADKRIVNENDYLL  182

Query  674   SVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERF  853
             S FS +  ++  +VE   SL+GAI+TR ++PVT++RGD ELS  +KIKVWVYKK+  ERF
Sbjct  183   SRFSGKGIARTVFVEDRASLLGAIQTRTVSPVTIFRGDLELSNVMKIKVWVYKKSVVERF  242

Query  854   PTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEW  1033
             PTLK YSDKAPP  KF+ HE+   +EYK   +P   VPPEQRI+GYRYGPQVVPISSAE 
Sbjct  243   PTLKKYSDKAPPNSKFSTHEVKVDFEYKSKDNPNNIVPPEQRIRGYRYGPQVVPISSAEL  302

Query  1034  EAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRV  1213
             EA+KFKPEKG+KLLGFT+ASNI RH YM+D  VFI +P N KAILAVS +ARAMK+ N+V
Sbjct  303   EALKFKPEKGIKLLGFTNASNIRRHQYMRDTYVFIPEPGNRKAILAVSTMARAMKNANKV  362

Query  1214  AIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSML  1393
             +I+RCVWRQGQGNV +GVLTPN+S   N+PDS YFN LPFAEDVREF FPSF+ LP S  
Sbjct  363   SILRCVWRQGQGNVVVGVLTPNLSSSDNIPDSFYFNILPFAEDVREFHFPSFNKLPLSRQ  422

Query  1394  PNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQ  1507
             PNE+QQ AADNLVKMLDL PS   EAL PE TPNPVL+
Sbjct  423   PNEKQQGAADNLVKMLDLVPSGKGEALRPEVTPNPVLE  460



>ref|XP_002961041.1| hypothetical protein SELMODRAFT_74928, partial [Selaginella moellendorffii]
 gb|EFJ38580.1| hypothetical protein SELMODRAFT_74928, partial [Selaginella moellendorffii]
Length=701

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/679 (47%), Positives = 447/679 (66%), Gaps = 19/679 (3%)
 Frame = +2

Query  134   REGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelg  313
             +E L+ V+DV PSMH  L  + K  + ++E+KL   K DEVG++LFG  ET N+L  E+G
Sbjct  1     QESLVFVLDVSPSMHPYLHHVSKATAAVLERKLFNHKNDEVGLVLFGMEETDNDLRREVG  60

Query  314   gYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLC  493
                   V   I +VD +L+  L  LPRG   GD++DA++V  DM+ KKYG   KG KR+C
Sbjct  61    EAYEGIVSEPITLVDGELVTKLRALPRGCYAGDYVDAIVVATDMIFKKYGDGKKGNKRIC  120

Query  494   LITNAMCPIKDPYEG-TKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFL  670
             LIT+A  PIK+P EG +  +QV  IA +M+ HG+R D+ I+RM ++   E G   E+  +
Sbjct  121   LITDAQSPIKEPMEGMSMMEQVEKIAEKMEDHGVRFDAAILRMNEE-KRESG--SESTEI  177

Query  671   LSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEER  850
             L   +  T  +   VES   L GA++ R + P TLYRGD E++   +IKVWVYKK ++ER
Sbjct  178   LENLASRTHGEVTTVESPLCLFGALKPRTVTPTTLYRGDMEMTPGARIKVWVYKKAAQER  237

Query  851   FPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAE  1030
              P+LK+YSDKAP +D  A H +    +YK   DPT  +P  QR KGY YG Q++P++   
Sbjct  238   VPSLKVYSDKAPQSDALATHVVKMDTDYKSSDDPTVSIPKAQRAKGYYYGQQLIPVTPDM  297

Query  1031  WEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNR  1210
               ++KF  +KGVKLLGFT+A+NI RHYYMK+ N+F+ +P N KA LA+SALARA+K  N 
Sbjct  298   ELSLKFTADKGVKLLGFTEAANIPRHYYMKEPNLFVPEPGNRKASLAMSALARALKQTNM  357

Query  1211  VAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSM  1390
             VA+VRCVWRQGQ NV +GVLTPN+S +  + DS YFN +PFAED+REF F SF + P+S 
Sbjct  358   VALVRCVWRQGQRNVVMGVLTPNLSFEDGIADSFYFNIVPFAEDIREFGFASFDDRPASQ  417

Query  1391  LPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLD  1570
             LP++QQ+EA D LV+MLDL+PSDS E+L PE T NPVLQR+YH+L +KS + DA+VP LD
Sbjct  418   LPSKQQEEATDLLVQMLDLSPSDSVESLQPEKTSNPVLQRFYHFLYLKSLNPDASVPQLD  477

Query  1571  EILRRITDPD--PELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREK----------P  1714
             E L+++ +PD   E + + + +  +F    + K++ K  K R     +            
Sbjct  478   ETLKKVIEPDFSSEHIEKLQGLCSQF--TLKTKNSTKFWKDRIEAAAKDDDAEAKPDVDT  535

Query  1715  TGSDEEGERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL  1894
             +GS    +  +T+ + E++G++NPVQDF+ +++RRDS EWV KAIQ MK  I  L+++S 
Sbjct  536   SGSGLSFDSFATR-QVEEVGSLNPVQDFQTLLARRDSDEWVGKAIQGMKKIIIDLLDSSY  594

Query  1895  EGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALIT  2074
             +G+TY KAL CL ALR+GC++++E K+FND  R L   C+ K L  F   +    + LI+
Sbjct  595   KGNTYDKALTCLAALRSGCVMQEESKEFNDFFRVLADKCQGKRLSDFWDAVIQRKLTLIS  654

Query  2075  KTEAPDSDVLESEARSFMT  2131
             K E  DSDV E  A +F+T
Sbjct  655   KGEVSDSDVTEEAALAFLT  673



>ref|XP_002966971.1| hypothetical protein SELMODRAFT_86463, partial [Selaginella moellendorffii]
 gb|EFJ31570.1| hypothetical protein SELMODRAFT_86463, partial [Selaginella moellendorffii]
Length=701

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/679 (47%), Positives = 446/679 (66%), Gaps = 19/679 (3%)
 Frame = +2

Query  134   REGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelg  313
             +E L+ V+DV PSMH  L  + K  + ++E+KL   K DEVG++LFG  ET N+L  E+G
Sbjct  1     QESLVFVLDVSPSMHPYLHHVSKATAAVLERKLFNHKNDEVGLVLFGMEETDNDLRREVG  60

Query  314   gYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLC  493
                   V   I +VD +L+  L  LPRG   GD++DA++V  DM+ KKYG   KG KR+C
Sbjct  61    EAYEGIVSEPITLVDGELVTKLRALPRGCYAGDYVDAIVVATDMIFKKYGDGKKGNKRIC  120

Query  494   LITNAMCPIKDPYEG-TKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFL  670
             LIT+A  PIK+P EG +  +QV  IA +M+ HG++ D+ I+RM ++   E G   E+  +
Sbjct  121   LITDAQSPIKEPMEGMSMMEQVEKIAEKMEDHGVKFDAAILRMNEE-KRESG--SESTEI  177

Query  671   LSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEER  850
             L   +  T  +   VES   L GA++ R + P TLYRGD E++   +IKVWVYKK ++ER
Sbjct  178   LENLASRTHGEVTTVESPLCLFGALKPRTVTPTTLYRGDMEMTPGARIKVWVYKKAAQER  237

Query  851   FPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAE  1030
              P+LK+YSDKAP +D  A H +    +YK   DPT  +P  QR KGY YG Q++P++   
Sbjct  238   VPSLKVYSDKAPQSDALATHVVKMDTDYKSSDDPTVSIPKAQRAKGYYYGQQLIPVTPDM  297

Query  1031  WEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNR  1210
               ++KF  +KGVKLLGFT+A+NI RHYYMK+ N+F+ +P N KA LA+SALARA+K  N 
Sbjct  298   ELSLKFTADKGVKLLGFTEAANIPRHYYMKEPNLFVPEPGNRKASLAISALARALKQTNM  357

Query  1211  VAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSM  1390
             VA+VRCVWRQGQ NV +GVLTPN+S +  + DS YFN +PFAED+REF F SF + P+S 
Sbjct  358   VALVRCVWRQGQRNVVMGVLTPNLSFEDGIADSFYFNIVPFAEDIREFGFASFDDRPASQ  417

Query  1391  LPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLD  1570
             LP++QQ+EA D LV+MLDL+PSDS E+L PE T NPVLQR+YH+L +KS + DA VP LD
Sbjct  418   LPSKQQEEATDLLVQMLDLSPSDSVESLQPEKTSNPVLQRFYHFLYLKSLNPDALVPQLD  477

Query  1571  EILRRITDPD--PELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREK----------P  1714
             E L+++ +PD   E + + + +  +F    + K++ K  K R     +            
Sbjct  478   ETLKKVIEPDFSSEHIEKLQGLCSQF--TLKTKNSTKFWKDRIEAAAKDDDAEAKPDVDT  535

Query  1715  TGSDEEGERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL  1894
             +GS    +  +T+ + E++G++NPVQDF+ +++RRDS EWV KAIQ MK  I  L+++S 
Sbjct  536   SGSGLSFDSFATR-QVEEVGSLNPVQDFQTLLARRDSDEWVGKAIQGMKKIIIDLLDSSY  594

Query  1895  EGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALIT  2074
             +G+TY KAL CL ALR+GC++++E K+FND  R L   C+ K L  F   +    + LI+
Sbjct  595   KGNTYDKALTCLAALRSGCVMQEESKEFNDFFRVLADKCQGKRLSDFWDAVIQRKLTLIS  654

Query  2075  KTEAPDSDVLESEARSFMT  2131
             K E  DSDV E  A +F+T
Sbjct  655   KGEVSDSDVTEEAALAFLT  673



>dbj|BAJ97086.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/466 (63%), Positives = 365/466 (78%), Gaps = 3/466 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+EGL+L++DVGPSMH  L EIE VC+ LV KKL++ + DEVGV+LFGT ET N+L 
Sbjct  1     MARNKEGLVLLLDVGPSMHRALQEIENVCTTLVRKKLVFHRSDEVGVVLFGTKETHNDLA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
              ELGGY+HV V   IKVVD++   ALE LPRG+  GDFLDA++VG+DM+IK++G T K K
Sbjct  61    RELGGYKHVLVKHDIKVVDEETKDALENLPRGTAPGDFLDAIVVGLDMLIKRFGDT-KAK  119

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +RLCLIT+A   ++DP +GTKEDQV TIA QMK H ++MD ++ R  +       ++DEN
Sbjct  120   QRLCLITDAQHLLRDPPQGTKEDQVDTIADQMKKHDIKMDCIVFR--EAGVQHNSVMDEN  177

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F   + +K   V++ T+L+GA++TRN+ PVT++RGD E+++  KIKVW YKKTS
Sbjct  178   DRLLYHFRDRSVAKVVQVDTPTALLGALKTRNVLPVTIFRGDLEVNSTFKIKVWAYKKTS  237

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAPP+D+FA HE+   YEYK + +P   VPP+QRIKGY YGPQVVPIS
Sbjct  238   EEKFPTLKKYSDKAPPSDQFASHEVKVDYEYKSILEPDTVVPPDQRIKGYLYGPQVVPIS  297

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             SAEWEAVKFKPEKGVKLLGF D S++ R Y+MKD N F+ +P N+KAI+AVSALARAM+D
Sbjct  298   SAEWEAVKFKPEKGVKLLGFADRSSVPRSYFMKDVNSFVPEPGNTKAIVAVSALARAMQD  357

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
             MN+VAI+RCVWRQ Q NV  GVLTPN+S   NVPDS YFN LPFAEDVR+F F SFS+LP
Sbjct  358   MNKVAILRCVWRQNQANVAFGVLTPNISSVNNVPDSFYFNILPFAEDVRDFPFRSFSSLP  417

Query  1382  SSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYH  1519
              S  P E+QQEAADNLVKMLDLAP   +E L P+FTPNP+L+  Y+
Sbjct  418   PSSQPTEEQQEAADNLVKMLDLAPPGREEILRPDFTPNPMLEVEYY  463



>tpg|DAA52574.1| TPA: hypothetical protein ZEAMMB73_970034 [Zea mays]
Length=463

 Score =   533 bits (1374),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 270/451 (60%), Positives = 331/451 (73%), Gaps = 11/451 (2%)
 Frame = +2

Query  800   TKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQR  979
             + L +KVWVYKKT+EE+FPTLK YSDKAPP DKFA HE+   YEYK V +P K VPP+QR
Sbjct  6     SSLVLKVWVYKKTAEEKFPTLKKYSDKAPPNDKFASHEVKVDYEYKSVVEPDKVVPPDQR  65

Query  980   IKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSK  1159
             IKGY YGPQV+P+S+AEWEAVKFKPEKGVKLLGFTD S++ RH +MKD  +FI +P N K
Sbjct  66    IKGYLYGPQVIPVSNAEWEAVKFKPEKGVKLLGFTDRSSVPRHQFMKDVCLFIPEPGNMK  125

Query  1160  AILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAE  1339
             A LAVSA+ARAM  MN+VAIVRCVWRQGQGNV IGVLTPN+S   N+ DS YFN LPFAE
Sbjct  126   ASLAVSAIARAMHQMNKVAIVRCVWRQGQGNVAIGVLTPNISSVNNIQDSFYFNVLPFAE  185

Query  1340  DVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYH  1519
             D+REFQF SFS+LPSS  P E+QQEAADNLVKMLDLAP   +E L PEFTPNP+L+R+Y 
Sbjct  186   DIREFQFRSFSSLPSSSQPTEEQQEAADNLVKMLDLAPP-GREVLKPEFTPNPILERFYS  244

Query  1520  YLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRL  1699
             YL++KSK  DA VPPL+  LRRIT+PDP+++ Q   ++    + F LKDNPK KK+R + 
Sbjct  245   YLDLKSKQPDANVPPLERSLRRITEPDPDVVGQQTQLIQNLSKAFVLKDNPKKKKARTQD  304

Query  1700  IREKPTGSDEEGERASTKV------KSEKIGNI---NPVQDFEDMISRRDSPEWVNKAIQ  1852
             +    TG+ ++ +    +V       +E +  I   NPVQDFE M+++R S  W  KAI 
Sbjct  305   MLAY-TGAGDQAKSVEDRVLENTHPSTENVVAIRDSNPVQDFEAMLAKRSSSTWTQKAIG  363

Query  1853  EMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRS  2032
             +M+N I  L++NS +G  YQKALEC  +LR  CI+EQEP++FN  L  +Y   KE D   
Sbjct  364   DMQNYIAALLQNSSDGGNYQKALECFASLRKACIIEQEPQEFNQFLTKIYERLKEGDAAK  423

Query  2033  FCKQLESHGIALITKTEAPDSDVLESEARSF  2125
             F + L S  I+LI K EAPDSDV E  ARSF
Sbjct  424   FFQLLSSKNISLINKEEAPDSDVTEEMARSF  454



>gb|AAS01978.1| putative H-box binding protein, KAP2, with alternative splicing 
isoforms [Oryza sativa Japonica Group]
Length=325

 Score =   409 bits (1050),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 206/328 (63%), Positives = 262/328 (80%), Gaps = 3/328 (1%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             MARN+E L+L++DVGPSMH VL E+E +CS LV KKL+Y++ DE+GV+LFGT ET+NEL 
Sbjct  1     MARNKEALVLLLDVGPSMHGVLQEVENICSTLVHKKLVYNRSDEIGVVLFGTKETSNELA  60

Query  302   eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             +ELGGY+HV V R IKVVD++   AL+ LPRG+  GDFLDA++VG+DM+I+K+G   KGK
Sbjct  61    KELGGYKHVVVARDIKVVDEETTNALQNLPRGTSPGDFLDAIVVGLDMLIRKFG-NIKGK  119

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
             +R+CL+T+A  P++DP +GTK+DQV TIA QMK H ++MD +I R  +       ++DEN
Sbjct  120   QRMCLVTDAQHPLRDPPQGTKKDQVDTIADQMKRHEIKMDCIIFR--ESGVRHNAVMDEN  177

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             D LL  F + + +K  +V+S TSL+GA+RTRN+ PVT++RGD E+S+  KIKVWVYKKTS
Sbjct  178   DQLLYHFRERSVTKVVHVDSPTSLLGALRTRNVLPVTVFRGDLEVSSSFKIKVWVYKKTS  237

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             EE+FPTLK YSDKAP +DKFA HE+   YEYK V +P   VPP+QRIKGY YGPQVVPIS
Sbjct  238   EEKFPTLKKYSDKAPASDKFASHEVKVDYEYKSVLEPDTVVPPDQRIKGYLYGPQVVPIS  297

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMR  1105
             SAEWEAVKFKPEKGVKLLGFTD S+I R
Sbjct  298   SAEWEAVKFKPEKGVKLLGFTDRSSISR  325



>ref|XP_006393488.1| hypothetical protein EUTSA_v100113511mg, partial [Eutrema salsugineum]
 gb|ESQ30774.1| hypothetical protein EUTSA_v100113511mg, partial [Eutrema salsugineum]
Length=340

 Score =   399 bits (1024),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/308 (61%), Positives = 238/308 (77%), Gaps = 8/308 (3%)
 Frame = +2

Query  1070  LLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQG  1249
             LLGFT+ASNI+RHYYMKD N+ + DP   K+++AVSA+AR MK  N+VAIVRCVWR GQG
Sbjct  1     LLGFTEASNILRHYYMKDVNIVVPDPSKEKSVIAVSAIAREMKQTNKVAIVRCVWRNGQG  60

Query  1250  NVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNL  1429
             NV +GVLTPNVS++ + PDS YFN LPFAEDVREF FPSFS  P+S  P+EQQQ  ADNL
Sbjct  61    NVVVGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFSRFPASWKPDEQQQAVADNL  120

Query  1430  VKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPEL  1609
             VKMLDLAPS  +E L PE TPNPVLQR+Y Y+E+K++  DAA+PP+DE  +RI + DPEL
Sbjct  121   VKMLDLAPSAKEEVLKPELTPNPVLQRFYEYIELKARSMDAALPPVDEAFKRIMEQDPEL  180

Query  1610  LSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERAST----KVKSEKIGN  1777
              S NK+++D FR+  E+ +NPK+KK+ KR +R+KP+GSD+E  R  T    + K + IG+
Sbjct  181   SSNNKSIMDSFRKSLEVMENPKLKKTSKRYLRDKPSGSDDEDNRMVTYNANENKVDTIGD  240

Query  1778  INPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSL-EGDTYQKALECLVALRNGCI  1954
               PVQDFE MISRRD+ +W++KAI +MKN+I  LVE+S  EGD   KALECL+ALR GC+
Sbjct  241   ATPVQDFEAMISRRDNHDWIDKAISQMKNRIVKLVEDSTHEGD---KALECLLALRKGCV  297

Query  1955  VEQEPKQF  1978
             +EQ    F
Sbjct  298   LEQVSSAF  305



>gb|KHN03547.1| ATP-dependent DNA helicase 2 subunit KU80 [Glycine soja]
Length=426

 Score =   395 bits (1014),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 207/404 (51%), Positives = 267/404 (66%), Gaps = 55/404 (14%)
 Frame = +2

Query  464   ITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEK  643
             +TNKGKKRLCLITNA+CP K+  EGTKE+QV+TIA QM AHGM+M+S+I+R K  + A  
Sbjct  1     MTNKGKKRLCLITNALCPSKESDEGTKEEQVTTIAKQMTAHGMKMESIILRGKFSMAA--  58

Query  644   GIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVW  823
                 EN+ LL +FSKETS++ + VE+  SL GA++TRNI P  +++GD E S KL+IKV 
Sbjct  59    -YWYENERLLDIFSKETSTRLSCVENPVSLFGALKTRNITPAAVFKGDLEFSPKLRIKVL  117

Query  824   VYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGP  1003
                KT+E++FP+LK YSDKAPP DK+AKHE+                             
Sbjct  118   HASKTAEDKFPSLKKYSDKAPPNDKYAKHEVKVE--------------------------  151

Query  1004  QVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSAL  1183
                     EW+A+KFKPEKGVKLLGFTD+SN+ RH++MKD  VF+    N+KA+LA+SA+
Sbjct  152   --------EWDAIKFKPEKGVKLLGFTDSSNVFRHHHMKDVYVFLPASGNTKAMLALSAV  203

Query  1184  ARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFP  1363
             ARAMK MN+VAIVRCVWR  Q NV IGVLTPN+S + N+  S+                 
Sbjct  204   ARAMKQMNKVAIVRCVWRWEQANVFIGVLTPNLSVRENIRVSI-----------------  246

Query  1364  SFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKH  1543
              F+N P+S  PN  Q EAA NL+K LDLAP      LLP+FT NPVL+ +Y +LE+K K 
Sbjct  247   PFTNFPASWQPNGLQLEAAANLIKTLDLAPHGQHGVLLPDFTSNPVLECFYCHLELKLKD  306

Query  1544  HDAAVPPLDEILRRITDPD-PELLSQNKTVVDEFRRCFELKDNP  1672
              DAAVPP+D  L++IT+PD  +LL + K+ +D F   FELK NP
Sbjct  307   PDAAVPPVDNTLKKITEPDHADLLLRKKSAIDSFCSSFELKGNP  350


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  1964  EPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPD  2092
             EPKQFND L++L   C+EK+L SFCK   S  + LI+KTEA D
Sbjct  352   EPKQFNDFLKHLCNFCQEKNLHSFCKYFASKELTLISKTEAVD  394



>ref|XP_004362085.1| ATP-dependent DNA helicase [Dictyostelium fasciculatum]
 gb|EGG24234.1| ATP-dependent DNA helicase [Dictyostelium fasciculatum]
Length=756

 Score =   321 bits (823),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 231/736 (31%), Positives = 367/736 (50%), Gaps = 86/736 (12%)
 Frame = +2

Query  134   REGLILVIDVGPSMH--------------------------------CVLPEIEKVCSVL  217
             +E L++++D+G  MH                                  + E  K  ++L
Sbjct  7     KEALVVILDIGLGMHKHHRSVGGGGISSSSSSLSSQSQHLLQSANNTSPIDEALKAATLL  66

Query  218   VEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPRG  397
              ++KLIY K DE+G++L GT ET N L ++   Y+H+T   +I+    + L+ LE +  G
Sbjct  67    FQQKLIYGKKDELGLVLIGTKETNNSLQKDG--YQHITTACNIEEPKVETLRFLESIQPG  124

Query  398   SVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQM  577
                GD +D++IV MDM+I K     K +KR+ L+TNA  PI        +D +S +  Q 
Sbjct  125   ESRGDVIDSLIVAMDMLIHKTE-KKKFQKRIFLVTNASDPIN-------KDDLSILQQQF  176

Query  578   KAHGMRMDSVIVRMKQDLDAEKGII----DENDFLLSVFSKETSSKAAYVESATSLMGAI  745
             K   ++++ V V    + D E  I     ++N+  L  F +  +     V+ A  +M   
Sbjct  177   KNTDVKLNVVGVDFTDEEDLENKIQLTEKEKNEVFLRRFVQSVNGILVPVKQALEIMSFF  236

Query  746   RTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
             R++++   T +RG  E+ST+  I VW Y +T  +  PTLK  S  A   D  A  E+   
Sbjct  237   RSQSVLSRTGFRGVLEISTEFGIPVWGYLRTKIQTLPTLKKVSTVAQQADNPASLEVKQE  296

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMR  1105
               +  + DP K++     +KGY+YG  ++P S  + EA+K    K +K LGF  AS+I  
Sbjct  297   KLHYSITDPDKEILDHDLLKGYKYGKSIIPYSKIDIEALKLSASKCLKTLGFAPASHIPL  356

Query  1106  HYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVS  1285
             H+ M    V +A P + +A LA+S +  A+ + ++V IVR V R    +  +G L P++ 
Sbjct  357   HHLMGQTEVLVAPPGDQEAALALSGIIHALAETDQVIIVRFVKR-SNCSPYLGYLYPHI-  414

Query  1286  DKGNVPDSLYFNALPFAEDVREFQFPSFS----NLPSSMLPNEQQQEAADNLVKMLDLAP  1453
              K N  + LYFN LPF +D+R +QFP  S           P   Q  AA +L++ +DL  
Sbjct  415   -KANY-ECLYFNPLPFIDDIRHYQFPPISPKNPQCKKQYQPTADQLNAAHSLIESMDLMT  472

Query  1454  SDSQE------ALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLS  1615
             +D  +      +L P++T NP LQ ++  L  ++ H    +P LD ++ +  +PD  +L 
Sbjct  473   ADEDDEGQPMPSLRPKYTYNPSLQHFFQCLHHRALHPKTPLPSLDPLISKYINPDENILE  532

Query  1616  QNKTVVDEFRRCFEL------KDNPKMKKSRKRLIREKP-----TGSDEEGERASTKVKS  1762
             +    + +F   F L      K + K +     LI E+       G D++G +   K   
Sbjct  533   RASDAIKDFHSKFTLTKVNNFKSDHKYRWKDGMLIEEEIKLDSYIGQDDDGSKKKRKADD  592

Query  1763  --------------EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEG  1900
                            ++G+INPVQ+F+DM++RRD  + V+KAI  M+++I  LV +SL+ 
Sbjct  593   LADYSLDKLVSGYVNEVGSINPVQNFKDMLARRDI-DLVDKAINLMRSRIVQLVNDSLKD  651

Query  1901  DTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKT  2080
               YQKALEC+VALR GCI E E   FN  L+ L    + K    F + L +  I LI   
Sbjct  652   QFYQKALECVVALRQGCIKESESDAFNTFLQELRDYFESKKRDDFWQLLVTWKITLINDQ  711

Query  2081  EAPDSDVLESEARSFM  2128
             E+  S V E E++ F+
Sbjct  712   ESDTSSVSEEESKKFL  727



>gb|AEZ36039.1| KU80, partial [Nicotiana benthamiana]
Length=181

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +2

Query  683   SKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTL  862
             S ++SSK  +VE+ TSL+GA+RTRNI+PVT+YRGDFE+S++LKIK WVYKKTSEE+FPTL
Sbjct  1     SNKSSSKVVHVETPTSLLGALRTRNISPVTIYRGDFEVSSQLKIKGWVYKKTSEEKFPTL  60

Query  863   KMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAV  1042
             K YS+KAPPTDKFA HEI   YEYK ++DP K VPPEQRIKG+RYGPQVVPISSAE EAV
Sbjct  61    KKYSEKAPPTDKFATHEIKVDYEYKSIEDPNKVVPPEQRIKGFRYGPQVVPISSAELEAV  120

Query  1043  KFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIV  1222
             KFKPEK VKLLGFTDASNIMRHYY+KD N+FIA+P N KAILA+S+LARAMK+MN+VAIV
Sbjct  121   KFKPEKSVKLLGFTDASNIMRHYYLKDVNIFIAEPGNKKAILALSSLARAMKEMNKVAIV  180

Query  1223  R  1225
             R
Sbjct  181   R  181



>dbj|GAM18435.1| hypothetical protein SAMD00019534_016100 [Acytostelium subglobosum 
LB1]
Length=753

 Score =   317 bits (811),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 232/737 (31%), Positives = 379/737 (51%), Gaps = 89/737 (12%)
 Frame = +2

Query  131   NREGLILVIDVGPSMH------------CVLPEIEKVCSVLVEKKLIYSKYDEVGVILFg  274
             ++E L++++D+G  MH              + E  K  ++L ++KLIY K DE+GV+L G
Sbjct  8     SKEALVIILDIGLGMHHHTNEAKHASTTTPIEEALKSVTLLFQQKLIYGKKDELGVVLVG  67

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIK  454
             T  T N L ++   Y+H+T+   I+    + L+ LE L  G   GD +DA+IV MDM+I 
Sbjct  68    TKGTKNNLQKDG--YQHITMQSEIEEPKIETLKYLENLSPGESRGDLIDALIVAMDMLIN  125

Query  455   KYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLD  634
             K     K +KR+ L+TNA  PI       KED +ST+  Q K   ++++ + V    + +
Sbjct  126   KTE-KKKYQKRIFLVTNANDPI------NKED-LSTLQEQFKKIDVKLNIIGVDFTDEEE  177

Query  635   AEKGII----DENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELST  802
              E  I     ++N+  L  F++  +     V+ A  +M   R++++   T +RG  E+ +
Sbjct  178   LENKIKLTNKEKNEKFLREFAESVNGVLVPVKQALEMMSFFRSQSVLQRTTFRGSLEIGS  237

Query  803   KLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKH------------EITSSYEYK---  937
             K  I VW Y KT  +  PTL   S+ +      A              E+  S + K   
Sbjct  238   K-NISVWGYMKTKIQSLPTLGKISNVSKDAAAVAAAAASNGNGNDDDDEVRRSMQVKQEK  296

Query  938   ---VVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRH  1108
                 + DP  ++  +  +KGY+YG  ++P S  +  A+K+  +K +K++GFTD  +I  +
Sbjct  297   MFYSISDPDNEIDHKDLLKGYKYGKSLIPFSKIDESAMKYTADKCLKVIGFTDLESIPFY  356

Query  1109  YYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSD  1288
             Y M  + + +  P +  A  A+S+L  A+ + N+V +VR V + G  N  +  + P++  
Sbjct  357   YSMGSSEMLLPPPNDKPAEQALSSLIHALAETNQVGLVRYVKKNG-SNPYLAYIFPHI--  413

Query  1289  KGNVPDSLYFNALPFAEDVREFQFPSFS----NLPSSMLPNEQQQEAADNLVKMLDLAPS  1456
             K N  + LY   +PFA+D+R +QFP+ S    N     +P+ +Q  AA  L+  +DL  +
Sbjct  414   KPNY-ECLYLCTMPFADDIRPYQFPNISPTNANCKKQYIPSAEQLAAAGTLIDSMDLMTA  472

Query  1457  DSQE------ALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQ  1618
             +  E      AL P +T NP LQ +Y  L  ++ H  A +P LD ++ +  +PD  +L Q
Sbjct  473   EENEERQQVPALRPRYTYNPSLQHFYQCLHYRALHPSAQLPKLDPVISKYINPDATVLEQ  532

Query  1619  NKTVVDEFRRCFELKDNPKMKKSRKRLIREKP-------------TGSDEEGERAST---  1750
                 ++EF+R F LK  P  K +     R K               G+D+  ++      
Sbjct  533   AAPAIEEFQRLFPLKPTPAFKDTSTTKYRWKDGVLVAEEIRLDSYVGADDGSKKRKADDM  592

Query  1751  ------KVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGD  1903
                   K+ S    ++G++NPVQ+F+DM++RRD  + V+KA+  MK +I  LV +SL+  
Sbjct  593   AGLSLDKLVSGFVNEVGSVNPVQNFKDMLARRDV-DLVDKAVALMKQRIVQLVNDSLKDQ  651

Query  1904  TYQKALECLVALRNGCIVEQEPKQFNDLLRNL--YASCKEKDLRSFCKQLESHGIALITK  2077
              YQKAL+C+V LR GCI E E ++FN  L  L  Y   K +D   F + L    I LI+ 
Sbjct  652   FYQKALDCVVELRKGCIKESESEEFNTFLGELRDYYEGKRRD--DFWQLLRVQSITLIST  709

Query  2078  TEAPDSDVLESEARSFM  2128
              E+ DS + ES+A +F+
Sbjct  710   AESDDSGISESDALAFL  726



>ref|XP_003293765.1| hypothetical protein DICPUDRAFT_158675 [Dictyostelium purpureum]
 gb|EGC29713.1| hypothetical protein DICPUDRAFT_158675 [Dictyostelium purpureum]
Length=769

 Score =   301 bits (772),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 227/751 (30%), Positives = 373/751 (50%), Gaps = 101/751 (13%)
 Frame = +2

Query  134   REGLILVIDVGPSMHCVLPE--------IE---KVCSVLVEKKLIYSKYDEVGVILFgtt  280
             +E +++V+DVG  M  VL          IE   +  ++L ++KLIYSK DE+G++L GT 
Sbjct  7     KEAVVIVLDVGIGMTSVLSNNNNNETSPIEDALRSVTLLYQQKLIYSKKDELGLVLIGTK  66

Query  281   etanelteelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKY  460
              T N L ++   Y+H+TV   I+    + L+ LE L  G   GD +D++IV MDM+IK+ 
Sbjct  67    GTKNNLQDDG--YQHITVASDIEEPSIETLKYLENLGPGESKGDVIDSLIVAMDMLIKRT  124

Query  461   GITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAE  640
                 K +KR+ L+TNA  PI         D ++ +  Q K   ++++ + V    + + +
Sbjct  125   E-NKKYQKRIFLVTNAKDPIN-------TDDLTIVKDQFKKIDVKLNIIGVDFTDEEELK  176

Query  641   K------GIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELST  802
             K          +N+  L  F+         V+ A  +M   R++++   T +RG  E+S 
Sbjct  177   KINNKNFTNKQKNEIFLREFADSVDGVLVPVKQALEMMSFFRSQSVLQRTSFRGALEISP  236

Query  803   KLKIKVWVYKKTSEERFPTLKMYS----DKAP-PTDKFAKHEITSSYEYKVVQDPTKQVP  967
             +LKI VW + K  ++  PTLK  S    +K P PT      ++T    +  + DP +++ 
Sbjct  237   ELKIPVWGFLKMKQQNLPTLKKISVLAQEKIPTPT----TLDVTQETFFYSITDPDQEIS  292

Query  968   PEQRIKGYRYGPQVVPISSAEWEAVKFK-PEKGVKLLGFTDASNIMRHYYMKDANVFIAD  1144
              +  +KGY+YG  ++P S  +   +K+    + +K+LGF D  +I  +Y M  + +F+A 
Sbjct  293   KDDLLKGYKYGKSLIPFSKIDESQLKYSSASRCLKVLGFVDRDSIPLYYNMGCSEMFVAA  352

Query  1145  PENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGN---------  1297
             P++ +A  ++SA  R M + N+  +VR V   G     +G + P +    +         
Sbjct  353   PKDKQAEQSLSAFIRGMIETNQAMLVRYVKTMGSAPY-LGYMIPKIKSYNDDDENDGIEE  411

Query  1298  -VPDSLYFNALPFAEDVREFQFPSFSN----LPSSMLPNEQQQEAADNLVKMLDL-----  1447
                + LYFN LP A+D+R++QFPS S        S +PN++Q +A   L+  +DL     
Sbjct  412   KFIECLYFNHLPLADDIRQYQFPSLSLKNPLTRKSFIPNKEQLDATQQLIDSMDLMGGGG  471

Query  1448  --APSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQN  1621
                  +S + L P FT NP+LQ +Y  L  +S H ++ +P LD I+ +  +PD ++L ++
Sbjct  472   DGDEEESIQMLKPSFTYNPLLQHFYQCLHHRSLHPNSLIPKLDPIISQYINPDEQILEKS  531

Query  1622  KTVVDEFRRCFELKDNPKMKKSRKR--------------------LIREK----PTGSDE  1729
             K  + EF   F L  +    K                        LI E+       +D+
Sbjct  532   KNSIKEFYLKFPLTKSINFNKLNNNNNQQQQQQQQSLKYYWKDGVLIGEEINLDSYVTDD  591

Query  1730  EGERASTKVKS--------------EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNK  1867
               E    K+                 ++G INPVQ+F+DM++RRD  + V+KAI  MK +
Sbjct  592   GSEFKKRKINDFSEFSLNKLISGYVNEVGTINPVQNFKDMLNRRDV-DLVDKAITLMKER  650

Query  1868  IFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDL---LRNLYASCKEKDLRSFC  2038
             I  LV +SL+   YQKA EC+  LRNGCI E E   FN     +R+LY + K+ D   + 
Sbjct  651   IIQLVNDSLKEQYYQKAFECIKELRNGCIRESEADSFNSFIKDIRSLYENKKKDDFWKYI  710

Query  2039  KQLESHGIALITKTEAPDSDVLESEARSFMT  2131
                + + I LI++ E   S + + EA  F+ 
Sbjct  711   TTNQPYAINLISEDECDSSSISKDEANEFLN  741



>ref|XP_006393489.1| hypothetical protein EUTSA_v100113510mg, partial [Eutrema salsugineum]
 gb|ESQ30775.1| hypothetical protein EUTSA_v100113510mg, partial [Eutrema salsugineum]
Length=232

 Score =   279 bits (713),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = +2

Query  122  MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
            MARNREGL+L++DVGP+MH +LP++EK CS+L++KKLIY+KYDEVG+++FGT ET NEL 
Sbjct  1    MARNREGLVLLLDVGPAMHSILPDVEKTCSLLLQKKLIYNKYDEVGIVVFGTEETENELA  60

Query  302  eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
             ++GGYEHV VLR+I+VVD+ +++ +++LPRG+V GDFLDA+IVGMDM+IK YG   KGK
Sbjct  61   RDIGGYEHVAVLRNIRVVDEVVVENVKRLPRGTVAGDFLDAIIVGMDMLIKMYGAAQKGK  120

Query  482  KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
            KRLCLITNA CP KDP+EGTK++QVSTIA +M A G++M+S+++R   + D  + +I+EN
Sbjct  121  KRLCLITNAACPTKDPFEGTKDEQVSTIAVKMAAEGIKMESIVMRDNVNGDVHEKVIEEN  180

Query  662  DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIK  817
            D LL++FS +  +K  YVES  SL+G+++TR +APVTL+RGD E++  +KIK
Sbjct  181  DRLLNLFSSDAIAKTVYVESPLSLLGSLKTRRVAPVTLFRGDLEINPTMKIK  232



>ref|XP_002672413.1| Ku70/Ku80 beta-barrel domain-containing protein [Naegleria gruberi]
 gb|EFC39669.1| Ku70/Ku80 beta-barrel domain-containing protein [Naegleria gruberi]
Length=773

 Score =   288 bits (736),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 220/749 (29%), Positives = 376/749 (50%), Gaps = 93/749 (12%)
 Frame = +2

Query  134   REGLILVIDVGPSMHCV----LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
             +E L+++ DVG S+         + ++  ++L++ K+ YS  DEVG +L GT +T N L 
Sbjct  12    KEALVIIFDVGKSLGTRSRDEFEKAKRAITLLIKMKMRYSPKDEVGFVLVGTKKTKNHLN  71

Query  302   -eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSV----DGDFLDAVIVGMDMMIKKYGI  466
              E  G YE++ + ++I  V  DL + ++ +   ++    +GD  DAVIV  DM+  + G 
Sbjct  72    DEYEGEYENIYIEQAIDTVSLDLFKIVDSINIDTIGMSPEGDLFDAVIVATDMIKDRCG-  130

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQ-MKAHGMRMDSVIVRMKQDLDAEK  643
               K  KR+ ++++A          T+E+    +  Q +K + + +D V   +K + D  K
Sbjct  131   KRKYAKRIVIVSDAGGTEISVDNDTRENIYQGMRNQDVKVNVIGLDFVNTEVKLEDDNGK  190

Query  644   GIID----ENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLK  811
              +       N+  L    K        ++ A   +   +++ +   T +RG+ +++  +K
Sbjct  191   IVGKTPKLRNEIFLCDMCKNVGGIVIPIQQAIDTLLLFKSKKVLSRTTFRGNLDIAGNIK  250

Query  812   IKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGY  991
             I VWVYKKT +   PT K  S  +   +     ++     Y    DP  Q+  ++ +K Y
Sbjct  251   IPVWVYKKTEKTSLPTAKRLSLVSRRANTGGDGDVQMERCYYSYDDPDNQIEKDKTVKAY  310

Query  992   RYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILA  1171
             +YG   VP +    +A+K+K  KG+ +LGFTD  NI R ++M +   FIA P++  A +A
Sbjct  311   KYGKNFVPFNIVNEKALKYKSSKGITVLGFTDEKNIDRSHFMAETYSFIAKPDDPFAQIA  370

Query  1172  VSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVRE  1351
             +S+  RA+ ++  V I+  V+R       +G L P++   G   + LYFNALPFAED+RE
Sbjct  371   LSSFIRALSELEMVMIITYVYRDDL-EPKLGFLYPHI---GTNSECLYFNALPFAEDIRE  426

Query  1352  FQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS------QEALLPEFTPNPVLQRY  1513
             + F SFS +  S    E+Q +AA++L+K +DL  +D        EA+ P    NP++Q +
Sbjct  427   YPFKSFSTVKHS----EEQLQAAEDLIKSMDLMDADEDENGEKSEAMKPTCIYNPLVQHF  482

Query  1514  YHYLEMKSKHHDAAVPPLDEILRRITDP--DPE-----LLSQNKTVVDEFRRCF---ELK  1663
             Y  L +++   +  +PP++ ++ +   P  +PE     L+ + K    +F+  F   E++
Sbjct  483   YDCLHVRALKPNDPLPPVEPLITKFCYPEMNPESFYYKLMEKTKEHRLKFKSLFPTKEVE  542

Query  1664  DNPKMKKSR---------------------------------------KRLIREKPTG-S  1723
              + K+ K +                                       KRL      G S
Sbjct  543   ADSKLGKRKYWFAMGENEITLDSYNLEEVAENVQGTALLESDHVGQVVKRLKDGAYDGMS  602

Query  1724  DEEGERASTKV--------KSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYL  1879
             D +      +V        ++  +   NP +DF +M++R+D  + V+KAIQEM+  IF L
Sbjct  603   DAQFNEVQQRVGLNNLFMEQANSVKTTNPTKDFSEMLNRKDV-DMVDKAIQEMQVVIFKL  661

Query  1880  VENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNL---YASCKEKDLRSFCKQLE  2050
             V +S+E   Y+K L C+  LR GCI E EP QFN+ L+ L   Y+  K +D   +C  + 
Sbjct  662   VNDSIEDQYYEKVLACIKTLREGCIREAEPNQFNNFLKKLKQSYSKGKREDF--WCSFIV  719

Query  2051  SHGIALITKTEAPDSDVLESEARSFMTES  2137
              + I+LIT+ E  +S+V E EA+ F+TE+
Sbjct  720   QNNISLITQDECDESEVTEDEAKKFLTEA  748



>ref|XP_637846.1| ATP-dependent DNA helicase [Dictyostelium discoideum AX4]
 sp|Q54LY5.1|XRCC5_DICDI RecName: Full=X-ray repair cross-complementing protein 5; AltName: 
Full=ATP-dependent DNA helicase 2 subunit ku80 [Dictyostelium 
discoideum]
 gb|EAL64327.1| ATP-dependent DNA helicase [Dictyostelium discoideum AX4]
Length=796

 Score =   283 bits (723),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 221/770 (29%), Positives = 362/770 (47%), Gaps = 114/770 (15%)
 Frame = +2

Query  134   REGLILVIDVGPSMHC-----------VLPEIEKVCSVLVEKKLIYSKYDEVGVILFgtt  280
             +E +++++D+G  M              + +  +  ++L ++KLIY K D++G++L GT 
Sbjct  8     KEAVVVILDIGLGMTSKDSDGTTTTTSSIEDALRSVTLLYQQKLIYGKKDQLGLVLIGTK  67

Query  281   etanelteelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKY  460
              T N L ++   Y+H+TV+  I+    + L+ LE L  G   GD +D++IV MDM+I+K 
Sbjct  68    GTKNNLQDDG--YQHITVVSDIEEPSIETLKYLENLAPGESKGDVIDSLIVAMDMLIRKT  125

Query  461   GITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDL---  631
                 K +KR+ L+TNA  PI         DQ   I  ++   G+     I     D    
Sbjct  126   E-NKKYQKRIFLVTNARDPINTEDLSIVRDQFKKIDVKLNIIGVDFLEEIEENNMDTSNN  184

Query  632   DAEKGIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLK  811
             +  K + ++N+  L  F++        V+ A  +M   R++++   T +RG  E++ +LK
Sbjct  185   NKNKSLKEKNEIFLREFAESVDGVLVPVKQALEMMSFFRSQSVMTRTSFRGALEITPELK  244

Query  812   IKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKH--------------------------E  913
             I VW Y K  ++  P+LK  S  A    +  +                           +
Sbjct  245   IPVWGYLKMKQQLLPSLKKISSIAQQQIEQQQQQQQQQNKNKNNEDNEDNEEGKPNITLD  304

Query  914   ITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDAS  1093
             +     Y  + DP  ++     +KGY+YG  ++P S  + + +K+   K +K++GFTD  
Sbjct  305   VNQEVSYYSITDPDNEILKPDLLKGYKYGKSLIPFSKIDEDQLKYSSSKCLKVVGFTDRK  364

Query  1094  NIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLT  1273
             +I  +Y M +  VF++ P + ++  A+S+   A+ + ++V +VR V +   G+  +G + 
Sbjct  365   SIPIYYNMGNTEVFVSQPGDKQSEEALSSFIHALVETDQVMVVRYV-KTMNGSPYLGYMI  423

Query  1274  PNV-SDKGNVPDSLYFNALPFAEDVREFQFPSFSN----LPSSMLPNEQQQEAADNLVKM  1438
             P+V SD       LY+N LP A+D+R++QFP  S        S +PN +Q EA   L+  
Sbjct  424   PHVKSDYV----CLYYNHLPLADDIRQYQFPPISPKNPLTRKSNIPNAEQLEATQQLIDS  479

Query  1439  LDLAPS------DSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPD  1600
             +DL  S      D  + L P FT NP+LQ +Y  L  +S H +  +P LD I+    +PD
Sbjct  480   MDLMKSEFDEDGDPIQMLKPRFTYNPLLQHFYQCLHHRSLHPNTQIPKLDPIIAEYINPD  539

Query  1601  PELLSQNKTVVDEFRRCFELKDNPKMKKS----------------------------RKR  1696
               +++++K  +  F   F L       K+                               
Sbjct  540   QIIMNKSKQSIKNFADKFPLTKTTVFSKTPAISGGNTNGTTSNTNNTMIGGVKYHWKDGM  599

Query  1697  LIREK----PTGSDEEGERASTKVKS--------------EKIGNINPVQDFEDMISRRD  1822
             LI E+       +D+  E    KV                 ++G INPVQ+F+DM++RRD
Sbjct  600   LIGEEINLDSYVTDDGSEAKKRKVNDFSEFSLDKLVSGYVTEVGTINPVQNFKDMLNRRD  659

Query  1823  SPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLL---R  1993
               + V+KAI  MK +I  LV +SL    YQKA EC+  LR GCI E E +QFN  L   R
Sbjct  660   M-DLVDKAITLMKERILQLVNDSLRDQYYQKAFECIKELRVGCIRESEAEQFNGFLKDMR  718

Query  1994  NLYASCKEKDLRSFCKQ-----LESHGIALITKTEAPDSDVLESEARSFM  2128
             +L+ S K  D   +        L    I LIT+ E   S+V + E   F+
Sbjct  719   SLFQSKKRDDFWQYITADVTSILGEKSINLITQDECDSSEVTQEELDQFL  768



>gb|EJY76224.1| ATP-dependent DNA helicase [Oxytricha trifallax]
Length=776

 Score =   268 bits (684),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 225/770 (29%), Positives = 363/770 (47%), Gaps = 126/770 (16%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVL------------PEIEKVCSVLVEKKLIYSKYDEVGVILFg  274
             N+E +++++DVG +M+  L              +E V  +L E+KL+Y+   E+G++L  
Sbjct  2     NKEAIVVILDVGSTMNKNLGNDDENGETRFQTALESV-KMLFEQKLLYAAGHEIGIVLIN  60

Query  275   ttetaneltee-lggYEHVTVLRSIKVVDDDLLQALEQL-----PRGSVDGDFLDAVIVG  436
             T E++N L +     Y+HVT  R I  +D +  + LEQ+     P     GD LD +IVG
Sbjct  61    TKESSNALNDAYSDQYKHVTTYRDIYKLDLESFRQLEQIQCEKAPIKDNGGDLLDGLIVG  120

Query  437   MDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQ--VSTIAAQMKAHGMRMDSVI  610
             MDM+++  G   K KKR+ LIT       D    T+ DQ  +  +   +     R++ + 
Sbjct  121   MDMLVRHCG-ERKVKKRVFLIT-------DGERETQYDQKELQQVIQTINERDARLNVIT  172

Query  611   V-----------------------RMKQDLDAEKGIIDENDFLLSVFSKETSSKAAYVES  721
             +                       ++K   +  K       FL S  +++        + 
Sbjct  173   LDFCDDLAEDEDEDEEDEDQSKKKQLKMQPNETKAQFKNKKFL-SELTEKVKGAIFPAKV  231

Query  722   ATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKF  901
             A  +    + R +   T YRG+ ++S   K+ V +Y +T EE FPTLK +S  A  +   
Sbjct  232   AIEIYQQFKKREVMARTKYRGNLDISKNCKLNVQIYSRTREEVFPTLKKHSLVADDSKNA  291

Query  902   AKHEITSSYEYKVVQDPTK-QVPPEQRIKGYRYGPQVVPISSAEWEAVKFKP--------  1054
              +  +    +   + DP +  VPP+Q+IK + YG Q+VP++      +K+KP        
Sbjct  292   KEGLVKVERQLAEIDDPDQIAVPPDQQIKAFNYGKQLVPVAKENEHVLKYKPTKEGEEET  351

Query  1055  ------------------EKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSA  1180
                               EK  KLLGFTD S + RH+++   +V +     SK   A +A
Sbjct  352   PSNEYVDDKDIKLQSSDYEKEFKLLGFTDQSKVPRHHFIAGVDVVLP-VRGSKNERAFAA  410

Query  1181  LARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQF  1360
             L  AM + +RV I R + R+   +  + VL P++S K  +   LY   LP  E++R++QF
Sbjct  411   LVYAMIETHRVLIARIIERKN-ADPKLVVLYPHISKKKPL---LYMAQLPTNEEIRDYQF  466

Query  1361  PSFSNLPSSMLPNEQQQEAADNLVKMLDLA-----PSDSQEALLPEFTPNPVLQRYYHYL  1525
             PS   +P+S      Q++AA  L+K LDL      P   +E L P+ T NP LQ +   +
Sbjct  467   PSL--VPAS----RDQKQAAKELIKALDLTKDVNEPEVEEEKLKPDLTFNPALQYFSQVV  520

Query  1526  EMKSKH-HDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELK-DNPKMKKSRKRL  1699
               +  H  +  +P L++ +     PD EL +  +  V  F   F+L+ +N    K RKR+
Sbjct  521   VHRITHPEEQELPELNQAIAEYVKPDKELFTHAQEEVSAFEEAFKLEHNNEDENKKRKRI  580

Query  1700  I------REKPTGSDE----EGERASTKVKSEK----------------IGNINPVQDFE  1801
                    RE+   ++E    E E +  ++K ++                IG++NP++DF+
Sbjct  581   YWRDIIQREEIKAAEEQKQMEEEASIARMKLDQKGDGFEFKDNDGAVKEIGSVNPIEDFK  640

Query  1802  DMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFN  1981
              M++ R   + V  AI +MK+ I  LV NSL GD Y KA+ECL +LR  CI E E ++FN
Sbjct  641   KMVTDR-KVDRVGTAIDQMKDMITKLVNNSLNGDLYHKAIECLASLREACITEDEAQKFN  699

Query  1982  DLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAP-DSDVLESEARSFM  2128
               +  L         + F   +    I+LITK E+   S +   EAR F+
Sbjct  700   LFMEQLKKRYTSGSNKGFFDMIVHEKISLITKDESSISSTITTEEARQFL  749



>gb|ELU08335.1| hypothetical protein CAPTEDRAFT_163248 [Capitella teleta]
Length=723

 Score =   258 bits (659),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 215/725 (30%), Positives = 351/725 (48%), Gaps = 82/725 (11%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMH-----CVLPEIEKVCSV--LVEKKLIYSKYDEVGVILFgtt  280
             MA N+E + +V+DVGP M+     C  P  E + ++  ++++KL     DEV +IL GT 
Sbjct  1     MAANKEAIAIVLDVGPGMNQAPPGCTTPIEESITAIQMILQRKLFSESKDEVALILLGTP  60

Query  281   etanelteelggYEHVTVLRSIKVVDDDLLQALEQ-LPRGSVDGDFLDAVIVGMDMMIK-  454
              TANEL ++ G Y ++T+ + I  VD  LLQ ++  +   S   DF+ AV+V MD ++K 
Sbjct  61    NTANELADDDGNYANITLAKPIGPVDWQLLQYVQNDIHPSSFSADFISAVVVAMDHIVKG  120

Query  455   KYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDL-  631
               G      KR+ L +N      D       D +  I   +K   +  D +   M  D  
Sbjct  121   TSGKKGFASKRIILFSNLCGEFGD-------DHLDNIVGSLKGQDIEFDVIGPEMDDDDD  173

Query  632   ----DAEKGIIDENDF----------LLSVFSKETSSKAAY-VESATSLMGAIRTRNIAP  766
                 +   G   +N             L  F +ET    +Y    A + +    +R +  
Sbjct  174   DDGDNPRPGTSGQNQKPKSTQQRAGEALVKFIQETVEGCSYSFREALAALSNYLSRQVRS  233

Query  767   VTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPT--DKFAKHEITSSYEYKV  940
              T +R + E+ ++LKI + ++ +  E +  + K    + P    ++   H +  + E ++
Sbjct  234   -TAWRCNMEIGSELKIPINLFTRIKEAKAKSFKNVYARDPNAALERNRAHHLNDAEETEI  292

Query  941   VQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMK  1120
              ++ T        + G+RYG  +VP S+ + EA+K++ EK  K+ GFT + N+  HY M 
Sbjct  293   EREDT--------VDGHRYGSTLVPFSADDKEAMKYRSEKCFKVFGFTKSENVRTHYKMG  344

Query  1121  DAN-VFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGN  1297
             DA  V +A+  +  A +A+SA   A+ + N VAIVR V+    G V IG L P +  +  
Sbjct  345   DATWVCVAEKSDEAAAVALSAFINALYETNCVAIVRRVY-NNNGAVRIGALVPQIEAEN-  402

Query  1298  VPDSLYFNALPFAEDVREFQFPSFSNLPSS--------MLPNEQQQEAADNLVKMLDLA-  1450
               + L +N LPFAEDVR +   SF +LP S          P + Q    D L+  +DL+ 
Sbjct  403   --ECLIYNELPFAEDVRNY---SFGSLPVSETNSANQRQAPTDDQLSLMDELIDNMDLSK  457

Query  1451  --PSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNK  1624
                 D  + L PE T NP LQR +  L+ ++ + D  +P L E++RR  +P   + +Q +
Sbjct  458   VETDDDCQVLDPEVTFNPYLQRLFQCLQHRALNPDDPLPDLSEVVRRSLEPPVCVATQCE  517

Query  1625  TVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE-------------  1765
             + V++ +  + L+   K KK     I  K    DE+ E A  K+KSE             
Sbjct  518   STVEKMKEKYSLQRVEKKKKETAENIFGK---KDEDEEPACKKMKSEDDLNGGLEDIVKA  574

Query  1766  ---KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVA  1936
                ++G +NPV+DF+ +++ +D  +   +A   MK ++  LV +S     Y KA+ C+  
Sbjct  575   KVEEVGTVNPVEDFKALLAWKDK-DMFEEACAMMKARVLQLVSDSFGTQLYPKAMNCIQT  633

Query  1937  LRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEA  2116
              R   I   EP+ FN+ LR L    +EK    F   L    + LI+K E+ DS V + EA
Sbjct  634   FRLEAIKAAEPRTFNNFLRELKDILREKGRSDFWDDLLKVKVTLISKLESEDSSVGQEEA  693

Query  2117  RSFMT  2131
             + F++
Sbjct  694   QRFLS  698



>ref|XP_004345889.1| ATPdependent DNA helicase [Acanthamoeba castellanii str. Neff]
 gb|ELR21345.1| ATPdependent DNA helicase [Acanthamoeba castellanii str. Neff]
Length=753

 Score =   256 bits (653),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 215/741 (29%), Positives = 359/741 (48%), Gaps = 126/741 (17%)
 Frame = +2

Query  125   ARNREGLILVIDVGPSM----HCV---------------------------LPEIEKVCS  211
             A +RE +++++DVG SM     C                            L +  K   
Sbjct  3     AASREAVVVILDVGASMATQQRCSSSSSRPTMGASSSSAAAACASVSTTSGLEQAVKAVE  62

Query  212   VLVEKKLIYSKYDEVGVILFgttet----------anelteelggYEHVTVLRSIKVVDD  361
             +LV++KL++   DE+G++LFGT  T                   GY+H+TV R I   D 
Sbjct  63    LLVQQKLMHPSRDELGLVLFGTRGTCLLLIAIVITETHNQLSEDGYQHITVAREIMGADI  122

Query  362   DLLQALEQL-PRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEG  538
             DLL+ +  + P G+   D +DA+IVGMD++I+K     + +KR+ L+T+A CP+      
Sbjct  123   DLLRYISTITPEGA---DVIDALIVGMDLLIRKTA-GKRYEKRIFLVTDAGCPVN-----  173

Query  539   TKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEND---------FLLSVFSKE  691
               +D +  +  Q      R++ + V  ++D D   G  D+ND          L+  F++ 
Sbjct  174   --QDDLDVVCEQFLKIDARLNVIGVGFEEDDDQRAGSQDDNDKAEFKRKNERLIREFAER  231

Query  692   TSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMY  871
                    V+ A  +M  I+ + +   T +RG  E+S  +KI VW Y KT E + PTLK  
Sbjct  232   VHGVVVPVQRAIEMMSFIKPKPVLQRTSHRGCLEISAHVKIPVWSYIKTMERKLPTLKKV  291

Query  872   SDKAPPTDKFAKHEITSSYEYKVVQDPTKQVP---PEQRIKGYRYGPQVVPISSAEWEAV  1042
             S  +  +    + E     E + +  P  + P   P++++KGY+YG  +VP S  +   +
Sbjct  292   SVVSQLSVWGEEEE-----EGRQLNAPPSRYPSVAPDEKVKGYKYGKTLVPFSMVDEAVL  346

Query  1043  KFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIV  1222
             K++  K ++L+GFT A N+ RH ++ +    + +P +  A  A+SALA A+ +   +AIV
Sbjct  347   KYEAAKCLQLIGFTSAKNVPRHQFLGNVECIVPEPGDGSAAAALSALAHALAETGSLAIV  406

Query  1223  RCVWRQGQGNVTIGVLTPNVSDKGNVPD--SLYFNALPFAEDVREFQFPSFSN-LPSSML  1393
             R V R  +GN  +G L+P++      PD   LYF ALPFAED+R++ F S +  L  +  
Sbjct  407   RYVKRN-KGNPYLGCLSPHIK-----PDFACLYFCALPFAEDLRQYPFASLARPLRKAYA  460

Query  1394  PNEQQQEAADNLVKMLDL--APSDS----QEALLPEFTPNPVLQRYYHYLEMKSKHHD-A  1552
             P+E+Q EA   L+  +DL  A +D      EA+ P++T NP LQ  Y  +  + +H D  
Sbjct  461   PSEEQLEATQALIDSMDLMTAATDEDGNPMEAVKPKYTYNPALQNLYRAVLHRLQHPDEP  520

Query  1553  AVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL-KDNPKMKKSRKRLIREKPTGSDE  1729
             ++PP+D  ++    PD  L  + +  +D ++  F   +      K  +R  R++   +D 
Sbjct  521   SLPPVDPAIQEALRPDLGLADKLRPALDRYKAAFTFTRVEGAAAKVERRYWRDRLADTDV  580

Query  1730  EGERASTKVKSEK--------------------IGNINPVQDFEDMISRRDSPEWVNKAI  1849
             + E    + K ++                    +G INP QDF DM++RRD  + V+KA+
Sbjct  581   QLESYVPEAKKQRKNPEEEGISMESLMSGATSDVGPINPEQDFSDMLARRDV-DLVDKAV  639

Query  1850  QEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLR  2029
             ++M+ +I  LVE+S+    Y KAL                 Q+N+ +  L    + K   
Sbjct  640   EQMQGRIKQLVEDSVGTQLYDKAL-----------------QYNEFVDELEGYYRHKRRD  682

Query  2030  SFCKQLESHGI-ALITKTEAP  2089
              F + L + G+ A +  T +P
Sbjct  683   DFWRLLCARGLNAPLRDTTSP  703



>gb|ACB11497.1| KU80-like protein [Pinus sylvestris]
Length=224

 Score =   232 bits (591),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 163/224 (73%), Gaps = 0/224 (0%)
 Frame = +2

Query  122  MARNREGLILVIDVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelt  301
            MARN+E L+L++D+ PSMH  L  +E+  S LV +K+ +SK DEVG++LFG  E  N+L 
Sbjct  1    MARNKESLVLLLDISPSMHNHLHYVERAMSTLVRRKVYFSKSDEVGLVLFGAEEPDNDLQ  60

Query  302  eelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
            +E+GGYE+V V R IKVVD+D+L+AL +LPRG   GDFLDA++VGMD++IKK G  +KG 
Sbjct  61   KEVGGYENVVVFRPIKVVDEDILEALSRLPRGMAPGDFLDAIVVGMDLLIKKLGKGSKGN  120

Query  482  KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDEN  661
            KRLCLIT A   IK+P EGTKEDQV  IA QMK HGM++D V+ R +     +  +  EN
Sbjct  121  KRLCLITGAQSFIKEPDEGTKEDQVDIIANQMKEHGMKLDVVVFRQRMPGQTKSELFSEN  180

Query  662  DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFE  793
              LL+ FS+ T ++   VES TSL+GA++ RNI+P T++RGD E
Sbjct  181  LSLLNRFSRRTEAEVIVVESPTSLLGAVKVRNISPFTIFRGDLE  224



>ref|XP_008606662.1| hypothetical protein SDRG_02836 [Saprolegnia diclina VS20]
 gb|EQC40188.1| hypothetical protein SDRG_02836 [Saprolegnia diclina VS20]
Length=731

 Score =   245 bits (626),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 201/719 (28%), Positives = 338/719 (47%), Gaps = 68/719 (9%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSV-------------LVEKKLIYSKYDEVGV  262
             M+R++E +++V+D G SM   L E  +   V             ++ +K+++ K+DEVG+
Sbjct  1     MSRSKEAMMIVLDAGVSMREPLNETTRKAVVGSRFDAAKTAVQSILSQKMLFRKHDEVGI  60

Query  263   ILFgttetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVD--GDFLDAVIVG  436
             +++GT  T N L E  GGYEHV VL ++  V   + + +      S D   D LD +IV 
Sbjct  61    VMYGTEGTENHLHETQGGYEHVQVLTNLDEVSTRVAETMASAQAASSDTKADILDGIIVA  120

Query  437   MDMMIKKYGITNKGK--KRLCLITNAMCPIKDPYE-GTKEDQVSTIAAQMKAHGMRMDSV  607
             +D++I++   T+K K  KRL ++T+A  PI +P +       V  +  Q++  G+     
Sbjct  121   LDLLIRR---TDKKKYEKRLVVVTDAATPIANPADMEVVCSMVQNMDVQLQIIGIDFSIT  177

Query  608   IVRMKQDL----DAEKGIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTL  775
              V   + L    + +  I  EN+ +L     E       V      +   +TR +   T 
Sbjct  178   DVTKIEPLAVKPEEKHHIKLENEKMLLSIVNEVHGDLMSVSKRIDFLAQGKTRTVNQTTK  237

Query  776   YRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPT  955
             +RG+ E    L+I  +V+ KT E+R PTL   S    P       ++     Y     P 
Sbjct  238   FRGNLEFGATLQIPTYVFSKTLEQRLPTLAKESTVGEP----GVGKVKMDRLYHSQSKPD  293

Query  956   KQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVF  1135
             ++V PE RIK Y+YG +++P S+A+  ++K +  + +K+LGF     + R  YM + +  
Sbjct  294   EEVAPEARIKAYKYGSEMIPFSTADQASLKLETTRSLKILGFLPRDCVDRSMYMSNTDAV  353

Query  1136  IADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNV-SDKGNVPDSL  1312
               D    +A  A++AL RAM D  +VAI R V R       + VL PN    K      L
Sbjct  354   FGDFTKPRAQEALAALVRAMADEKKVAIARFVARANAAPKVV-VLIPNTCGGKDGRLRCL  412

Query  1313  YFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLPEFTP  1492
             +   +PF ED+R+++FPS   +P +  P ++QQ+ AD LV  L L PSD Q+     F P
Sbjct  413   WLQQIPFEEDMRQYEFPSL-RVPKAT-PTKEQQDVADALVDALML-PSDKQQLHSKAFCP  469

Query  1493  NPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNP  1672
             +  LQR+Y  +  +++     V  L   + R    D EL +     +  F   F+LK+  
Sbjct  470   S--LQRFYDTIPKRAEDPHCPVASLPPYVERYLREDKELFTAALPSIQSFNAAFQLKEAV  527

Query  1673  KMKKSRKRL----------IREKPTGSDEEGERASTKVKSE----------------KIG  1774
             K K  +K+           I+++P   D+      +    +                 +G
Sbjct  528   KAKDQKKKFFWSDANKNAAIKDEPLAGDDAAVAEPSGGGDDDDEFDLDDLLGGEDVTSVG  587

Query  1775  NINPVQDFEDMIS-RRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGC  1951
             ++NP+ DFE ++S + +     + A+  M+++I  L     E   + KAL+CL+  R   
Sbjct  588   SMNPISDFEALLSAKHNKVAKAHTAVSGMQDQIATLFGQ--ESAYHAKALQCLLHFRRRS  645

Query  1952  IVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFM  2128
                     FN  L+ L  +     + S    LE+H + L++  + P +DV  S+A +F+
Sbjct  646   PEIHYSASFNAFLQTLKDAWYLSPVWSL---LETHNVTLLSTKDDPTTDVTPSDAHAFL  701



>emb|CDW74323.1| atp-dependent dna helicase [Stylonychia lemnae]
Length=734

 Score =   241 bits (614),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 209/711 (29%), Positives = 347/711 (49%), Gaps = 95/711 (13%)
 Frame = +2

Query  206   CSVLVEKKLIYSKYDEVGVILFgttetan-elteelggYEHVTVLRSIKVVDDDLLQALE  382
               +L+E KL+Y+   E+G++L GT +++N    +    Y+HVT  R I  +D +  + LE
Sbjct  22    VKMLIESKLLYATSHEIGIVLIGTQKSSNFLNDQYEDQYKHVTTFRQIDKLDLESFRHLE  81

Query  383   QL-----PRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIK-DPYEGTK  544
              +     P     GD LD +IVGMDMM++  G   K KKR+ LIT+     K DP E   
Sbjct  82    NITCEKAPIKDNGGDLLDGLIVGMDMMVRHCG-EKKYKKRVFLITDGERETKYDPRE---  137

Query  545   EDQVSTIAAQMKAHGMRMDSVIVRMKQDL-----------------------DAEKGIID  655
                +  I   +     R++ + +    +L                       D  +    
Sbjct  138   ---LKQIITTLNERDTRLNIITLDFCNELAEDDEDDDEEESKKDSKKKESAADETESQNK  194

Query  656   ENDFLLSVFSKETSSKAAY--VESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVY  829
               +FL+ +  K    K A    + A  +    + R +     YRG+ +L+  LK+ V +Y
Sbjct  195   NKEFLMELTDK---VKGAIFPAKVAMEIYKQFKKREVMARVKYRGNLDLAKDLKLNVSIY  251

Query  830   KKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQ-VPPEQRIKGYRYGPQ  1006
              +T EE FP+LK +S  A  +    +  +    ++  V DP +Q V  +Q+IK Y YG Q
Sbjct  252   SRTREEVFPSLKKHSTIANESTSAKESLVKLERQFAEVDDPDQQPVDTDQQIKAYNYGKQ  311

Query  1007  VVPISSAEWEAVKFKPEK-----------GVKLLGFTDASNIMRHYYMKDANVFIADPEN  1153
             +VP+S      +K+KP K            VK+    + S + RH+++   +V +   + 
Sbjct  312   LVPVSKENEHILKYKPPKQDDEHDPANDMDVKV---QNQSKVPRHHFIAGVDVILP-VKG  367

Query  1154  SKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPF  1333
             SK   A +AL  AM + +RV I R V R+   +  + VL P++S K  +   LY   +P 
Sbjct  368   SKNERAFAALVFAMIETHRVLIARIVERKN-VDPKLVVLYPHISKKKPL---LYMAQIPT  423

Query  1334  AEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQE-ALLPEFTPNPVLQR  1510
              E++R++QFPS   +P++    + Q+ AA  L+K LDL   +++E  L PE T NP LQ 
Sbjct  424   NEEIRDYQFPSL--IPAT----KPQKTAAKQLIKALDLVDQEAEEEKLKPEITFNPALQY  477

Query  1511  YYHYLEMK-SKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELK-DNPKMKK  1684
             +   +  + ++     +P L++ +     PD +L  Q +  +  F   FELK +N    K
Sbjct  478   FSQVVVHRITEPAQQELPQLNQQIAEYVKPDKKLFQQAEDEISAFEEAFELKYNNEDENK  537

Query  1685  SRKR-----LIR--EKPTGSDEEGERASTKVKSEKIG---------------NINPVQDF  1798
              +KR     +IR  E+   ++E+      ++  +KIG               ++NP++DF
Sbjct  538   KKKRVYWRDIIRKEEEKVANEEQKLEEEEQIARQKIGDKDMDDKEDKIKEISSMNPIEDF  597

Query  1799  EDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQF  1978
             ++M++ R   + V+ AI +M+  I   V NSL GD Y +AL+CL+ALR  CI E E ++F
Sbjct  598   KNMVNDR-KVDRVSDAIDQMQKLIIRFVTNSLAGDLYSRALDCLIALRESCINEDEGQKF  656

Query  1979  NDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLES-EARSFM  2128
             N  +  L     +   + F + +  H I+LITK E+  S V+ + EA+ F+
Sbjct  657   NQFMEKLKQLFSKGTNKEFFQSIIKHKISLITKDESSISSVITADEAKRFL  707



>gb|EFW41225.2| hypothetical protein CAOG_06357 [Capsaspora owczarzaki ATCC 30864]
Length=750

 Score =   240 bits (612),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 190/641 (30%), Positives = 311/641 (49%), Gaps = 61/641 (10%)
 Frame = +2

Query  317   YEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLC  493
             Y+++TV R  ++ D  L++ L+ Q+  G V  DF+D ++V +D++IK    T K  KR+ 
Sbjct  100   YQNITVARPAEIPDLQLVRYLQDQIKPGKVHADFVDGLVVAIDLIIKAVA-TKKFDKRIM  158

Query  494   LITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRM----KQDLDAEKGIIDEN  661
             L T+A  P  D       D VS I  ++K     + SVI       ++   A+       
Sbjct  159   LFTDARSPYND-------DGVSEIVDKLKLMECAV-SVIADFDDPARKVFHAKTKQQRAG  210

Query  662   DFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTS  841
             +  LS  ++ET+   A    A  ++   R R +  VT +RGD  + + + I V+ Y +T+
Sbjct  211   EAFLSTLAEETNGLTASFRRALEMLARFRARQVKQVTTFRGDLNIGS-INIPVYNYTRTA  269

Query  842   EERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPIS  1021
             E + PT K  S  A    +    E+     Y + +D   +V  E   + Y+YG   +P S
Sbjct  270   EAKVPTFKKLSAVAQQAAEPGDMEVRRETSYFLQEDEETEVQKEDITRAYKYGKDFIPWS  329

Query  1022  SAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKD  1201
             S +   +K    K + +LGFT ASNI R   M  A   +  P ++ A  A+SA A+AM  
Sbjct  330   SVDESTMKLSSHKCLSVLGFTAASNIPRQLLMGGAVAVVPQPGDAVASKALSAFAQAMVL  389

Query  1202  MNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLP  1381
                VAIVR V+R+   NV +G L P +S +      L +N+LPFAED+RE+ F +     
Sbjct  390   QKSVAIVRYVFREN-ANVRLGCLHPVISAEHFY---LLYNSLPFAEDMREYPFTTLHQ--  443

Query  1382  SSMLPNEQQQEAADNLVKMLDLA------PSDSQEALLPEFTPNPVLQRYYHYLEMKSKH  1543
                +P+ +Q +  D L+  LDL         ++ +AL P+ + NPVLQR Y  ++ ++ H
Sbjct  444   KRYMPSAEQLKVVDGLIDKLDLTMAYHDQEGNAMDALHPKLSFNPVLQRVYQCVKQRALH  503

Query  1544  HDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRK-RLIREK---  1711
              D  +PPLD ++ +  +P  ++ ++ +  +D  R+ F L+   + +K    +L  E    
Sbjct  504   PDDDIPPLDPLIEKYVNPSQDIFARAQAELDRVRQAFPLQVIERKEKDEAVKLWNEADAP  563

Query  1712  -----PTGSDEEGERASTKVKSE--------------------KIGNINPVQDFEDMISR  1816
                  P         A+ KVK E                    ++G+I+P++DF  M+S 
Sbjct  564   VLNVDPVDLLGGASHAAKKVKLENPDGNAGPVTLDSLSSGQVMEVGSIDPIKDFRTMVSS  623

Query  1817  RDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRN  1996
             + + + V+ A+ +MK +I  L+  S   + +QKA +CL  LR  C+   E  QFND +  
Sbjct  624   K-TRDLVSTAVAQMKKRIIQLITESFGSNLFQKAFDCLKVLRIECVRSDESAQFNDFMGL  682

Query  1997  LYASCKEKDLR----SFCKQLESHGIALITKTEAPDSDVLE  2107
             L  +   K        F + +    I LI+  EA DS+ LE
Sbjct  683   LKQTTSNKHHNPQHYEFWQLIVKAKITLISSDEAYDSEFLE  723



>gb|KDO24367.1| hypothetical protein SPRG_10445 [Saprolegnia parasitica CBS 223.65]
Length=729

 Score =   239 bits (609),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 201/721 (28%), Positives = 341/721 (47%), Gaps = 74/721 (10%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSV-------------LVEKKLIYSKYDEVGV  262
             M+R +E +++V+D G SM   L E  +   V             ++ +K+++ K+DEVG+
Sbjct  1     MSRTKEAMMIVLDAGVSMREPLNEPTRKAVVGSRFDAAKTAVQSILSQKMLFRKHDEVGI  60

Query  263   ILFgttetanelteelggYEHVTVLRSIKVVDDDLLQ--ALEQLPRGSVDGDFLDAVIVG  436
             +++GT  T N L E  GGYEHV VL ++  V   + +  A+ Q        D LD +IV 
Sbjct  61    VMYGTEGTDNHLHETQGGYEHVHVLSNLDEVSTRVAETMAVAQAASKDTKADVLDGIIVA  120

Query  437   MDMMIKKYGITNKGK--KRLCLITNAMCPIKDPYE-GTKEDQVSTIAAQMKAHGM-----  592
             +D++I++   T+K K  KRL ++T+A  PI +P +       V  +  Q++  G+     
Sbjct  121   LDLLIRR---TDKKKYEKRLVVVTDAATPIANPADMEVVCSMVQNMDVQLQIIGIDFSIT  177

Query  593   ---RMDSVIVRMKQDLDAEKGIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIA  763
                + + + V+ ++  D    I  EN+ +L     E   +   V      +   +T+ + 
Sbjct  178   DATKAEPLAVKPEETHD----IKLENEKMLLSIVNEVHGELLSVSKRIDFLTQGKTKTVN  233

Query  764   PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVV  943
               T +RG+ E    L+I  +V+ KT E+R PTL   S    P       ++     Y   
Sbjct  234   QTTKFRGNLEFGATLQIPTYVFSKTLEQRLPTLAKESTVGEP----GVGKVKMDRLYHSQ  289

Query  944   QDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYMKD  1123
               P ++V PE RIK Y+YG +++P S+A+  ++K +  + +K+LGF     + R  +M +
Sbjct  290   AKPDEEVAPEARIKAYKYGSEMIPFSTADQASLKLETTRSLKILGFLPRDCVDRSMFMSN  349

Query  1124  ANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNV-SDKGNV  1300
              +    D    +A  A++AL RAM D N+VAI R V R       + VL PN  S K   
Sbjct  350   TDAVFGDFTKPRAQEALAALVRAMADENKVAIARFVARANAAPKVV-VLIPNTCSGKDGR  408

Query  1301  PDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEALLP  1480
                L+   +PF ED+R+++FPS     ++  P ++QQ+ AD LV  L L PSD Q+    
Sbjct  409   LHCLWLQQIPFEEDMRQYEFPSLRVAKAT--PTKEQQDVADALVDALML-PSDKQQLHSK  465

Query  1481  EFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL  1660
              F P+  LQR+Y  +  +++     V  L   + R    D EL +     +  F   F+L
Sbjct  466   AFCPS--LQRFYDTIPKRAEDPQCPVASLPPYVERYLREDKELFTTALPSIQRFNAAFQL  523

Query  1661  KDNPKMKKSRKRL----------IREKP-TGSDEEGERASTKVKSE-------------K  1768
             K+  K K  +K+           ++++P TG D E          E              
Sbjct  524   KEAVKAKDQKKKFFWSDAKKNEAVKDEPLTGDDAEPSGGGDDDDDEFDLDDLLGGEDVTS  583

Query  1769  IGNINPVQDFEDMIS-RRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRN  1945
             +G++NP+ DFE ++S + +     + A+  M+++I  L     E   + KAL+CL+  R 
Sbjct  584   VGSMNPISDFEALLSAKHNKVVKAHSAVSGMQDQISTLFGQ--ESAYHGKALQCLLHFRR  641

Query  1946  GCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSF  2125
                       FN  L+ L  +     + S    L +H + L++  + P +DV  + A +F
Sbjct  642   RSPEIHYTASFNAFLQTLKDTWYLSPVWSL---LVAHNVTLLSTKDDPTTDVTPTGAHAF  698

Query  2126  M  2128
             +
Sbjct  699   L  699



>gb|KHN17333.1| ATP-dependent DNA helicase 2 subunit KU80 [Glycine soja]
Length=144

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +2

Query  860   LKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEA  1039
             +K YSDKAPP DKF KHE+   YE+K  +DP K VPP QRIKGY YGPQ+VPIS AEWEA
Sbjct  1     MKKYSDKAPPKDKFGKHEVKIDYEHKSSKDPDKVVPPNQRIKGYPYGPQIVPISFAEWEA  60

Query  1040  VKFKPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAI  1219
             VKFKPEKGV+L+GFT +SN+ RH+YMKD  V +  P N++A++AVSA+ARAMK+MN+VAI
Sbjct  61    VKFKPEKGVRLMGFTYSSNVFRHHYMKDVYVSLPKPGNTRAMIAVSAVARAMKEMNKVAI  120

Query  1220  VRCVWRQGQGNVTIGVLTPNVSDK  1291
             V CVWRQG  NV IGVLTPN+SDK
Sbjct  121   VCCVWRQGHANVVIGVLTPNLSDK  144



>ref|XP_010058458.1| PREDICTED: ATP-dependent DNA helicase 2 subunit KU80-like [Eucalyptus 
grandis]
Length=235

 Score =   216 bits (549),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +2

Query  317  YEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCL  496
            YEHV VL++IKVVD D ++ L Q+PRG+V GDFLDA++VGMDM+IKKY  TNKGKKRLCL
Sbjct  6    YEHVAVLQNIKVVDGDHVETLRQIPRGTVPGDFLDAIVVGMDMLIKKYSSTNKGKKRLCL  65

Query  497  ITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLS  676
            +TN + PIKDPYEG+KED+V+ IA QM +HGM+++ V+VR          +++END +L+
Sbjct  66   MTNGLSPIKDPYEGSKEDRVNAIAEQMTSHGMKLECVVVRESVVRGENVSVMEENDRILN  125

Query  677  VFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIK  817
            +F +++ +K  +VES TSL+GA++TRNI+PVT++RGD E+S KLKIK
Sbjct  126  LFPQKSCAKTIFVESWTSLLGALKTRNISPVTIFRGDLEISPKLKIK  172


 Score = 75.9 bits (185),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +2

Query  1961  QEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMTES  2137
             +EPKQFND L  L   C + DLRSFC  L + GI LI+KTEA DSDV E EARSF+ +S
Sbjct  172   KEPKQFNDFLHQLCKFCLQNDLRSFCDFLATKGITLISKTEAADSDVAEEEARSFLVKS  230



>gb|EFA77444.1| ATP-dependent DNA helicase [Polysphondylium pallidum PN500]
Length=699

 Score =   225 bits (574),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 210/721 (29%), Positives = 343/721 (48%), Gaps = 114/721 (16%)
 Frame = +2

Query  134   REGLILVIDVGPSMH-----------CVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgtt  280
             +E L++++D+G  MH             + E  K  ++L ++KL+Y K DE+GV+L GT 
Sbjct  9     KEALVVILDIGLGMHQHSNTNKQYTTTPIEEALKSATLLYQQKLLYGKKDELGVVLIGTK  68

Query  281   etanelteelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKY  460
             ET N L ++   Y H+T    I+    + L+ LEQL  G   GD +DA+IV MDM+I K 
Sbjct  69    ETKNNLQKDG--YHHITTQTEIEEPTLETLKFLEQLKPGQSRGDIIDALIVAMDMLIHKT  126

Query  461   GITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAE  640
                 K +KR+ L+TN   PI        +D +ST+  Q K   ++++ + V    + + E
Sbjct  127   A-KKKYQKRIFLVTNCYDPIN-------KDDLSTLRDQFKKIDVKLNIIGVDFTDEEELE  178

Query  641   KGII----DENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKL  808
               I     +EN+  L  F++        V+ A  +M   R++++   T            
Sbjct  179   NKIKLTKKEENEKFLREFAESVDGVLVPVKQALEMMSFFRSQSVLQRT------------  226

Query  809   KIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKG  988
                  V++ T       + +Y DK          E T ++  K V           R + 
Sbjct  227   -----VFRDTG------VVVYEDK--------DSEFTDAW--KGVDSGATAKGRATRCQN  265

Query  989   YRYGPQVVPISSAEWEAVKF--KPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSK-  1159
                G           EA+ F  +    V L   T+    +  Y+ K +   +  P   K 
Sbjct  266   NNRG--------QTGEALLFDKRSRYRVGLFRVTERIQKVPIYHNKGSTEMMVSPPGDKV  317

Query  1160  AILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAE  1339
             A  A+S+L   M +  +  + R V R G  + +I +L P++  K N  +SLY   LPF +
Sbjct  318   ARSALSSLIHGMAETKQALLARYVKRNG-SSPSIALLYPHI--KANY-ESLYVCQLPFLD  373

Query  1340  DVREFQFPSFS-NLPSS---MLPNEQQQEAADNLVKMLDLAPSDSQE------ALLPEFT  1489
             D++++QFP  +   P++    +P  +Q +AA  L+  +DL  ++  E      AL P FT
Sbjct  374   DLKQYQFPPIAPTNPATRKPYIPTAEQVDAARALIDSMDLMTAEEDEDHQKIAALRPRFT  433

Query  1490  PNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL---  1660
              NP LQ +Y  L  ++ H ++ +P LD I+ +  +PD  ++   +  +  F+  F L   
Sbjct  434   YNPSLQHFYQCLHHRALHPESQLPKLDPIISKYINPDEAIMENAQDAIKNFQILFPLTKT  493

Query  1661  ---KDNPKMKKSRKRLIRE-----------------KPTGSDEEGERASTKVKS---EKI  1771
                K  PK +     L+ +                 K   +D+  + +  K+ S    ++
Sbjct  494   TNFKSEPKYRWQDGMLVEQQQEIRLDSYVTDDTNSSKKRKADDLADYSLDKLVSGYVNEV  553

Query  1772  GNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGC  1951
             G+INPVQ+F+DM++RRD  + V+KAI  MK +I  LV +SL+   YQKALEC+VALR G 
Sbjct  554   GSINPVQNFKDMLARRDI-DLVDKAISLMKQRIVQLVNDSLKDQFYQKALECVVALRRGS  612

Query  1952  IVEQEPKQFNDLLRNL--YASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSF  2125
             I E E   FN  LR L  Y   K++D   F + + ++ I LIT  E+ DS++ E E++ F
Sbjct  613   IKESESLVFNQFLRELRDYYESKKRD--DFWQLIVTNQIGLITNDESDDSEITEKESKEF  670

Query  2126  M  2128
             +
Sbjct  671   L  671



>ref|XP_005107132.1| PREDICTED: X-ray repair cross-complementing protein 5-like [Aplysia 
californica]
Length=734

 Score =   220 bits (560),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 192/725 (26%), Positives = 345/725 (48%), Gaps = 76/725 (10%)
 Frame = +2

Query  119   QMARNREGLILVIDVGPSMH----CVLPEIEKV---CSVLVEKKLIYSKYDEVGVILFgt  277
             +MA N+E + +V+DVGPSM+     V   +E      ++++++K+     DEV +IL   
Sbjct  5     KMAANKEAIAIVLDVGPSMNQAPAGVATPLETAIEGINMILQRKMFSESKDEVALILL-G  63

Query  278   tetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMIK  454
             T        +   Y+++ + RS+ V D DLLQ ++ +L  G   GDFLDA++V MD +  
Sbjct  64    TNDTENPLSDGDTYQNIVLKRSLAVADFDLLQMVQSELQPGDSSGDFLDALVVAMDHL--  121

Query  455   KYGITNK---GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQ  625
             + G+  K   G +R+ L ++      D        ++ TI   ++  G  ++ +   +++
Sbjct  122   ENGLQGKKGFGTRRVILFSDMGGAFGD-------QELDTIVGAIQNTGTELNVIGPSIEE  174

Query  626   DLD---------AEKGIIDE-------NDFLLSVFSKETSSKAAYVESATSLMGAIRTRN  757
             D D         A+  +  E        + ++     + + +      A   +   ++R 
Sbjct  175   DNDEDGDAGGAKADGHVKKEKTPQQRAGETMIKHILDQVNGECYSFSEALPALSYFQSRQ  234

Query  758   IAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYK  937
             + P+  ++ + ++   ++I V  Y K  E +   LK    K    D         +Y  K
Sbjct  235   VKPMA-WKCNLDIGG-VEIPVNGYSKVKEFK---LKQSWKKVYAQDSSVAPGTLRTYHMK  289

Query  938   VVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYYM  1117
                +   +V  E  ++GYRYG  +VP+S  + + +K+K EK +K+LGFT + +  RH+ +
Sbjct  290   --NEEETEVEKEDMVEGYRYGNTLVPMSEDDKDNMKYKAEKCLKVLGFTKSEHFKRHHIL  347

Query  1118  KDANVFI-ADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKG  1294
              D  + I A+ ++  A +A+SAL  A+ + N VAI R V+        +G L P++  K 
Sbjct  348   GDGVLSITAEKDDEAAAVALSALINALYETNSVAIARRVYAANSAP-RLGCLFPHIKAK-  405

Query  1295  NVPDSLYFNALPFAEDVREFQFPSFSNLPSSML-----PNEQQQEAADNLVKMLDLAPS-  1456
                + L++  LPFAED+R F F S      S+      P + Q +  D L+  +DL  + 
Sbjct  406   --YECLFWVELPFAEDIRTFTFGSLPLTEESLANKKFQPTDDQLKCMDELITNMDLTQAL  463

Query  1457  -----DSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQN  1621
                  D  EAL P+ T NP  QR Y  L+ +  H D  +P L  ++    +  P +++  
Sbjct  464   EDEDGDKDEALKPKLTFNPYFQRVYQCLQHRVLHPDDPLPDLSPVIADYINAPPSVVNAA  523

Query  1622  KTVVDEFRRCFELKDNPKMKKSR--KRLIRE----------KPTGSDEE---GERASTKV  1756
             K  ++  ++ F+L++  K K  +  + + ++          KP   D +   G +  TK 
Sbjct  524   KPCLERMKQLFKLEEVEKNKNGQTGESMFKDNEEEAGPSAKKPKLDDGDLAGGLQNMTKA  583

Query  1757  KSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVA  1936
             +  ++G + P  DF  +ISR+D  ++ ++A ++M+ ++  +V +S     Y KAL+CL  
Sbjct  584   EVTEVGTVTPTADFRALISRKDQ-DFFDEACKQMQARVEQVVTDSFGQQFYPKALDCLKV  642

Query  1937  LRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEA  2116
             LR  C+ + EP  +N  L     +   K  R F  Q+     ALITK E  +S V   E 
Sbjct  643   LRQECVKKSEPNSYNTFLPKFKDTLIGKGRRDFWDQIVKEKQALITKPECEESAVTVEEG  702

Query  2117  RSFMT  2131
               F++
Sbjct  703   ERFVS  707



>gb|EKC32697.1| ATP-dependent DNA helicase 2 subunit 2 [Crassostrea gigas]
Length=729

 Score =   217 bits (552),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 193/729 (26%), Positives = 349/729 (48%), Gaps = 83/729 (11%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEK-------VCSVLVEKKLIYSKYDEVGVILFgtt  280
             MA N+E + +V+DVGPSM+   P  E           +++++K+     DEV ++LFGT 
Sbjct  1     MAANKEAIAIVLDVGPSMNNAPPGEETPLQTAVDAIKMIIQRKMFSESKDEVSLVLFGTP  60

Query  281   etanelteelggYEHVTVLRSIKVVDDDLLQALEQ-LPRGSVDGDFLDAVIVGMDMMIKK  457
             +T N L +    Y+++T+ R + VVD D LQ ++  +   +   DF+DA++V +D ++  
Sbjct  61    DTDNPLADGDS-YDNITISRPLGVVDFDFLQQVQNDITPSNTSADFVDALVVALDHLVNA  119

Query  458   -YGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSV---------  607
               G      KRL L+++      D       DQ+  I + +K  G  ++ +         
Sbjct  120   TQGKKGFAMKRLILLSDLGGEFGD-------DQIEAIISGIKNSGTELNVIGPDINLDGD  172

Query  608   IVRMKQDLDAEKGIIDEN-----------DFLLSVFSKETSSKAAYVESATSLMGAIRTR  754
                         G  + +           + +L    +E   +      A   +   + R
Sbjct  173   EDDDDSQRPGPSGAANGHQKARTPQQKAGEGMLKRILEEVEGECYSFSEALPALSHFQMR  232

Query  755   NIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEY  934
              + P T ++   E+++ ++I V  Y K  + +  + K    K    D+ A  EI +   Y
Sbjct  233   QVRP-TPWKVQLEITSNIRIPVCSYIKIKDFKVKSFK----KVYAKDEDA--EIDNLRTY  285

Query  935   KVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHYY  1114
                 +   +V  E  ++G+RYG  +VP+S  +   +K+K EK +K LGFTDA NI RH++
Sbjct  286   HKNDEEETEVEKEDIVEGHRYGTTLVPMSEDDKLNMKYKAEKCLKALGFTDAQNIKRHHF  345

Query  1115  MKD-ANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDK  1291
             M D  +  +AD ++  A++A+SAL  A+ + N   +VR V+        +G L P++   
Sbjct  346   MGDNTHYVVADKDDETAVVALSALINALYETNMAVVVRKVYSAATA-PKLGCLLPHIK--  402

Query  1292  GNVPDSLYFNALPFAEDVREFQFPSF-----SNLPSSMLPNEQQQEAADNLVKMLDLAPS  1456
              +  + L +  LPF ED+R++ F S      +       P + Q +A ++L+   DL+ +
Sbjct  403   -SSYECLIYVELPFREDIRQYTFGSLPLKQDTEANKKYRPTDAQLDAINDLINESDLSQA  461

Query  1457  ------DSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQ  1618
                   +  EAL P+   NP  QR Y  L+ ++      +P L  ++    +P  E+ ++
Sbjct  462   AEDEDGEKTEALKPKLIFNPYFQRLYQCLQHRALEPHEPLPELSPMIANSLNPPQEVSAR  521

Query  1619  NKTVVDEFRRCFELKDNPKM-KKSRKRLIREKPTGSDEEGERASTKVKSE----------  1765
              +   ++ +  F+L+   K  +K+ + + ++K     EE E ++ K+K +          
Sbjct  522   CEAQCEKLKNLFKLEKVKKEDRKTGENMFKQK-----EEDEPSAKKIKMDDDLGGGLADI  576

Query  1766  ------KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALEC  1927
                   ++G + PV DF  +I+++D+ ++  +A  +M+ ++  LV +S     Y KAL+C
Sbjct  577   TKAEVTEVGTVTPVDDFISLINQKDADKF-EEASGQMQKRVEQLVTDSFGPQFYGKALDC  635

Query  1928  LVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLE  2107
             L ALR   I + EP  +N+ ++ L     EK  R F + +     ALITKTE+ DS V  
Sbjct  636   LKALRQQSIKKSEPTLYNNFMKKLKDFLIEKGRRDFWEMIVDDKQALITKTESEDSSVSL  695

Query  2108  SEARSFMTE  2134
              EA+ F+ E
Sbjct  696   GEAKDFIAE  704



>ref|XP_009530013.1| hypothetical protein PHYSODRAFT_316299 [Phytophthora sojae]
 gb|EGZ16264.1| hypothetical protein PHYSODRAFT_316299 [Phytophthora sojae]
Length=770

 Score =   216 bits (549),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 198/753 (26%), Positives = 337/753 (45%), Gaps = 100/753 (13%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPE---------------------IEKVCSV--LVEKKL  232
             M+R +E +++++DVG SM   L E                        + +V  +V++KL
Sbjct  1     MSRAKEAVVVLLDVGASMRVPLRERVAASDKNRQDPGDELQHTRFAASIAAVEGVVQQKL  60

Query  233   IYSKYDEVGVILFgttetane--lteelggYEHVTVLRSIKVVDDDLLQALEQL-PRGSV  403
              +   DEVG++ +G+ +T N+    +    Y +V V+ SI      +++ L +L P  S 
Sbjct  61    FFKPKDEVGIVAYGSEDTDNQLNEEQGESEYRNVQVVNSIDSPTLHMIKRLRELKPSRSE  120

Query  404   DG--DFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIA---  568
             D   D LD +IV +D++ ++     K  KRL +IT+A   I D   G  E  V+ I    
Sbjct  121   DTKVDILDGLIVALDLLFRRTD-GKKYDKRLMVITDAAAKIADA--GDLESVVTMIQNME  177

Query  569   AQMKAHGMRMDSVIVRMKQDLDAEKG--------------------IIDENDFLLSVFSK  688
              +++  G+      ++ ++D + ++                     I  EN+ +L   + 
Sbjct  178   VKLQVIGLDFQHTTIKPQKDKEGDEEMPEANVKDEPDAGGAPGPERIKAENEKMLVSIAN  237

Query  689   ETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKM  868
             E   +   V     L+     + +A  T +RG  E    L I V+ Y KT     PTL  
Sbjct  238   EVGGEVCSVSKRMHLLAQGMKKTVALTTKFRGPLEFGDALGIPVYCYLKTKTATLPTLSK  297

Query  869   YSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKF  1048
              S  +   +K A  ++     Y   Q+  ++VPP+Q++K YRYG + VP +SA+ E  KF
Sbjct  298   ESQSS--YEKEAAGKVKLDRRYTSPQNIDEEVPPDQQVKAYRYGAEKVPFASADVEFFKF  355

Query  1049  KPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRC  1228
             + EK +K+LGF D + I    ++   ++F+A+P    A    +AL  AM ++++V + R 
Sbjct  356   QTEKSLKVLGFLDKAQINHAKFVAGTDIFVAEPGKPHAATCFAALIDAMVELDQVIVARF  415

Query  1229  VWRQGQGNVTIGVLTPNVSDKGNVPD--SLYFNALPFAEDVREFQFPSFSNLPSSMLPNE  1402
             V R+      I  L P+    G   +  +++   LP+ EDVR ++F    +      P +
Sbjct  416   VARKNAAP-KIVALIPHAPSSGQGENYYAMWSQQLPYEEDVRNYEFAPLKS--RKYTPTD  472

Query  1403  QQQEAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILR  1582
              QQ  AD LV  L +   D  + +   F  NPV++R++H + M++    A VP L   + 
Sbjct  473   GQQALADKLVDSLSIR-DDKADEVGACF--NPVIRRFFHAVSMRALDESAGVPALPSYME  529

Query  1583  RITDPDPELLSQNKTVVDEFRRCFELK----------------DNPKMKKSRKRLIREK-  1711
                  DP    +  ++++ F   F+LK                D P      + L  E  
Sbjct  530   ASLKMDPARQEKISSLIENFGDAFQLKEAVKKAKDRKKKSFWSDVPAASVKEEDLKEEHD  589

Query  1712  -PTGSDEEGE---------RASTKVKSEKIGNINPVQDFEDMI----SRRDSPEWVNKAI  1849
                G D  G            S  V S  +G++NP+ DFE+++    S+    + +  A+
Sbjct  590   DAAGGDNAGSDLELDLDELLDSGDVTS--VGSMNPIADFEELVESSKSKASRRQQLTTAV  647

Query  1850  QEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLR  2029
               M+ +I   +  S   + Y KAL+CL   R   +  Q   QFN+ L  L     E    
Sbjct  648   TGMETQIEKFLSQS-GSEFYPKALQCLTHFRKRSVEIQYSSQFNEFLTKLKTVLTED--S  704

Query  2030  SFCKQLESHGIALITKTEAPDSDVLESEARSFM  2128
                K ++S  I+L+T  + P  DV  +EAR+F+
Sbjct  705   DAWKAVKSADISLLTSADDPSVDVSAAEARAFL  737



>ref|XP_006028756.1| PREDICTED: X-ray repair cross-complementing protein 5 [Alligator 
sinensis]
Length=725

 Score =   215 bits (547),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 197/719 (27%), Positives = 331/719 (46%), Gaps = 74/719 (10%)
 Frame = +2

Query  134   REGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttetan  292
             R  + L +DVG SM    P       + +KV    V++++     DEV ++LFGT  T N
Sbjct  3     RAAIALCLDVGFSMSNSAPGEESPFEQAKKVVMKFVQRQVFAESKDEVSLVLFGTDGTEN  62

Query  293   elteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMIKKYGIT  469
              L      Y+++TV R + + D DLL+ +E ++  GS   DFLDA++V MD++ K+    
Sbjct  63    NLASGDQ-YQNITVQRHLMLPDFDLLEDIEKEIQPGSQQADFLDALVVCMDLLQKETVGK  121

Query  470   NKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVI---VRMKQDLDAE  640
                K+ + + T+   P         ED +  I A +K  G+ +   +   V   +D    
Sbjct  122   KYDKQHIEVFTDLSSPFS-------EDLLEIIIANLKKTGISLQFFLPFPVVTDEDESGA  174

Query  641   KGIIDENDFLLSVFSKE--TSSKAAYVESATSLMGAIRTRNIAP-VTLYRGDFE------  793
              G    +D   S F ++  T  + A +    +LM A+        +  +R   E      
Sbjct  175   MGDSPCSDTRRSSFPRKGLTEQQKAGIRVVRTLMFALEEEGGLEEIYTFRDSLERLSMFK  234

Query  794   --------------LSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYE  931
                           + + L I++  YK  +EE+        D         K +I     
Sbjct  235   KIERRPMAWPCQLTIGSNLSIRIVAYKSITEEKVKKSWTVVD----AKTLKKDDIKKETV  290

Query  932   YKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRH  1108
             Y +  D   ++  E  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I RH
Sbjct  291   YCLNDDDETEIQKEDIIQGFRYGSDIVPFSKVDEEQMKYKTEAKCFSVLGFSRSSLIRRH  350

Query  1109  YYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNV  1282
             +YM      VF A  + + A+ A SAL  A+++++ VAIVR  + + + N  +GV  P +
Sbjct  351   HYMGTQVLKVFAAKDDEAAAV-AFSALVHALEELDMVAIVRYAYDR-RSNPQVGVAFPCI  408

Query  1283  SDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS  1462
              D     + L +  LP+ ED+R++ F S  N      P  +Q  A D+L+  + L   D 
Sbjct  409   KD---AYECLMYVQLPYMEDMRQYMFASLKN-NKKCTPTGEQLSAVDSLIDSMSLVHEDD  464

Query  1463  QEALLPEF----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTV  1630
                    F     PNP  QR Y  L  K+ H +  +PP+++ L  +  P  E+  + +T 
Sbjct  465   DGETFDTFKTSKIPNPHFQRLYQCLHHKAFHPNEPLPPIEQHLLDMLQPPREVKERCQTA  524

Query  1631  VDEFRRCFELKDNPKMKKSR------KRLIREKPTGSDEEGERASTKVKS------EKIG  1774
             +++ +  F LK+  K K+ +      K   RE P+ +  E +  S  + +        +G
Sbjct  525   LEKIKSLFPLKEAGKKKEQKTAQDIFKDNNREGPSAAKAEDKEGSVSIANLAQGNVTSVG  584

Query  1775  NINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCI  1954
             +INP +DF  ++ ++D+     +  Q++ N+I   +E S     Y+K+++C+   R   I
Sbjct  585   SINPAEDFRALVKQKDAN--FTEVSQQLINRIDQFLE-SKGWQYYRKSIDCIQVFREEAI  641

Query  1955  VEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
                E ++FND L+ L     +K L  F + +    I LITK EA  S V   EA+ F+ 
Sbjct  642   KLSEVRRFNDFLQALKGKVDDKALTDFWEIVIQDEITLITKDEAEGSTVTGEEAKKFLA  700



>ref|XP_422072.4| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X3 [Gallus gallus]
Length=768

 Score =   215 bits (547),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 202/730 (28%), Positives = 342/730 (47%), Gaps = 84/730 (12%)
 Frame = +2

Query  119   QMARN-REGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFg  274
             +MAR  +  ++L +DVG +M    P       + +KV +  +++++     DEV V+LFG
Sbjct  39    KMARGGKSAIVLCLDVGITMSSSAPGEESSLEQAKKVVTKFLQRQVFAESKDEVAVVLFG  98

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T NEL      Y+++TV RS+ + D DLL+ ++ ++  GS   DFLDA+IV MD++ 
Sbjct  99    TDGTKNELASRDQ-YQNITVHRSLMLPDFDLLEDIQNRIQLGSQQADFLDAIIVCMDLLQ  157

Query  452   KKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDL  631
             K+       K+ + L T+   P+        EDQ+  I A +K  G+   S+   +   +
Sbjct  158   KETLGKKFEKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGI---SLQFFLPFPV  207

Query  632   DAEKGIIDENDFLLSVFSKE-------TSSKAAYVESATSLMGAIRTRN-IAPVTLYRGD  787
             D   G  D +  + S   +        T+ +   V+    LM  +     +  +  +R  
Sbjct  208   DGADGHGDTSASIYSQLHRNSFPRKRLTAQQKEGVDVVKKLMHTLDEEGGLEEIYTFRES  267

Query  788   FE--------------------LSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAK  907
              E                    + + L I++  YK  +EE+        D         K
Sbjct  268   LERLAMFKKIERRPAAWSCQLTIGSNLSIRIVAYKALTEEKVKKTWTVVD----AKTLRK  323

Query  908   HEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFT  1084
              ++     Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+
Sbjct  324   EDVQRETVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFS  383

Query  1085  DASNIMRHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNV  1255
              +S I RH YM +    VF A D EN  A +A SAL +A+ ++N VAIVR  + + + N 
Sbjct  384   RSSQIQRHCYMGNQVLKVFAAKDDEN--AAVAFSALVQALDELNVVAIVRYAYDR-RCNP  440

Query  1256  TIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVK  1435
              IGV  P + D     + L++  LP+ EDVR++ F S  N      P   Q  A D+L+ 
Sbjct  441   QIGVAFPCIKD---TYECLFYVQLPYMEDVRQYMFSSLKN-NKKCTPTADQLSAIDSLID  496

Query  1436  MLDLAPSDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPD  1600
              ++L   D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +  
Sbjct  497   SMNLVYEDHNGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEVP  556

Query  1601  PELLSQNKTVVDEFRRCFELKDNPKMK--KSRKRLIREKPTG--------SDEEGERAST  1750
               +  + K  +++ +  F LKD  K K  K+ + + ++   G         DEE   +  
Sbjct  557   CVVKERCKAPLEKVKALFPLKDAGKKKEEKTAQDIFKDDEDGPNAKRRKIEDEEDSFSIM  616

Query  1751  KVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKAL  1921
             K+       +G++NP +DF+ ++ ++++        Q++ N+I   +EN      Y K +
Sbjct  617   KLAEGNVTSVGSVNPAEDFQILVRQKNAD--FKDVSQQLINRIDQFLENR-SSQYYMKGI  673

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
              C+   R   I   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V
Sbjct  674   NCIRVFRGEAIKLSKVQCFNDFLQALKSKVEDKALADFWEIVVQDRISLITKDEAEGSSV  733

Query  2102  LESEARSFMT  2131
                EA  F+T
Sbjct  734   TSEEAEKFLT  743



>gb|KFO69669.1| X-ray repair cross-complementing protein 5, partial [Cuculus 
canorus]
Length=720

 Score =   214 bits (544),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 201/724 (28%), Positives = 341/724 (47%), Gaps = 87/724 (12%)
 Frame = +2

Query  140   GLILVIDVGPSM-------HCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M          L + +KV +  V++++     DEV V+LFGT  T N+L
Sbjct  2     AIVLCLDVGFTMSNSASGEESSLEQAKKVMTKFVQRQVFAESRDEVAVVLFGTDGTRNDL  61

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
               E   Y+++TV RS+ + D DLL+ ++ L + G+   DFLDA+IV MD++ K+      
Sbjct  62    ASEDQ-YQNITVHRSLMLPDFDLLEDIQDLIKPGTEQADFLDAIIVCMDLLQKETIGKKY  120

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+ D       DQ+  I   +K  G+ +                   
Sbjct  121   EKRHIELFTDLSSPVSD-------DQLEIIVDNLKKTGISLQFFLPFPADADDGGGDTSG  173

Query  602   SVIVRMKQDLDAEKGIIDEND-------FLLSVFSKETSSKAAYVESAT----SLMGAIR  748
             +V  +M+++    KG+  +          L+    +E   +  Y    +    S+   I 
Sbjct  174   TVRTQMQRNSFPRKGLTTQQKEGIGVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIE  233

Query  749   TRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
              R +A P  L  G     + L I++  YK  +EE+   +    D         K ++   
Sbjct  234   RRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVKKVWTVVD----AKTLRKEDVQKE  284

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I 
Sbjct  285   TVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQ  344

Query  1103  RHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLT  1273
             RHYYM +    VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N  IGV  
Sbjct  345   RHYYMGNQVLKVFAAKDDEN--AAVAFSALVHALDELKVVAIVRYAYDR-RCNPQIGVAF  401

Query  1274  PNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAP  1453
             P + D     + L +  LPF ED+R++ F S  N      P   Q  A D+L+  ++L  
Sbjct  402   PFIKD---AYECLIYVQLPFMEDLRQYIFSSLKN-NKKFTPTADQLSAVDSLIDSMNLVY  457

Query  1454  SDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQ  1618
              D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  +
Sbjct  458   EDGDGGSFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNDPLPPIEQHLLEMLEMPCVVKER  517

Query  1619  NKTVVDEFRRCFELKD--NPKMKKSRKRLIRE--------KPTGSDEEGERASTKVKS--  1762
              +  +++ +  F LK+  N K +K+ + + ++        KP   DEEG  +  K+    
Sbjct  518   CQAPLEKVKALFPLKEVGNKKEEKTAQDIFKDNEDGPKPKKPKIEDEEGSFSIMKLAEGN  577

Query  1763  -EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVAL  1939
                +G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K + C+ A 
Sbjct  578   VTSVGSVNPAEDFRILVRQKNAD--FRDVSQQLINRIDQFLENK-GSQYYMKGINCIRAF  634

Query  1940  RNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEAR  2119
             R   +   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V   EA 
Sbjct  635   REEALKLSKVQCFNDFLQALKSKAEDKALVDFWEIMIQDRISLITKDEAEGSSVTSEEAE  694

Query  2120  SFMT  2131
              F+ 
Sbjct  695   KFLA  698



>ref|XP_004942947.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X4 [Gallus gallus]
Length=785

 Score =   214 bits (546),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 202/730 (28%), Positives = 342/730 (47%), Gaps = 84/730 (12%)
 Frame = +2

Query  119   QMARN-REGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFg  274
             +MAR  +  ++L +DVG +M    P       + +KV +  +++++     DEV V+LFG
Sbjct  39    KMARGGKSAIVLCLDVGITMSSSAPGEESSLEQAKKVVTKFLQRQVFAESKDEVAVVLFG  98

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T NEL      Y+++TV RS+ + D DLL+ ++ ++  GS   DFLDA+IV MD++ 
Sbjct  99    TDGTKNELASRDQ-YQNITVHRSLMLPDFDLLEDIQNRIQLGSQQADFLDAIIVCMDLLQ  157

Query  452   KKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDL  631
             K+       K+ + L T+   P+        EDQ+  I A +K  G+   S+   +   +
Sbjct  158   KETLGKKFEKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGI---SLQFFLPFPV  207

Query  632   DAEKGIIDENDFLLSVFSKE-------TSSKAAYVESATSLMGAIRTRN-IAPVTLYRGD  787
             D   G  D +  + S   +        T+ +   V+    LM  +     +  +  +R  
Sbjct  208   DGADGHGDTSASIYSQLHRNSFPRKRLTAQQKEGVDVVKKLMHTLDEEGGLEEIYTFRES  267

Query  788   FE--------------------LSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAK  907
              E                    + + L I++  YK  +EE+        D         K
Sbjct  268   LERLAMFKKIERRPAAWSCQLTIGSNLSIRIVAYKALTEEKVKKTWTVVD----AKTLRK  323

Query  908   HEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFT  1084
              ++     Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+
Sbjct  324   EDVQRETVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFS  383

Query  1085  DASNIMRHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNV  1255
              +S I RH YM +    VF A D EN  A +A SAL +A+ ++N VAIVR  + + + N 
Sbjct  384   RSSQIQRHCYMGNQVLKVFAAKDDEN--AAVAFSALVQALDELNVVAIVRYAYDR-RCNP  440

Query  1256  TIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVK  1435
              IGV  P + D     + L++  LP+ EDVR++ F S  N      P   Q  A D+L+ 
Sbjct  441   QIGVAFPCIKD---TYECLFYVQLPYMEDVRQYMFSSLKN-NKKCTPTADQLSAIDSLID  496

Query  1436  MLDLAPSDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPD  1600
              ++L   D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +  
Sbjct  497   SMNLVYEDHNGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEVP  556

Query  1601  PELLSQNKTVVDEFRRCFELKDNPKMK--KSRKRLIREKPTG--------SDEEGERAST  1750
               +  + K  +++ +  F LKD  K K  K+ + + ++   G         DEE   +  
Sbjct  557   CVVKERCKAPLEKVKALFPLKDAGKKKEEKTAQDIFKDDEDGPNAKRRKIEDEEDSFSIM  616

Query  1751  KVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKAL  1921
             K+       +G++NP +DF+ ++ ++++        Q++ N+I   +EN      Y K +
Sbjct  617   KLAEGNVTSVGSVNPAEDFQILVRQKNAD--FKDVSQQLINRIDQFLENR-SSQYYMKGI  673

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
              C+   R   I   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V
Sbjct  674   NCIRVFRGEAIKLSKVQCFNDFLQALKSKVEDKALADFWEIVVQDRISLITKDEAEGSSV  733

Query  2102  LESEARSFMT  2131
                EA  F+T
Sbjct  734   TSEEAEKFLT  743



>ref|XP_788472.3| PREDICTED: X-ray repair cross-complementing protein 5-like [Strongylocentrotus 
purpuratus]
Length=729

 Score =   213 bits (543),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 198/728 (27%), Positives = 341/728 (47%), Gaps = 84/728 (12%)
 Frame = +2

Query  125   ARNREGLILVIDVGPSMH------CVLPEIEK-VCSVLVEKKLIYSKYDEVGVILFgtte  283
             ++ +E +++V+DVGPSM+      C   E  + V ++++++K+     DE+ +ILFGT  
Sbjct  3     SKEKEAIVIVLDVGPSMNQAPPGNCTTLETARDVITMILQRKVFAESKDEIALILFGTPG  62

Query  284   tanelteelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVD-GDFLDAVIVGMDMMIKKY  460
             +AN++      Y+++TV R  ++ D DL+Q +    + S + GDF+DA+IV MD++    
Sbjct  63    SANKMD-----YDNITVERPFRLADLDLIQHIRSNIQASTESGDFVDALIVAMDLIHDAT  117

Query  461   G--ITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLD  634
                 +   K R+ L ++      D       D++  +   +KA  M+ +  ++ +  D  
Sbjct  118   SEKASKFTKNRIILFSDLGGEFAD-------DKLQNVTHSLKA--MKTEVNMIGLPFDNT  168

Query  635   AEKGIIDE------------------------NDFLLSVFSKETSSKAAYVESATSLMGA  742
                G  D+                         + L+    +E +      +     +  
Sbjct  169   DGGGNGDDARDQPSTSRGRGPPRKVKTPQQMAGERLVMNIVEEVNGCIYSFDEVIPAVTM  228

Query  743   IRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITS  922
                R + P T ++ + E+ ++LKI V  Y K  E    + K    K     +F    I S
Sbjct  229   FEKRAVRP-TPWKVNLEIGSELKIPVSGYLKVKEATTKSWKSTFQKG--HREFTPQTIRS  285

Query  923   SYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFK-PEKGVKLLGFTDASNI  1099
              +   +  D   +V  E +++GYRYG  ++PIS  + + + +K P K +++LGFT  S I
Sbjct  286   KH---LNDDEETEVEKEDQVEGYRYGNDIIPISEEDKKNMDYKKPGKVMQVLGFTKDSKI  342

Query  1100  MRHYYMKDA-NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTP  1276
              +H  + ++  +F A P++  A ++ SAL  A+ + N VAIVR  +  G     IG L P
Sbjct  343   KKHQQIGNSVYIFYAQPDDQAAAMSFSALVNALYETNSVAIVRRAY-SGSSAPRIGFLAP  401

Query  1277  NVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPS  1456
             ++  K N  ++L++  LPFAED+R + F S  N      P+E+Q  A D+L+  +DL  +
Sbjct  402   HI--KANY-EALFYIELPFAEDLRMYTFMSLDNNKRCQ-PSEEQLAAVDSLIDNMDLMTA  457

Query  1457  DSQE-----ALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQN  1621
             +  E     AL P+ T NP  QR    L  ++ + D  +P ++  +     P   +  Q 
Sbjct  458   EEDEDGDTEALKPKNTLNPYTQRLCQCLMHRALNPDDPIPGIETAIATYLQPCRAVAVQC  517

Query  1622  KTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE------------  1765
             +  V+  ++ F+L+     +      I +   G D E  R   KV  E            
Sbjct  518   EPDVEAMQKLFKLEKAKAKENVTGDSIWKASDGGDGEPARKKAKVDDEVNGGDLSMAGMA  577

Query  1766  -----KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECL  1930
                  ++G ++PV DF+ +IS++D   +  +A  +M  +I  L++ S     Y KAL+CL
Sbjct  578   MGVVTEVGTVDPVGDFKAIISQKDEDRF-KEAAGQMGRRILQLIKESFGSQLYGKALDCL  636

Query  1931  VALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLES  2110
                R   I   EP+ FN  LR L    KE     F + +   G+ LI  TEA DS V + 
Sbjct  637   RVYREQAIQLSEPETFNAYLRKLKDELKELLKVDFWQDVTKDGLTLIDVTEARDSKVSKD  696

Query  2111  EARSFMTE  2134
             EA  F+ E
Sbjct  697   EADKFIQE  704



>gb|KFW00558.1| X-ray repair cross-complementing protein 5, partial [Eurypyga 
helias]
Length=720

 Score =   213 bits (543),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 197/722 (27%), Positives = 338/722 (47%), Gaps = 83/722 (11%)
 Frame = +2

Query  140   GLILVIDVGPSMHCV-------LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M          L + +KV +  V++++     DEV V+LFGT  T N+L
Sbjct  2     AIVLCLDVGFTMSDSASDEESSLEQAKKVMTKFVQRQVFAESKDEVAVVLFGTDGTKNDL  61

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y ++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  62    ASGDQ-YRNITVRRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKY  120

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIID  655
              K+ + L T+   PI        EDQ+  I A +K  G+   S+   +   +D + G  D
Sbjct  121   TKRHIELFTDLNSPIS-------EDQLEIIIANLKKTGI---SLQFFLPFPVDVDDGGGD  170

Query  656   ENDFLLSVFSKETSSKAAYVESATSLMGAIRT--------RNIAPVTLYRGDFE------  793
              +  + S   +++  +    E     +  +R           +  +  +R   E      
Sbjct  171   ASASVRSQMHRKSFPRKGLTEQQKEGIDVVRKLMHTLDEEGGLEEIYTFRESLERLSMFK  230

Query  794   --------------LSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYE  931
                           + + L I++  YK  +EE+   +    D         K+++     
Sbjct  231   KIERRPMPWPCQLTIGSNLSIRIVAYKSVTEEKVKKIWTVVD----AKTLRKNDVQKETV  286

Query  932   YKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRH  1108
             Y +  D   +V  E  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I RH
Sbjct  287   YCLNDDDETEVQKEDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRH  346

Query  1109  YYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPN  1279
             YYM +    VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N  IGV  P 
Sbjct  347   YYMGNQVLKVFAAKDDEN--AAVAFSALVHALDELKVVAIVRYAYDR-RCNPQIGVAFPY  403

Query  1280  VSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD  1459
             + D+    + L +  LPF ED+R++ F S  N     +P   Q  A D+L+  ++L   D
Sbjct  404   IKDEY---ECLIYVQLPFVEDLRQYIFSSLKN-NKKFIPTADQLSAVDSLIDSMNLVYED  459

Query  1460  S-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNK  1624
                   ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  + +
Sbjct  460   DDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPCVVKERCQ  519

Query  1625  TVVDEFRRCFELKDNPKMKK--SRKRLIRE--------KPTGSDEEGERASTKVKS---E  1765
               +++ +  F LK+  K K+  + + + ++        KP   DEEG  +  K+      
Sbjct  520   APLEKVKALFPLKEVGKKKEDNTAQDIFKDNEDGPNPKKPKMEDEEGSFSIIKLAEGNVT  579

Query  1766  KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRN  1945
              +G++NP +DF  ++ +++S        Q++ N+I   +EN      Y K + C+   R 
Sbjct  580   SVGSVNPAEDFRILVRQKNSD--FKDVSQQLINRIDQFLENK-GSQYYMKGINCIRVFRE  636

Query  1946  GCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSF  2125
               +   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V   EA  F
Sbjct  637   DALKLSKVQCFNDYLQALKSKVEDKALADFWEIMIQDRISLITKDEAEGSSVTSEEAEKF  696

Query  2126  MT  2131
             + 
Sbjct  697   LA  698



>gb|KFU88460.1| X-ray repair cross-complementing protein 5, partial [Chaetura 
pelagica]
Length=719

 Score =   213 bits (542),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 201/721 (28%), Positives = 335/721 (46%), Gaps = 86/721 (12%)
 Frame = +2

Query  146   ILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFgttetanelte  304
             +L +DVG +M C   E E       KV +  V++++     DEV V+LFGT +T N L  
Sbjct  4     VLCLDVGLAMGCSAAEGESPLEQAKKVMTKFVQRQVFAESKDEVAVVLFGTDDTRNGLAS  63

Query  305   elggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
                 Y+++TV RS+ + D DLL+ +E + + GS   DFLDA+IV MD++ K+       K
Sbjct  64    GDQ-YQNITVHRSLMLADFDLLKDIEDVIKPGSEQADFLDAIIVCMDLLQKETIGKKYEK  122

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVI-----------------  610
             + + + T+   P+        EDQ+  I A +K  G+ +   +                 
Sbjct  123   RHIEVFTDLSSPVS-------EDQLEIIIANLKKTGISLQFFLPFTVDVDDGGGDASARC  175

Query  611   VRMKQDLDAEKGI-------IDENDFLLSVFSKETSSKAAYVESAT----SLMGAIRTRN  757
               M ++    KG+       ID    L+    +E   +  Y    +    S+   I  R 
Sbjct  176   SEMHRNYFPRKGLTQKQKEGIDVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIERRP  235

Query  758   IA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEY  934
              A P  L  G     + L I++  YK  +EE+   +    D         K ++     Y
Sbjct  236   TAWPCQLTIG-----SNLSIRIVAYKSVTEEKLKKVWTVVD----AKTLKKDDVQRETVY  286

Query  935   KVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHY  1111
              +  D   +V  +  ++G+RYG  +VP S  + E +K+K E K   +LGF+ +S I RHY
Sbjct  287   CLNDDDETEVQKDDTLQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHY  346

Query  1112  YMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNV  1282
             YM +    VF A D EN  A +A SAL  A+ ++N VA+VR  + + + N  +GV  P +
Sbjct  347   YMGNQVLKVFAAKDDEN--AAVAFSALVHALDELNVVAVVRYAYDR-RCNPQVGVAFPYI  403

Query  1283  SDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS  1462
              D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   D 
Sbjct  404   KD---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKCIPTVDQLSAVDSLIDSMNLVYEDD  459

Query  1463  -----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKT  1627
                  ++   P   PNP  QR Y  L+ K+ H +  +PP++  L  + +    +  + + 
Sbjct  460   DGESFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNDPLPPVEPHLLEMLEIPRVVKERCQA  519

Query  1628  VVDEFRRCFELKDNPKMKK--SRKRLIRE--------KPTGSDEEGERASTKVKS---EK  1768
              +++ +  F LK+  K K+  + + + ++        KP   DEEG  +  K+       
Sbjct  520   TLEKVKALFPLKEVGKKKEEMTAQDIFKDNEDGPNAKKPKLEDEEGSFSIMKLAEGNVTS  579

Query  1769  IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNG  1948
             +G++NP +DF  ++ +R +        Q++ N+I   +EN      Y K + C+   R  
Sbjct  580   VGSVNPAEDFRILVRQRSAD--FKDVSQQLINRIDQFLENK-GSQYYMKGINCIRVFREE  636

Query  1949  CIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFM  2128
              I   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V   EA  F+
Sbjct  637   AIKLSKVQCFNDFLQALKSKVEDKALADFWEIMIQDRISLITKDEAEGSSVTSEEAEKFL  696

Query  2129  T  2131
              
Sbjct  697   A  697



>ref|XP_005030596.1| PREDICTED: X-ray repair cross-complementing protein 5 [Anas platyrhynchos]
Length=729

 Score =   213 bits (543),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 200/729 (27%), Positives = 338/729 (46%), Gaps = 84/729 (12%)
 Frame = +2

Query  122   MARNREGLILVIDVG-------PSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgtt  280
             MAR++  ++L +DVG       P     L + +KV +  V++++     DEV V+LFGT 
Sbjct  1     MARSKAAIVLCLDVGFTMSNSYPGEESSLEQAKKVMTKFVQRQVFAESKDEVAVVLFGTD  60

Query  281   etanelteelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKK  457
              T N L  E   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+
Sbjct  61    GTRNGLASEDQ-YQNITVHRSLMLPDFDLLEDIQTVIQPGSQQADFLDAIIVCMDLLQKE  119

Query  458   YGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------  601
                    K+ + L T+   P+        EDQ+  I A +K  G  +             
Sbjct  120   TVGKKFEKRHIELFTDLNSPVS-------EDQLEIIVANLKKTGTSLQFFLPFPVNDDDG  172

Query  602   ------SVIVRMKQDLDAEKGIIDENDFLLSVFSK--ETSSKAAYVESATSLMGAIR---  748
                    V   + Q+    KG+ ++    + V +K   T  +   +E   +   ++    
Sbjct  173   GGDTSAHVHSHLHQNSFPRKGLTEQQKEGVDVVTKLMHTLDEGGGLEEIYTFRESLERLS  232

Query  749   -----TRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHE  913
                   R  AP   +     + + L I++  YK  +EE+   + M  D         K +
Sbjct  233   MFKKIERRPAP---WSCQLTIGSNLSIRIVAYKSVTEEKVKKMWMVVD----AKTLKKED  285

Query  914   ITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDA  1090
             +     Y +  D   +V  +  ++G+RYG  ++P S  + E +K+K E K   +LGF+ A
Sbjct  286   VQKETVYCLNDDDETEVQKDDTVQGFRYGSDIIPFSKEDEEQMKYKAEAKCFSVLGFSRA  345

Query  1091  SNIMRHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTI  1261
             S I RH YM +    VF A D EN  A +A SAL  A+ ++  VAIVR V+ + + N  I
Sbjct  346   SQIQRHCYMGNQVLKVFAAKDDEN--AAVAFSALVHALDELKVVAIVRYVYDR-RCNPQI  402

Query  1262  GVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKML  1441
             GV  P + D     + L +  LP+ EDVR++ F S  N      P   Q  A D+L+  +
Sbjct  403   GVAFPCIKD---AYECLIYVQLPYMEDVRQYMFSSLKN-KKKFTPTADQLSAVDSLIDSM  458

Query  1442  DLAPSDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPE  1606
             +L   D      ++   P   PNP  QR Y  L+ K+ H +  +PP++  L  + +    
Sbjct  459   NLVYEDDDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEPHLLEMLEMPCV  518

Query  1607  LLSQNKTVVDEFRRCFELKDNPKMK--KSRKRLIRE---------KPTGSDEEGERASTK  1753
             +  + +  +++ +  F LKD  K K  K+ + + ++         K    DEE   +  K
Sbjct  519   VKERCQVPLEKVKALFPLKDVGKKKEEKTAQDIFKDDNEDGHNPKKQKIEDEEDSFSIIK  578

Query  1754  VKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALE  1924
             +       +G++NP +DF  ++ ++++        Q++ N+I   +E+      Y K + 
Sbjct  579   LAEGNVTSVGSVNPAEDFRILVRQKNAD--FKDVSQQLINRIDQFLEHK-SSQYYMKGIN  635

Query  1925  CLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVL  2104
             C+   R   I   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V 
Sbjct  636   CIRVFREESIKLSKVRCFNDFLQALKSKVEDKALVDFWEIVVQDRISLITKDEAEGSSVT  695

Query  2105  ESEARSFMT  2131
               EA  F+ 
Sbjct  696   SEEAEKFLA  704



>ref|XP_010711901.1| PREDICTED: X-ray repair cross-complementing protein 5 [Meleagris 
gallopavo]
Length=729

 Score =   213 bits (541),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 204/729 (28%), Positives = 342/729 (47%), Gaps = 84/729 (12%)
 Frame = +2

Query  122   MARN-REGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgt  277
             MAR  +  ++L +DVG +M    P       + ++V +  +++++     DEV V+LFGT
Sbjct  1     MARGGKSAIVLCLDVGTTMSSSAPGEESPLEQAKRVMTKFLQRQVFAESKDEVAVVLFGT  60

Query  278   tetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIK  454
               T N L      Y+++TV RS+ + D DLL+ ++ + + G+   DFLDA+IV MD++ +
Sbjct  61    DGTKNNLASRDQ-YQNITVHRSLMLPDFDLLEDIQNMIQLGTQQADFLDAIIVCMDLLQQ  119

Query  455   KYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD-----------  601
             +       K+ + L T+   P+        EDQ+  I A +K  G  +            
Sbjct  120   ETLGKKFEKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGTSLQFFLPFPVDGAD  172

Query  602   -------SVIVRMKQD------LDAE-KGIIDENDFLLSVFSKETSSKAAYV--ESATSL  733
                    S+  ++ Q+      L A+ K  ID    L+    +E   +  Y   ES   L
Sbjct  173   GRGDASASIFSQLHQNSFPRKRLTAQQKEGIDVVKKLMHTLDEEGGLEEIYTFRESLERL  232

Query  734   -MGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKH  910
              M     R  AP   +     + + L I++  YK  +EE+   +    D         K 
Sbjct  233   AMFKKIERRSAP---WSCQLTIGSNLSIRIVAYKALTEEKVKKIWTVVD----AKTLRKE  285

Query  911   EITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTD  1087
             ++     Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ 
Sbjct  286   DVQRETVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSR  345

Query  1088  ASNIMRHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVT  1258
             +S I RH YM +    VF A D EN  A +A SA  +A+ ++N VAIVR  + + + N  
Sbjct  346   SSQIQRHCYMGNHVLKVFAAKDDEN--AAVAFSAFVQALDELNVVAIVRYAYDR-RCNPQ  402

Query  1259  IGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKM  1438
             IGV  P + D     + L++  LPF EDVR++ F S  N      P   Q  A D+L+  
Sbjct  403   IGVAFPCIKD---AYECLFYVQLPFMEDVRQYVFSSLKN-NKKCSPTVDQLSAIDSLIDS  458

Query  1439  LDLAPSDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDP  1603
             ++L   D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +   
Sbjct  459   MNLVYEDDDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPC  518

Query  1604  ELLSQNKTVVDEFRRCFELKDNPKMK--KSRKRLIREKPTG--------SDEEGERASTK  1753
              +  + K  V++ +  F LKD  K K  K+ + + ++   G         DEE   +  K
Sbjct  519   VVKERCKAPVEKVKALFPLKDAGKKKEEKTAQDIFKDDEDGPNAKRRKTEDEEDSFSIMK  578

Query  1754  VKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALE  1924
             +       +G++NP +DF+ ++ ++++        Q++ N+I   +EN      Y K + 
Sbjct  579   LAEGNVTSVGSVNPAEDFQILVRQKNAD--FKDVSQQLINRIDQFLENR-SSQYYMKGIN  635

Query  1925  CLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVL  2104
             C+   R   +   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V 
Sbjct  636   CIKVFRGEAMKLSKVQCFNDFLQALKSKVEDKALADFWEIVVQDRISLITKDEAEGSSVT  695

Query  2105  ESEARSFMT  2131
               EA  F+T
Sbjct  696   SEEAEKFLT  704



>ref|XP_005049501.1| PREDICTED: X-ray repair cross-complementing protein 5 [Ficedula 
albicollis]
Length=727

 Score =   212 bits (540),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 203/731 (28%), Positives = 337/731 (46%), Gaps = 103/731 (14%)
 Frame = +2

Query  140   GLILVIDVGPSMHCV-------LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M          L + +K+ +  V++++     DEV V+LFGT  T+N L
Sbjct  8     AIVLCLDVGLTMSSSSPGGESSLDQAKKIMTKFVQRQVFAESKDEVAVVLFGTNGTSNGL  67

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
               E   Y+++TV RS+++ D DLL+ ++ + +  S   DFLDA+IV MD++ K+      
Sbjct  68    ASEDQ-YQNITVHRSLQLPDFDLLEDIQDVIKPASEQADFLDAIIVCMDLLQKQTIGKKY  126

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+        EDQ+  I A +K  G+ +                   
Sbjct  127   EKRHIELFTDLNSPVS-------EDQLGIIIANLKKTGISLQFFLPFPVSVDDGIGDPSA  179

Query  602   SVIVRMKQDL-------DAEKGIIDENDFLLSVFSKETSSKAAYVESAT----SLMGAIR  748
             SV   M +D+       + +K  ID    L+    +E   +  Y    +    S+   I 
Sbjct  180   SVHAHMHRDIFPKKCLTEQQKQGIDVVRKLMYTLDEEGGLEEIYTFRESLERLSMFKKIE  239

Query  749   TRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
              + I  P  L  G       L I++  YK  +EER   L    D         K ++   
Sbjct  240   RKPIPWPCQLTIG-----PNLSIRIVAYKWVTEERVKKLWAIVD----AKTLRKEDVQKE  290

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGFT +S I 
Sbjct  291   TVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEGKCFSVLGFTRSSQIQ  350

Query  1103  RHYYM--KDANVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLT  1273
             RHYYM  +   VF A D EN  A +A SAL RA+ ++  VA+VR  + + + N  +GV  
Sbjct  351   RHYYMGTQALKVFAAKDDEN--AAVAFSALVRALDELKVVAVVRYAYDR-RCNPQVGVAF  407

Query  1274  PNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAP  1453
             P + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L  
Sbjct  408   PYIKD---AYECLIYVQLPYMEDLRQYVFSSLKN-SKKCIPTADQLSAVDSLIDSMNLVH  463

Query  1454  SDSQ---EALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNK  1624
              D +   +   P   PNP  QR Y  L+ K+ H D  +PP+++ L  + +    +  + +
Sbjct  464   EDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPDKPLPPIEQHLLEMLEMPCVVRERCQ  523

Query  1625  TVVDEFRRCFEL-------------------KDNPKMKKSRKRLIREKPTGSDEEGERAS  1747
               ++  +  F L                   +D P +KK         P   DEEG  + 
Sbjct  524   APLERVKALFPLKEVGKKKEEKTAQDIFKDNEDEPSLKK---------PKIEDEEGSFSI  574

Query  1748  TKVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKA  1918
              K+       +G++NP +DF  ++ ++++    N   Q++ N+I   +EN      Y K 
Sbjct  575   MKLAEGSVTSVGSVNPAEDFRILVRKKNAD--FNDVSQQLINRIDQFLENK-GSQYYMKG  631

Query  1919  LECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSD  2098
             ++C+   R   +   + + FND L+ L +  ++K L  F + +    I+LITK EA +S 
Sbjct  632   VDCIRVFREEAMKLSKVQCFNDFLQALKSKLEDKALSDFWEIMVQDRISLITKDEAEESL  691

Query  2099  VLESEARSFMT  2131
             V   EA  F+ 
Sbjct  692   VTGEEAEKFLA  702



>gb|KFO55071.1| X-ray repair cross-complementing protein 5, partial [Corvus brachyrhynchos]
Length=717

 Score =   212 bits (539),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 200/720 (28%), Positives = 339/720 (47%), Gaps = 81/720 (11%)
 Frame = +2

Query  140   GLILVIDVGPSMHCV-------LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M          L + +K+ +  V++++     DEV V+LFGT  T N+L
Sbjct  1     AIVLCLDVGFTMSSSSPGEESSLDQAKKIMTKFVQRQVFAESKDEVAVVLFGTNGTRNDL  60

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
               E   Y+++TV RS+K+ D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  61    ASEDQ-YQNITVHRSLKLPDFDLLEDIQDVIKAGSEQADFLDAIIVCMDLLQKETIGKKY  119

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+        EDQ+  I A +K  G+ +                   
Sbjct  120   EKRHIELFTDLSSPVS-------EDQLGIIIANLKKTGISLQFFLPFSVGVDDGSGDTSA  172

Query  602   SVIVRM------KQDL-DAEKGIIDENDFLLSVFSKETSSKAAYVESAT----SLMGAIR  748
             SV   M      ++DL + +K  ID    L+    +E   +  Y    +    S+   I 
Sbjct  173   SVHAHMHRNSFPRKDLTEQQKQGIDVVRKLMYTLDEEGGLEEIYTFRESLERLSMFKKIE  232

Query  749   TRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
              ++I  P  L  G       L I++  YK  +EER   L    D         K ++   
Sbjct  233   RKSIPWPCQLTIG-----PNLSIRIVAYKSVTEERVKKLWTIVD----AKTLRKEDVQKE  283

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGFT +S I 
Sbjct  284   TVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEGKCFSVLGFTRSSQIQ  343

Query  1103  RHYYMKDANV-FIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPN  1279
             RHYYM +  +   A  ++  A +A SAL RA+ ++  VAIVR  + + +    +GV  P 
Sbjct  344   RHYYMGNQALKVFAAKDDKNAAVAFSALVRALDELKVVAIVRYAYDR-RCYPQVGVAFPY  402

Query  1280  VSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD  1459
             + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   D
Sbjct  403   IKD---AYECLIYVQLPYMEDLRQYVFSSLKN-SKKCIPTADQLSAVDSLIDSMNLVHED  458

Query  1460  SQ---EALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTV  1630
              +   +   P   PNP  QR+Y  L+ K+ H +  +PP+++ L  + +    +  + +  
Sbjct  459   GETFEDLFKPSKIPNPHFQRFYQCLQHKAFHPNKPLPPIEQHLLEMLEMPCVVRERCQAP  518

Query  1631  VDEFRRCFELKDNPK----------MKKSRKRLIREKPTGSDEEGERASTKVKSEKI---  1771
             +++ +  F LK+  K          +K +      +KP   DEEG  +  K+    I   
Sbjct  519   LEKVKTLFPLKEVGKKKEEKTVQDILKDNEDEPSLKKPKIEDEEGSFSIMKLAEGNITSV  578

Query  1772  GNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGC  1951
             G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K ++C+   R   
Sbjct  579   GSVNPAEDFRVLVRKKNAD--FKDVSQQLINRIDQFLENK-GSQYYMKGIDCIRVFREEA  635

Query  1952  IVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             +   + + FND L+ L +  ++K L  F   +    I+LITK EA +S V   EA  F+ 
Sbjct  636   MKLSKVQCFNDFLQALKSKLEDKALADFWDIMIQDRISLITKDEAEESSVTGEEAEKFLA  695



>ref|XP_007420221.1| PREDICTED: X-ray repair cross-complementing protein 5 [Python 
bivittatus]
Length=729

 Score =   211 bits (538),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 200/730 (27%), Positives = 342/730 (47%), Gaps = 86/730 (12%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtt  280
             M+R +  ++L +DVG SM    P       + +KV ++ V++++     DEV ++LFGT 
Sbjct  1     MSRAKMAVVLCMDVGFSMSSSAPGEESSFEQAKKVMTMFVQRQVFAENKDEVSLVLFGTE  60

Query  281   etanelteelggYEHVTVLRSIKVVDDDLLQALEQL-PRGSVDGDFLDAVIVGMDMMIKK  457
              T+N L      Y+H+TV R + + D DLL+ ++ L P GS  GD LDA+IV MD++ K+
Sbjct  61    NTSNSLASGDQ-YQHITVHRHLMLPDFDLLEEIQNLIPLGSEQGDILDALIVCMDLLQKE  119

Query  458   YGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDA  637
                   GKK   L       +  P+    EDQ+  I A +K  G+ +   +     D D 
Sbjct  120   ----TIGKKYDKLHIEVFTDLGSPF---SEDQLDIIVANLKKTGISLQFFLPFPVDDEDR  172

Query  638   EKGII-------DENDFLLSVFSKETSSKAAYVESATSLMGAI-RTRNIAPVTLYRGDFE  793
              + +        ++N F     S +       V++   LM ++ R   +  +  +R   E
Sbjct  173   GRHVSAGAHASRNQNSFPGKAVSGQQKEGLQMVKN---LMFSLDREDGLEDIYTFRESLE  229

Query  794   --------------------LSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHE  913
                                 + + L I++  YK  +EE+       S  A       K +
Sbjct  230   RLSMFKKIERRLMPWPCQLTIGSNLSIRIVAYKAFTEEKMKK----SWVAVDAKSHKKED  285

Query  914   ITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDA  1090
             I     Y +  D   +V  E  I+G+RYG  ++P S  + E +K+K + K   +LGF  +
Sbjct  286   IQKETVYCLNDDDETEVQKEDVIQGFRYGSDLIPFSKVDEEQMKYKTDGKCFAVLGFCRS  345

Query  1091  SNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVW-RQGQGNVTI  1261
             S I R+ YM +    VF A  + + A+ A+SAL  A+ +++ VAIVR V+ R+ Q  V  
Sbjct  346   SLIQRYRYMGNQVLKVFAAKDDEAAAV-ALSALINALNELDMVAIVRYVYDRRSQPQV--  402

Query  1262  GVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKML  1441
             G   P +    N  + L +  LP+ ED+R + F S  N      P E Q  A D L++ +
Sbjct  403   GAAFPLIK---NEYECLAYVQLPYMEDLRHYMFSSLKN-NKKYTPTEDQLCAVDCLIESM  458

Query  1442  DLAPSDSQEALLPEFT-----PNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPE  1606
              L   +  E  + +       PNP+ QR Y  L+ K+ H DA +PP+++ L  + +   E
Sbjct  459   SLVFEEESEGTVKDIFKTSKFPNPLFQRLYQCLQHKAFHPDAPLPPIEKHLLDMLEAPRE  518

Query  1607  LLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSD--------EEGERASTKVKS  1762
             +  + +  + + +  F LK+  KMK+ +   +  K    D         E + A+ ++ S
Sbjct  519   VTEKCQAPLQKVKALFPLKEEGKMKEQKTAQLIFKDNNEDGPNAKKAKTEDDEANFRIAS  578

Query  1763  ------EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTY-QKAL  1921
                    K+G++NP ++F  ++ ++++     +  Q++   IF  +EN   G  Y  K++
Sbjct  579   LSEGSVTKVGSVNPAENFRVLVRKKNAD--FKEVSQQLIKHIFQFLEN--RGLLYYMKSI  634

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
             +C+   R   I   E + FND L  L    ++K+L  F + +   GI+LIT  EA  S +
Sbjct  635   DCIKVFREDAIKLSEVQCFNDFLEALKKKVEDKNLPDFWEIVIQEGISLITNEEAEGSSL  694

Query  2102  LESEARSFMT  2131
                +A+ F+ 
Sbjct  695   TAEDAKKFLA  704



>gb|ETP37839.1| hypothetical protein F442_14420 [Phytophthora parasitica P10297]
Length=764

 Score =   211 bits (538),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 194/746 (26%), Positives = 328/746 (44%), Gaps = 91/746 (12%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSV-----------------------LVEKKL  232
             M+R +E +++++DVG SM   L E   V                          +V++KL
Sbjct  1     MSRTKEAVVVLLDVGASMRVPLRERVSVSDKNRQDMDNELQHTRFAAAMAAVENVVQQKL  60

Query  233   IYSKYDEVGVILFgttet--anelteelggYEHVTVLRSIKVVDDDLLQALEQL-PRGSV  403
              +   DEVG++ +G+ +T       +    Y++V V+ SI      +++ L +L P  S 
Sbjct  61    FFKPKDEVGIVAYGSEDTDNQLNEEQGEEEYKNVQVVNSIDSPTLHMIKRLRELKPSTSK  120

Query  404   DG--DFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVS---TIA  568
             +   D LD +IV +D++ ++     K  KRL +IT+A   I D   G  E  V+    + 
Sbjct  121   ETKVDILDGMIVALDLLFRRTD-GKKYDKRLMIITDAAAKIADA--GDLESVVTMMQNME  177

Query  569   AQMKAHGMRMDSVIVRMK-QDLDAE------------------KGIIDENDFLLSVFSKE  691
              +++  G+      ++ K + +D E                    I  EN+ +L   + E
Sbjct  178   VKLQVIGLDFQHTTIKPKDKKVDEEMPEAAVKDEPMEPAASGPDRIKAENEKMLVSIANE  237

Query  692   TSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMY  871
                +   V     L+     + +A  T +RG  E      I ++ Y KT     PTL   
Sbjct  238   VGGEVCSVSKRMQLLAQGMKKTVALTTKFRGPLEFGDTFGIPLYCYLKTKTATLPTLSKE  297

Query  872   SDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFK  1051
             S  +   +K    ++     Y + Q+  ++VPP++++K YRYG + VP +SA+ E  KF+
Sbjct  298   SQSS--YEKETAGKVKLDRRYTLPQNIDQEVPPDEQVKAYRYGSEKVPFASADIEFFKFQ  355

Query  1052  PEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCV  1231
              EK +K LGF D S I    ++   +VFIA+P    A    +AL  AM D+++V I R V
Sbjct  356   TEKSLKTLGFLDRSQINHSKFVAGTDVFIAEPGKPHAATCFAALIDAMVDLDQVLIARFV  415

Query  1232  WRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQ  1411
              R+      I  L P+    G    +++   LP+ ED+R ++F           P+ +QQ
Sbjct  416   ARKNAAPKIIA-LIPHAPSSGENYYAMWSQQLPYEEDIRNYEFAPLKT--RKYTPSSEQQ  472

Query  1412  EAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRIT  1591
               AD LV  L +   D  + +   F  NPV++R++H + M++    A VP L   L    
Sbjct  473   SLADKLVDSLSIR-DDKADEVGACF--NPVIRRFFHAVSMRALDESAGVPALPSYLESSL  529

Query  1592  DPDPELLSQNKTVVDEFRRCFELK----------------DNPKMKKSRKRLIREKPTGS  1723
               DP    +  ++++ F   F+LK                D P      + L  E   G+
Sbjct  530   KMDPGRQEKISSLIESFGDAFQLKEAVKKAKDRKKKSFWSDVPTASIKEEDLKEEHHEGA  589

Query  1724  DEEGERASTKVKSE-------KIGNINPVQDFEDMISRRDSP----EWVNKAIQEMKNKI  1870
              + G      +           +G++NP+ DFE ++    S     + V  A+  M+ +I
Sbjct  590   GDAGSDLELDLDDLLDSGDVTSVGSMNPIADFESLVESSQSKLSRRQQVTTAVTGMETQI  649

Query  1871  FYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLE  2050
                   S   + + KAL+CL   R      Q   QFN+ L  L     E D  ++ K ++
Sbjct  650   EKFFSQS-GSEFFPKALQCLSHFRKRSPEIQYSAQFNEFLTKLKTVLSE-DSEAW-KTVK  706

Query  2051  SHGIALITKTEAPDSDVLESEARSFM  2128
             +  I+L++  E P  DV  +EAR+F+
Sbjct  707   TADISLLSSAEDPSVDVSPAEARAFL  732



>gb|ETO68595.1| hypothetical protein F444_14597 [Phytophthora parasitica P1976]
Length=764

 Score =   211 bits (538),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 194/746 (26%), Positives = 328/746 (44%), Gaps = 91/746 (12%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSV-----------------------LVEKKL  232
             M+R +E +++++DVG SM   L E   V                          +V++KL
Sbjct  1     MSRTKEAVVVLLDVGASMRVPLRERVSVSDKNRQDMDNELQHTRFAAAMAAVENVVQQKL  60

Query  233   IYSKYDEVGVILFgttet--anelteelggYEHVTVLRSIKVVDDDLLQALEQL-PRGSV  403
              +   DEVG++ +G+ +T       +    Y++V V+ SI      +++ L +L P  S 
Sbjct  61    FFKPKDEVGIVAYGSEDTDNQLNEEQGEEEYKNVQVVNSIDSPTLHMIKRLRELKPSTSK  120

Query  404   DG--DFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVS---TIA  568
             +   D LD +IV +D++ ++     K  KRL +IT+A   I D   G  E  V+    + 
Sbjct  121   ETKVDILDGMIVALDLLFRRTD-GKKYDKRLMIITDAAAKIADA--GDLESVVTMMQNME  177

Query  569   AQMKAHGMRMDSVIVRMK-QDLDAE------------------KGIIDENDFLLSVFSKE  691
              +++  G+      ++ K + +D E                    I  EN+ +L   + E
Sbjct  178   VKLQVIGLDFQHTTIKPKDKKVDEEMPEAAVKDEPMEPAASGPDRIKAENEKMLVSIANE  237

Query  692   TSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMY  871
                +   V     L+     + +A  T +RG  E      I ++ Y KT     PTL   
Sbjct  238   VGGEVCSVSKRMQLLAQGMKKTVALTTKFRGPLEFGDTFGIPLYCYLKTKTATLPTLSKE  297

Query  872   SDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFK  1051
             S  +   +K    ++     Y + Q+  ++VPP++++K YRYG + VP +SA+ E  KF+
Sbjct  298   SQSS--YEKETAGKVKLDRRYTLPQNIDQEVPPDEQVKAYRYGSEKVPFASADIEFFKFQ  355

Query  1052  PEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCV  1231
              EK +K LGF D S I    ++   +VFIA+P    A    +AL  AM D+++V I R V
Sbjct  356   TEKSLKTLGFLDRSQINHSKFVAGTDVFIAEPGKPHAATCFAALIDAMVDLDQVLIARFV  415

Query  1232  WRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQ  1411
              R+      I  L P+    G    +++   LP+ ED+R ++F           P+ +QQ
Sbjct  416   ARKNAAPKIIA-LIPHAPSSGENYYAMWSQQLPYEEDIRNYEFAPLKT--RKYTPSSEQQ  472

Query  1412  EAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRIT  1591
               AD LV  L +   D  + +   F  NPV++R++H + M++    A VP L   L    
Sbjct  473   SLADKLVDRLSIR-DDKADEVGACF--NPVIRRFFHAVSMRALDESAGVPALPSYLESSL  529

Query  1592  DPDPELLSQNKTVVDEFRRCFELK----------------DNPKMKKSRKRLIREKPTGS  1723
               DP    +  ++++ F   F+LK                D P      + L  E   G+
Sbjct  530   KMDPGRQEKISSLIESFGDAFQLKEAVKKAKDRKKKSFWSDVPTASIKEEDLKEEHHEGA  589

Query  1724  DEEGERASTKVKSE-------KIGNINPVQDFEDMISRRDSP----EWVNKAIQEMKNKI  1870
              + G      +           +G++NP+ DFE ++    S     + V  A+  M+ +I
Sbjct  590   GDAGSDLELDLDDLLDSGDVTSVGSMNPIADFESLVESSQSKLSRRQQVTTAVTGMETQI  649

Query  1871  FYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLE  2050
                   S   + + KAL+CL   R      Q   QFN+ L  L     E D  ++ K ++
Sbjct  650   EKFFSQS-GSEFFPKALQCLSHFRKRSPEIQYSAQFNEFLTKLKTVLSE-DSEAW-KTVK  706

Query  2051  SHGIALITKTEAPDSDVLESEARSFM  2128
             +  I+L++  E P  DV  +EAR+F+
Sbjct  707   TADISLLSSAEDPSVDVSPAEARAFL  732



>ref|XP_006124793.1| PREDICTED: X-ray repair cross-complementing protein 5 [Pelodiscus 
sinensis]
Length=742

 Score =   211 bits (537),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 194/724 (27%), Positives = 331/724 (46%), Gaps = 87/724 (12%)
 Frame = +2

Query  140   GLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M    P       + +KV +  V++++     DEV V+LFGT +T N L
Sbjct  21    AIVLCMDVGFAMSNSAPGEESPFEQAKKVMTKFVQRQVFAESKDEVSVVLFGTDDTQNTL  80

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQ-LPRGSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV R + + D DLL+ ++  +  GS   DFLDA++V MD++ K+      
Sbjct  81    ASGDQ-YQNITVQRHLMLPDFDLLEEIQNAIQPGSEQADFLDALVVCMDLLQKETVGKKY  139

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIID  655
              K+ + + T+   P         EDQ+  I A +K  G+   S+   +   +D E G  D
Sbjct  140   EKRHIEVFTDLSSPFS-------EDQLEIIIANLKKTGI---SLQFFLPFPVDDEDGSGD  189

Query  656   ENDFLLSVFSKETSSKAAYVES-------ATSLMGAIRTRNIAPVTLYRGDFE-------  793
               D   S   + +  +    E           LM A+    +  +  +R   E       
Sbjct  190   LGDGRHSEMYRNSFPRKGLTEQQKEGICMVRKLMFALEEGGLDEIYTFRESLERLSMFKK  249

Query  794   -------------LSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEY  934
                          + + L I++  YK  +EE+        D         K ++     Y
Sbjct  250   IERRPMAWPCQLTIGSNLSIRIVAYKSLTEEKVKKSWTLVD----AQTLKKEDLQKETVY  305

Query  935   KVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHY  1111
              +  D   +V  +  ++G+RYG  +VP S  + E +K+K E K   +LGF+ AS I RH+
Sbjct  306   CLNDDDETEVQKDDLVQGFRYGSDIVPFSKVDEEQMKYKTEGKCFSVLGFSRASQIQRHH  365

Query  1112  YMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVS  1285
             YM      VF A  + + A+ A+SAL  A+ +++ VAIVR  + + + N  +GV  P + 
Sbjct  366   YMGSQVLKVFAAKDDEAAAV-ALSALIHALDELDVVAIVRYAYDR-RSNPQVGVAFPYIK  423

Query  1286  DKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD--  1459
             D     + L +  LP+ ED+R++ F S  N      P   Q  A D+L+  + L   D  
Sbjct  424   D---AYECLIYVQLPYMEDLRQYMFSSLKN-NKKYTPTVDQLSAVDSLIDSMSLVYEDED  479

Query  1460  ---SQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTV  1630
                +++       PNP  QR Y  L+ K+ H D  +PP+++ L  + +   E+   ++  
Sbjct  480   GETTEDLFKTSKIPNPQFQRLYQCLQHKAFHPDKPLPPIEQHLLEMLEAPQEVRETSQAP  539

Query  1631  VDEFRRCFELKDNPKMKKSR------KRLIREKPTG--SDEEGERASTKVKS------EK  1768
             +++ +  F LKD  K K+ +      K    ++P+   + EE E     + +        
Sbjct  540   LEKIKALFPLKDAGKKKEQKTAQDVFKNNNEDEPSAKKAREENEEGGFSISNLAEGNVTS  599

Query  1769  IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEG---DTYQKALECLVAL  1939
             +G+INP ++F  ++ ++      N   +E+  ++   +E  LE      Y K++ C+   
Sbjct  600   VGSINPAENFCVLVRQK------NANFKEVSRQLANRIEQFLETKGLQYYMKSINCIRVF  653

Query  1940  RNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEAR  2119
             R   I   E + FND LR+L    ++K L  F + L   GI+LITK EA  S V   EA+
Sbjct  654   REEAIKLSEVQCFNDFLRDLKEKVEDKTLADFWEILIQDGISLITKDEAEGSSVTSEEAK  713

Query  2120  SFMT  2131
              F+ 
Sbjct  714   KFLA  717



>gb|KFP61416.1| X-ray repair cross-complementing protein 5, partial [Cariama 
cristata]
Length=719

 Score =   211 bits (536),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 197/722 (27%), Positives = 339/722 (47%), Gaps = 84/722 (12%)
 Frame = +2

Query  140   GLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M    P+ E       K+ +  V++++     DEV V+LFGT  T N+L
Sbjct  2     AIVLCLDVGLTMSSSAPDEEPSLEQAKKIMTKFVQRQVFAESKDEVAVVLFGTDGTRNDL  61

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++ L + GS   DFLDA+IV MD++ K+      
Sbjct  62    ASGDQ-YQNITVHRSLMLPDFDLLEDIQDLIKPGSEQADFLDAIIVCMDLLQKETIGKKY  120

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+        EDQ+  I A +K  G+ +                   
Sbjct  121   DKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGISLQFFLPFPVDVDDGGGDTTA  173

Query  602   SVIVRMKQDLDAEKGIIDENDFLLSVFSK--ETSSKAAYVESA---------TSLMGAIR  748
             SV   M ++    K + ++    ++V  K  +T  +   +E            S+   I 
Sbjct  174   SVRSHMHRNYFPRKSLTEQQKEGINVVRKLMQTLDEGGGLEEIYTFRESLERLSMFKKIE  233

Query  749   TRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
              R +A P  L  G     + L I++  YK  +EE+   +    D         K ++   
Sbjct  234   RRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVKKIWTVVD----AKTLKKDDVQKE  284

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I 
Sbjct  285   TVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQ  344

Query  1103  RHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTP  1276
             RHYYM +    VF A  + + A+ A SAL  A+ ++  VAIVR  + + + N  IGV  P
Sbjct  345   RHYYMGNQVLKVFAAKGDENAAV-AFSALVHALDELKVVAIVRYAYDR-RCNPQIGVAFP  402

Query  1277  NVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPS  1456
              + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   
Sbjct  403   YIKD---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKWIPTADQLSAVDSLIDSMNLVCD  458

Query  1457  D---SQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKT  1627
             D   S++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  + + 
Sbjct  459   DGETSEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPCVVKERCQA  518

Query  1628  VVDEFRRCFELKDNPKMK--KSRKRLIRE---------KPTGSDEEGERASTKVKS---E  1765
              +++ +  F LK+  K K  K+ + + ++         KP    EEG  +  K+      
Sbjct  519   PLEKVKALFPLKEVGKKKEDKTAQDIFKDNSEGGPNPKKPKIEYEEGTFSIIKLAEGNVT  578

Query  1766  KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRN  1945
              +G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K + C+   R 
Sbjct  579   SVGSVNPAEDFRILVRQKNAD--FKDVSQQLINRIDQFLENK-GSQYYMKGINCIRVFRE  635

Query  1946  GCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSF  2125
               +   + + FND L+ L +  ++K L  F + +    I+LIT  EA +S V   EA  F
Sbjct  636   EAMKLSKVQCFNDFLQALKSKMEDKALADFWEIMIQDRISLITNDEAEESSVTSEEAEKF  695

Query  2126  MT  2131
             + 
Sbjct  696   LA  697



>gb|ETL86709.1| hypothetical protein L917_13909 [Phytophthora parasitica]
Length=764

 Score =   211 bits (536),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 193/746 (26%), Positives = 328/746 (44%), Gaps = 91/746 (12%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSV-----------------------LVEKKL  232
             M+R +E +++++DVG SM   L E   V                          +V++KL
Sbjct  1     MSRTKEAVVVLLDVGASMRVPLRERVSVSDKNRQDMGNELQHTRFAAAMAAVENVVQQKL  60

Query  233   IYSKYDEVGVILFgttet--anelteelggYEHVTVLRSIKVVDDDLLQALEQL-PRGSV  403
              +   DEVG++ +G+ +T       +    Y++V V+ SI      +++ L +L P  S 
Sbjct  61    FFKPKDEVGIVAYGSEDTDNQLNEEQGEEEYKNVQVVNSIDSPTLHMIKRLRELKPSTSK  120

Query  404   DG--DFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVS---TIA  568
             +   D LD +IV +D++ ++     K  KRL +IT+A   I D   G  E  V+    + 
Sbjct  121   ETKVDILDGMIVALDLLFRRTD-GKKYDKRLMIITDAAAKIADA--GDLESVVTMMQNME  177

Query  569   AQMKAHGMRMDSVIVRMK-QDLDAE------------------KGIIDENDFLLSVFSKE  691
              +++  G+      ++ K + +D E                    I  EN+ +L   + E
Sbjct  178   VKLQVIGLDFQHTTIKPKDKKVDEEMPEAAVKDEPMEPAASGPDRIKAENEKMLVSIANE  237

Query  692   TSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMY  871
                +   V     L+     + +A  T +RG  E      I ++ Y KT     PTL   
Sbjct  238   VGGEVCSVSKRMQLLAQGMKKTVALTTKFRGPLEFGDTFGIPLYCYLKTKTATLPTLSKE  297

Query  872   SDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFK  1051
             S  +   +K    ++     Y + Q+  ++VPP++++K YRYG + VP +SA+ E  KF+
Sbjct  298   SQSS--YEKETAGKVKLDRRYTLPQNIDQEVPPDEQVKAYRYGSEKVPFASADIEFFKFQ  355

Query  1052  PEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCV  1231
              EK +K LGF D S I    ++   +VFIA+P    A    +AL  AM D+++V I R V
Sbjct  356   TEKSLKTLGFLDRSQINHSKFVAGTDVFIAEPGKPHAATCFAALIDAMVDLDQVLIARFV  415

Query  1232  WRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQ  1411
              R+      I  L P+    G    +++   LP+ ED+R ++F           P+ +QQ
Sbjct  416   ARKNAAPKIIA-LIPHAPSSGENYYAMWSQQLPYEEDIRNYEFAPLKT--RKYTPSSEQQ  472

Query  1412  EAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRIT  1591
               AD LV  L +   D  + +   F  NPV++R++H + M++    A VP L   L    
Sbjct  473   SLADKLVDSLSIR-DDKADEVGACF--NPVIRRFFHAVSMRALDESAGVPALPSYLESSL  529

Query  1592  DPDPELLSQNKTVVDEFRRCFELK----------------DNPKMKKSRKRLIREKPTGS  1723
               DP    +  ++++ F   F+LK                D P      + L  E   G+
Sbjct  530   KMDPGRQEKISSLIESFGDAFQLKEAVKKAKDRKKKSFWSDVPTASIKEEDLKEEHHEGA  589

Query  1724  DEEGERASTKVKSE-------KIGNINPVQDFEDMISRRDSP----EWVNKAIQEMKNKI  1870
              + G      +           +G++NP+ DFE ++    S     + +  A+  M+ +I
Sbjct  590   GDAGSDLELDLDDLLDSGDVTSVGSMNPIADFESLVESSQSKLSRRQQLTTAVTGMETQI  649

Query  1871  FYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLE  2050
                   S   + + KAL+CL   R      Q   QFN+ L  L     E D  ++ K ++
Sbjct  650   EKFFSQS-GSEFFPKALQCLSHFRKRSPEIQYSAQFNEFLTKLKTVLSE-DSEAW-KTIK  706

Query  2051  SHGIALITKTEAPDSDVLESEARSFM  2128
             +  I+L++  E P  DV  +EAR+F+
Sbjct  707   TADISLLSSAEDPSVDVSPAEARAFL  732



>gb|KFO94722.1| X-ray repair cross-complementing protein 5, partial [Buceros 
rhinoceros silvestris]
Length=719

 Score =   210 bits (534),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 199/724 (27%), Positives = 341/724 (47%), Gaps = 87/724 (12%)
 Frame = +2

Query  140   GLILVIDVG-------PSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG       P     L + +K+ +  V++++     DEV V+LFGT  T N+L
Sbjct  1     AIVLCLDVGYTMSTSAPGEESALEQAKKIMTKFVQRQVFAESKDEVAVVLFGTDGTRNDL  60

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  61    ASGDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKY  119

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+        EDQ++ I   +K  G+ +                   
Sbjct  120   EKRHIELFTDLSSPVS-------EDQLAIIVDNLKKTGISLQFFLPFPMDVDDGDGDKSA  172

Query  602   SVIVRMKQDLDAEKGI-------IDENDFLLSVFSKETSSKAAYVESAT----SLMGAIR  748
             S    M ++  A+KG+       ID    L+    +E   +  Y    +    S+   I 
Sbjct  173   SAHSHMPRNSFAKKGLTAQQKEGIDVVRKLMHNLDEEGGLEEIYTFRESLERLSMFKKIE  232

Query  749   TRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
              R +A P  L  G     + L I++  YK  +EE+    KM++     T +  K ++   
Sbjct  233   RRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVK--KMWTVVDAKTHR--KDDVRKE  283

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGFT +S I 
Sbjct  284   TVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEHMKYKTESKCFSVLGFTRSSQIQ  343

Query  1103  RHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLT  1273
              HYYM +    VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N  +GV  
Sbjct  344   GHYYMGNQVLKVFAAKDDEN--AAVAFSALVNALDELKVVAIVRYAYDR-RSNPQVGVAF  400

Query  1274  PNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAP  1453
             P + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L  
Sbjct  401   PYIKD---AYECLIYVQLPYMEDLRQYVFSSLKN-NKKCIPTADQLSAVDSLIDSMNLVS  456

Query  1454  SDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQ  1618
              D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  +
Sbjct  457   EDDDGETFEDLFKPSKIPNPYFQRLYQCLQHKAFHPNDPLPPVEKHLSEMLEMPCVVKER  516

Query  1619  NKTVVDEFRRCFELK--DNPKMKKSRKRLIRE--------KPTGSDEEGERASTKVKS--  1762
              +  +++ +  F LK  D  K +K+ + + ++        KP   DEE   +  K+    
Sbjct  517   CQAPLEKVKALFPLKEVDKRKPEKTAQDIFKDNEDGPNSKKPKIEDEESSFSILKLAEGN  576

Query  1763  -EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVAL  1939
                +G++NP +DF  ++ ++++        +++ N+I   +EN      Y K + C+   
Sbjct  577   VTSVGSVNPAEDFRILVRQKNAD--FKDVSKQLTNRIDQFLENK-GSQYYMKGINCIRVF  633

Query  1940  RNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEAR  2119
             R   +   + + FND L+ L    ++K L  F + +    I+LITK EA +S V   EA 
Sbjct  634   REEAVKRSKARCFNDFLQTLKLKVEDKALADFWEIMIQDRISLITKDEAGESSVTSEEAE  693

Query  2120  SFMT  2131
              F+ 
Sbjct  694   KFLA  697



>gb|KFQ28286.1| X-ray repair cross-complementing protein 5, partial [Merops nubicus]
Length=720

 Score =   210 bits (534),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 195/724 (27%), Positives = 339/724 (47%), Gaps = 88/724 (12%)
 Frame = +2

Query  140   GLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M    P       + +K+ +  V++++     DEV V+LFGT +T N+L
Sbjct  1     AIVLCLDVGFTMSSSAPGEESSLEQAKKIMTKFVQRQVFAESKDEVAVVLFGTDDTRNDL  60

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
               E   Y+++T+ RS+ + D DL++ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  61    ACEDQ-YQNITIHRSLMLPDFDLMEDIQDVIKAGSEQADFLDAIIVCMDLLQKETIGKKY  119

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIID  655
              KK + L T+   P+        EDQ+  I   +K  G+ +    +    D+D   G   
Sbjct  120   EKKHIELFTDLSSPVS-------EDQLEIIIDNLKKTGISL-QFFLPFPVDVDDGGG---  168

Query  656   ENDFLLSVFSKETSS--KAAYVESATSLMGAIRT--------RNIAPVTLYRGDFE----  793
               D   SV+S   +S  +    E     +  +R           +  V  +R   E    
Sbjct  169   --DTSTSVWSTHRNSFPRKGLTEQQKEGINVVRKLMHTLDEEGGLEEVYTFRESLERLSM  226

Query  794   ----------------LSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
                             + + L I++  YK  +EE+   +    D         K ++   
Sbjct  227   FKKIERRPMAWPCQLTIGSNLSIRIVAYKSVTEEKVKKIWTVVD----AKTHRKDDVQRE  282

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   +V  +  I+G+RYG  ++P S  + E +K+K E K   +LGFT +S I 
Sbjct  283   TVYCLNDDDETEVQKDDTIQGFRYGSDIIPFSKEDEEQMKYKTEAKCFSVLGFTRSSQIQ  342

Query  1103  RHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLT  1273
             RHYYM +    VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N  +GV  
Sbjct  343   RHYYMGNQVLKVFAAKDDEN--AAVAFSALIHALHELKVVAIVRYAYDR-RCNPQVGVAF  399

Query  1274  PNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAP  1453
             P++ D     + L +  LPF ED+R++ F S  N     +P   Q  A D+L+  ++L  
Sbjct  400   PHIKD---AYECLIYVQLPFTEDLRQYLFSSLKN-NKKCIPTADQLSAVDSLIDSMNLVY  455

Query  1454  SDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQ  1618
              D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  +
Sbjct  456   EDDNGETFEDLFKPSKIPNPQFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPCVVKER  515

Query  1619  NKTVVDEFRRCFELKDNPKMK--KSRKRLIRE--------KPTGSDEEGERASTKVKS--  1762
              ++ +++ +  F LK+  K K  K+ + + ++        KP   DEEG  +  K+    
Sbjct  516   CQSPLEKVKALFPLKEVGKKKEDKTAQDIFKDNEDGPNPKKPKIEDEEGSFSIVKLAEGS  575

Query  1763  -EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVAL  1939
                +G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K + C+   
Sbjct  576   VTSVGSVNPAEDFRILVRQKNAD--FRDVSQQLINRIDQFLENK-GSQYYMKGINCISVF  632

Query  1940  RNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEAR  2119
             R   +     + FND L+ L +  ++K L  F + +    I+LI+K EA +S V   EA 
Sbjct  633   REEAMKLSRVQCFNDFLQALKSKVEDKALADFWEIMIQDRISLISKDEAEESSVTSEEAE  692

Query  2120  SFMT  2131
              F+ 
Sbjct  693   KFLA  696



>ref|XP_008910277.1| hypothetical protein PPTG_15029 [Phytophthora parasitica INRA-310]
 gb|ETN04350.1| hypothetical protein PPTG_15029 [Phytophthora parasitica INRA-310]
Length=764

 Score =   210 bits (535),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 194/746 (26%), Positives = 328/746 (44%), Gaps = 91/746 (12%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSV-----------------------LVEKKL  232
             M+R +E +++++DVG SM   L E   V                          +V++KL
Sbjct  1     MSRTKEAVVVLLDVGASMRVPLRERVSVSDKNRQDMDNELQHTRFAAAMAAVENVVQQKL  60

Query  233   IYSKYDEVGVILFgttet--anelteelggYEHVTVLRSIKVVDDDLLQALEQL-PRGSV  403
              +   DEVG++ +G+ +T       +    Y++V V+ SI      +++ L +L P  S 
Sbjct  61    FFKPKDEVGIVAYGSEDTDNQLNEEQGEEEYKNVQVVNSIDSPTLHMIKRLRELKPSTSK  120

Query  404   DG--DFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVS---TIA  568
             +   D LD +IV +D++ ++     K  KRL +IT+A   I D   G  E  V+    + 
Sbjct  121   ETKVDILDGMIVALDLLFRRTD-GKKYDKRLMIITDAAAKIADA--GDLESVVTMMQNME  177

Query  569   AQMKAHGMRMDSVIVRMK-QDLDAE------------------KGIIDENDFLLSVFSKE  691
              +++  G+      ++ K + +D E                    I  EN+ +L   + E
Sbjct  178   VKLQVIGLDFQHTTIKPKDKKVDEEMPEAAVKDEPMEPAASGPDRIKAENEKMLVSIANE  237

Query  692   TSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMY  871
                +   V     L+     + +A  T +RG  E      I ++ Y KT     PTL   
Sbjct  238   VGGEVCSVSKRMQLLAQGMKKTVALTTKFRGPLEFGDTFGIPLYCYLKTKTATLPTLSKE  297

Query  872   SDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFK  1051
             S  +   +K    ++     Y + Q+  ++VPP++++K YRYG + VP +SA+ E  KF+
Sbjct  298   SQSS--YEKETAGKVKLDRRYTLPQNIDQEVPPDEQVKAYRYGSEKVPFASADIEFFKFQ  355

Query  1052  PEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCV  1231
              EK +K LGF D S I    ++   +VFIA+P    A    +AL  AM D+++V I R V
Sbjct  356   TEKSLKTLGFLDRSQINHSKFVAGTDVFIAEPGKPHAATCFAALIDAMVDLDQVLIARFV  415

Query  1232  WRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQ  1411
              R+      I  L P+    G    +++   LP+ ED+R ++F           P+ +QQ
Sbjct  416   ARKNAAPKIIA-LIPHAPSSGENYYAMWSQQLPYEEDIRNYEFAPLKT--RKYTPSSEQQ  472

Query  1412  EAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRIT  1591
               AD LV  L +   D  + +   F  NPV++R++H + M++    A VP L   L    
Sbjct  473   SLADKLVDSLSIR-DDKADEVGACF--NPVIRRFFHAVSMRALDESAGVPALPSYLESSL  529

Query  1592  DPDPELLSQNKTVVDEFRRCFELK----------------DNPKMKKSRKRLIREKPTGS  1723
               DP    +  ++++ F   F+LK                D P      + L  E   G+
Sbjct  530   KMDPGRQEKISSLIESFGDAFQLKEAVKKAKDRKKKSFWSDVPTASIKEEDLKEEHHEGA  589

Query  1724  DEEGERASTKVKSE-------KIGNINPVQDFEDMISRRDSP----EWVNKAIQEMKNKI  1870
              + G      +           +G++NP+ DFE ++    S     + V  A+  M+ +I
Sbjct  590   GDAGSDLELDLDDLLDSGDVTSVGSMNPIADFEYLVESSQSKLIRRQQVTTAVTGMETQI  649

Query  1871  FYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLE  2050
                   S   + + KAL+CL   R      Q   QFN+ L  L     E D  ++ K ++
Sbjct  650   EKFFSQS-GSEFFPKALQCLSHFRKRSPEIQYSAQFNEFLTKLKTVLSE-DSEAW-KTVK  706

Query  2051  SHGIALITKTEAPDSDVLESEARSFM  2128
             +  I+L++  E P  DV  +EAR+F+
Sbjct  707   TADISLLSSAEDPSVDVSPAEARAFL  732



>gb|ETK79992.1| hypothetical protein L915_14226 [Phytophthora parasitica]
 gb|ETL33414.1| hypothetical protein L916_14125 [Phytophthora parasitica]
 gb|ETP09735.1| hypothetical protein F441_14457 [Phytophthora parasitica CJ01A1]
Length=764

 Score =   210 bits (535),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 193/746 (26%), Positives = 328/746 (44%), Gaps = 91/746 (12%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSV-----------------------LVEKKL  232
             M+R +E +++++DVG SM   L E   V                          +V++KL
Sbjct  1     MSRTKEAVVVLLDVGASMRVPLRERVSVSDKNRQDMDNELQHTRFAAAMAAVENVVQQKL  60

Query  233   IYSKYDEVGVILFgttet--anelteelggYEHVTVLRSIKVVDDDLLQALEQL-PRGSV  403
              +   DEVG++ +G+ +T       +    Y++V V+ SI      +++ L +L P  S 
Sbjct  61    FFKPKDEVGIVAYGSEDTDNQLNEEQGEEEYKNVQVVNSIDSPTLHMIKRLRELKPSTSK  120

Query  404   DG--DFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVS---TIA  568
             +   D LD +IV +D++ ++     K  KRL +IT+A   I D   G  E  V+    + 
Sbjct  121   ETKVDILDGMIVALDLLFRRTD-GKKYDKRLMIITDAAAKIADA--GDLESVVTMMQNME  177

Query  569   AQMKAHGMRMDSVIVRMK-QDLDAE------------------KGIIDENDFLLSVFSKE  691
              +++  G+      ++ K + +D E                    I  EN+ +L   + E
Sbjct  178   VKLQVIGLDFQHTTIKPKDKKVDEEMPEAAVKDEPMEPAASGPDRIKAENEKMLVSIANE  237

Query  692   TSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMY  871
                +   V     L+     + +A  T +RG  E      I ++ Y KT     PTL   
Sbjct  238   VGGEVCSVSKRMQLLAQGMKKTVALTTKFRGPLEFGDTFGIPLYCYLKTKTATLPTLSKE  297

Query  872   SDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFK  1051
             S  +   +K    ++     Y + Q+  ++VPP++++K YRYG + VP +SA+ E  KF+
Sbjct  298   SQSS--YEKETAGKVKLDRRYTLPQNIDQEVPPDEQVKAYRYGSEKVPFASADIEFFKFQ  355

Query  1052  PEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCV  1231
              EK +K LGF D S I    ++   +VFIA+P    A    +AL  AM D+++V I R V
Sbjct  356   TEKSLKTLGFLDRSQINHSKFVAGTDVFIAEPGKPHAATCFAALIDAMVDLDQVLIARFV  415

Query  1232  WRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQ  1411
              R+      I  L P+    G    +++   LP+ ED+R ++F           P+ +QQ
Sbjct  416   ARKNAAPKIIA-LIPHAPSSGENYYAMWSQQLPYEEDIRNYEFAPLKT--RKYTPSSEQQ  472

Query  1412  EAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRIT  1591
               AD LV  L +   D  + +   F  NPV++R++H + M++    A VP L   L    
Sbjct  473   SLADKLVDSLSIR-DDKADEVGACF--NPVIRRFFHAVSMRALDESAGVPALPSYLESSL  529

Query  1592  DPDPELLSQNKTVVDEFRRCFELK----------------DNPKMKKSRKRLIREKPTGS  1723
               DP    +  ++++ F   F+LK                D P      + L  E   G+
Sbjct  530   KMDPGRQEKISSLIESFGDAFQLKEAVKKAKDRKKKSFWSDVPTASIKEEDLKEEHHEGA  589

Query  1724  DEEGERASTKVKSE-------KIGNINPVQDFEDMISRRDSP----EWVNKAIQEMKNKI  1870
              + G      +           +G++NP+ DFE ++    S     + +  A+  M+ +I
Sbjct  590   GDAGSDLELDLDDLLDSGDVTSVGSMNPIADFESLVESSQSKLIRRQQLTTAVTGMETQI  649

Query  1871  FYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLE  2050
                   S   + + KAL+CL   R      Q   QFN+ L  L     E D  ++ K ++
Sbjct  650   EKFFSQS-GSEFFPKALQCLSHFRKRSPEIQYSAQFNEFLTKLKTVLSE-DSEAW-KTIK  706

Query  2051  SHGIALITKTEAPDSDVLESEARSFM  2128
             +  I+L++  E P  DV  +EAR+F+
Sbjct  707   TADISLLSSAEDPSVDVSPAEARAFL  732



>gb|ETM39882.1| hypothetical protein L914_14029 [Phytophthora parasitica]
Length=764

 Score =   210 bits (535),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 193/746 (26%), Positives = 328/746 (44%), Gaps = 91/746 (12%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSV-----------------------LVEKKL  232
             M+R +E +++++DVG SM   L E   V                          +V++KL
Sbjct  1     MSRTKEAVVVLLDVGASMRVPLRERVSVSDKNRQDMDNELQHTRFAAAMAAVENVVQQKL  60

Query  233   IYSKYDEVGVILFgttet--anelteelggYEHVTVLRSIKVVDDDLLQALEQL-PRGSV  403
              +   DEVG++ +G+ +T       +    Y++V V+ SI      +++ L +L P  S 
Sbjct  61    FFKPKDEVGIVAYGSEDTDNQLNEEQGEEEYKNVQVVNSIDSPTLHMIKRLRELKPSTSK  120

Query  404   DG--DFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVS---TIA  568
             +   D LD +IV +D++ ++     K  KRL +IT+A   I D   G  E  V+    + 
Sbjct  121   ETKVDILDGMIVALDLLFRRTD-GKKYDKRLMIITDAAAKIADA--GDLESVVTMMQNME  177

Query  569   AQMKAHGMRMDSVIVRMK-QDLDAE------------------KGIIDENDFLLSVFSKE  691
              +++  G+      ++ K + +D E                    I  EN+ +L   + E
Sbjct  178   VKLQVIGLDFQHTTIKPKDKKVDEEMPEAAVKDEPMEPAASGPDRIKAENEKMLVSIANE  237

Query  692   TSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMY  871
                +   V     L+     + +A  T +RG  E      I ++ Y KT     PTL   
Sbjct  238   VGGEVCSVSKRMQLLAQGMKKTVALTTKFRGPLEFGDTFGIPLYCYLKTKTATLPTLSKE  297

Query  872   SDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFK  1051
             S  +   +K    ++     Y + Q+  ++VPP++++K YRYG + VP +SA+ E  KF+
Sbjct  298   SQSS--YEKETAGKVKLDRRYTLPQNIDQEVPPDEQVKAYRYGSEKVPFASADIEFFKFQ  355

Query  1052  PEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCV  1231
              EK +K LGF D S I    ++   +VFIA+P    A    +AL  AM D+++V I R V
Sbjct  356   TEKSLKTLGFLDRSQINHSKFVAGTDVFIAEPGKPHAATCFAALIDAMVDLDQVLIARFV  415

Query  1232  WRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQ  1411
              R+      I  L P+    G    +++   LP+ ED+R ++F           P+ +QQ
Sbjct  416   ARKNAAPKIIA-LIPHAPSSGENYYAMWSQQLPYEEDIRNYEFAPLKT--RKYTPSSEQQ  472

Query  1412  EAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRIT  1591
               AD LV  L +   D  + +   F  NPV++R++H + M++    A VP L   L    
Sbjct  473   SLADKLVDSLSIR-DDKADEVGACF--NPVIRRFFHAVSMRALDESAGVPALPSYLESSL  529

Query  1592  DPDPELLSQNKTVVDEFRRCFELK----------------DNPKMKKSRKRLIREKPTGS  1723
               DP    +  ++++ F   F+LK                D P      + L  E   G+
Sbjct  530   KMDPGRQEKISSLIESFGDAFQLKEAVKKAKDRKKKSFWSDVPTASIKEEDLKEEHHEGA  589

Query  1724  DEEGERASTKVKSE-------KIGNINPVQDFEDMISRRDSP----EWVNKAIQEMKNKI  1870
              + G      +           +G++NP+ DFE ++    S     + +  A+  M+ +I
Sbjct  590   GDAGSDLELDLDDLLDSGDVTSVGSMNPIADFESLVESSQSKLIRRQQLTTAVTGMETQI  649

Query  1871  FYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLE  2050
                   S   + + KAL+CL   R      Q   QFN+ L  L     E D  ++ K ++
Sbjct  650   EKFFSQS-GSEFFPKALQCLSHFRKRSPEIQYSAQFNEFLTKLKTVLSE-DSEAW-KTVK  706

Query  2051  SHGIALITKTEAPDSDVLESEARSFM  2128
             +  I+L++  E P  DV  +EAR+F+
Sbjct  707   TADISLLSSAEDPSVDVSPAEARAFL  732



>gb|ETI39867.1| hypothetical protein F443_14591 [Phytophthora parasitica P1569]
Length=764

 Score =   210 bits (535),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 193/746 (26%), Positives = 328/746 (44%), Gaps = 91/746 (12%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSV-----------------------LVEKKL  232
             M+R +E +++++DVG SM   L E   V                          +V++KL
Sbjct  1     MSRTKEAVVVLLDVGASMRVPLRERVSVSDKNRQDMGNELQHTRFAAAMAAVENVVQQKL  60

Query  233   IYSKYDEVGVILFgttet--anelteelggYEHVTVLRSIKVVDDDLLQALEQL-PRGSV  403
              +   DEVG++ +G+ +T       +    Y++V V+ SI      +++ L +L P  S 
Sbjct  61    FFKPKDEVGIVAYGSEDTDNQLNEEQGEEEYKNVQVVNSIDSPTLHMIKRLRELKPSTSK  120

Query  404   DG--DFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVS---TIA  568
             +   D LD +IV +D++ ++     K  KRL +IT+A   I D   G  E  V+    + 
Sbjct  121   ETKVDILDGMIVALDLLFRRTD-GKKYDKRLMIITDAAAKIADA--GDLESVVTMMQNME  177

Query  569   AQMKAHGMRMDSVIVRMK-QDLDAE------------------KGIIDENDFLLSVFSKE  691
              +++  G+      ++ K + +D E                    I  EN+ +L   + E
Sbjct  178   VKLQVIGLDFQHTTIKPKDKKVDEEMPEAAVKDEPMEPAASGPDRIKAENEKMLVSIANE  237

Query  692   TSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMY  871
                +   V     L+     + +A  T +RG  E      I ++ Y KT     PTL   
Sbjct  238   VGGEVCSVSKRMQLLAQGMKKTVALTTKFRGPLEFGDTFGIPLYCYLKTKTATLPTLSKE  297

Query  872   SDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFK  1051
             S  +   +K    ++     Y + Q+  ++VPP++++K YRYG + VP +SA+ E  KF+
Sbjct  298   SQSS--YEKETAGKVKLDRRYTLPQNIDQEVPPDEQVKAYRYGSEKVPFASADIEFFKFQ  355

Query  1052  PEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCV  1231
              EK +K LGF D S I    ++   +VFIA+P    A    +AL  AM D+++V I R V
Sbjct  356   TEKSLKTLGFLDRSQINHSKFVAGTDVFIAEPGKPHAATCFAALIDAMVDLDQVLIARFV  415

Query  1232  WRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQ  1411
              R+      I  L P+    G    +++   LP+ ED+R ++F           P+ +QQ
Sbjct  416   ARKNAAPKIIA-LIPHAPSSGENYYAMWSQQLPYEEDIRNYEFAPLKT--RKYTPSSEQQ  472

Query  1412  EAADNLVKMLDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRIT  1591
               AD LV  L +   D  + +   F  NPV++R++H + M++    A VP L   L    
Sbjct  473   SLADKLVDSLSIR-DDKADEVGACF--NPVIRRFFHAVSMRALDESAGVPALPSYLESSL  529

Query  1592  DPDPELLSQNKTVVDEFRRCFELK----------------DNPKMKKSRKRLIREKPTGS  1723
               DP    +  ++++ F   F+LK                D P      + L  E   G+
Sbjct  530   KMDPGRQEKISSLIESFGDAFQLKEAVKKAKDRKKKSFWSDVPTASIKEEDLKEEHHEGA  589

Query  1724  DEEGERASTKVKSE-------KIGNINPVQDFEDMISRRDSP----EWVNKAIQEMKNKI  1870
              + G      +           +G++NP+ DFE ++    S     + +  A+  M+ +I
Sbjct  590   GDAGSDLELDLDDLLDSGDVTSVGSMNPIADFESLVESSQSKLSRRQQLTTAVTGMETQI  649

Query  1871  FYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLE  2050
                   S   + + KAL+CL   R      Q   QFN+ L  L     E D  ++ K ++
Sbjct  650   EKFFSQS-GSEFFPKALQCLSHFRKRSPEIQYSAQFNEFLTKLKTVLSE-DSEAW-KTVK  706

Query  2051  SHGIALITKTEAPDSDVLESEARSFM  2128
             +  I+L++  E P  DV  +EAR+F+
Sbjct  707   TADISLLSSAEDPSVDVSPAEARAFL  732



>ref|XP_010144967.1| PREDICTED: X-ray repair cross-complementing protein 5 [Eurypyga 
helias]
Length=711

 Score =   209 bits (533),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 192/700 (27%), Positives = 329/700 (47%), Gaps = 76/700 (11%)
 Frame = +2

Query  185   LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDD  364
             L + +KV +  V++++     DEV V+LFGT  T N+L      Y ++TV RS+ + D D
Sbjct  12    LEQAKKVMTKFVQRQVFAESKDEVAVVLFGTDGTKNDLASGDQ-YRNITVRRSLMLPDFD  70

Query  365   LLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGT  541
             LL+ ++ + + GS   DFLDA+IV MD++ K+       K+ + L T+   PI       
Sbjct  71    LLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKYTKRHIELFTDLNSPIS------  124

Query  542   KEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLSVFSKETSSKAAYVES  721
              EDQ+  I A +K  G+   S+   +   +D + G  D +  + S   +++  +    E 
Sbjct  125   -EDQLEIIIANLKKTGI---SLQFFLPFPVDVDDGGGDASASVRSQMHRKSFPRKGLTEQ  180

Query  722   ATSLMGAIRT--------RNIAPVTLYRGDFE--------------------LSTKLKIK  817
                 +  +R           +  +  +R   E                    + + L I+
Sbjct  181   QKEGIDVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIERRPMPWPCQLTIGSNLSIR  240

Query  818   VWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRY  997
             +  YK  +EE+   +    D         K+++     Y +  D   +V  E  I+G+RY
Sbjct  241   IVAYKSVTEEKVKKIWTVVD----AKTLRKNDVQKETVYCLNDDDETEVQKEDTIQGFRY  296

Query  998   GPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA-DPENSKAI  1165
             G  +VP S  + E +K+K E K   +LGF+ +S I RHYYM +    VF A D EN  A 
Sbjct  297   GSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHYYMGNQVLKVFAAKDDEN--AA  354

Query  1166  LAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDV  1345
             +A SAL  A+ ++  VAIVR  + + + N  IGV  P + D+    + L +  LPF ED+
Sbjct  355   VAFSALVHALDELKVVAIVRYAYDR-RCNPQIGVAFPYIKDEY---ECLIYVQLPFVEDL  410

Query  1346  REFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLPEFTPNPVLQR  1510
             R++ F S  N     +P   Q  A D+L+  ++L   D      ++   P   PNP  QR
Sbjct  411   RQYIFSSLKN-NKKFIPTADQLSAVDSLIDSMNLVYEDDDGETFEDLFKPSKIPNPHFQR  469

Query  1511  YYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKK--  1684
              Y  L+ K+ H +  +PP+++ L  + +    +  + +  +++ +  F LK+  K K+  
Sbjct  470   LYQCLQHKAFHPNEPLPPIEQHLLEMLEMPCVVKERCQAPLEKVKALFPLKEVGKKKEDN  529

Query  1685  SRKRLIRE--------KPTGSDEEGERASTKVKS---EKIGNINPVQDFEDMISRRDSPE  1831
             + + + ++        KP   DEEG  +  K+       +G++NP +DF  ++ +++S  
Sbjct  530   TAQDIFKDNEDGPNPKKPKMEDEEGSFSIIKLAEGNVTSVGSVNPAEDFRILVRQKNSD-  588

Query  1832  WVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASC  2011
                   Q++ N+I   +EN      Y K + C+   R   +   + + FND L+ L +  
Sbjct  589   -FKDVSQQLINRIDQFLENK-GSQYYMKGINCIRVFREDALKLSKVQCFNDYLQALKSKV  646

Query  2012  KEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             ++K L  F + +    I+LITK EA  S V   EA  F+ 
Sbjct  647   EDKALADFWEIMIQDRISLITKDEAEGSSVTSEEAEKFLA  686



>ref|XP_008874858.1| hypothetical protein H310_10297 [Aphanomyces invadans]
 gb|ETV96595.1| hypothetical protein H310_10297 [Aphanomyces invadans]
Length=738

 Score =   209 bits (532),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 193/727 (27%), Positives = 322/727 (44%), Gaps = 77/727 (11%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSV-------------LVEKKLIYSKYDEVGV  262
             M+R +E +++V+D   +M   L EI +   V             +V + L++ K DEVG+
Sbjct  1     MSRTKEAIMIVLDASVAMRSPLGEITRKVDVGSRFDAAKKAIQGIVNQLLLFRKNDEVGI  60

Query  263   ILFgttetaneltee-lggYEHVTVLRSIKVVDDDLLQALEQLPRGSVD--GDFLDAVIV  433
             +++GT  T N+L  +    Y++VTVL SI  V  DL + L+ +   SV+   D LD +IV
Sbjct  61    VMYGTEGTDNQLNSDDGNNYKNVTVLSSIAPVTFDLAKQLQAMEAASVETPADVLDGIIV  120

Query  434   GMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIV  613
              +D++I++     K  KRL +IT+A  PI +P   +  + V T+   ++ H +++  +  
Sbjct  121   ALDLVIRRTD-NKKYDKRLVVITDAATPINNP---SDMEVVCTMMQNLEVH-LQIIGIDF  175

Query  614   RMKQDLDAEKGIIDE----------NDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIA  763
              +    +   G+ DE          N+ +L   + E   +   V      +   + + + 
Sbjct  176   GLDTKHEQPDGVKDEAVAASFIKSENEKMLHSIATEVQGEVQSVSKRMDFLAQSKLKPVL  235

Query  764   PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSY----E  931
               T  RG+ E    L I V+V+ K  E   P+L+  S  A  +  FA+ ++         
Sbjct  236   QTTKMRGNLEFGENLFIPVYVFGKVLEATIPSLQKESQVAKKSSTFAEDDVPGKVRMERS  295

Query  932   YKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRHY  1111
             Y     P  +VPPE+RIK Y+YG +++P S+A+  A+K    +G+K+LGF D S      
Sbjct  296   YFATAQPDDEVPPERRIKAYKYGSEMIPCSTADQAALKLLTTRGLKVLGFVDKSQWKHGL  355

Query  1112  YMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDK  1291
              M   +    D    KA  A+ AL+ AM +  + A+ R V R       I VL PNV + 
Sbjct  356   GMTGTDAVFGDFTKPKAQEALHALSTAMHNEGKFALARFV-RAANAAPKIVVLFPNVEEP  414

Query  1292  GNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQEA  1471
                   L+   LPF ED+R ++FPS    P  + P  +Q  AAD LV  L   P+ +  A
Sbjct  415   R--LHCLWMQQLPFEEDLRPYEFPSLVTSPK-IQPTAEQFAAADALVDQLS-RPASTLHA  470

Query  1472  LLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRC  1651
                    NP LQR Y  +  ++   +A + PL   + R    D  L       +  F R 
Sbjct  471   F------NPALQRLYDTIAQRAMDPNAPLAPLPPFVERYLREDRSLFEPALPAIQAFDRA  524

Query  1652  FELKDNPKMKKSRKRLIREKPTGSDEEGERAS-----TKVKSE-----------------  1765
             F+LK+    K ++K+       G  +    A      + + +E                 
Sbjct  525   FQLKEAATAKDNKKKSFWSDIKGDAKVAAAAKRGTDISAIPAESNDGGGDDDGDLDLDEL  584

Query  1766  ------KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALEC  1927
                   ++G++NP+ DFE ++S +   +    A+  M+ +I         G  + K LEC
Sbjct  585   LGEDVTEVGSMNPISDFEALLSTKQLAK-SQLAVLGMELQILEFFRQDAVG-YHSKGLEC  642

Query  1928  LVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLE  2107
             L   R           FN+ L  L +     D   + + L  H + L++  + P  D+  
Sbjct  643   LRYFRRRSPEIHRTTLFNEFLHRLKSEFAPGDAPVW-QLLVQHHVTLLSTRDDPSCDISP  701

Query  2108  SEARSFM  2128
               A +F+
Sbjct  702   QAAENFL  708



>ref|XP_009555976.1| PREDICTED: X-ray repair cross-complementing protein 5 [Cuculus 
canorus]
Length=712

 Score =   209 bits (531),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 196/703 (28%), Positives = 332/703 (47%), Gaps = 81/703 (12%)
 Frame = +2

Query  185   LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDD  364
             L + +KV +  V++++     DEV V+LFGT  T N+L  E   Y+++TV RS+ + D D
Sbjct  12    LEQAKKVMTKFVQRQVFAESRDEVAVVLFGTDGTRNDLASEDQ-YQNITVHRSLMLPDFD  70

Query  365   LLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGT  541
             LL+ ++ L + G+   DFLDA+IV MD++ K+       K+ + L T+   P+ D     
Sbjct  71    LLEDIQDLIKPGTEQADFLDAIIVCMDLLQKETIGKKYEKRHIELFTDLSSPVSD-----  125

Query  542   KEDQVSTIAAQMKAHGMRMD------------------SVIVRMKQDLDAEKGIIDEND-  664
               DQ+  I   +K  G+ +                   +V  +M+++    KG+  +   
Sbjct  126   --DQLEIIVDNLKKTGISLQFFLPFPADADDGGGDTSGTVRTQMQRNSFPRKGLTTQQKE  183

Query  665   ------FLLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTLYRGDFELSTKLK  811
                    L+    +E   +  Y    +    S+   I  R +A P  L  G     + L 
Sbjct  184   GIGVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIERRPMAWPCQLTIG-----SNLS  238

Query  812   IKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGY  991
             I++  YK  +EE+   +    D         K ++     Y +  D   +V  +  I+G+
Sbjct  239   IRIVAYKSVTEEKVKKVWTVVD----AKTLRKEDVQKETVYCLNDDDETEVQKDDTIQGF  294

Query  992   RYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA-DPENSK  1159
             RYG  +VP S  + E +K+K E K   +LGF+ +S I RHYYM +    VF A D EN  
Sbjct  295   RYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHYYMGNQVLKVFAAKDDEN--  352

Query  1160  AILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAE  1339
             A +A SAL  A+ ++  VAIVR  + + + N  IGV  P + D     + L +  LPF E
Sbjct  353   AAVAFSALVHALDELKVVAIVRYAYDR-RCNPQIGVAFPFIKD---AYECLIYVQLPFME  408

Query  1340  DVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLPEFTPNPVL  1504
             D+R++ F S  N      P   Q  A D+L+  ++L   D      ++   P   PNP  
Sbjct  409   DLRQYIFSSLKN-NKKFTPTADQLSAVDSLIDSMNLVYEDGDGGSFEDLFKPSKIPNPHF  467

Query  1505  QRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKD--NPKM  1678
             QR Y  L+ K+ H +  +PP+++ L  + +    +  + +  +++ +  F LK+  N K 
Sbjct  468   QRLYQCLQHKAFHPNDPLPPIEQHLLEMLEMPCVVKERCQAPLEKVKALFPLKEVGNKKE  527

Query  1679  KKSRKRLIRE---------KPTGSDEEGERASTKVKS---EKIGNINPVQDFEDMISRRD  1822
             +K+ + + ++         KP   DEEG  +  K+       +G++NP +DF  ++ +++
Sbjct  528   EKTAQDIFKDNSEDGPKPKKPKIEDEEGSFSIMKLAEGNVTSVGSVNPAEDFRILVRQKN  587

Query  1823  SPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLY  2002
             +        Q++ N+I   +EN      Y K + C+ A R   +   + + FND L+ L 
Sbjct  588   AD--FRDVSQQLINRIDQFLENK-GSQYYMKGINCIRAFREEALKLSKVQCFNDFLQALK  644

Query  2003  ASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             +  ++K L  F + +    I+LITK EA  S V   EA  F+ 
Sbjct  645   SKAEDKALVDFWEIMIQDRISLITKDEAEGSSVTSEEAEKFLA  687



>ref|XP_007072873.1| PREDICTED: LOW QUALITY PROTEIN: X-ray repair complementing defective 
repair in Chinese hamster cells 5 (double-strand-break 
rejoining) [Chelonia mydas]
Length=745

 Score =   209 bits (531),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 195/727 (27%), Positives = 330/727 (45%), Gaps = 92/727 (13%)
 Frame = +2

Query  140   GLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M    P       + +K+ ++ V++++     DEV V+LFGT  T N L
Sbjct  21    AIVLCMDVGFAMSNSAPGEESPFEQAKKMMTMFVQRQVFAESKDEVSVVLFGTDGTENTL  80

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQ-LPRGSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV R + + D DLL+ ++  +  GS   DFLDA++V MD++ K+      
Sbjct  81    ASGDQ-YQNITVQRHLMLPDFDLLEDIQNAIQPGSEQADFLDALVVCMDLLQKETIGKKY  139

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIID  655
              K+ + + T+   P         EDQ+  I A +K  G+   S+   +   +D E G  D
Sbjct  140   EKRHIEVFTDLSSPF-------SEDQLEIIIANLKKTGI---SLQFFLPFPVDDEDGSGD  189

Query  656   ENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIA--------PVTLYRGDFE------  793
               D   S   + +  +    E     +  +R    A         +  +R   E      
Sbjct  190   TGDDRHSDMCRNSFPRKGLTEQQKEGICMVRKLMFALEEEGGLDEIYTFRESLERLSMFK  249

Query  794   --------------LSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYE  931
                           + + L I++  YK  +EE+        D         K ++     
Sbjct  250   KIERRPMAWPCQLTIGSNLSIRIVAYKSLTEEKVKKSWTLVD----AKTLKKEDVQKETV  305

Query  932   YKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRH  1108
             Y +  D   +V  +  ++G+ YG  +VP S  + E +K+K E K   +LGF+ +S I RH
Sbjct  306   YCLDDDDETEVQKDDLVQGFCYGSDIVPFSKVDEEQMKYKTEAKCFSVLGFSRSSQIQRH  365

Query  1109  YYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNV  1282
             +YM +    VF A  + + A+ A+SAL  A+ +++ VAIVR  + + + N  +GV  P +
Sbjct  366   HYMGNQVLKVFAAKDDEAAAV-ALSALIHALDELDVVAIVRYAYDR-RSNPQVGVAFPCI  423

Query  1283  SDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD-  1459
              D   V + L +  LP+ ED+R++ F S  N      P E Q  A D+L+  + LA  D 
Sbjct  424   KD---VYECLIYVQLPYMEDLRQYMFSSLKN-NKKYTPTEDQLSAVDSLIDSMSLAYEDE  479

Query  1460  ----SQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKT  1627
                 +++   P   PNP  QR Y  L+ K+ H D  +PP+++ L  + +   E+  + + 
Sbjct  480   DGETTEDLFKPSKIPNPQFQRLYQCLQHKAFHPDKPLPPIEQHLLEMLEVPQEVREKCQA  539

Query  1628  VVDEFRRCFELKDNPKMKK----------------SRKRLIREKPTGSDEEGERASTKVK  1759
              +++ +  F LKD  K K+                S KR   E   GS      A   V 
Sbjct  540   PLEKIKALFPLKDAGKKKEQKTAQDVFKDNNEDGPSAKRAKAENEEGSFSIANLAEGSVT  599

Query  1760  SEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEG---DTYQKALECL  1930
             +  +G+INP ++F  ++ ++      N   +E+  ++   +E  LE      Y K++ C+
Sbjct  600   T--VGSINPAENFCVLVRQK------NANFKEVSQQLINRIEQFLETKGLQYYMKSINCI  651

Query  1931  VALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLES  2110
                R   I   E + FND L+ L    ++K L  F + L   GI+LI+K EA  S V   
Sbjct  652   RVFREEAIKLAEVQCFNDFLQALKKKVEDKTLADFWEILIQDGISLISKDEAEGSSVTHE  711

Query  2111  EARSFMT  2131
             EA+ F+ 
Sbjct  712   EAKKFLA  718



>ref|XP_010405273.1| PREDICTED: X-ray repair cross-complementing protein 5 [Corvus 
cornix cornix]
Length=709

 Score =   208 bits (530),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 195/698 (28%), Positives = 330/698 (47%), Gaps = 74/698 (11%)
 Frame = +2

Query  185   LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDD  364
             L + +K+ +  V++++     DEV V+LFGT  T N+L  E   Y+++TV RS+K+ D D
Sbjct  12    LDQAKKIMTKFVQRQVFAESKDEVAVVLFGTNGTRNDLASEDQ-YQNITVHRSLKLPDFD  70

Query  365   LLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGT  541
             LL+ ++ + + GS   DFLDA+IV MD++ K+       K+ + L T+   P+       
Sbjct  71    LLEDIQDVIKAGSEQADFLDAIIVCMDLLQKETIGKKYEKRHIELFTDLSSPVS------  124

Query  542   KEDQVSTIAAQMKAHGMRMD------------------SVIVRM------KQDL-DAEKG  646
              EDQ+  I A +K  G+ +                   SV   M      ++DL + +K 
Sbjct  125   -EDQLGIIIANLKKTGISLQFFLPFSVGVDDGSGDTSASVHAHMHRNSFPRKDLTEQQKQ  183

Query  647   IIDENDFLLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTLYRGDFELSTKLK  811
              ID    L+    +E   +  Y    +    S+   I  ++I  P  L  G       L 
Sbjct  184   GIDVVRKLMYTLDEEGGLEEIYTFRESLERLSMFKKIERKSIPWPCQLTIG-----PNLS  238

Query  812   IKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGY  991
             I++  YK  +EER   L    D         K ++     Y +  D   +V  +  I+G+
Sbjct  239   IRIVAYKSVTEERMKKLWTIVD----AKTLRKEDVQKETVYCLNDDDETEVQKDDTIQGF  294

Query  992   RYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDANV-FIADPENSKAI  1165
             RYG  +VP S  + E +K+K E K   +LGFT +S I RHYYM +  +   A  ++  A 
Sbjct  295   RYGSDIVPFSKEDEEQMKYKTEGKCFSVLGFTRSSQIQRHYYMGNQALKVFAAKDDKNAA  354

Query  1166  LAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDV  1345
             +A SAL RA+ ++  VAIVR  + + +    +GV  P + D     + L +  LP+ ED+
Sbjct  355   VAFSALVRALDELKVVAIVRYAYDR-RCYPQVGVAFPYIKD---AYECLIYVQLPYMEDL  410

Query  1346  REFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQ---EALLPEFTPNPVLQRYY  1516
             R++ F S  N     +P   Q  A D+L+  ++L   D +   +   P   PNP  QR+Y
Sbjct  411   RQYVFSSLKN-SKKCIPTADQLSAVDSLIDSMNLVHEDGETFEDLFKPSKIPNPHFQRFY  469

Query  1517  HYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPK-------  1675
               L+ K+ H +  +PP+++ L  + +    +  + +  +++ +  F LK+  K       
Sbjct  470   QCLQHKAFHPNKPLPPIEQHLLEMLEMPCVVRERCQAPLEKVKTLFPLKEVGKKKEEKTV  529

Query  1676  ---MKKSRKRLIREKPTGSDEEGERASTKVKSEKI---GNINPVQDFEDMISRRDSPEWV  1837
                +K +      +KP   DEEG  +  K+    I   G++NP +DF  ++ ++++    
Sbjct  530   QDILKDNEDEPSLKKPKIEDEEGSFSIMKLAEGNITSVGSVNPAEDFRVLVRKKNAD--F  587

Query  1838  NKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKE  2017
                 Q++ N+I   +EN      Y K ++C+   R   +   + + FND L+ L +  ++
Sbjct  588   KDVSQQLINRIDQFLENK-GSQYYMKGIDCIRVFREEAMKLSKVQCFNDFLQALKSKLED  646

Query  2018  KDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             K L  F   +    I+LITK EA +S V   EA  F+ 
Sbjct  647   KALADFWDIMIQDRISLITKDEAEESSVTGEEAEKFLA  684



>ref|XP_005485248.1| PREDICTED: X-ray repair cross-complementing protein 5 [Zonotrichia 
albicollis]
Length=727

 Score =   208 bits (530),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 195/725 (27%), Positives = 330/725 (46%), Gaps = 91/725 (13%)
 Frame = +2

Query  140   GLILVIDVGPSMHCV-------LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M          L + +K+ +  V++++     DEV V+LFGT  T N L
Sbjct  8     AVVLCLDVGLTMSSSSPGEESSLDQAKKIMTKFVQRQVFAESKDEVAVVLFGTNGTRNGL  67

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
               E   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  68    ASEDQ-YQNITVHRSLMLPDFDLLEDIQNMIKAGSAQADFLDAIIVCMDLLQKETIGKKY  126

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+        EDQ+  I A +K  G  +                   
Sbjct  127   EKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGTSIQFFLPFPVSVDDGSGDKSA  179

Query  602   SVIVRMKQDLDAEKGI-------IDENDFLLSVFSKETSSKAAYVESAT-SLMGAIRTRN  757
             SV   M ++    KG+       ID    L+    +E   +  Y  S +   +   +   
Sbjct  180   SVHAHMHKNSFPMKGLTEQQKQGIDVVRKLMYTLDEEGGLEEIYTFSESLERLSMFKKME  239

Query  758   IAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYK  937
               P+  +     +   L I++  YK  +EER   L    D         + ++     Y 
Sbjct  240   RKPMP-WPCQLTIGPNLSIRIVAYKSVTEERVKKLWAIVD----AKTLRREDVQKETVYC  294

Query  938   VVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYY  1114
             +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGFT +S I RHYY
Sbjct  295   LNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEGKCFSVLGFTRSSQIQRHYY  354

Query  1115  MKDANV-FIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDK  1291
             M +  +   A  +++ A +A SAL RA+ ++  VA+VR  + + +    IGV  P + D 
Sbjct  355   MGNQALKVFAAKDDANAAVAFSALVRALDELKVVAVVRYAYDR-RCYPQIGVAFPYIKD-  412

Query  1292  GNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQ--  1465
                 + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   D +  
Sbjct  413   --TYECLIYVQLPYMEDLRQYVFSSLKN-SKKCIPTVDQLSAVDSLIDSMNLVHEDGETF  469

Query  1466  -EALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEF  1642
              +   P   PNP  QR Y  L+ K+ H D  +PP+++ L  + +    +  + +  ++  
Sbjct  470   EDLFKPSKIPNPHFQRLYQCLQHKAFHSDKPLPPIEQHLLEMLEMPCVVRERCQAPLERV  529

Query  1643  RRCFEL-------------------KDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE  1765
             +  F L                   +D P +KK         P   DEE   +  K+   
Sbjct  530   KALFPLKEVGKKKEEKTAQDIFKDNEDEPSLKK---------PKIEDEEEGFSLMKLAEG  580

Query  1766  KI---GNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVA  1936
              I   G++NP +DF  ++ ++++        Q++KN+I   +EN      Y K ++C+ A
Sbjct  581   NITSVGSVNPAEDFRILVRKKNAD--FKDVSQQLKNRIDQFLENK-GSQYYMKGIDCIRA  637

Query  1937  LRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEA  2116
              R   +   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V   EA
Sbjct  638   FREEAMKLSKVQCFNDFLQALKSKLEDKALSDFWEIMVQERISLITKDEAEGSLVTGEEA  697

Query  2117  RSFMT  2131
               F+ 
Sbjct  698   EKFLA  702



>ref|XP_008643055.1| PREDICTED: X-ray repair cross-complementing protein 5 [Corvus 
brachyrhynchos]
Length=709

 Score =   208 bits (529),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 195/698 (28%), Positives = 330/698 (47%), Gaps = 74/698 (11%)
 Frame = +2

Query  185   LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDD  364
             L + +K+ +  V++++     DEV V+LFGT  T N+L  E   Y+++TV RS+K+ D D
Sbjct  12    LDQAKKIMTKFVQRQVFAESKDEVAVVLFGTNGTRNDLASEDQ-YQNITVHRSLKLPDFD  70

Query  365   LLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGT  541
             LL+ ++ + + GS   DFLDA+IV MD++ K+       K+ + L T+   P+       
Sbjct  71    LLEDIQDVIKAGSEQADFLDAIIVCMDLLQKETIGKKYEKRHIELFTDLSSPVS------  124

Query  542   KEDQVSTIAAQMKAHGMRMD------------------SVIVRM------KQDL-DAEKG  646
              EDQ+  I A +K  G+ +                   SV   M      ++DL + +K 
Sbjct  125   -EDQLGIIIANLKKTGISLQFFLPFSVGVDDGSGDTSASVHAHMHRNSFPRKDLTEQQKQ  183

Query  647   IIDENDFLLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTLYRGDFELSTKLK  811
              ID    L+    +E   +  Y    +    S+   I  ++I  P  L  G       L 
Sbjct  184   GIDVVRKLMYTLDEEGGLEEIYTFRESLERLSMFKKIERKSIPWPCQLTIG-----PNLS  238

Query  812   IKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGY  991
             I++  YK  +EER   L    D         K ++     Y +  D   +V  +  I+G+
Sbjct  239   IRIVAYKSVTEERVKKLWTIVD----AKTLRKEDVQKETVYCLNDDDETEVQKDDTIQGF  294

Query  992   RYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDANV-FIADPENSKAI  1165
             RYG  +VP S  + E +K+K E K   +LGFT +S I RHYYM +  +   A  ++  A 
Sbjct  295   RYGSDIVPFSKEDEEQMKYKTEGKCFSVLGFTRSSQIQRHYYMGNQALKVFAAKDDKNAA  354

Query  1166  LAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDV  1345
             +A SAL RA+ ++  VAIVR  + + +    +GV  P + D     + L +  LP+ ED+
Sbjct  355   VAFSALVRALDELKVVAIVRYAYDR-RCYPQVGVAFPYIKD---AYECLIYVQLPYMEDL  410

Query  1346  REFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQ---EALLPEFTPNPVLQRYY  1516
             R++ F S  N     +P   Q  A D+L+  ++L   D +   +   P   PNP  QR+Y
Sbjct  411   RQYVFSSLKN-SKKCIPTADQLSAVDSLIDSMNLVHEDGETFEDLFKPSKIPNPHFQRFY  469

Query  1517  HYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPK-------  1675
               L+ K+ H +  +PP+++ L  + +    +  + +  +++ +  F LK+  K       
Sbjct  470   QCLQHKAFHPNKPLPPIEQHLLEMLEMPCVVRERCQAPLEKVKTLFPLKEVGKKKEEKTV  529

Query  1676  ---MKKSRKRLIREKPTGSDEEGERASTKVKSEKI---GNINPVQDFEDMISRRDSPEWV  1837
                +K +      +KP   DEEG  +  K+    I   G++NP +DF  ++ ++++    
Sbjct  530   QDILKDNEDEPSLKKPKIEDEEGSFSIMKLAEGNITSVGSVNPAEDFRVLVRKKNAD--F  587

Query  1838  NKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKE  2017
                 Q++ N+I   +EN      Y K ++C+   R   +   + + FND L+ L +  ++
Sbjct  588   KDVSQQLINRIDQFLENK-GSQYYMKGIDCIRVFREEAMKLSKVQCFNDFLQALKSKLED  646

Query  2018  KDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             K L  F   +    I+LITK EA +S V   EA  F+ 
Sbjct  647   KALADFWDIMIQDRISLITKDEAEESSVTGEEAEKFLA  684



>ref|XP_005279951.2| PREDICTED: X-ray repair cross-complementing protein 5 [Chrysemys 
picta bellii]
Length=731

 Score =   208 bits (530),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 195/733 (27%), Positives = 337/733 (46%), Gaps = 90/733 (12%)
 Frame = +2

Query  122   MARN--REGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR   +  ++L +DVG +M    P       + +K+ ++ V++++     DEV V+LFG
Sbjct  1     MARGGGKAAIVLCMDVGFAMSNSAPGEESPFEQAKKMMTMFVQRQVFAESKDEVSVVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMI  451
             T  TAN L      Y+++TV R + + D DLL+ ++   + GS   DFLDA++V MD++ 
Sbjct  61    TDGTANTLASGDQ-YQNITVQRHLMLPDFDLLEDIQNAVQPGSEQADFLDALVVCMDLLQ  119

Query  452   KKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDL  631
             K+       K+ + + T+   P         EDQ+  I A +K  G+   S+   +   +
Sbjct  120   KETIGKKYEKRHIEVFTDLSSPFS-------EDQLEIIIANLKKTGI---SLQFFLPFPV  169

Query  632   DAEKGIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIA--------PVTLYRGD  787
             D  +G  D  D   S   + +  +    E     +  +R    A         +  +R  
Sbjct  170   DDGEGSGDTGDGRHSDMYRNSFPRKGLTEQQKEGICMVRKLMFALEEEGGLDEIYTFRES  229

Query  788   FE--------------------LSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAK  907
              E                    + + L I++  YK  +EE+        D         K
Sbjct  230   LERLSMFKKIERRPMAWPCQLTIGSNLSIRIVAYKSLAEEKLKKSWTVVD----AKTLKK  285

Query  908   HEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFT  1084
              ++     Y +  D   +VP +  ++G+RYG  +VP S  + E +K+K E K   +LGF+
Sbjct  286   DDVQKETVYCLNDDDETEVPKDDLVQGFRYGSDIVPFSKVDEEQMKYKTEAKCFSVLGFS  345

Query  1085  DASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVT  1258
              +S I RH+YM +    VF A  + + A+ A+SAL  A+ +++ VAIVR  + + + N  
Sbjct  346   RSSQIQRHHYMGNQVLKVFAAKDDEAAAV-ALSALIHALDELDVVAIVRYAYDR-RSNPQ  403

Query  1259  IGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKM  1438
             +GV  P + D     + L +  LPF ED+R++ F S  N      P E Q  A D+L+  
Sbjct  404   VGVAFPCIKD---AYECLIYVQLPFMEDLRQYMFSSLKN-NKKYTPTEDQLSAVDSLIDS  459

Query  1439  LDLAPSD-----SQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDP  1603
             + L   D     +++       PNP  QR Y  L+ K+ H D  +PP+++ L  + +   
Sbjct  460   MSLVYEDDDGETTEDIFKTSKIPNPQFQRLYQCLQHKAFHPDKPLPPIEQHLLEMLEIPQ  519

Query  1604  ELLSQNKTVVDEFRRCFELKDNPKMK--KSRKRLIRE---------KPTGSDEEGERAST  1750
             E+  + +  +++ +  F LKD  K K  K+ + + ++         K    +EEG  +  
Sbjct  520   EVRERCQAPLEKIKALFPLKDAGKKKEQKTAQDVFKDNNEDGPSTKKANAENEEGSFSIA  579

Query  1751  KVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQ  1912
              +       +G+INP ++F  ++ ++      N   +E+  ++   +E  LE      Y 
Sbjct  580   NLAEGNVTTVGSINPAENFCVLVRQK------NANFKEVSQQLVNRIEQFLETKGLQYYM  633

Query  1913  KALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPD  2092
             K++ C+   R   I   E   FND L++L    +++ L  F + L   GI+LITK EA  
Sbjct  634   KSINCIRVFREEAIKLSEVLCFNDFLQSLKEKVEDQTLADFWEILIQDGISLITKDEAEG  693

Query  2093  SDVLESEARSFMT  2131
             S V   EA+ F+ 
Sbjct  694   SSVTSDEAKKFLA  706



>ref|XP_005237741.1| PREDICTED: X-ray repair cross-complementing protein 5 [Falco 
peregrinus]
Length=768

 Score =   208 bits (529),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 203/731 (28%), Positives = 335/731 (46%), Gaps = 89/731 (12%)
 Frame = +2

Query  122   MARN-REGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgt  277
             MAR  +  ++L +DVG +M    P       + +K+    V++++     DEV V+LFGT
Sbjct  1     MARGGKVAIVLCLDVGFTMSSSAPGEESSLEQAKKIMMKFVQRQVFAESKDEVAVVLFGT  60

Query  278   tetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIK  454
               T N L      Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K
Sbjct  61    DATRNNLASGDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQK  119

Query  455   KYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLD  634
             +       K+ + L T+   P+        EDQ+  I A +K  G+ +    +    D+D
Sbjct  120   ETIGKKYEKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGISL-QFFLPFPADVD  171

Query  635   AE-------KGIIDENDF------------------LLSVFSKETSSKAAYVESAT----  727
                      +  +  N F                  L+    +E   +  Y  S +    
Sbjct  172   GGGDTSAYVRSHVHRNSFPRKALTKQQKEGIDVVRKLMHTLDQEGGLEEIYTFSESLERL  231

Query  728   SLMGAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFA  904
             S+   +  R +A P  L  G     + L I++  YK  +EE+   +    D         
Sbjct  232   SMFKKMERRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVKKIWTVVD----AKTLR  282

Query  905   KHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGF  1081
             K ++     Y +  D   +V  E  I+G+RYG  +VP S  + E +K+K E K   +LGF
Sbjct  283   KDDVQKETVYCLNDDDETEVQKEDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGF  342

Query  1082  TDASNIMRHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             + +S I RHYYM +    VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N
Sbjct  343   SRSSQIQRHYYMGNQVLKVFAAKDDEN--AAVAFSALVHALNELKVVAIVRYAYDR-RSN  399

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
               IG   P + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+
Sbjct  400   PQIGAAFPYIKD---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKCIPTADQLSAVDSLI  455

Query  1433  KMLDLAPSDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDP  1597
               ++L   D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + + 
Sbjct  456   DSMNLVYEDDDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQRLLEMLEM  515

Query  1598  DPELLSQNKTVVDEFRRCFELKDNPK----------MKKSRKRLIREKPTGSDEEGERAS  1747
                +  + +  +++ R  F LK+  K           K +    I +KP   DEEG    
Sbjct  516   PCVVKERCQAPLEKVRALFPLKEVVKKKEEKTAQDIFKDNEDGPIPKKPKIEDEEGSFTI  575

Query  1748  TKVKSEKI---GNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKA  1918
              K+    I   G++ P +DF  ++ ++++        Q++ N+I   +EN      Y K 
Sbjct  576   MKLAEGNITSVGSVKPAEDFRILVRQKNTN--FEDVSQQLINRIDQFLENK-GSQYYMKG  632

Query  1919  LECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSD  2098
             + C+   R   +   + K FND L+ L +  ++K L  F + +    I+LITK EA +S 
Sbjct  633   INCIRVFREEAMKLSKVKCFNDFLQALKSKVEDKSLADFWEIMIQDRISLITKDEAEESS  692

Query  2099  VLESEARSFMT  2131
             V   EA  F+ 
Sbjct  693   VTTEEAEKFLA  703



>gb|KFW80172.1| X-ray repair cross-complementing protein 5, partial [Manacus 
vitellinus]
Length=718

 Score =   207 bits (528),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 198/730 (27%), Positives = 336/730 (46%), Gaps = 104/730 (14%)
 Frame = +2

Query  146   ILVIDVG-------PSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelte  304
             +L +DVG       P     L + +KV +  V++++     DEV V+LFGT  T N L  
Sbjct  3     VLCLDVGFTMSNSSPGEESSLEQAKKVMTKFVQRQVFAESKDEVAVVLFGTHGTRNGLAS  62

Query  305   elggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGK  481
                 Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+       K
Sbjct  63    GDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKYEK  121

Query  482   KRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------SV  607
             + + L T+   P+        EDQ+  I A +K  G+ +                   SV
Sbjct  122   RHIELFTDLNSPVS-------EDQLEIIIANLKKTGISLQFFLPFQVGIDDGSGDTTASV  174

Query  608   IVRMKQD-------LDAEKGIIDENDFLLSVFSKETSSKAAYVESAT----SLMGAIRTR  754
                M ++        + +K  ID    L+    +E   +  Y    +    S+   I  R
Sbjct  175   HSHMHRNSFPIKSLTEQQKRGIDVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIERR  234

Query  755   NIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYE  931
              +  P  L  G     + L I++  YK  +EE+   +    D         + ++     
Sbjct  235   PMPWPCQLTIG-----SNLSIRIVAYKAVTEEKVKKIWTVVD----AKTLRRDDVQKETV  285

Query  932   YKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRH  1108
             Y +  D   +VP +  I+G+RYG  +VP S  + E +K+K E K   +LGFT +S I RH
Sbjct  286   YCLNDDDETEVPKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEGKCFSVLGFTRSSQIQRH  345

Query  1109  YYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNV  1282
             YYM +    VF A  + + A+ A SAL RA+ ++  VAIVR  + + + N  IGV  P +
Sbjct  346   YYMGNQVLKVFAAKGDENAAV-AFSALVRALDELKVVAIVRYAYDR-RSNPQIGVAFPYI  403

Query  1283  SDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS  1462
              +     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   D 
Sbjct  404   KE---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKCIPTVDQLSAVDSLIDSMNLVYEDG  459

Query  1463  Q---EALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVV  1633
             +   +   P   PNP  QR Y  L+ K+ H D  +PP+++ L  + +    +  + +  +
Sbjct  460   ETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPDKPLPPIEQHLLDMLEMPSVVKERCQAPL  519

Query  1634  DEFRRCFEL--------------------KDNPKMKKSRKRLIREKPTGSDEEG----ER  1741
             +  +  F L                    +D P++KK +        T  +EEG    + 
Sbjct  520   ERVKALFPLKEVGKKKEEKTAQDIFKDNSEDEPRLKKPK--------TEDEEEGFSILKL  571

Query  1742  ASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKAL  1921
             A   + S  +G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K +
Sbjct  572   AEGNITS--VGSVNPAEDFRILVRKKNAD--FKDVSQQLINRIDQFLENK-GSQYYMKGI  626

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
             +C+   R   +   + + FND LR L +  ++K L  F + +    I+LI+K EA +S V
Sbjct  627   DCIRVFREEAMKLSKVQCFNDFLRALKSKLEDKALADFWEIMIQDRISLISKDEAQESSV  686

Query  2102  LESEARSFMT  2131
                EA+ F+ 
Sbjct  687   TSEEAQKFLA  696



>gb|EPZ30967.1| Ku70/Ku80 beta-barrel domain-containing protein [Rozella allomycis 
CSF55]
Length=729

 Score =   207 bits (528),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 184/685 (27%), Positives = 320/685 (47%), Gaps = 70/685 (10%)
 Frame = +2

Query  200   KVCSVLVEKKLIYS-KYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDDLLQA  376
             K  SV++++KL+ + K D++ +IL GT ET N+L E+   Y+++ V +  + +D   ++ 
Sbjct  28    KAYSVMIQQKLMDARKSDQLALILTGTNETDNDLAEDSSSYQNIVVAKEFQSIDMSFIRY  87

Query  377   LE--QLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKK---RLCLITNAMCPIKDPYEGT  541
             +    L  G+ + D +DA++V  DM+IKK     KGKK   ++ L+T+A  P+       
Sbjct  88    INDPNLELGNQEADCIDAIVVATDMLIKK----TKGKKFTRKIYLLTDANGPVN------  137

Query  542   KEDQVSTIAAQMKAHGMRMDSVI---------VRMKQDLDAEKGIIDENDFLLSVFSKET  694
               D  + I  +MKA  +++ +VI         +   + L+ E     ++   +    KE 
Sbjct  138   -MDGFTDIVGEMKALEIQL-TVIGFGFHTEEELETMESLEQEMSGCQQSQLAMYKLVKEV  195

Query  695   SSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYS  874
               +   +  A  ++   R++ +  VT +RG+  +   ++I +++Y ++++   PT K  S
Sbjct  196   DGQVLPINEALQILSHFRSKTVRQVTTFRGNLSIGKSIQIPIFMYTQSTQRTLPTAKKGS  255

Query  875   DKAPPTDKFAKH--EITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKF  1048
               +  +++      E+  +  Y    + +  V  EQ +K YRYG  +VP + +E +A+  
Sbjct  256   AISMQSEEIKDKTMEVIRNTSYFTKDEASDVVEKEQLVKAYRYGKTLVPFNESEEKAMSL  315

Query  1049  KPEKGVKLLGFTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRC  1228
             +  KG++++GF   + I R  +M         PE  +A +++S+   AM + +  AI R 
Sbjct  316   ETSKGLEIIGFVPVTEIDRESFMGSTYAVTCHPEIVEAQVSLSSFIHAMFEKDACAIARY  375

Query  1229  VWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQ  1408
             V R    +  +  L P++  +    + L  N LPF+EDVR F FP    LP   +  EQ 
Sbjct  376   V-RHDNASPKLVCLMPHIKAE---KECLIMNILPFSEDVRRFTFP---GLPKEEMTAEQS  428

Query  1409  QEAADNLVKMLDLAPS------DSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLD  1570
               A D  +  +DL  +      D  E   P  T N   Q  Y  ++ +  H D  +  LD
Sbjct  429   N-AFDEWMGSMDLMTAARDEDGDPMELFKPRDTYNVAYQAVYQAIQERVLHPDKPLKELD  487

Query  1571  EILRRITDPDPELLSQNKTVVDEFR------------------RCFELKDNPKMKKSRKR  1696
             E L +   P    L   K     F                   R F   D  +++KS + 
Sbjct  488   EELIKHISP----LESKKAAESAFTLHNLYKLEMVEKEEAPAARIFASNDFEELEKSLEG  543

Query  1697  LIREKPTGSDEEGERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFY  1876
             +   +P    E+    S   +   +G  +P+ DF  MI+ R   + V+KAI+EM   I  
Sbjct  544   V---RPGDVTEKSLADSISAEISSVGTADPIGDFNSMINNRKR-DLVSKAIKEMSEMIIK  599

Query  1877  LVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLR-SFCKQLES  2053
             +V  S     Y KA EC+VALR G + EQE ++FN+ L  L +S K    R  F + +++
Sbjct  600   IVNESFGDQMYAKACECVVALRKGSVQEQEWEEFNNYLGKLKSSFKGSKRRDGFWQVIKA  659

Query  2054  HGIALITKTEAPDSDVLESEARSFM  2128
               I+LI+  E   S +   E   F+
Sbjct  660   KEISLISSIECGSSSISPEEKSKFL  684



>ref|XP_004478743.1| PREDICTED: X-ray repair cross-complementing protein 5-like [Dasypus 
novemcinctus]
Length=732

 Score =   206 bits (525),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 202/734 (28%), Positives = 345/734 (47%), Gaps = 93/734 (13%)
 Frame = +2

Query  122   MAR--NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR  N+  ++L +DVG +M    P       + +KV ++ V++++     DE+ ++LFG
Sbjct  1     MARSGNKAAVVLCMDVGFAMSNSFPGEESPFEQAKKVMTMFVQQQVFAESKDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALEQ-LPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  E   Y+++TV R +K+ D DLL  ++  +  GS   DFLDA+IV MD+ I
Sbjct  61    TDGTDNALASEDQ-YQNITVHRHLKLPDFDLLLDIKSTIQPGSQQADFLDALIVCMDV-I  118

Query  452   KKYGITNKGKKR-LCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQD  628
             ++  I  K +KR + + T+   P         +DQ+  I   +K  G+   S+   +   
Sbjct  119   QQETIGKKFEKRHIEVFTDLSSPFS-------KDQLDIIIYNLKKSGI---SLQFFLPFQ  168

Query  629   LDAEKGIIDENDFLLSVFSKETSSKAAYVES----------------------------A  724
             +  E G  D  D  L +    +SS    +                              +
Sbjct  169   IGKEDGTGDRGDSNLHLDQHGSSSPQKGITEQQKEGIQMVKKVMMSLEGEDGLDEIYSFS  228

Query  725   TSLMGAIRTRNIAPVTL-YRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKF  901
              SL   +  + I+  +L +     + + L IK+  YK   +E+    K +S     T K 
Sbjct  229   ESLQQLVVFKKISKCSLPWSCQLTIGSNLSIKISAYKSILQEKLR--KTWSVVDARTLK-  285

Query  902   AKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLG  1078
              K +I     Y +  D   +VP E  I+GYRYG  +VP S  + E +K+K E K   +LG
Sbjct  286   -KEDIQKETVYCLNDDDETEVPKEDTIQGYRYGSDIVPFSKVDEEQMKYKSEGKCFSVLG  344

Query  1079  FTDASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             F  +S + R ++M +    VF A  + + A+ A+SAL  A+  ++ VAIVR  + + + N
Sbjct  345   FCRSSQVQRKFFMGNQVLKVFAAKDDEAAAV-ALSALIHALDQLDMVAIVRYAYDK-RAN  402

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
               +GV  P + D     + L +  LPF ED+R++ F S  N      P E Q  A D+L+
Sbjct  403   PQVGVAFPYIKD---TYECLVYVQLPFMEDLRQYMFSSLKN-NKKFTPTEAQLSAVDDLI  458

Query  1433  KMLDLAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDP  1597
               + L   + +E  + +       PNP  QR +  L  +  H    +PP+ + +  + +P
Sbjct  459   DSMSLIKKNEEENTIEDLFAVTKIPNPQFQRLFQCLLHRVLHSQEPLPPIQQHILNMLNP  518

Query  1598  DPELLSQNKTVVDEFRRCFELKDNPKMKK--SRKRLIREK----PTGS---DEEGE-RAS  1747
               E+ ++ +  + + +  F L D  K K   + + + ++K    PT      EEGE R S
Sbjct  519   PTEVTTRCQIPLSKIKTLFPLTDAIKKKDQMTAQDIFQDKNEDGPTSKKYKTEEGEVRFS  578

Query  1748  TKVKSE----KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---  1906
                 +E     +G++NP ++F  ++ ++      N   +E+ +++   +E  LE +    
Sbjct  579   ISSLAEGSVTSVGSVNPAENFHVLVRQK------NANFEEVSHQLISHIEQFLETNETPY  632

Query  1907  YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEA  2086
             + K+++C+ A R   I   E ++FN+ L+ L    + K L  F + +   GI LITK EA
Sbjct  633   FMKSMDCIRAFREEAIQFSEEQRFNNFLKALREKVEMKQLNHFWEIVIQDGITLITKDEA  692

Query  2087  PDSDVLESEARSFM  2128
               S V   EA+ F+
Sbjct  693   SGSTVTAEEAQKFL  706



>ref|XP_005443001.1| PREDICTED: X-ray repair cross-complementing protein 5 [Falco 
cherrug]
Length=824

 Score =   207 bits (527),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 201/734 (27%), Positives = 334/734 (46%), Gaps = 99/734 (13%)
 Frame = +2

Query  128   RNREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttet  286
             +++  ++L +DVG +M    P       + +K+    V++++     DEV V+LFGT  T
Sbjct  59    KSQVAIVLCLDVGFTMSSSAPGEESSLEQAKKIMMKFVQRQVFAESKDEVAVVLFGTDAT  118

Query  287   anelteelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYG  463
              N L      Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+  
Sbjct  119   RNNLASGDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETI  177

Query  464   ITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAE-  640
                  K+ + L T+   P+        EDQ+  I A +K  G+ +    +    D+D   
Sbjct  178   GKKYEKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGISL-QFFLPFPADVDGGG  229

Query  641   ------KGIIDENDF------------------LLSVFSKETSSKAAYVESAT----SLM  736
                   +  +  N F                  L+    +E   +  Y  S +    S+ 
Sbjct  230   DTSAYVRSHVHRNSFPRKALTKQQKEGIDVVRKLMHALDQEGGLEEIYTFSESLERLSMF  289

Query  737   GAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHE  913
               +  R +A P  L  G     + L I++  YK  +EE+   +    D         K +
Sbjct  290   KKMERRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVKKIWTVVD----AKTLRKDD  340

Query  914   ITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDA  1090
             +     Y +  D   +V  E  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +
Sbjct  341   VQKETVYCLNDDDETEVQKEDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRS  400

Query  1091  SNIMRHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTI  1261
             S I RHYYM +    VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N  I
Sbjct  401   SQIQRHYYMGNQVLKVFAAKDDEN--AAVAFSALVHALNELKVVAIVRYAYDR-RSNPQI  457

Query  1262  GVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKML  1441
             GV  P + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  +
Sbjct  458   GVAFPYIKD---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKCIPTADQLSAVDSLIDSM  513

Query  1442  DLAPSDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPE  1606
             +L   D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    
Sbjct  514   NLVYEDDDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQRLLEMLEMPCV  573

Query  1607  LLSQNKTVVDEFRRCFEL----------------KDNPKMKKSRKRLIREKPTGSDEEGE  1738
             +  + +  +++ R  F L                KDN +   + K     KP   DEEG 
Sbjct  574   VKERCQAPLEKVRALFPLKEVVKKKEEKTAQDIFKDNSEDGPNPK-----KPKIEDEEGS  628

Query  1739  RASTKVKSEKI---GNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTY  1909
                 K+    I   G++ P +DF  ++ ++++        Q++ N+I   +EN      Y
Sbjct  629   FTIMKLAEGNITSVGSVKPAEDFRILVRQKNTN--FEDVSQQLINRIDQFLENK-GSQYY  685

Query  1910  QKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAP  2089
              K + C+   R   +   + K FND L+ L +  ++K L  F + +    I+LITK EA 
Sbjct  686   MKGINCIRVFREEAMKLSKVKCFNDFLQALKSKVEDKSLADFWEIMIQDRISLITKDEAE  745

Query  2090  DSDVLESEARSFMT  2131
             +S V   EA  F+ 
Sbjct  746   ESSVTTEEAEKFLA  759



>ref|XP_009994539.1| PREDICTED: X-ray repair cross-complementing protein 5 [Chaetura 
pelagica]
Length=710

 Score =   206 bits (524),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 194/701 (28%), Positives = 327/701 (47%), Gaps = 79/701 (11%)
 Frame = +2

Query  185   LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDD  364
             L + +KV +  V++++     DEV V+LFGT +T N L      Y+++TV RS+ + D D
Sbjct  12    LEQAKKVMTKFVQRQVFAESKDEVAVVLFGTDDTRNGLASGDQ-YQNITVHRSLMLADFD  70

Query  365   LLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGT  541
             LL+ +E + + GS   DFLDA+IV MD++ K+       K+ + + T+   P+       
Sbjct  71    LLKDIEDVIKPGSEQADFLDAIIVCMDLLQKETIGKKYEKRHIEVFTDLSSPVS------  124

Query  542   KEDQVSTIAAQMKAHGMRMDSVI-----------------VRMKQDLDAEKGI-------  649
              EDQ+  I A +K  G+ +   +                   M ++    KG+       
Sbjct  125   -EDQLEIIIANLKKTGISLQFFLPFTVDVDDGGGDASARCSEMHRNYFPRKGLTQKQKEG  183

Query  650   IDENDFLLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTLYRGDFELSTKLKI  814
             ID    L+    +E   +  Y    +    S+   I  R  A P  L  G     + L I
Sbjct  184   IDVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIERRPTAWPCQLTIG-----SNLSI  238

Query  815   KVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYR  994
             ++  YK  +EE+   +    D         K ++     Y +  D   +V  +  ++G+R
Sbjct  239   RIVAYKSVTEEKLKKVWTVVD----AKTLKKDDVQRETVYCLNDDDETEVQKDDTLQGFR  294

Query  995   YGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA-DPENSKA  1162
             YG  +VP S  + E +K+K E K   +LGF+ +S I RHYYM +    VF A D EN  A
Sbjct  295   YGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHYYMGNQVLKVFAAKDDEN--A  352

Query  1163  ILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAED  1342
              +A SAL  A+ ++N VA+VR  + + + N  +GV  P + D     + L +  LP+ ED
Sbjct  353   AVAFSALVHALDELNVVAVVRYAYDR-RCNPQVGVAFPYIKD---AYECLIYVQLPYMED  408

Query  1343  VREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLPEFTPNPVLQ  1507
             +R++ F S  N     +P   Q  A D+L+  ++L   D      ++   P   PNP  Q
Sbjct  409   LRQYIFSSLKN-NKKCIPTVDQLSAVDSLIDSMNLVYEDDDGESFEDLFKPSKIPNPHFQ  467

Query  1508  RYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKK-  1684
             R Y  L+ K+ H +  +PP++  L  + +    +  + +  +++ +  F LK+  K K+ 
Sbjct  468   RLYQCLQHKAFHPNDPLPPVEPHLLEMLEIPRVVKERCQATLEKVKALFPLKEVGKKKEE  527

Query  1685  -SRKRLIRE--------KPTGSDEEGERASTKVKS---EKIGNINPVQDFEDMISRRDSP  1828
              + + + ++        KP   DEEG  +  K+       +G++NP +DF  ++ +R + 
Sbjct  528   MTAQDIFKDNEDGPNAKKPKLEDEEGSFSIMKLAEGNVTSVGSVNPAEDFRILVRQRSAD  587

Query  1829  EWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYAS  2008
                    Q++ N+I   +EN      Y K + C+   R   I   + + FND L+ L + 
Sbjct  588   --FKDVSQQLINRIDQFLENK-GSQYYMKGINCIRVFREEAIKLSKVQCFNDFLQALKSK  644

Query  2009  CKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
              ++K L  F + +    I+LITK EA  S V   EA  F+ 
Sbjct  645   VEDKALADFWEIMIQDRISLITKDEAEGSSVTSEEAEKFLA  685



>ref|XP_010142399.1| PREDICTED: X-ray repair cross-complementing protein 5, partial 
[Buceros rhinoceros silvestris]
Length=707

 Score =   206 bits (523),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 195/709 (28%), Positives = 334/709 (47%), Gaps = 80/709 (11%)
 Frame = +2

Query  164   GPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRS  343
              P     L + +K+ +  V++++     DEV V+LFGT  T N+L      Y+++TV RS
Sbjct  5     APGEESALEQAKKIMTKFVQRQVFAESKDEVAVVLFGTDGTRNDLASGDQ-YQNITVHRS  63

Query  344   IKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPI  520
             + + D DLL+ ++ + + GS   DFLDA+IV MD++ K+       K+ + L T+   P+
Sbjct  64    LMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKYEKRHIELFTDLSSPV  123

Query  521   KDPYEGTKEDQVSTIAAQMKAHGMRMD------------------SVIVRMKQDLDAEKG  646
                     EDQ++ I   +K  G+ +                   S    M ++  A+KG
Sbjct  124   S-------EDQLAIIVDNLKKTGISLQFFLPFPMDVDDGDGDKSASAHSHMPRNSFAKKG  176

Query  647   I-------IDENDFLLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTLYRGDF  790
             +       ID    L+    +E   +  Y    +    S+   I  R +A P  L  G  
Sbjct  177   LTAQQKEGIDVVRKLMHNLDEEGGLEEIYTFRESLERLSMFKKIERRPMAWPCQLTIG--  234

Query  791   ELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPP  970
                + L I++  YK  +EE+    KM++     T +  K ++     Y +  D   +V  
Sbjct  235   ---SNLSIRIVAYKSVTEEKVK--KMWTVVDAKTHR--KDDVRKETVYCLNDDDETEVQK  287

Query  971   EQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA  1141
             +  I+G+RYG  +VP S  + E +K+K E K   +LGFT +S I  HYYM +    VF A
Sbjct  288   DDTIQGFRYGSDIVPFSKEDEEHMKYKTESKCFSVLGFTRSSQIQGHYYMGNQVLKVFAA  347

Query  1142  -DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYF  1318
              D EN  A +A SAL  A+ ++  VAIVR  + + + N  +GV  P + D     + L +
Sbjct  348   KDDEN--AAVAFSALVNALDELKVVAIVRYAYDR-RSNPQVGVAFPYIKD---AYECLIY  401

Query  1319  NALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLPE  1483
               LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   D      ++   P 
Sbjct  402   VQLPYMEDLRQYVFSSLKN-NKKCIPTADQLSAVDSLIDSMNLVSEDDDGETFEDLFKPS  460

Query  1484  FTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELK  1663
               PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  + +  +++ +  F LK
Sbjct  461   KIPNPYFQRLYQCLQHKAFHPNDPLPPVEKHLSEMLEMPCVVKERCQAPLEKVKALFPLK  520

Query  1664  --DNPKMKKSRKRLIRE--------KPTGSDEEGERASTKVKS---EKIGNINPVQDFED  1804
               D  K +K+ + + ++        KP   DEE   +  K+       +G++NP +DF  
Sbjct  521   EVDKRKPEKTAQDIFKDNEDGPNSKKPKIEDEESSFSILKLAEGNVTSVGSVNPAEDFRI  580

Query  1805  MISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFND  1984
             ++ ++++        +++ N+I   +EN      Y K + C+   R   +   + + FND
Sbjct  581   LVRQKNAD--FKDVSKQLTNRIDQFLENK-GSQYYMKGINCIRVFREEAVKRSKARCFND  637

Query  1985  LLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
              L+ L    ++K L  F + +    I+LITK EA +S V   EA  F+ 
Sbjct  638   FLQTLKLKVEDKALADFWEIMIQDRISLITKDEAGESSVTSEEAEKFLA  686



>ref|XP_005520033.1| PREDICTED: X-ray repair cross-complementing protein 5 [Pseudopodoces 
humilis]
Length=727

 Score =   206 bits (523),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 202/728 (28%), Positives = 332/728 (46%), Gaps = 97/728 (13%)
 Frame = +2

Query  140   GLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M    P       + +K+ +  V++++     DEV V+LFGT  T N+L
Sbjct  8     AIVLCLDVGLTMSSSSPGEESSLEQAKKIMTKFVQRQVFAESKDEVAVVLFGTNGTRNDL  67

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
             + E   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  68    SSEDQ-YQNITVHRSLMLPDFDLLEDIQDVIKAGSKQADFLDAIIVCMDLLQKQTIGKKY  126

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+        EDQ+  I A +K  G+ +                   
Sbjct  127   EKRHIELFTDLSSPVS-------EDQLGIIIANLKKTGISLQFFLPFPVSVDGGSGDTSA  179

Query  602   SVIVRMKQDLDAEKGI-------IDENDFLLSVFSKETSSKAAYV--ESATSL-MGAIRT  751
             SV   + ++    KG+       ID    L+    +E   +  Y   ES   L M     
Sbjct  180   SVHAHIHRNSFPIKGLTEQQKQGIDVVRKLMYTLDEEGGLEEIYTFRESLERLSMFKKME  239

Query  752   RNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYE  931
             R   P   +     +   L I++  YK  +EER   L    D         K ++     
Sbjct  240   RRPMP---WLCQLTIGPNLSIRIVAYKSVTEERVKKLWTIVD----AKSLRKEDVQKETV  292

Query  932   YKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRH  1108
             Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGFT +S I RH
Sbjct  293   YCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEGKCFSVLGFTRSSQIQRH  352

Query  1109  YYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNV  1282
             YYM +    VF A  + + A+ A SAL RA+ ++  VAIVR  + + + N  IGV  P +
Sbjct  353   YYMGNQALKVFAAKGDENAAV-AFSALVRALDELKVVAIVRYAYDR-RCNPQIGVAFPCI  410

Query  1283  SDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD-  1459
              D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   D 
Sbjct  411   KD---AYECLIYVQLPYMEDLRQYVFSSLKN-SKKCIPTADQLSAVDSLIDSMNLVHEDG  466

Query  1460  --SQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVV  1633
               S++   P   PNP  QR Y  L+ K+ H D  +PP+++ L  + +    +  + +T +
Sbjct  467   ETSEDLFKPSKIPNPHFQRLYQCLQHKAFHPDKPLPPIEQHLLEMLEMPCVVRERCQTPL  526

Query  1634  DEFRRCFEL-------------------KDNPKMKKSRKRLIREKPTGSDEEGERASTKV  1756
                +  F L                   +D P +KK         P   DEE   +  K+
Sbjct  527   QRVKALFPLKEIGKKKEEKTAQDIFKDNEDEPSLKK---------PKIEDEEESFSIMKL  577

Query  1757  KSEKI---GNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALEC  1927
                 I   G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K ++C
Sbjct  578   AEGSITSVGSVNPAEDFRILVRKKNAD--FKDVSQQLINRIDQFLENK-GSQYYMKGIDC  634

Query  1928  LVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLE  2107
             +   R   +   + + FND L+ L +  ++K L  F + +    I+LITK E   S V  
Sbjct  635   IRVFREEAMKLSKVQCFNDFLQALKSKLEDKALSDFWEIMVQDRISLITKDEVEQSSVTG  694

Query  2108  SEARSFMT  2131
              EA  F+ 
Sbjct  695   EEAAKFLA  702



>ref|XP_008937038.1| PREDICTED: X-ray repair cross-complementing protein 5 [Merops 
nubicus]
Length=711

 Score =   206 bits (523),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 191/710 (27%), Positives = 331/710 (47%), Gaps = 82/710 (12%)
 Frame = +2

Query  164   GPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRS  343
              P     L + +K+ +  V++++     DEV V+LFGT +T N+L  E   Y+++T+ RS
Sbjct  5     APGEESSLEQAKKIMTKFVQRQVFAESKDEVAVVLFGTDDTRNDLACEDQ-YQNITIHRS  63

Query  344   IKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPI  520
             + + D DL++ ++ + + GS   DFLDA+IV MD++ K+       KK + L T+   P+
Sbjct  64    LMLPDFDLMEDIQDVIKAGSEQADFLDAIIVCMDLLQKETIGKKYEKKHIELFTDLSSPV  123

Query  521   KDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLSVFSKETSS  700
                     EDQ+  I   +K  G+ +    +    D+D   G     D   SV+S   +S
Sbjct  124   S-------EDQLEIIIDNLKKTGISL-QFFLPFPVDVDDGGG-----DTSTSVWSTHRNS  170

Query  701   --KAAYVESATSLMGAIRT--------RNIAPVTLYRGDFE-------------------  793
               +    E     +  +R           +  V  +R   E                   
Sbjct  171   FPRKGLTEQQKEGINVVRKLMHTLDEEGGLEEVYTFRESLERLSMFKKIERRPMAWPCQL  230

Query  794   -LSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPP  970
              + + L I++  YK  +EE+   +    D         K ++     Y +  D   +V  
Sbjct  231   TIGSNLSIRIVAYKSVTEEKVKKIWTVVD----AKTHRKDDVQRETVYCLNDDDETEVQK  286

Query  971   EQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA  1141
             +  I+G+RYG  ++P S  + E +K+K E K   +LGFT +S I RHYYM +    VF A
Sbjct  287   DDTIQGFRYGSDIIPFSKEDEEQMKYKTEAKCFSVLGFTRSSQIQRHYYMGNQVLKVFAA  346

Query  1142  -DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYF  1318
              D EN  A +A SAL  A+ ++  VAIVR  + + + N  +GV  P++ D     + L +
Sbjct  347   KDDEN--AAVAFSALIHALHELKVVAIVRYAYDR-RCNPQVGVAFPHIKD---AYECLIY  400

Query  1319  NALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLPE  1483
               LPF ED+R++ F S  N     +P   Q  A D+L+  ++L   D      ++   P 
Sbjct  401   VQLPFTEDLRQYLFSSLKN-NKKCIPTADQLSAVDSLIDSMNLVYEDDNGETFEDLFKPS  459

Query  1484  FTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELK  1663
               PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  + ++ +++ +  F LK
Sbjct  460   KIPNPQFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPCVVKERCQSPLEKVKALFPLK  519

Query  1664  DNPKMK--KSRKRLIRE---------KPTGSDEEGERASTKVKS---EKIGNINPVQDFE  1801
             +  K K  K+ + + ++         KP   DEEG  +  K+       +G++NP +DF 
Sbjct  520   EVGKKKEDKTAQDIFKDNSEDGPNPKKPKIEDEEGSFSIVKLAEGSVTSVGSVNPAEDFR  579

Query  1802  DMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFN  1981
              ++ ++++        Q++ N+I   +EN      Y K + C+   R   +     + FN
Sbjct  580   ILVRQKNAD--FRDVSQQLINRIDQFLENK-GSQYYMKGINCISVFREEAMKLSRVQCFN  636

Query  1982  DLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             D L+ L +  ++K L  F + +    I+LI+K EA +S V   EA  F+ 
Sbjct  637   DFLQALKSKVEDKALADFWEIMIQDRISLISKDEAEESSVTSEEAEKFLA  686



>ref|XP_008921156.1| PREDICTED: X-ray repair cross-complementing protein 5 [Manacus 
vitellinus]
Length=710

 Score =   205 bits (522),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 194/717 (27%), Positives = 330/717 (46%), Gaps = 97/717 (14%)
 Frame = +2

Query  164   GPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRS  343
              P     L + +KV +  V++++     DEV V+LFGT  T N L      Y+++TV RS
Sbjct  5     SPGEESSLEQAKKVMTKFVQRQVFAESKDEVAVVLFGTHGTRNGLASGDQ-YQNITVHRS  63

Query  344   IKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPI  520
             + + D DLL+ ++ + + GS   DFLDA+IV MD++ K+       K+ + L T+   P+
Sbjct  64    LMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKYEKRHIELFTDLNSPV  123

Query  521   KDPYEGTKEDQVSTIAAQMKAHGMRMD------------------SVIVRMKQD------  628
                     EDQ+  I A +K  G+ +                   SV   M ++      
Sbjct  124   S-------EDQLEIIIANLKKTGISLQFFLPFQVGIDDGSGDTTASVHSHMHRNSFPIKS  176

Query  629   -LDAEKGIIDENDFLLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTLYRGDF  790
               + +K  ID    L+    +E   +  Y    +    S+   I  R +  P  L  G  
Sbjct  177   LTEQQKRGIDVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIERRPMPWPCQLTIG--  234

Query  791   ELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPP  970
                + L I++  YK  +EE+   +    D         + ++     Y +  D   +VP 
Sbjct  235   ---SNLSIRIVAYKAVTEEKVKKIWTVVD----AKTLRRDDVQKETVYCLNDDDETEVPK  287

Query  971   EQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA  1141
             +  I+G+RYG  +VP S  + E +K+K E K   +LGFT +S I RHYYM +    VF A
Sbjct  288   DDTIQGFRYGSDIVPFSKEDEEQMKYKTEGKCFSVLGFTRSSQIQRHYYMGNQVLKVFAA  347

Query  1142  DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFN  1321
               + + A+ A SAL RA+ ++  VAIVR  + + + N  IGV  P + +     + L + 
Sbjct  348   KGDENAAV-AFSALVRALDELKVVAIVRYAYDR-RSNPQIGVAFPYIKE---AYECLIYV  402

Query  1322  ALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQ---EALLPEFTP  1492
              LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   D +   +   P   P
Sbjct  403   QLPYMEDLRQYIFSSLKN-NKKCIPTVDQLSAVDSLIDSMNLVYEDGETFEDLFKPSKIP  461

Query  1493  NPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL----  1660
             NP  QR Y  L+ K+ H D  +PP+++ L  + +    +  + +  ++  +  F L    
Sbjct  462   NPHFQRLYQCLQHKAFHPDKPLPPIEQHLLDMLEMPSVVKERCQAPLERVKALFPLKEVG  521

Query  1661  ----------------KDNPKMKKSRKRLIREKPTGSDEEG----ERASTKVKSEKIGNI  1780
                             +D P++KK +        T  +EEG    + A   + S  +G++
Sbjct  522   KKKEEKTAQDIFKDNSEDEPRLKKPK--------TEDEEEGFSILKLAEGNITS--VGSV  571

Query  1781  NPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVE  1960
             NP +DF  ++ ++++        Q++ N+I   +EN      Y K ++C+   R   +  
Sbjct  572   NPAEDFRILVRKKNAD--FKDVSQQLINRIDQFLENK-GSQYYMKGIDCIRVFREEAMKL  628

Query  1961  QEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
              + + FND LR L +  ++K L  F + +    I+LI+K EA +S V   EA+ F+ 
Sbjct  629   SKVQCFNDFLRALKSKLEDKALADFWEIMIQDRISLISKDEAQESSVTSEEAQKFLA  685



>gb|KFV63426.1| X-ray repair cross-complementing protein 5, partial [Picoides 
pubescens]
Length=717

 Score =   205 bits (522),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 192/717 (27%), Positives = 336/717 (47%), Gaps = 75/717 (10%)
 Frame = +2

Query  140   GLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M    P       + +K+ +  V++++     DEV V+LFGT  T N+L
Sbjct  1     AVVLCLDVGCTMSSSAPGEESSLEQAKKIMTKFVQRQVFAESKDEVAVVLFGTDGTRNDL  60

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
               E   YE++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  61    ASENQ-YENITVHRSLMLPDFDLLEDIQDMIKPGSEQADFLDAIIVCMDLLQKQTIGKKY  119

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIID  655
              K+ + + T+   P         EDQ+  I A +K  G+ +   +    +  D +     
Sbjct  120   EKRHIEVFTDLKSP-------ASEDQLEIIIANLKKTGISLQFFLPFPVEVGDGDTSASR  172

Query  656   ENDFLLSVFSKE--TSSKAAYVESATSLMGAIRTRN-IAPVTLYRGDFE-----------  793
              +    + F ++  T  + A ++    LM  +     +  +  +R   E           
Sbjct  173   HSHVHRNSFPRKGLTEEQKAGIDMVRKLMHTLDEEGGLEEIYTFRESLERLSVFKKIERR  232

Query  794   ---------LSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQ  946
                      + + L I++  YK  +EE+   +    D         K ++     Y +  
Sbjct  233   PMPWPCQLTIGSNLSIRIVAYKSVTEEKVKKIWTVVD----AKTHRKSDVQKETVYCLND  288

Query  947   DPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKD  1123
             D   +VP +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I RHYYM +
Sbjct  289   DDETEVPKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHYYMGN  348

Query  1124  A--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKG  1294
                 VF A D EN  A +A SAL  A+ ++N VAIVR  + + + N  +G   P + DK 
Sbjct  349   QALKVFAAKDDEN--AAVAFSALVHALDELNMVAIVRYAYDR-RCNPQVGAAFPYIKDKY  405

Query  1295  NVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS----  1462
                + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  + L   D     
Sbjct  406   ---ECLIYVQLPYMEDIRQYIFSSLKN-NKKCIPTADQLSAVDSLIDSMSLICEDDDGET  461

Query  1463  -QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDE  1639
              ++   P   PNP  QR Y  L+ K+ H    +PP++E L  + +    +  + +  +++
Sbjct  462   YEDLFKPSKIPNPHFQRLYQCLQHKAFHPSEPLPPVEEHLLEMLEMPCVVKERCQAPLEK  521

Query  1640  FRRCFELKDNPKMKK--SRKRLIRE--------KPTGSDEEGERASTKVKS---EKIGNI  1780
              +  F LK+  K K+  + + + +E        KP   DE+G  +  K+       +G++
Sbjct  522   IKALFPLKEVGKKKEEKTAQDIFKENEDEPNPKKPKIEDEDGSFSIIKLAEGNVTSVGSV  581

Query  1781  NPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVE  1960
             NP +DF  ++ +++         Q++ N+I   + N      Y K + C+   R   +  
Sbjct  582   NPAEDFRILVRQKNGD--FKDVSQQLINRIDQFLGNK-GSQYYMKGINCIRVFREEAMKL  638

Query  1961  QEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
              + + FND +++L +  ++K L  F + +    I+LITK EA +S V   EA  F+ 
Sbjct  639   SKVQCFNDFMQDLKSKVEDKALADFWEIMVQDRISLITKDEAEESSVTGEEAEKFLA  695



>ref|XP_002897431.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY65174.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=767

 Score =   205 bits (522),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 196/737 (27%), Positives = 326/737 (44%), Gaps = 87/737 (12%)
 Frame = +2

Query  137   EGLILVIDVGPSMHCVLPEIEKVCSV-----------------------LVEKKLIYSKY  247
             E +++++DVG SM   L E   V                          +V++KL +   
Sbjct  12    EAVLVLLDVGASMRAPLRERVSVSDKNRQDTDNDLQHTRFAAALAAVENVVQQKLFFKPK  71

Query  248   DEVGVILFgttet--anelteelggYEHVTVLRSIKVVDDDLLQALEQL-PRGSVDG--D  412
             DEVG++ +G+ +T       +  G Y +V V+ SI      +++ L +L P  S +   D
Sbjct  72    DEVGIVAYGSEDTDNQLNEEQGQGEYRNVQVVNSIDSPTLHMIKRLRELKPSKSEETKVD  131

Query  413   FLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVS---TIAAQMKA  583
              LD +IV +D++ ++     K  KRL +IT+A   I D   G  E  V+    +  Q++ 
Sbjct  132   ILDGIIVALDLLFRRTD-GKKYDKRLLIITDAAAKIADA--GDLESVVTMMQNMEVQLQV  188

Query  584   HGMRMDSVIVRMKQDLDAEKGIIDE---------------NDFLLSVFSKETSSKAAYVE  718
              G+         K D  AE  + DE               N+ +L   + E   + + V 
Sbjct  189   IGLDFQHTTTAKKADEMAETSVKDEPMELATSGPDRVKAENEKMLVSIANEVGGEVSSVS  248

Query  719   SATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDK  898
                 L+     + +A  T +RG  E    L I ++ Y KT     PTL   S  +   +K
Sbjct  249   KRMQLLAQGMKKTVALTTKFRGPLEFGDTLAIPLYCYLKTKTATLPTLSKESQNS--YEK  306

Query  899   FAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLG  1078
                 ++     Y   Q+  ++VPP++++K YRYG + VP +SA+ E  KF+ EK +K LG
Sbjct  307   ETAGKVKLDRRYTSPQNVDQEVPPDEQVKAYRYGSEKVPFASADIEFFKFQTEKSLKALG  366

Query  1079  FTDASNIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVT  1258
             F D S +    ++   +VFIA+P    A    +AL  AM ++++V I R V R+      
Sbjct  367   FLDRSQLNHSKFIAGTDVFIAEPGKPHAATCFAALIDAMVELDQVIIARFVPRKNAAP-K  425

Query  1259  IGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKM  1438
             I  L P+    G    +++   LP+ EDVR ++F           P+ +QQ  AD LV  
Sbjct  426   IVALIPHAPSSGENFYAMWAQQLPYEEDVRNYEFAPLKT--RKYTPSSEQQALADKLVDS  483

Query  1439  LDLAPSDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQ  1618
             L +   D  + +   F  NPV++R++H + M++    A VP L   L      D     +
Sbjct  484   LSIR-DDKADEVGACF--NPVIRRFFHAVSMRALDESAGVPALPSYLESSLKMDSGRQEK  540

Query  1619  NKTVVDEFRRCFELKD--NPKMKKSRKRLIREKPTGS-----------DEEGERASTKVK  1759
               ++++ F   F+LK+       + +K    + PT S           +  G+  S    
Sbjct  541   ISSLIESFGDAFQLKEAVKKAKDRKKKSFWSDVPTASIKEEDLKEENEEATGDAGSDLEL  600

Query  1760  SE----------KIGNINPVQDFEDMI----SRRDSPEWVNKAIQEMKNKIFYLVENSLE  1897
                          +G++NP+ DFE +I    S+    + +  A+  M+ +I  L+  S  
Sbjct  601   DLDDLLDSGDVTSVGSMNPIADFEALIESSQSKLSRRQQLTTAVTGMETQIEKLLSQS-G  659

Query  1898  GDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITK  2077
              + + KA++CL   R      Q   QFN+ L  L     E D  ++ K ++   I LI+ 
Sbjct  660   SEFFPKAMQCLSHFRKRSPEIQYSTQFNEFLTKLKTVLSE-DSEAW-KTVKDADIGLISS  717

Query  2078  TEAPDSDVLESEARSFM  2128
             TE P  DV  +EAR+F+
Sbjct  718   TEDPSVDVSPAEARAFL  734



>ref|XP_009645458.1| PREDICTED: LOW QUALITY PROTEIN: X-ray repair cross-complementing 
protein 5 [Egretta garzetta]
Length=713

 Score =   204 bits (520),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 201/720 (28%), Positives = 332/720 (46%), Gaps = 82/720 (11%)
 Frame = +2

Query  122   MARN-REGLILVIDVGPSM-------HCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgt  277
             MAR+ +  ++L +DVG +M          L + +KV +  V++++     DEV V+LFGT
Sbjct  1     MARSGKAAIVLCLDVGFTMSNSASGEESSLEQAKKVMTKFVQRQVFAESKDEVAVVLFGT  60

Query  278   tetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIK  454
               T NEL      Y+++T+ RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K
Sbjct  61    DGTRNELASGDQ-YQNITIHRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQK  119

Query  455   KYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVI---VRMKQ  625
             +       K+ + L T+   P+        EDQ+  I A +K  G+ +   +   V +  
Sbjct  120   ETIGKKYEKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGISLQFFLPFPVDVDG  172

Query  626   DLDAEKGIIDENDF-----LLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTL  775
               D       +N       L+    +    +  Y    +    S+   I  R +A P  L
Sbjct  173   GGDTSASGCSQNHRNVVRKLMHTLDEGGGLEEIYTFRESLERLSMFKKIERRPMAWPCQL  232

Query  776   YRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPT  955
               G     + L I++  YK  +EE+   +    D         K ++     Y +  D  
Sbjct  233   TIG-----SNLSIRIVAYKSVTEEKVKKVWTLVD----AKTLRKDDVQKETVYCLNDDDE  283

Query  956   KQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--  1126
              +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I RHYYM     
Sbjct  284   TEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHYYMGSHVL  343

Query  1127  NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVP  1303
              VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N  IGV  P + D     
Sbjct  344   KVFAAKDDEN--AAVAFSALVHALDELKVVAIVRYAFDR-RCNPQIGVAFPYIKD---AY  397

Query  1304  DSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QE  1468
             + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   D      ++
Sbjct  398   ECLIYVQLPYMEDLRQYIFSSLKN-NKKCIPTADQLSAVDSLIDSMNLIYEDDDGETFED  456

Query  1469  ALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRR  1648
                P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  + +  +++ + 
Sbjct  457   LFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPVEQHLLEMLEIPHVVKERCQASLEKVKA  516

Query  1649  CFEL----------------KDNPKMKKSRKRLIREKPTGSDEEGERASTKVKS---EKI  1771
              F L                KDN     + K     KP   DEEG  +  K+       +
Sbjct  517   LFPLKEVGKKKEEKTAQDIFKDNSDDGPNPK-----KPKIEDEEGSFSIMKLAEGNVTSV  571

Query  1772  GNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGC  1951
             G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K + C+   R   
Sbjct  572   GSVNPAEDFRILVRQKNTD--FKDVSQQLINRIDQFLENK-GSQYYMKGINCIRVFREEA  628

Query  1952  IVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             I   + + FND LR L +  ++K L    + +    I+LITK EA  S V   EA  F+ 
Sbjct  629   IKLSKVQCFNDFLRALKSKVEDKALADLWEIMIQDRISLITKDEAEGSSVTSEEAEKFLA  688



>ref|XP_009707214.1| PREDICTED: X-ray repair cross-complementing protein 5 [Cariama 
cristata]
Length=709

 Score =   204 bits (519),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 191/706 (27%), Positives = 331/706 (47%), Gaps = 76/706 (11%)
 Frame = +2

Query  164   GPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRS  343
              P     L + +K+ +  V++++     DEV V+LFGT  T N+L      Y+++TV RS
Sbjct  5     APDEEPSLEQAKKIMTKFVQRQVFAESKDEVAVVLFGTDGTRNDLASGDQ-YQNITVHRS  63

Query  344   IKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPI  520
             + + D DLL+ ++ L + GS   DFLDA+IV MD++ K+       K+ + L T+   P+
Sbjct  64    LMLPDFDLLEDIQDLIKPGSEQADFLDAIIVCMDLLQKETIGKKYDKRHIELFTDLSSPV  123

Query  521   KDPYEGTKEDQVSTIAAQMKAHGMRMD------------------SVIVRMKQDLDAEKG  646
                     EDQ+  I A +K  G+ +                   SV   M ++    K 
Sbjct  124   S-------EDQLEIIIANLKKTGISLQFFLPFPVDVDDGGGDTTASVRSHMHRNYFPRKS  176

Query  647   IIDENDFLLSVFSK--ETSSKAAYVESA---------TSLMGAIRTRNIA-PVTLYRGDF  790
             + ++    ++V  K  +T  +   +E            S+   I  R +A P  L  G  
Sbjct  177   LTEQQKEGINVVRKLMQTLDEGGGLEEIYTFRESLERLSMFKKIERRPMAWPCQLTIG--  234

Query  791   ELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPP  970
                + L I++  YK  +EE+   +    D         K ++     Y +  D   +V  
Sbjct  235   ---SNLSIRIVAYKSVTEEKVKKIWTVVD----AKTLKKDDVQKETVYCLNDDDETEVQK  287

Query  971   EQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA  1141
             +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I RHYYM +    VF A
Sbjct  288   DDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHYYMGNQVLKVFAA  347

Query  1142  DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFN  1321
               + + A+ A SAL  A+ ++  VAIVR  + + + N  IGV  P + D     + L + 
Sbjct  348   KGDENAAV-AFSALVHALDELKVVAIVRYAYDR-RCNPQIGVAFPYIKD---AYECLIYV  402

Query  1322  ALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD---SQEALLPEFTP  1492
              LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   D   S++   P   P
Sbjct  403   QLPYMEDLRQYIFSSLKN-NKKWIPTADQLSAVDSLIDSMNLVCDDGETSEDLFKPSKIP  461

Query  1493  NPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNP  1672
             NP  QR Y  L+ K+ H +  +PP+++ L  + +    +  + +  +++ +  F LK+  
Sbjct  462   NPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPCVVKERCQAPLEKVKALFPLKEVG  521

Query  1673  KMK--KSRKRLIREKPTGSD--------EEGERASTKVKS---EKIGNINPVQDFEDMIS  1813
             K K  K+ + + ++   G +        EEG  +  K+       +G++NP +DF  ++ 
Sbjct  522   KKKEDKTAQDIFKDNEGGPNPKKPKIEYEEGTFSIIKLAEGNVTSVGSVNPAEDFRILVR  581

Query  1814  RRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLR  1993
             ++++        Q++ N+I   +EN      Y K + C+   R   +   + + FND L+
Sbjct  582   QKNAD--FKDVSQQLINRIDQFLENK-GSQYYMKGINCIRVFREEAMKLSKVQCFNDFLQ  638

Query  1994  NLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
              L +  ++K L  F + +    I+LIT  EA +S V   EA  F+ 
Sbjct  639   ALKSKMEDKALADFWEIMIQDRISLITNDEAEESSVTSEEAEKFLA  684



>ref|XP_002588418.1| hypothetical protein BRAFLDRAFT_164247 [Branchiostoma floridae]
 gb|EEN44429.1| hypothetical protein BRAFLDRAFT_164247 [Branchiostoma floridae]
Length=716

 Score =   204 bits (519),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 198/700 (28%), Positives = 331/700 (47%), Gaps = 83/700 (12%)
 Frame = +2

Query  140   GLILVIDVGPSM------HCV-LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++LV+DVGP M      H   L   +   S+L+++K+     DEV +IL GT ETANEL
Sbjct  1     AMVLVVDVGPLMAQAPPGHVTPLENAKDAISMLLQRKMFSQSKDEVALILLGTQETANEL  60

Query  299   teel-ggYEHVTVLRSIKVVDDDLLQALEQ-LPRGSVDGDFLDAVIVGMDMMIKKYGITN  472
                    Y ++TV R +   D DLL+ ++  +  G V  DF+DA++V +D++  +     
Sbjct  61    AGTDDESYLNITVARPLGQPDFDLLEFVKNDIVPGPVSADFVDAIVVALDLVRNQTMGKK  120

Query  473   KGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDA-----  637
                KR+ L +N      D       DQ+  +   MKA     + + + +  D +      
Sbjct  121   FETKRIVLFSNLAGEFTD-------DQLEGVINGMKALECEFNLIGLSLDDDDEDGDMPD  173

Query  638   ---------EKGIIDENDFLLSVFSKETSSKAAYVE-SATSLMGAIRTRNI--APVTLYR  781
                      E+         L     E     AY E SA  ++   + RN+  AP   ++
Sbjct  174   QNGAGPPRKERTPQQRAGTALIRHVIEEVDGVAYSERSALQMLSFFQKRNVRAAP---WK  230

Query  782   GDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQ  961
                E+ T LKI V  + +  E +  + K    +       +K +I +++E+++  D  ++
Sbjct  231   VMLEVGTNLKIPVRGFIRVKECKPNSFKKVHART-----LSKDDIHTTHEHRLNDD--EE  283

Query  962   VPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA-NVF  1135
              P E  I GYRYG  +VP S+ +   +KFK + K   +LGFT A N+ R YYM D+   F
Sbjct  284   TPVESTIDGYRYGNTIVPFSTDDESQMKFKTDAKCFDVLGFTRADNVKRQYYMGDSVRCF  343

Query  1136  IADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLY  1315
             +A+  +  A +A+SA   A+ + N VAIVR V+ +      +  LTP++  K N  + L 
Sbjct  344   VAEEGDEPAAVALSAFIHALYETNMVAIVRYVYNKNSAP-KVAFLTPHI--KPNY-ECLL  399

Query  1316  FNALPFAEDVREFQFPSFSNLPSSM-LPNEQQQEAADNLVKMLDLAPSD------SQEAL  1474
                LPF ED+R++ F S    P++   P++ Q  A D+L+  ++L   D       Q+ L
Sbjct  400   CIMLPFMEDMRKYTFSSLH--PNNKNQPSDDQLSAVDDLIDNMNLVMPDKDEDGKQQQYL  457

Query  1475  LPEFTPNPVLQRYYHYLEMKSKH-HDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRC  1651
              P+ T NP LQR Y  L  ++ +  D  +PP ++ +     P  +LL+Q +  VD+ +  
Sbjct  458   KPKLTFNPHLQRLYQCLSARALNPDDPQLPPPNQTILNYLQPQQDLLTQAQPCVDKIKAA  517

Query  1652  FELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE--------------------KI  1771
             F L+    + K ++    +   G  ++ E A+ K + +                    ++
Sbjct  518   FPLE---VVTKKKEETTAQNIFGGGDDAEPAAKKPRLDTDAGGDGGLTMAGLAQGPVTEV  574

Query  1772  GNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGC  1951
             G++ P++DF  MISR+D  +++  + Q ++ +I  +V  S     Y KA+ECL+ALR   
Sbjct  575   GSVRPLEDFRAMISRKDDDKFMEASAQ-LQKRIEEIVMESFGDQFYGKAMECLLALRKES  633

Query  1952  IVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALI  2071
                 EP QFN  LR    +   K  + F   +    + LI
Sbjct  634   AKLGEPDQFNTFLRGFKETLFNKGRKDFWDCMVREKVTLI  673



>ref|XP_005154127.1| PREDICTED: X-ray repair cross-complementing protein 5 [Melopsittacus 
undulatus]
Length=730

 Score =   204 bits (518),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 204/737 (28%), Positives = 339/737 (46%), Gaps = 99/737 (13%)
 Frame = +2

Query  122   MARNRE-GLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgt  277
             MAR+ +  ++L +DVG +M+   P       + +KV +  V++++     DEV V+LFGT
Sbjct  1     MARSSKVAIVLCLDVGFTMNSSAPGEESSLEQAKKVMTKFVQRQVFAESKDEVAVVLFGT  60

Query  278   tetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIK  454
               T N+L      Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K
Sbjct  61    DGTRNDLASRDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQK  119

Query  455   KYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD-----------  601
             +       K+ + L T+   P+        EDQ+  I A +K  G+ +            
Sbjct  120   QTIGKKYEKRHIELFTDLCSPVS-------EDQLEIIIANLKKTGISLQFFLPFPVDVDD  172

Query  602   -------SVIVRMKQDLDAEKGI-------IDENDFLLSVFSKETSSKAAYVESAT----  727
                    SV   + ++    KG+       ID    L+    +E   +  Y    +    
Sbjct  173   GGGDTSASVYSHIHRNPFPRKGLTEQQKEGIDVVRKLMHTLDEEGGLEEIYTFRESLEHL  232

Query  728   SLMGAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFA  904
             S+   I  R +A P  L  G     + L I++  YK  +EE+   +    D         
Sbjct  233   SMFKKIERRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVKKVWTIVD----AKTLR  283

Query  905   KHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGF  1081
             K ++     Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF
Sbjct  284   KDDVRRETVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGF  343

Query  1082  TDASNIMRHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             + +S I RH YM +    VF A D EN  A +A SAL  A+ ++  VA+VR  + + + N
Sbjct  344   SRSSQIQRHCYMGNQVLKVFAAKDDEN--AAVAFSALVHALDELKVVAVVRYAYDR-RSN  400

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
               IG   P + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+
Sbjct  401   PQIGAAFPYIKD---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKCIPTADQLSAVDSLI  456

Query  1433  KMLDLA-PSDSQEAL----LPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDP  1597
               ++L   +D  E       P   PNP  QR Y  L+ K+ H +  +PP++E L  + + 
Sbjct  457   DSMNLVYEADDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEEHLLEMLEM  516

Query  1598  DPELLSQNKTVVDEFRRCFEL----------------KDNPKMKKSRKRLIREKPTGSDE  1729
                +  + +  +++ +  F L                KDN +   + K     KP   DE
Sbjct  517   PSVVKERCQGPLEKIKALFPLKEVVKKKDKKTAQDIFKDNSEDGPNAK-----KPRIEDE  571

Query  1730  EGERASTKVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEG  1900
             EG  +  K+       +G++NP +DF  ++ ++ S        Q++ N+I   +EN    
Sbjct  572   EGSFSIMKLAEGNVTSVGSVNPAEDFRILVRQKSSD--FKDVSQQLINRIDQFLENK-GS  628

Query  1901  DTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKT  2080
               Y K + C+   R   +   + + FND L+ L +  ++K L  F + +    I+LITK 
Sbjct  629   QYYMKGINCIRVFREEAVKLSKVQCFNDFLQALKSKVEDKALADFWEIMMQDRISLITKD  688

Query  2081  EAPDSDVLESEARSFMT  2131
             EA +S V   EA  F+ 
Sbjct  689   EAMESSVTSEEAEKFLA  705



>ref|XP_005415838.1| PREDICTED: X-ray repair cross-complementing protein 5 [Geospiza 
fortis]
Length=749

 Score =   204 bits (519),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 198/727 (27%), Positives = 329/727 (45%), Gaps = 95/727 (13%)
 Frame = +2

Query  140   GLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M    P       + +K+ +  V++++     DEV V+LFGT  T N L
Sbjct  30    AVVLCLDVGLTMSSSSPGEETSLDQAKKIMTKFVQRQVFAESKDEVAVVLFGTNGTRNGL  89

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
               E   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  90    ASEDQ-YQNITVHRSLMLPDFDLLEDIQNVIKAGSAQADFLDAIIVCMDLLQKETIGKKY  148

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+        EDQ+  I A +K  G  +                   
Sbjct  149   EKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGTSLQFFLPFPVSVDDGSGDKSA  201

Query  602   SVIVRMKQDLDAEKGI-------IDENDFLLSVFSKETSSKAAYV--ESATSL-MGAIRT  751
             SV   M ++    KG+       ID    L+    +E   +  Y   ES   L M     
Sbjct  202   SVHAHMHKNSFPIKGLTEQQKQGIDVVRKLMYTLDEEGGLEEIYTFRESLERLSMFKKME  261

Query  752   RNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYE  931
             R   P   +     +   L I++  YK  +EER   L    D         K ++     
Sbjct  262   RKPMP---WPCQLTIGPNLSIRIVAYKSVTEERVKKLWAIVD----AKTLRKEDVQKETV  314

Query  932   YKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRH  1108
             Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGFT +S I RH
Sbjct  315   YCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEGKCFSVLGFTRSSQIQRH  374

Query  1109  YYMKDANV-FIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVS  1285
             YYM +  +   A  +++ A +A SAL RA+ ++  VA+VR  + + +    IGV  P + 
Sbjct  375   YYMGNQALKVFAAKDDANAAVAFSALVRALDELKVVAVVRYAYDR-RCYPQIGVAFPYIK  433

Query  1286  DKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQ  1465
             D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   D +
Sbjct  434   D---TYECLIYVQLPYMEDLRQYVFTSLKN-SKKCIPTVDQLYAVDSLIDSMNLVHEDGE  489

Query  1466  ---EALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVD  1636
                +   P   PNP  QR Y  L+ K+ H D  +PP+++ L  + +    +  + +  ++
Sbjct  490   TFEDLFKPSKIPNPHFQRLYQCLQHKAFHSDKPLPPIEQHLLEMLEMPCVVRERCQAPLE  549

Query  1637  EFRRCFEL-------------------KDNPKMKKSRKRLIREKPTGSDEEGERASTKVK  1759
               +  F L                   +D P +KK         P   D+E   +  K+ 
Sbjct  550   RVKALFPLKEVGKKKEEKTAQDIFKDNEDEPSLKK---------PKIEDDEESFSLMKLA  600

Query  1760  SEKI---GNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECL  1930
                I   G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K ++C+
Sbjct  601   EGNITSVGSVNPAEDFRILVRKKNAD--FKDVSQQLINRIDQFLENK-GSQYYMKGIDCI  657

Query  1931  VALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLES  2110
              A R   +   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V   
Sbjct  658   RAFREEAMKLSKVQCFNDFLQALKSKLEDKALSDFWEIMVQERISLITKDEAEGSLVTGE  717

Query  2111  EARSFMT  2131
             EA  F+ 
Sbjct  718   EAEKFLA  724



>gb|KFP99347.1| X-ray repair cross-complementing protein 5, partial [Leptosomus 
discolor]
Length=719

 Score =   203 bits (517),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 194/723 (27%), Positives = 334/723 (46%), Gaps = 85/723 (12%)
 Frame = +2

Query  140   GLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M    P       + +K+ +  V++++     DEV V+LFGT  T N L
Sbjct  1     AIVLCLDVGFTMSSSAPGEESSLEQAKKIMTKFVQRQVFAESKDEVAVVLFGTDGTRNGL  60

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  61    ASGDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKY  119

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD----------------SV  607
              K+ + L T+   P+        EDQ+  I A +K  G+ +                 S 
Sbjct  120   EKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGISLQFFLPFPVDVDDGGGDTSA  172

Query  608   IVR--MKQDLDAEKGIIDENDFLLSVFSK--ETSSKAAYVESA---------TSLMGAIR  748
              +R  M ++    KG+ ++    + V  K   T  +   +E            S+   I 
Sbjct  173   TIRSHMHRNCFPRKGLTEQQKEGVDVVRKLMHTLDEGGGLEEIYTFRESLERLSMFKKIE  232

Query  749   TRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
              R +A P  L  G     + L I++  YK  +EE+   +    D         K ++   
Sbjct  233   RRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVKKIWTVVD----AKTLRKDDVQKE  283

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   +V  +  I+G+RYG  ++P S  + E +K+K E K   +LGF+ +S + 
Sbjct  284   TVYCLNDDDETEVQRDDTIQGFRYGSDIIPFSKEDEEQMKYKTEAKCFSVLGFSRSSQVQ  343

Query  1103  RHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTP  1276
             RH YM +    VF A  + + A+ A SAL  A+ ++  VAIVR  + + + N  +GV  P
Sbjct  344   RHCYMGNQVLKVFAAKGDENAAV-AFSALVHALDELKVVAIVRYAYDR-RCNPQVGVAFP  401

Query  1277  NVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPS  1456
              + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   
Sbjct  402   YIKD---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKCIPTADQLSAVDSLIDSMNLVSE  457

Query  1457  DS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQN  1621
             D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  + 
Sbjct  458   DDDGETFEDLFKPSKIPNPQFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPSVVKERC  517

Query  1622  KTVVDEFRRCFELKDNPK----------MKKSRKRLIREKPTGSDEEGERASTKVKS---  1762
             +  +++ +  F LK+  K           K +    I +KP   DEEG  +  K+     
Sbjct  518   QAPLEKIKALFPLKEVGKKKEEKTAQDIFKDNEDGPIPKKPKMEDEEGGFSIMKLAEGNV  577

Query  1763  EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALR  1942
               +G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K + C+   R
Sbjct  578   TSVGSVNPGEDFRILVKQKNAD--FRDVSQQLINRIDQFLENK-GSQYYMKGINCIRVFR  634

Query  1943  NGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARS  2122
                +   + + FND LR L +  ++K L  F + +    I+LITK EA  S V   EA  
Sbjct  635   EEAVKLSKVQCFNDFLRALKSKVEDKALADFWEIMIQDRISLITKDEAEGSSVTSEEAEK  694

Query  2123  FMT  2131
             F+ 
Sbjct  695   FLA  697



>ref|XP_009939224.1| PREDICTED: X-ray repair cross-complementing protein 5 [Opisthocomus 
hoazin]
Length=729

 Score =   203 bits (517),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 196/736 (27%), Positives = 341/736 (46%), Gaps = 98/736 (13%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSM-------HCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgtt  280
             MAR +  ++L +DVG +M          L + ++V +  V++++     DEV V+LFGT 
Sbjct  1     MARGQAAVVLCLDVGFTMGNSASDEESSLEQAKRVMAKFVQRQVFAESKDEVAVVLFGTD  60

Query  281   etanelteelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKK  457
              T N+L  E   Y+++T+ RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+
Sbjct  61    GTRNDLASEDQ-YQNITIHRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQKQ  119

Query  458   YGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------  601
                    K+ + + T+   P+        EDQ+  I   +K  G+ +             
Sbjct  120   TIGKKYEKRHIEVFTDLNSPVS-------EDQLEIIIDNLKKTGISLQFFLPFPVDVGGG  172

Query  602   ------SVIVRMKQDLDAEKGIIDEND-------FLLSVFSKETSSKAAYVESAT----S  730
                   +V  +M ++    KG+ ++          L+    +E   +  Y    +    S
Sbjct  173   GGDTSATVHSQMHRNSFPLKGLTEQQKEGVHVVRKLMHTLDEEGGLEEIYTFRESLKRLS  232

Query  731   LMGAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAK  907
             +   +  R +A P  L  G     + L I++  YK  +EE+   +    D        +K
Sbjct  233   MFKKLERRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVKKIWTVVD----AKTLSK  283

Query  908   HEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFT  1084
              ++     Y +  D   +V  +  I+G+RYG  ++P S  + E +K+K E K   +LGF+
Sbjct  284   DDVQKETVYCLNDDDETEVQKDDTIQGFRYGSDIIPFSKEDEEQMKYKTEAKCFSVLGFS  343

Query  1085  DASNIMRHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNV  1255
              +S I RHYYM +    VF A D EN  A +A SAL  A++++  VAIVR  + + + N 
Sbjct  344   RSSQIQRHYYMGNQVLKVFAAKDDEN--AAVAFSALVHALEELKVVAIVRYAYDR-RCNP  400

Query  1256  TIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVK  1435
              IGV  P + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+ 
Sbjct  401   QIGVAFPYIKD---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKCIPTADQLSAVDSLID  456

Query  1436  MLDLAPSDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPD  1600
              ++L   +      ++   P   PNP  QR Y  L+ K+ H D  +PP+++ L  + +  
Sbjct  457   SMNLVYENDDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPDDPLPPIEQHLLEMLEMP  516

Query  1601  PELLSQNKTVVDEFRRCFEL----------------KDNPKMKKSRKRLIREKPTGSDEE  1732
               +  + +  +++ +  F L                KDN +   + K     KP   DEE
Sbjct  517   CVVKERCQAPLEKVKALFPLKEVGKKKEEKTAQDIFKDNSEEGPNSK-----KPKIEDEE  571

Query  1733  GERASTKVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGD  1903
             G  +  K+       +G++NP +DF  ++ ++++        +++ N+I   +EN     
Sbjct  572   GSFSIIKLAEGNVTSVGSVNPAEDFRILVRQKNAD--FKDVSRQLTNRIDQFLENK-GSQ  628

Query  1904  TYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTE  2083
              Y K + C+   R   I   + + FND L+ L +  ++K L  F + +    I+L TK E
Sbjct  629   YYMKGINCIGVFREEAIKLSKVQCFNDFLQALKSKVEDKALADFWEIMIQDRISLFTKDE  688

Query  2084  APDSDVLESEARSFMT  2131
             A  S V   EA  F+ 
Sbjct  689   AEGSSVTSEEAEKFLA  704



>ref|XP_002117043.1| hypothetical protein TRIADDRAFT_61074 [Trichoplax adhaerens]
 gb|EDV20349.1| hypothetical protein TRIADDRAFT_61074 [Trichoplax adhaerens]
Length=784

 Score =   204 bits (518),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 170/646 (26%), Positives = 304/646 (47%), Gaps = 92/646 (14%)
 Frame = +2

Query  317   YEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCL  496
             YE+++V+R +   D + L+ ++     +     LD++IV MD++ K       G KR+ L
Sbjct  124   YENISVVRPLGPPDLNFLRYIQ-----TNIAPVLDSIIVAMDLLKKSTSGKKFGDKRIIL  178

Query  497   ITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLS  676
              ++   P  D       DQ++             +S + ++ + +D +            
Sbjct  179   FSDLGSPFAD-------DQIAG------------ESTLKKILEIVDGD------------  207

Query  677   VFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFP  856
                      +  + SA S +   + R+I   T++RG  E+ +KLKI  + Y K  E +  
Sbjct  208   ---------SHSLRSALSTLSFFQKRSIKMTTVFRGPLEIGSKLKINTYAYIKVRESKPE  258

Query  857   TLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWE  1036
             + K  S  +  +++    ++     Y +  +   ++  E   KGY+YG  +VP    + E
Sbjct  259   SWKKLSAISEASNQPGDMKVKIERSYHLNDEDETEIERENLAKGYKYGKTIVPWLKIDEE  318

Query  1037  AVKFKPEKGVKLLGFTDASNIMRHYYMKDA-NVFIADPENSKAILAVSALARAMKDMNRV  1213
             ++K K  K + +LGFT + N+ RH+ M D   VF+  P +  A +A SAL +A+ + ++V
Sbjct  319   SMKLKAAKCLSVLGFTKSENVKRHWLMGDGVVVFMPAPNDEPAGVAFSALVQALYETDKV  378

Query  1214  AIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSML  1393
             A+VR V+R       +G+L P +        SL F  LPF ED+R++ F S +    + +
Sbjct  379   AVVRYVYR-NNSQPKLGILFPQIKATYR---SLLFIQLPFMEDIRQYTFASLTTNKKN-V  433

Query  1394  PNEQQQEAADNLVKMLDLAPS----DSQ--EALLPEFTPNPVLQRYYHYLEMKSKHHDAA  1555
             P + Q +  D+LV  +DL+ +    D +  EAL P+ T NPVLQR Y  ++ ++ + D A
Sbjct  434   PTDDQLDLVDDLVTSMDLSRAYRDDDGELIEALKPKLTFNPVLQRSYQCIQHRALNPDDA  493

Query  1556  VPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL------------------KDNP---  1672
             +P  D ++ R   P  ++ +   +   + +  F +                  KDN    
Sbjct  494   LPRPDPVITRYLSPSQDVTATCASHFQKIKDSFGIVHVQKKKKRDDGTAASIFKDNIDLA  553

Query  1673  -KMKKSRKRLIREKPTGSDEEGERASTKVKSEKIGNINPVQDFEDMISRRDS--------  1825
              ++  S KR      T   +    + +K    ++G + PVQDF+ MI+++D         
Sbjct  554   LELDTSSKRAKDSNSTADVDFSISSLSKENVTEVGTVQPVQDFKAMINQKDEDRFEEGTD  613

Query  1826  --PEWV---NKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLL  1990
               P W      A ++MK++I+ LV +S+    + KA++CL ALR  C+   EP  FN  L
Sbjct  614   YRPNWYPMNTLACKQMKSRIWQLVMDSIGSQLFPKAMDCLKALREECVRLGEPAVFNQFL  673

Query  1991  RNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFM  2128
             +++         R F   +    I LI+  E+ +SDV  ++A+SF+
Sbjct  674   QDMKDKLSNAFGRDFWLLVVEGEITLISVQESSESDVTVADAKSFL  719



>ref|XP_009666109.1| PREDICTED: X-ray repair cross-complementing protein 5 [Struthio 
camelus australis]
Length=749

 Score =   203 bits (517),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 198/722 (27%), Positives = 339/722 (47%), Gaps = 82/722 (11%)
 Frame = +2

Query  140   GLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DV  +M    P       + +KV +  V++++     DEV V+LFGT  T N+L
Sbjct  27    AIVLCLDVSFTMSNAAPGEESPLEQAKKVMTKFVQRQVFAESKDEVAVVLFGTDGTRNDL  86

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ +K  I  K
Sbjct  87    ASGDQ-YQNITVHRSLMLPDFDLLEDIQNVIQPGSEQADFLDAIIVCMDLL-QKQTIGKK  144

Query  476   GKKR-LCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD-----------------  601
              +KR + L T+   P+        EDQ+  I A +K  G  +                  
Sbjct  145   CEKRHIELFTDLSSPVS-------EDQLEIIVANLKKTGTLLQFFLPFSVDADDGGGDAS  197

Query  602   -SVIVRMKQDLDAEKGIIDENDFLLSVFSK--ETSSKAAYVESATSLMGAIRTRNIAPV-  769
              S     +++  A KGI ++    + V  K   T  +   +E   +   ++   ++    
Sbjct  198   ASAHSHEQRNSFARKGITEQQKEGIHVIKKLMHTLDEGGGLEEIYTFRESLERLSMFKKM  257

Query  770   ----TLYRGDFELSTKLKIKVWVYKKTSEERFP-TLKMYSDKAPPTDKFAKHEITSSYEY  934
                 T +     + + L I++  YK  +EE+   T  +   K    D   K  +     Y
Sbjct  258   ERRPTAWPCHLTIGSNLSIRIVAYKALTEEKVKKTWTIVDAKTLRRDDVQKETV-----Y  312

Query  935   KVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHY  1111
              +  D   ++  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I R Y
Sbjct  313   CLNDDDETEIQKDDTIQGFRYGSDIVPFSKVDEEQMKYKTEAKCFSVLGFSRSSQIRRQY  372

Query  1112  YMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNV  1282
             YM      VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N  IGV  P +
Sbjct  373   YMGSQVLKVFAAKDDEN--AAVAFSALIHALAELKVVAIVRYAYDR-RSNPQIGVAFPYI  429

Query  1283  SDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS  1462
              D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   D 
Sbjct  430   KD---AYECLIYVQLPYMEDLRQYMFSSLKN-NRKYIPTADQLSAVDSLIDSMNLIYEDD  485

Query  1463  -----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKT  1627
                  ++   P   PNP  QR Y  L+ K+ + +  +PP++  L  + +    +  + + 
Sbjct  486   DGESFEDLFKPSKIPNPHFQRLYQCLQHKAFYPNEPLPPIEPHLLEMLEMPSVVKERCQA  545

Query  1628  VVDEFRRCFELKDNPKMK--KSRKRLIRE---------KPTGSDEEGERASTKVKS---E  1765
              +++ +  F LKD  K K  K+ + + ++         KP   +EEG  +   +      
Sbjct  546   PLEKIKALFPLKDVGKKKEGKTAQDIFKDNNEDEPNPKKPKTENEEGGFSIISIAEGNVT  605

Query  1766  KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRN  1945
              +G++NP +DF+ ++ ++++    N+  Q++ N+I   +EN      Y KA+ C+   R 
Sbjct  606   SVGSVNPAKDFQILVRQKNA--VFNEVSQQLINRIDQFLENK-GSQYYMKAINCIKVFRE  662

Query  1946  GCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSF  2125
               I   + + FND L+ L +   +K L  F + +    I+LITK EA  S V   EA  F
Sbjct  663   EAIKLSKVQSFNDFLQALKSKVDDKALADFWEIVMQDRISLITKDEAGGSLVTSEEAEKF  722

Query  2126  MT  2131
             + 
Sbjct  723   LA  724



>ref|XP_010213604.1| PREDICTED: X-ray repair cross-complementing protein 5 [Tinamus 
guttatus]
Length=710

 Score =   202 bits (513),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 194/706 (27%), Positives = 330/706 (47%), Gaps = 71/706 (10%)
 Frame = +2

Query  158   DVGPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVL  337
             +  P     L + +KV +  +++++     DEV V+LFGT  T N L      Y+++TV 
Sbjct  3     NAAPGEESPLEQAKKVMTKFLQRQVFAESKDEVAVVLFGTDGTRNVLASGDQ-YQNITVH  61

Query  338   RSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMC  514
             RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+       K  + L T+   
Sbjct  62    RSLMLPDFDLLEDIQTVIQPGSEQADFLDAIIVCMDLLQKETIGKKYEKVHIELFTDLSS  121

Query  515   PIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLL-SVFSKE  691
             P+        EDQ+  I   +K  G+ +    +    D D E G  D +  L  + F+++
Sbjct  122   PVS-------EDQLEIIIDNLKKTGILL-QFFLPFPVDADDEGGDTDAHSHLHKNSFARK  173

Query  692   --TSSKAAYVESATSLMGAI-RTRNIAPVTLYRGDFE--------------------LST  802
               T  +   +     LM A+     +  +  +R   E                    + +
Sbjct  174   DITEQQKEGIHVVKKLMHALDEGGGLEEIYTFRESLERLSMFKKMERRPMPWPCQLTIGS  233

Query  803   KLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRI  982
              L I++  YK  SEER        D         K ++     Y +  D   ++  +  I
Sbjct  234   DLSIRIVAYKSLSEERVKKTWTVVD----AKTLRKEDVQRETVYCLNDDDETEIQKDDTI  289

Query  983   KGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIADPEN  1153
             +G+RYG  +VP S  + + +K+K E K   +LGFT +S + R YYM +    VF A  ++
Sbjct  290   QGFRYGSDIVPFSKIDEDQMKYKTEAKCFSVLGFTRSSQVQRQYYMGNQVLKVFAA-KDD  348

Query  1154  SKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPF  1333
               A +A SAL  A+ ++  VAIVR V+ + + N  IGV  P + D     + L +  LPF
Sbjct  349   EVAAVAFSALIHALDELKVVAIVRYVYDR-RCNPQIGVAFPYIKD---TYECLIYVQLPF  404

Query  1334  AEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLPEFTPNP  1498
              ED+R++ F S  N     +P E Q  A D+L+  ++L   D      ++   P   PNP
Sbjct  405   TEDLRQYMFSSLKN-NKKYIPTEDQLSAVDSLIDSMNLVYEDEDGESFEDLFKPSKIPNP  463

Query  1499  VLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKM  1678
               QR Y  L+ K+ + D  +PP++  L  + +    +  + +  +++ +  F LKD  K 
Sbjct  464   HFQRLYQCLQHKAFYPDKPLPPIEPHLLEMLETPCVVKERCQVPLEKIKALFPLKDVGKK  523

Query  1679  K--KSRKRLIRE-KPTG--------SDEEGERASTKVKS---EKIGNINPVQDFEDMISR  1816
             K  K+ + + ++ K  G         DEEG  +   +       +G++NP +DF+ ++ +
Sbjct  524   KEDKTAQDIFKDNKEDGPSPKKLKVEDEEGGFSIVSIAEGNVTSVGSVNPAKDFQILVRQ  583

Query  1817  RDSPEWVNKAIQEMKNKIFYLVEN-SLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLR  1993
             R++     +  Q++ N+I   +EN  L+   Y K + C+   R   I   +   FND L+
Sbjct  584   RNAD--FKQVSQQLINRIDQFLENRGLQ--YYMKGINCIKVFREEAIKLFQVHCFNDFLQ  639

Query  1994  NLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             +L +  ++K L  F + +    I+LITK EA  S V   EA  F+ 
Sbjct  640   DLKSKVEDKVLPDFWEIVMQDRISLITKDEAEGSLVTREEAEKFLA  685



>ref|XP_005498630.1| PREDICTED: X-ray repair cross-complementing protein 5 [Columba 
livia]
Length=730

 Score =   202 bits (513),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 204/737 (28%), Positives = 335/737 (45%), Gaps = 99/737 (13%)
 Frame = +2

Query  122   MARN-REGLILVIDVGPSM-------HCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgt  277
             MAR+ +  ++L +DVG +M          L + +KV +  V++++     DEV V+LFGT
Sbjct  1     MARSSKAAIVLCLDVGCAMSNSASGEESSLEQAKKVMTKFVQRQVFAETKDEVAVVLFGT  60

Query  278   tetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIK  454
               T N L      Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K
Sbjct  61    DGTRNALASRDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQK  119

Query  455   KYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD-----------  601
             +       K+ + L T+   P+        EDQ+  I A +K  G+ +            
Sbjct  120   ETIGKKYEKRHIELFTDLSSPVS-------EDQLDIIIANLKKTGISLQFFLPFPVDDDD  172

Query  602   -------SVIVRMKQDLDAEKGI-------IDENDFLLSVFSKETSSKAAYVESAT----  727
                    SV  +M ++    KG+       ID    L+    +E   +  Y    +    
Sbjct  173   GGGDKSASVCSQMHRNSFPRKGLTEQQKEGIDVVRKLMHTLDEEGGLEEIYTFRESLERL  232

Query  728   SLMGAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFA  904
             S+   I  +++  P  L  G     + L I++  YK   EE+   +    D         
Sbjct  233   SMFKKIERKSLPWPCQLTIG-----SNLSIRIVAYKSVIEEKVKKVWTVVD----AKTLR  283

Query  905   KHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGF  1081
             K +I     Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF
Sbjct  284   KEDIQKETVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGF  343

Query  1082  TDASNIMRHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             + +S I R YYM +    VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N
Sbjct  344   SRSSQIQRQYYMGNQVLKVFAAKDDEN--AAVAFSALVHALDELKVVAIVRYAYDR-RCN  400

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
               IGV  P + D     + L +  LP+ ED+R + F S  N      P   Q  A D+L+
Sbjct  401   PQIGVAFPYIKD---AYECLIYVQLPYMEDLRPYIFSSLKN-NKKCTPTVDQLSAVDSLI  456

Query  1433  KMLDLAPSDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDP  1597
               ++L   D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + + 
Sbjct  457   DSMNLVSEDDDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEM  516

Query  1598  DPELLSQNKTVVDEFRRCFEL----------------KDNPKMKKSRKRLIREKPTGSDE  1729
                +  + +  + + +  F L                KDN +   + K     KP   DE
Sbjct  517   PHVVKERCQAPLGKVKALFPLKEVSKKKEEKTAQDIFKDNSEDGPNPK-----KPKIEDE  571

Query  1730  EGERASTKVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEG  1900
             EG  +  K+       +G++NP +DF  ++ ++++        Q++ N+I   +EN    
Sbjct  572   EGSFSIMKLAEGSVTSVGSVNPAEDFRILVRQKNTN--FKDVSQQLINRIHQFLENK-GS  628

Query  1901  DTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKT  2080
               Y K + C+   R   I   + + FND L+ L +  ++K L  F + +    I+LITK 
Sbjct  629   QYYMKGINCIRVFREEAIKLSKVQCFNDFLQALKSKMEDKALADFWEIIIQDRISLITKD  688

Query  2081  EAPDSDVLESEARSFMT  2131
             EA  S V   EA  F+ 
Sbjct  689   EAEGSSVTSEEAEKFLA  705



>gb|KGL77706.1| X-ray repair cross-complementing protein 5, partial [Tinamus 
guttatus]
Length=730

 Score =   202 bits (513),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 198/729 (27%), Positives = 337/729 (46%), Gaps = 87/729 (12%)
 Frame = +2

Query  140   GLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M    P       + +KV +  +++++     DEV V+LFGT  T N L
Sbjct  2     AVVLCLDVGLTMGNAAPGEESPLEQAKKVMTKFLQRQVFAESKDEVAVVLFGTDGTRNVL  61

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  62    ASGDQ-YQNITVHRSLMLPDFDLLEDIQTVIQPGSEQADFLDAIIVCMDLLQKETIGKKY  120

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIID  655
              K  + L T+   P+        EDQ+  I   +K  G+ +    +    D D E G  D
Sbjct  121   EKVHIELFTDLSSPVS-------EDQLEIIIDNLKKTGILL-QFFLPFPVDADDEGGDTD  172

Query  656   ENDFLL-SVFSKE--TSSKAAYVESATSLMGAI-RTRNIAPVTLYRGDFE----------  793
              +  L  + F+++  T  +   +     LM A+     +  +  +R   E          
Sbjct  173   AHSHLHKNSFARKDITEQQKEGIHVVKKLMHALDEGGGLEEIYTFRESLERLSMFKKMER  232

Query  794   ----------LSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVV  943
                       + + L I++  YK  SEER        D         K ++     Y + 
Sbjct  233   RPMPWPCQLTIGSDLSIRIVAYKSLSEERVKKTWTVVD----AKTLRKEDVQRETVYCLN  288

Query  944   QDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMK  1120
              D   ++  +  I+G+RYG  +VP S  + + +K+K E K   +LGFT +S + R YYM 
Sbjct  289   DDDETEIQKDDTIQGFRYGSDIVPFSKIDEDQMKYKTEAKCFSVLGFTRSSQVQRQYYMG  348

Query  1121  DA--NVFIADPENSK----------AILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIG  1264
             +    VF A  +  +          A +A SAL  A+ ++  VAIVR V+ + + N  IG
Sbjct  349   NQVLKVFAAKDDEVRVFFLSFFLLDAAVAFSALIHALDELKVVAIVRYVYDR-RCNPQIG  407

Query  1265  VLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLD  1444
             V  P + D     + L +  LPF ED+R++ F S  N     +P E Q  A D+L+  ++
Sbjct  408   VAFPYIKD---TYECLIYVQLPFTEDLRQYMFSSLKN-NKKYIPTEDQLSAVDSLIDSMN  463

Query  1445  LAPSDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPEL  1609
             L   D      ++   P   PNP  QR Y  L+ K+ + D  +PP++  L  + +    +
Sbjct  464   LVYEDEDGESFEDLFKPSKIPNPHFQRLYQCLQHKAFYPDKPLPPIEPHLLEMLETPCVV  523

Query  1610  LSQNKTVVDEFRRCFELKDNPKMK--KSRKRLIRE-KPTG--------SDEEGERASTKV  1756
               + +  +++ +  F LKD  K K  K+ + + ++ K  G         DEEG  +   +
Sbjct  524   KERCQVPLEKIKALFPLKDVGKKKEDKTAQDIFKDNKEDGPSPKKLKVEDEEGGFSIVSI  583

Query  1757  KS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVEN-SLEGDTYQKALE  1924
                    +G++NP +DF+ ++ +R++     +  Q++ N+I   +EN  L+   Y K + 
Sbjct  584   AEGNVTSVGSVNPAKDFQILVRQRNAD--FKQVSQQLINRIDQFLENRGLQ--YYMKGIN  639

Query  1925  CLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVL  2104
             C+   R   I   +   FND L++L +  ++K L  F + +    I+LITK EA  S V 
Sbjct  640   CIKVFREEAIKLFQVHCFNDFLQDLKSKVEDKVLPDFWEIVMQDRISLITKDEAEGSLVT  699

Query  2105  ESEARSFMT  2131
               EA  F+ 
Sbjct  700   REEAEKFLA  708



>ref|XP_004401280.1| PREDICTED: X-ray repair cross-complementing protein 5 [Odobenus 
rosmarus divergens]
Length=732

 Score =   202 bits (513),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 192/731 (26%), Positives = 340/731 (47%), Gaps = 86/731 (12%)
 Frame = +2

Query  122   MAR--NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR  N+  ++L +DVG +M   LP  E       KV ++ V++++     DE+ ++LFG
Sbjct  1     MARSGNKAAVVLCMDVGSAMSNSLPGEESPFELAKKVMTMFVQRQVFAESRDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  +   Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD++ 
Sbjct  61    TDGTENALAGKDQ-YQNITVHRHLMLPDFDLLEDIERKIQLGSQQADFLDALIVCMDVIQ  119

Query  452   KKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVR--MKQ  625
             ++       KK + + T+   P         +DQ+  I   +K  G+ +   +     K+
Sbjct  120   QETVGKKFEKKHIEVFTDLSSPFS-------KDQLDVIIHNLKKFGISLQFFLPFPVGKE  172

Query  626   DLDAEKGIID------ENDFLLSVFSKETSSKAAYVESAT-SLMG---------------  739
             D   ++G  +      E  F L   +++       V+    SL G               
Sbjct  173   DGTGDRGDGNSRSDHHEPSFPLKGITEQQKEGIRMVKKVMMSLEGEDGLDEIYSFSESLR  232

Query  740   ------AIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKF  901
                    I  R+I     +     + + L IK+  YK   +ER        D        
Sbjct  233   QLCVFKKIEKRSIP----WSCMLTIGSSLSIKIVAYKSIIQERVKKAWTVVD----ARTL  284

Query  902   AKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLG  1078
              K ++     Y +  D   +VP E  I+G+RYG  +VP S  + E +K+K E K   +LG
Sbjct  285   KKEDLQKETVYCLNDDNETEVPKEDTIQGFRYGSDIVPFSKVDEEHMKYKSEGKCFSVLG  344

Query  1079  FTDASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             F  +S + R Y+M +    VF A  + + A+ A+S+L  A+ +++ VA+VR  + + + +
Sbjct  345   FCRSSQVHRRYFMGNQVLKVFAAKDDEAAAV-ALSSLIHALDELDMVAVVRYAYDR-KAH  402

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
               +G   P + D     + L +  LPF ED+R++ F S  N     +P E Q  A D L+
Sbjct  403   PQVGAAFPYIKD---AYECLIYVQLPFMEDLRQYMFSSLKN-NKKYIPTEAQLSAVDALI  458

Query  1433  KMLDLAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDP  1597
               + L   D +E  + +       PNP  QR +  L  ++ H    +PP+ + +  + DP
Sbjct  459   DSMSLVKKDEKEDTIEDLFPTSKIPNPQFQRLFQCLLHRALHPQEPLPPIQQHILNMLDP  518

Query  1598  DPELLSQNKTVVDEFRRCFELKDNPKMKK--SRKRLIR----EKPTGS---DEEGERAST  1750
               E+ ++ + ++ + +  F L +  K K   + + + +    E PT      EEGE   +
Sbjct  519   PTEVTAKCQILLSKIKTVFPLTEAIKKKDQVTAQNIFQDNHEEGPTSKKLKTEEGEPCFS  578

Query  1751  KVKSE----KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKA  1918
                +E     +G++NP ++F  ++ ++ +     +A +++ N I   ++ + E   + K+
Sbjct  579   ISLAEGSVTSVGSVNPAENFRVLVRQKKAT--FEEASRQLINHIDQFLDTN-ETPYFMKS  635

Query  1919  LECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSD  2098
             ++C+   R   I   E ++FN+ L+ L    + K L  F + +   GI LITK EAP S 
Sbjct  636   MDCITVFREEAIQFSEEQRFNNFLKTLREKVEMKQLNHFWEIVIQDGITLITKDEAPGSS  695

Query  2099  VLESEARSFMT  2131
             V   EA+ F+ 
Sbjct  696   VTAEEAKKFLA  706



>gb|KFW08590.1| X-ray repair cross-complementing protein 5, partial [Fulmarus 
glacialis]
Length=696

 Score =   201 bits (512),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 198/727 (27%), Positives = 337/727 (46%), Gaps = 96/727 (13%)
 Frame = +2

Query  140   GLILVIDVGPSMHCV-------LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG SM          L + +KV +  V++++     DEV V+LFGT  T N+L
Sbjct  2     AIVLCLDVGFSMGSSASGEESSLEQAKKVMTKFVQRQVFAESKDEVAVVLFGTDGTGNDL  61

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
               E   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  62    ASEDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKY  120

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD-----------------S  604
              K+ + L T+   P+        EDQ+  I A +K  G+ +                  S
Sbjct  121   EKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGISLQFFLPFPVDVDGGGDTSAS  173

Query  605   VIVRMKQDLDAEKGIIDEND-------FLLSVFSKETSSKAAYVESAT----SLMGAIRT  751
             V  ++ ++    KG+ ++ +        L+    +E   +  Y    +    S+   I  
Sbjct  174   VCSQVHRNSFPRKGLTEQQNEGIHVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIER  233

Query  752   RNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSY  928
             R++A P  L  G     + L I++  YK   EE+    KM++     T    K ++    
Sbjct  234   RSMAWPCQLTIG-----SNLSIRIVAYKSVMEEKVK--KMWTVVDAKT--LRKDDVQKET  284

Query  929   EYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMR  1105
              Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I R
Sbjct  285   VYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQR  344

Query  1106  HYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPN  1279
             HYYM +    VF A  ++  A +A SAL  A+ ++  VAIVR  + + + N  IGV  P 
Sbjct  345   HYYMGNQVLKVF-AGKDDENAAVAFSALVHALNELKVVAIVRYAYDR-RCNPQIGVAFPY  402

Query  1280  VSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD  1459
             + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+   +L   +
Sbjct  403   IKD---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKFVPTADQLSAVDSLIDSTNLVCEN  458

Query  1460  -----SQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNK  1624
                  S++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  + +
Sbjct  459   DDGETSEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPRVVKERCQ  518

Query  1625  TVVDEFRRCFEL----------------KDNPKMKKSRKRLIREKPTGSDEEGERASTKV  1756
               +++ +  F L                KDN      +K      P   DEEG  +  K+
Sbjct  519   APLEKVKALFPLKEVGKKKEEKTAQDIFKDNEDGPNPKK------PKIEDEEGSFSIIKL  572

Query  1757  KS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALEC  1927
                    +G++NP +DF  ++ ++++        Q++ N++   +EN      Y K + C
Sbjct  573   AEGNVTSVGSVNPAEDFRILVRQKNTD--FEDVSQQLINRVDQFLENK-GSQYYMKGINC  629

Query  1928  LVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLE  2107
             +   R   I   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V  
Sbjct  630   IRVFREEAIKLSKVQCFNDFLQALKSKVEDKALADFWEVMTQDRISLITKDEAEGSLVTT  689

Query  2108  SEARSFM  2128
              EA   +
Sbjct  690   EEAEKVL  696



>ref|XP_009909485.1| PREDICTED: X-ray repair cross-complementing protein 5 [Picoides 
pubescens]
Length=709

 Score =   201 bits (511),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 188/702 (27%), Positives = 328/702 (47%), Gaps = 68/702 (10%)
 Frame = +2

Query  164   GPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRS  343
              P     L + +K+ +  V++++     DEV V+LFGT  T N+L  E   YE++TV RS
Sbjct  5     APGEESSLEQAKKIMTKFVQRQVFAESKDEVAVVLFGTDGTRNDLASENQ-YENITVHRS  63

Query  344   IKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPI  520
             + + D DLL+ ++ + + GS   DFLDA+IV MD++ K+       K+ + + T+   P 
Sbjct  64    LMLPDFDLLEDIQDMIKPGSEQADFLDAIIVCMDLLQKQTIGKKYEKRHIEVFTDLKSP-  122

Query  521   KDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLSVFSKE--T  694
                     EDQ+  I A +K  G+ +   +    +  D +      +    + F ++  T
Sbjct  123   ------ASEDQLEIIIANLKKTGISLQFFLPFPVEVGDGDTSASRHSHVHRNSFPRKGLT  176

Query  695   SSKAAYVESATSLMGAIRTRN-IAPVTLYRGDFE--------------------LSTKLK  811
               + A ++    LM  +     +  +  +R   E                    + + L 
Sbjct  177   EEQKAGIDMVRKLMHTLDEEGGLEEIYTFRESLERLSVFKKIERRPMPWPCQLTIGSNLS  236

Query  812   IKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGY  991
             I++  YK  +EE+   +    D         K ++     Y +  D   +VP +  I+G+
Sbjct  237   IRIVAYKSVTEEKVKKIWTVVD----AKTHRKSDVQKETVYCLNDDDETEVPKDDTIQGF  292

Query  992   RYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA-DPENSK  1159
             RYG  +VP S  + E +K+K E K   +LGF+ +S I RHYYM +    VF A D EN  
Sbjct  293   RYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHYYMGNQALKVFAAKDDEN--  350

Query  1160  AILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAE  1339
             A +A SAL  A+ ++N VAIVR  + + + N  +G   P + DK    + L +  LP+ E
Sbjct  351   AAVAFSALVHALDELNMVAIVRYAYDR-RCNPQVGAAFPYIKDKY---ECLIYVQLPYME  406

Query  1340  DVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLPEFTPNPVL  1504
             D+R++ F S  N     +P   Q  A D+L+  + L   D      ++   P   PNP  
Sbjct  407   DIRQYIFSSLKN-NKKCIPTADQLSAVDSLIDSMSLICEDDDGETYEDLFKPSKIPNPHF  465

Query  1505  QRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKK  1684
             QR Y  L+ K+ H    +PP++E L  + +    +  + +  +++ +  F LK+  K K+
Sbjct  466   QRLYQCLQHKAFHPSEPLPPVEEHLLEMLEMPCVVKERCQAPLEKIKALFPLKEVGKKKE  525

Query  1685  --SRKRLIRE--------KPTGSDEEGERASTKVKS---EKIGNINPVQDFEDMISRRDS  1825
               + + + +E        KP   DE+G  +  K+       +G++NP +DF  ++ +++ 
Sbjct  526   EKTAQDIFKENEDEPNPKKPKIEDEDGSFSIIKLAEGNVTSVGSVNPAEDFRILVRQKNG  585

Query  1826  PEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYA  2005
                     Q++ N+I   + N      Y K + C+   R   +   + + FND +++L +
Sbjct  586   D--FKDVSQQLINRIDQFLGNK-GSQYYMKGINCIRVFREEAMKLSKVQCFNDFMQDLKS  642

Query  2006  SCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
               ++K L  F + +    I+LITK EA +S V   EA  F+ 
Sbjct  643   KVEDKALADFWEIMVQDRISLITKDEAEESSVTGEEAEKFLA  684



>ref|XP_008143502.1| PREDICTED: LOW QUALITY PROTEIN: X-ray repair cross-complementing 
protein 5 [Eptesicus fuscus]
Length=654

 Score =   200 bits (509),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 193/709 (27%), Positives = 329/709 (46%), Gaps = 98/709 (14%)
 Frame = +2

Query  122   MAR--NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR  N+  ++L +DVG +M    P  E       KV ++ V++++     DE+ ++LFG
Sbjct  1     MARSGNKAAVVLCMDVGFAMSNSFPGEESPFELAKKVMTMFVQRQVFAESKDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  E   Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD+ I
Sbjct  61    TDGTENALACEDQ-YQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVCMDV-I  118

Query  452   KKYGITNKGKKR-LCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQD  628
             ++  +  K +KR + + T+   P         +DQ+ TI      H ++  S+ ++    
Sbjct  119   QQETVGKKFEKRHIEVFTDLSSPFS-------KDQLDTII-----HNLKKSSISLQFFLF  166

Query  629   LDAEKGIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKL  808
                    + +    L VF K   S   +                 P  L  G     + L
Sbjct  167   FFXLSESLRQ----LCVFKKIERSSMPW-----------------PCQLTIG-----SNL  200

Query  809   KIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKG  988
              IK+  YK   +E+        D         K ++     Y +  D   +VP E  I+G
Sbjct  201   SIKILAYKSILQEKVKKSWTVVD----ARTLKKEDVQKETVYCLNDDDETEVPKEDTIQG  256

Query  989   YRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIADPENSK  1159
             +RYG  ++P S  + E +K+K E K   +LGF  +S + R Y+M +    VF A  + + 
Sbjct  257   FRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCRSSQVHRKYFMGNQVLKVFAAKDDEAA  316

Query  1160  AILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAE  1339
             A+ A+S+L  A+ ++  VAIVR  + + + N  +GV  P++ D     + L +  LPF E
Sbjct  317   AV-ALSSLIHALDELAMVAIVRYAYDR-RSNPQVGVAFPHIKD---TYECLVYVQLPFME  371

Query  1340  DVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQ----EALLPEF-TPNPVL  1504
             D+R++ F S  N      P E Q  A D L+  + L   D +    E L P    PNP  
Sbjct  372   DLRQYMFSSLKN-NKKYTPTEAQLSAVDALIDSMSLVKKDEEGDTIEDLFPTTKIPNPQF  430

Query  1505  QRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKK  1684
             QR +  L  ++ H    +PP+ + +  + DP  E+ +  +  + + +  F L +   +KK
Sbjct  431   QRLFQCLLHRALHPQEPLPPVQQHVLNMLDPPTEVTANCEIPLSKIKTLFPLTE--AIKK  488

Query  1685  SRKRLIREKPTGSDEEGERASTKVKSE-----------------KIGNINPVQDFEDMIS  1813
               +   ++      EEG   S K+K+E                 K+G++NP ++F  ++ 
Sbjct  489   KDQLTAQDIFQDKSEEGP-TSKKLKTEEGEAHFSLSSLAEGTVTKVGSVNPAENFHVLVR  547

Query  1814  RRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQKALECLVALRNGCIVEQEPKQFND  1984
             ++      N + +E   ++   +E  L+ +    + K+++C+ A R   I   E ++FN+
Sbjct  548   QK------NASFEEASRQLVSHIEQFLDTNETPYFMKSMDCIKAFREEAIQFSEAQRFNN  601

Query  1985  LLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
              L+ L    + K L  F + +   GI LIT+ EAP S V   EA+  +T
Sbjct  602   FLKELQEKVEIKQLNHFWEIIIQDGITLITRDEAPGSSVTAEEAKKVLT  650



>ref|XP_006935602.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X1 [Felis catus]
Length=733

 Score =   201 bits (512),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 187/731 (26%), Positives = 342/731 (47%), Gaps = 85/731 (12%)
 Frame = +2

Query  122   MARNRE--GLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR+R    ++L +DVG +M   LP  E       K+ +V V++++     DE+ ++LFG
Sbjct  1     MARSRSKAAIVLCMDVGSAMSNSLPGEESPFELAKKLMTVFVQRQVFAESKDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  +   Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD++ 
Sbjct  61    TDGTENALAGKDQ-YQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVCMDVIQ  119

Query  452   KKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVR--MKQ  625
             ++      GK+ + + T+   P         +DQ+  I   ++  G+ +   +     K+
Sbjct  120   QETVGKKFGKRHIEVFTDLSSPFS-------QDQLDIIIHNLEKSGISLQFFLPFPVGKE  172

Query  626   DLDAEKG----IIDEN--DFLLSVFSKETSSKAAYVESAT-SLMG------------AIR  748
             D   ++G     +D++   F L   +++       V+    SL G            ++R
Sbjct  173   DGTGDRGDGNSCLDQHGPSFPLKGITEQQKEGIRMVKKVMMSLEGEDGLDEIYSFSESLR  232

Query  749   TRNIAPVTL-----YRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHE  913
                +   T      +     + + L IK+  YK   +E+        D         K +
Sbjct  233   QLRVFKKTERYSVPWLCTLTIGSNLAIKIVAYKAIMQEKVKKSWTVVD----ARTLKKED  288

Query  914   ITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDA  1090
             I     Y +  D   +VP E  I+G+RYG  +VP S  + E +++K E K   +LGF  +
Sbjct  289   IQKETVYCLQDDDETEVPKEDTIQGFRYGSDIVPFSKVDEEQMRYKSEGKCFSVLGFCRS  348

Query  1091  SNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIG  1264
             S + R Y++ +    VF A  + + A+ A+S+L  A+ +++ VA+VR  +  G+ N  +G
Sbjct  349   SQVHRRYFVGNQVLKVFAAKDDEAAAV-ALSSLIHALDELDMVAVVRYAY-AGRTNPQVG  406

Query  1265  VLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLD  1444
             +  P + D     + L +  LPF ED+R++ F S  N      P E Q  A D L+  + 
Sbjct  407   MAFPYIKD---AYECLMYVQLPFMEDLRQYMFSSLKN-SKKCTPTEAQLSAVDALIDSMS  462

Query  1445  LAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPEL  1609
             L   D +E  + +       PNP  QR Y  L  ++ H    +PP+ + +  + DP  E+
Sbjct  463   LVKKDEKEDTIEDLFPTTKIPNPQHQRLYQCLAHRALHPQEPLPPIQQHILNMLDPPAEV  522

Query  1610  LSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE--------  1765
              ++ +  + + +  F L +  K K    ++  +     + E   AS K+K++        
Sbjct  523   TAKCQIPLSKIKTVFPLTEATKKKD---QVPAQNIFPDNHEEGPASKKLKTQEGEACFSV  579

Query  1766  ---------KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKA  1918
                      ++G++NP ++F  ++ ++ +     +A +++ N+I   ++ + E   + K+
Sbjct  580   SSLAEGSVTRVGSVNPAENFRVLVRQKKAS--FEEASRQLINQIEQFLDTN-ETPYFMKS  636

Query  1919  LECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSD  2098
             ++C+   R   I   E + FN+ L+ L    + K L+ F   +   GI LITK EAP S 
Sbjct  637   MDCITVFREEAIQVSEEQCFNNFLKALREKVEIKQLKHFWDIVVQDGITLITKDEAPGSS  696

Query  2099  VLESEARSFMT  2131
             +   EA+ F+ 
Sbjct  697   ITAEEAKKFLA  707



>ref|XP_005331894.1| PREDICTED: X-ray repair cross-complementing protein 5 [Ictidomys 
tridecemlineatus]
Length=733

 Score =   201 bits (512),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 187/730 (26%), Positives = 336/730 (46%), Gaps = 91/730 (12%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M    P       + +KV ++ V++++     +E+ ++LFGT  T 
Sbjct  6     NKAAVVLCMDVGFAMSNSCPGEESPFEQAKKVMTMFVQRQVFAESKNEIALVLFGTDGTE  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L      Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD++  +   
Sbjct  66    NALAAGDQ-YQNITVHRHLMLPDFDLLEDIESRIQPGSQQADFLDALIVCMDVIQNETVG  124

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSV----IVRMKQDLD  634
                 KK + + T+   P         +DQ+  I   +K  G+ +       I ++    D
Sbjct  125   KKFEKKHIEVFTDLNSPFS-------KDQLDIIIHNLKKSGISLQFFLPFPIAKINGTGD  177

Query  635   ---------------AEKGIIDEN--------DFLLSVFSKETSSKA-AYVESATSL--M  736
                             +KGI ++         + ++S+  ++   +  ++ ES   L   
Sbjct  178   RGDGSLYLDDRGPSFPQKGITEQQKEGIQMVKNVMMSLEGEDGLDEIYSFRESLRQLCVF  237

Query  737   GAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEI  916
               I  R++     +     + + L IK+  YK  + E+     M  D         K +I
Sbjct  238   KKIERRSMP----WSCQLTIGSNLSIKIVAYKSITLEQIKKTWMVVD----ARTLKKEDI  289

Query  917   TSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDAS  1093
                  Y +  D   +VP E  I+G+RYG  +VP S  + E +K+K E K   +LGF  +S
Sbjct  290   QKETVYCLNDDDETEVPKEDTIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCRSS  349

Query  1094  NIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGV  1267
              + R ++M      VF A  + + A+ A+S+L  A+ +++ VA+VR V+ + + N  +GV
Sbjct  350   QVQRKFFMGSQVLKVFAAKGDKAAAV-ALSSLVHALDELDMVAVVRYVYDR-RANPQVGV  407

Query  1268  LTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDL  1447
               P + D     + L +  LPF ED+R++ F S  N      P E Q  A D L+  + L
Sbjct  408   AFPYIKD---AYECLVYVQLPFMEDLRQYMFSSLKN-NKKFTPTEAQLSAVDALIDSMSL  463

Query  1448  APSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELL  1612
                D +E  + +       PNP  QR +  L  ++ H    +PP+ + +  + +P  E+ 
Sbjct  464   VKEDKEEDTIEDLFPTTKIPNPAFQRLFQCLLHRALHPQEPLPPIQQHILNMLEPPTEVT  523

Query  1613  SQNKTVVDEFRRCFEL------KDNPKMKKSRKRLIREKPTGS---DEEGE-----RAST  1750
             ++ +  + + +  F L      KD+   +   +    E PT      EEGE         
Sbjct  524   AKCQIPLSKIKNLFPLTEAIKKKDHVTAQDIFQDNHEEGPTAKKCKTEEGEAHFSVSGLA  583

Query  1751  KVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQKAL  1921
             +V   K+G++NPV++F  ++ ++      N + +E  +++   +E  L+ +    + K++
Sbjct  584   EVNITKVGSVNPVENFRALVRQK------NASFEEACHQLISHIEQFLDTNETPYFMKSM  637

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
             +C+ A R   I   E + FN  +++L    + K L  F   +   GI LITK EA  S V
Sbjct  638   DCIKAFREEAIQFSEEQHFNSFMKSLREKVEVKQLNHFWDIVVQDGITLITKDEASGSSV  697

Query  2102  LESEARSFMT  2131
                EA+ F+ 
Sbjct  698   TAEEAKKFLA  707



>ref|XP_002913725.1| PREDICTED: x-ray repair cross-complementing protein 5-like [Ailuropoda 
melanoleuca]
Length=733

 Score =   201 bits (512),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 192/739 (26%), Positives = 342/739 (46%), Gaps = 101/739 (14%)
 Frame = +2

Query  122   MARN--REGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR+  +  ++L +DVGP+M   L   E       KV ++ +++++     DE+ ++LFG
Sbjct  1     MARSGSKAAVVLCMDVGPAMSNSLAGEESPFELAKKVMTMFLQRQVFAESRDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  +   Y+++TV R + + D DLL+ +E ++   S   DFLDA++V MDM+ 
Sbjct  61    TDGTENALGGKDQ-YQNITVHRHLMLPDFDLLEDIERKIQPSSQQADFLDALVVCMDMIQ  119

Query  452   KKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVR--MKQ  625
             ++       KK + + T+   P         +DQ+  I   +K  G+ +   +     K+
Sbjct  120   RETVGKKFEKKHIEVFTDLSSPFS-------KDQLDVIIHNLKKFGISLQFFLPFPVGKE  172

Query  626   DLDAE-----------------KGIIDEND--------FLLSVFSKETSSKA-AYVESAT  727
             D   +                 KGI ++           +LS+  ++   +  ++ ES  
Sbjct  173   DGTGDRGDGNSHSDHHGPSFPLKGITEQQKEGIRMVKKVMLSLEGEDGLDEIYSFSESLR  232

Query  728   SL--MGAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDK  898
              L     I TR++  P TL  G     + L I +  YK   +ER        D       
Sbjct  233   QLCVFKKIETRSVPWPCTLTIG-----SNLSINIVAYKSIVQERVKKSWTVVD----AQT  283

Query  899   FAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLL  1075
               K ++     Y +  D   +VP E  I+G+RYG  +VP S  + E +K+K E K   +L
Sbjct  284   LKKEDLQKETIYCLNDDNETEVPKEDTIQGFRYGSDIVPFSKVDEEHMKYKSEGKCFSVL  343

Query  1076  GFTDASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQG  1249
             GF  +S + R Y+M +    VF A  + + A+ A+S+L  A+ ++  VA+VR V+ + + 
Sbjct  344   GFCRSSQVHRRYFMGNQVLKVFAAKDDEAAAV-ALSSLIHALDELAMVAVVRYVYDR-RA  401

Query  1250  NVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNL  1429
             N  +G+  P + D     + L +  LPF ED+R++ F S  N     +P E Q  A D L
Sbjct  402   NPQVGMAFPYIKD---AYECLIYVQLPFMEDLRQYMFSSLKN-NKKYIPTEAQLSAVDAL  457

Query  1430  VKMLDLAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITD  1594
             +  + L   D +E  + +       PNP  QR +  L  ++ H    +PP+ + +  + D
Sbjct  458   IDSMSLVKKDEKEDTIEDLFPTSKIPNPQFQRLFQCLLHRALHPQEPLPPIQQHILNMLD  517

Query  1595  PDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSEK--  1768
             P  E+ ++ +  + + +  F L +   +KK  +   +     + EEG   S K+K+E+  
Sbjct  518   PPTEVTAKCQIPLSKIKTAFPLTE--AIKKKDQVTAQNIFQDNHEEGP-TSKKLKTEERE  574

Query  1769  ---------------IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGD  1903
                            +G++NP ++F  ++ ++ +        +E   ++   +E  L+ +
Sbjct  575   ACFSISSLAEGSVTSVGSVNPAENFRVLVRQKKA------TFEEASRQLINCIEQFLDTN  628

Query  1904  T---YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALIT  2074
                 + K+++C+   R   I   E ++FND L+ L    + K L  F + +   GI LIT
Sbjct  629   ETPYFMKSMDCITVFRKEAIQFSEEQRFNDFLKALREKVEMKQLNHFWEIVVQDGITLIT  688

Query  2075  KTEAPDSDVLESEARSFMT  2131
             K EAP S +   EA+ F+ 
Sbjct  689   KDEAPGSSITAEEAKKFLA  707



>ref|XP_008688711.1| PREDICTED: X-ray repair cross-complementing protein 5 [Ursus 
maritimus]
Length=731

 Score =   201 bits (511),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 198/735 (27%), Positives = 336/735 (46%), Gaps = 95/735 (13%)
 Frame = +2

Query  122   MARN--REGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR+  +  ++L +DVGP+M   LP  E       KV ++ V++++     DE+ ++LFG
Sbjct  1     MARSGSKAAVVLCMDVGPAMSNSLPGEESPFELAKKVMTMFVQRQVFAESRDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  +   Y+++TV R + + D DLL+ +E ++   S   DFLDA+IV MDM+ 
Sbjct  61    TDGTENALGGKDQ-YQNITVHRHLMLPDFDLLEDIERKIQPSSQQADFLDALIVCMDMIQ  119

Query  452   KKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRM-----------  598
             ++       KK + + T+   P         +DQ+  I   +K  G+ +           
Sbjct  120   RETVGKKFEKKHIEVFTDLSSPFS-------KDQLDVIIHNLKKFGISLQFFLPFPVGKE  172

Query  599   DSVIVRMKQDLDAE--------KGIIDEND--------FLLSVFSKETSSKA-AYVESAT  727
             D    R   +  ++        KGI ++           +LS+  ++   +  ++ ES  
Sbjct  173   DGTGDRGDGNSHSDHHGPSFPPKGITEQQKEGIRMVKKVMLSLEGEDGLDEIYSFSESLR  232

Query  728   SL--MGAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDK  898
              L     I TR+I  P TL  G     + L IK+  YK   +ER        D       
Sbjct  233   QLCVFKKIETRSIPWPCTLTIG-----SNLSIKIVAYKSIVQERVKKSWTVVD----ART  283

Query  899   FAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLL  1075
               K ++     Y +  D   +VP E  I+G+RYG  +VP S  + E +K+K E K   +L
Sbjct  284   LKKEDLQKETIYCLNDDNETEVPKEDTIQGFRYGSDIVPFSKVDEEHMKYKSEGKCFSVL  343

Query  1076  GFTDASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQG  1249
             GF  +S + R Y+M +    VF A  + + A+ A+S+L  A+ ++  VA+VR  + + + 
Sbjct  344   GFCRSSQVHRRYFMGNQVLKVFAAKDDEAAAV-ALSSLIHALDELAMVAVVRYAYDR-RA  401

Query  1250  NVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNL  1429
             N  +G+  P + D     + L +  LPF ED+R++ F S  N     +P E Q  A D L
Sbjct  402   NPQVGMAFPYIKD---AYECLIYVQLPFMEDLRQYMFSSLKN-NKKYIPTEAQLSAVDAL  457

Query  1430  VKMLDLAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITD  1594
             +  + L   D +E  + +       PNP  QR +  L  ++ H    +PP+ + +  + D
Sbjct  458   IDSMSLIKKDEKEDTIEDLFPTSKIPNPQFQRLFQCLLHRALHPQEPLPPIQQHILNMLD  517

Query  1595  PDPELLSQNKTVVDEFRRCFEL----------------KDNPKMKKSRKRLIREKPTGSD  1726
             P  E+ ++ +  + + +  F L                +DN +   + K+L  E+     
Sbjct  518   PPTEVTAKCQIPLSKIKTAFPLTEAIRKKDQVTAQNIFQDNHEEGPTSKKLKTEEREACF  577

Query  1727  EEGERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT  1906
                  A   V S  +G++NP     D +  R       +A +++ N I   ++ + E   
Sbjct  578   SISSLAEGSVTS--VGSVNPA----DRVLVRQKKASFEEASRQLINCIEQFLDTN-ETPY  630

Query  1907  YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEA  2086
             + K+++C+   R   I   E ++FND L+ L    + K L  F + +   GI LITK EA
Sbjct  631   FMKSMDCITVFRKEAIQFSEEQRFNDFLKALREKVEMKQLNHFWEIVVQDGITLITKDEA  690

Query  2087  PDSDVLESEARSFMT  2131
             P S V   EA+ F+ 
Sbjct  691   PGSSVTAEEAKKFLA  705



>gb|KFQ91744.1| X-ray repair cross-complementing protein 5, partial [Nipponia 
nippon]
Length=697

 Score =   200 bits (509),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 198/729 (27%), Positives = 333/729 (46%), Gaps = 99/729 (14%)
 Frame = +2

Query  140   GLILVIDVGPSM-------HCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M          L + +K+ +  V++++     DEV V+LFGT  T N+L
Sbjct  2     AIVLCLDVGFTMSNSASGEESSLEQAKKIMTKFVQRQVFAESKDEVAVVLFGTDGTMNDL  61

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  62    GRGDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKY  120

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+        EDQ+  I A +K  G+ +                   
Sbjct  121   EKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGISLQFFLPFPVDVDDGGGNTSA  173

Query  602   SVIVRMKQDLDAEKGIIDENDFLLSVFSK--ETSSKAAYVESA---------TSLMGAIR  748
             SV  +M ++    KG+ ++    + V  K   T  +   +E            S+   I 
Sbjct  174   SVHSQMHRNSFPRKGLTEQQKKGIDVVRKLMHTLDEGGGLEEIYTFRESLERLSMFKKIE  233

Query  749   TRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
              R +A P  L  G     + L I++  YK  +EE+   +    D         + ++   
Sbjct  234   RRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVKKIWTVVD----AKTLRRDDVQKE  284

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I 
Sbjct  285   TVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQ  344

Query  1103  RHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLT  1273
             RHYYM +    VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N  IGV  
Sbjct  345   RHYYMGNQVLKVFAAKDDEN--AAVAFSALVHALDELKVVAIVRYAYDR-RCNPQIGVAF  401

Query  1274  PNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAP  1453
             P + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L  
Sbjct  402   PYIKD---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKFIPTVDQLSAVDSLIDSMNLVY  457

Query  1454  SDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQ  1618
              D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  +
Sbjct  458   EDDDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPHVVKER  517

Query  1619  NKTVVDEFRRCFEL----------------KDNPKMKKSRKRLIREKPTGSDEEGERAST  1750
              +  +++ +  F L                KDN      +K      P   DEEG  +  
Sbjct  518   CQAPLEKVKALFPLKEVGKKKEEKTAQDIFKDNEDGPNPKK------PKIEDEEGSFSII  571

Query  1751  KVKSEKI---GNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKAL  1921
             K+    I   G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K +
Sbjct  572   KLAEGNITSVGSVNPAEDFRILVRQKNAD--FKDVSQQLINRIDQFLENK-GSQYYMKGI  628

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
              C+   R   +   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V
Sbjct  629   NCIRVFREEAVKLSKVQCFNDFLQALKSKMEDKALADFWEIMIQDRISLITKDEAEGSSV  688

Query  2102  LESEARSFM  2128
                EA   +
Sbjct  689   TSEEAEKVL  697



>gb|KFQ09175.1| X-ray repair cross-complementing protein 5, partial [Haliaeetus 
albicilla]
Length=720

 Score =   201 bits (510),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 197/731 (27%), Positives = 331/731 (45%), Gaps = 101/731 (14%)
 Frame = +2

Query  140   GLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M    P       + +K+    V++++     DEV VILFGT  T N+L
Sbjct  2     AIVLCLDVGFTMSSSAPGEESSLEQAKKIMMKFVQRQVFAESKDEVAVILFGTDGTRNDL  61

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  62    ASGDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPGSEKADFLDAIIVCMDLLQKETIGKKY  120

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIID  655
              K+ + L T+   P+        EDQ+  I A +K  G+ +  + +    D+D   G + 
Sbjct  121   EKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGISL-QIFLPFPMDVDDGGGDVS  172

Query  656   --------ENDF------------------LLSVFSKETSSKAAYVESAT----SLMGAI  745
                      N F                  L+    +E   +  Y    +    S+   I
Sbjct  173   ASVHSHMHRNSFPKNGLTEQQKEGIDVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKI  232

Query  746   RTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITS  922
               R +A P  L  G     + L I++  YK  +EE+   +    D         K ++  
Sbjct  233   ERRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVKKIWTVVD----AKTLRKDDVQK  283

Query  923   SYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNI  1099
                Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I
Sbjct  284   ETVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEGKCFSVLGFSRSSQI  343

Query  1100  MRHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVL  1270
              +HYYM +    VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N  IGV 
Sbjct  344   QQHYYMGNQVLKVFAAKDDEN--AAVAFSALVHALDELKAVAIVRYAYDR-RCNPQIGVA  400

Query  1271  TPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLA  1450
              P + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L 
Sbjct  401   FPYIKD---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKCIPTADQLSAVDSLIDSMNLV  456

Query  1451  PSDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLS  1615
               +      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  
Sbjct  457   YENDDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPCVVKE  516

Query  1616  QNKTVVDEFRRCFEL----------------KDNPKMKKSRKRLIREKPTGSDEEGERAS  1747
             + +  +++ +  F L                KDN      +K      P   DEEG  + 
Sbjct  517   RCQAPLEKVKALFPLKEVGKKKEEKTAQDIFKDNEDGPNPKK------PKTEDEEGSFSI  570

Query  1748  TKVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKA  1918
              K+       +G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K 
Sbjct  571   IKLAEGNVTSVGSVNPAEDFRILVRQKNAD--FKDVSQQLINRIDQFLENK-SSQYYMKG  627

Query  1919  LECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSD  2098
             + C+   R   +   + + FND L+ L +  ++K L  F + L    I+LITK E  +S 
Sbjct  628   ISCIRVFREEAMKLFKVQCFNDFLQALKSKVEDKALADFWEILIQDRISLITKDETEESS  687

Query  2099  VLESEARSFMT  2131
             V   EA  F+ 
Sbjct  688   VTSEEAEKFLA  698



>gb|KFV77700.1| X-ray repair cross-complementing protein 5, partial [Struthio 
camelus australis]
Length=696

 Score =   200 bits (509),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 197/717 (27%), Positives = 337/717 (47%), Gaps = 82/717 (11%)
 Frame = +2

Query  140   GLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DV  +M    P       + +KV +  V++++     DEV V+LFGT  T N+L
Sbjct  2     AIVLCLDVSFTMSNAAPGEESPLEQAKKVMTKFVQRQVFAESKDEVAVVLFGTDGTRNDL  61

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ +K  I  K
Sbjct  62    ASGDQ-YQNITVHRSLMLPDFDLLEDIQNVIQPGSEQADFLDAIIVCMDLL-QKQTIGKK  119

Query  476   GKKR-LCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD-----------------  601
              +KR + L T+   P+        EDQ+  I A +K  G  +                  
Sbjct  120   CEKRHIELFTDLSSPVS-------EDQLEIIVANLKKTGTLLQFFLPFSVDADDGGGDAS  172

Query  602   -SVIVRMKQDLDAEKGIIDENDFLLSVFSK--ETSSKAAYVESATSLMGAIRTRNIAPV-  769
              S     +++  A KGI ++    + V  K   T  +   +E   +   ++   ++    
Sbjct  173   ASAHSHEQRNSFARKGITEQQKEGIHVIKKLMHTLDEGGGLEEIYTFRESLERLSMFKKM  232

Query  770   ----TLYRGDFELSTKLKIKVWVYKKTSEERFP-TLKMYSDKAPPTDKFAKHEITSSYEY  934
                 T +     + + L I++  YK  +EE+   T  +   K    D   K  +     Y
Sbjct  233   ERRPTAWPCHLTIGSNLSIRIVAYKALTEEKVKKTWTIVDAKTLRRDDVQKETV-----Y  287

Query  935   KVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHY  1111
              +  D   ++  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I R Y
Sbjct  288   CLNDDDETEIQKDDTIQGFRYGSDIVPFSKVDEEQMKYKTEAKCFSVLGFSRSSQIRRQY  347

Query  1112  YMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNV  1282
             YM      VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N  IGV  P +
Sbjct  348   YMGSQVLKVFAAKDDEN--AAVAFSALIHALAELKVVAIVRYAYDR-RSNPQIGVAFPYI  404

Query  1283  SDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS  1462
              D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   D 
Sbjct  405   KD---AYECLIYVQLPYMEDLRQYMFSSLKN-NRKYIPTADQLSAVDSLIDSMNLIYEDD  460

Query  1463  -----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKT  1627
                  ++   P   PNP  QR Y  L+ K+ + +  +PP++  L  + +    +  + + 
Sbjct  461   DGESFEDLFKPSKIPNPHFQRLYQCLQHKAFYPNEPLPPIEPHLLEMLEMPSVVKERCQA  520

Query  1628  VVDEFRRCFELKDNPKMK--KSRKRLIRE---------KPTGSDEEGERASTKVKS---E  1765
              +++ +  F LKD  K K  K+ + + ++         KP   +EEG  +   +      
Sbjct  521   PLEKIKALFPLKDVGKKKEGKTAQDIFKDNNEDEPNPKKPKTENEEGGFSIISIAEGNVT  580

Query  1766  KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRN  1945
              +G++NP +DF+ ++ ++++    N+  Q++ N+I   +EN      Y KA+ C+   R 
Sbjct  581   SVGSVNPAKDFQILVRQKNA--VFNEVSQQLINRIDQFLENK-GSQYYMKAINCIKVFRE  637

Query  1946  GCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEA  2116
               I   + + FND L+ L +   +K L  F + +    I+LITK EA  S V   EA
Sbjct  638   EAIKLSKVQSFNDFLQALKSKVDDKALADFWEIVMQDRISLITKDEAGGSLVTSEEA  694



>ref|NP_033559.2| X-ray repair cross-complementing protein 5 [Mus musculus]
 sp|P27641.4|XRCC5_MOUSE RecName: Full=X-ray repair cross-complementing protein 5; AltName: 
Full=ATP-dependent DNA helicase 2 subunit 2; AltName: 
Full=ATP-dependent DNA helicase II 80 kDa subunit; AltName: 
Full=CTC box-binding factor 85 kDa subunit; Short=CTC85; Short=CTCBF; 
AltName: Full=DNA repair protein XRCC5; AltName: Full=Ku 
autoantigen protein p86 homolog; AltName: Full=Ku80; 
AltName: Full=Nuclear factor IV [Mus musculus]
 gb|AAH51660.1| Xrcc5 protein [Mus musculus]
 dbj|BAE40726.1| unnamed protein product [Mus musculus]
 gb|EDL00282.1| X-ray repair complementing defective repair in Chinese hamster 
cells 5 [Mus musculus]
Length=732

 Score =   200 bits (509),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 183/729 (25%), Positives = 338/729 (46%), Gaps = 89/729 (12%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M    P       + +KV ++ V++++     DE+ ++L+GT  T 
Sbjct  6     NKAAVVLCVDVGVAMGNSFPGEESPIEQAKKVMTMFVQRQVFSESKDEIALVLYGTDGTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQAL-EQLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L  +   Y+++TV R + + D DLL+ +  ++   S   DFLDA+IV MD++ ++   
Sbjct  66    NALAGKDQ-YQNITVCRHLMLPDFDLLEDIGNKIQPSSQQADFLDALIVCMDLIQRETIG  124

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRM--KQDLDAE  640
                GKK + + T+   P         +DQ+  I   +K  G+ +   +     K     E
Sbjct  125   KKFGKKHIEVFTDLSSPF-------SQDQLDVIICNLKKSGISLQFFLPFPIDKNGEPGE  177

Query  641   KGIIDEN-DFLLSVFSKE--TSSKAAYVESATSLMGAIR-----------TRNIAPVTLY  778
             +G +D   D L   F ++  T  +   +   T +M ++            + ++  + ++
Sbjct  178   RGDLDSGLDHLKPSFPQKGLTEQQKEGIRMVTRVMLSLEGEDGLDEIYSFSESLRQLCVF  237

Query  779   RG----------DFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSY  928
             +              +   L IK+  YK   +E+F    +  D         K +I    
Sbjct  238   KKIERRSMPWPCQLTIGPNLSIKIVAYKSIVQEKFKKSWVVVD----ARTLKKEDIQKET  293

Query  929   EYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMR  1105
              Y +  D   +V  E  I+GYRYG  ++P S  + E +K+K E K   +LGF  +S + R
Sbjct  294   VYCLNDDDETEVSKEDTIQGYRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVHR  353

Query  1106  HYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPN  1279
              ++M      VF A  + + A+ A+S+L  A+ ++N VAIVR  + + + N  +GV  P 
Sbjct  354   RFFMGHQVLKVFAAKDDEAAAV-ALSSLVHALDELNMVAIVRYAYDK-RSNPQVGVAFPY  411

Query  1280  VSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD  1459
             + D     + L +  LPF ED+R++ F S  N      P E Q  A D+L+  + L   +
Sbjct  412   IKD---AYECLVYVQLPFMEDLRQYMFSSLKN-NKKCTPTEAQLSAIDDLIDSMSLVKKN  467

Query  1460  SQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNK  1624
              +E ++ +       PNP  QR Y  L  ++ H    +PP+ + +  + DP  E+ ++ +
Sbjct  468   EEEDIVEDLFPTSKIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTEMKAKCE  527

Query  1625  TVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE-------------  1765
             + + + +  F L +   +KK  +   ++    + EEG  A+ K K+E             
Sbjct  528   SPLSKVKTLFPLTE--VIKKKNQVTAQDVFQDNHEEGP-AAKKYKTEKEEDHISISSLAE  584

Query  1766  ----KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQKALE  1924
                 K+G++NPV++F  ++ ++ +      + +E   ++   +E  L+ +    + K+++
Sbjct  585   GNITKVGSVNPVENFRFLVRQKIA------SFEEASLQLISHIEQFLDTNETLYFMKSMD  638

Query  1925  CLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVL  2104
             C+ A R   I   E ++FN  L  L    + K L  F + +   G+ LITK E P S + 
Sbjct  639   CIKAFREEAIQFSEEQRFNSFLEALREKVEIKQLNHFWEIVVQDGVTLITKDEGPGSSIT  698

Query  2105  ESEARSFMT  2131
               EA  F+ 
Sbjct  699   AEEATKFLA  707



>gb|KFP36887.1| X-ray repair cross-complementing protein 5, partial [Chlamydotis 
macqueenii]
Length=695

 Score =   200 bits (508),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 201/725 (28%), Positives = 333/725 (46%), Gaps = 99/725 (14%)
 Frame = +2

Query  140   GLILVIDVGPSM-------HCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M            + +KV +  V++++     DEV V+LFGT  T N+L
Sbjct  2     AIVLCLDVGFTMSNSASGEESSFEQAKKVMTKFVQRQVFAESKDEVAVVLFGTDGTRNDL  61

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  62    ANGDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKY  120

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+        EDQ+  I A +K  G+ +                   
Sbjct  121   EKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGISLQFFLPFPVDVGDGSGDTSA  173

Query  602   SVIVRMKQD-------LDAEKGIIDENDFLLSVFSKETSSKAAYVESAT----SLMGAIR  748
             SV   M ++        + +K  ID    L+    +E   +  Y    +    S+   I 
Sbjct  174   SVRSHMHRNPFPRKSLTEQQKEGIDVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIE  233

Query  749   TRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
              R +A P  L  G     + L I++  YK  +EE+    KM++     T    K ++   
Sbjct  234   RRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVK--KMWTVVDART--LRKDDVQKE  284

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I 
Sbjct  285   TVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQ  344

Query  1103  RHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLT  1273
             RHYYM +    VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N  IGV  
Sbjct  345   RHYYMGNQVLKVFAAKDDEN--AAVAFSALVHALDELKVVAIVRYAYDR-RSNPQIGVAF  401

Query  1274  PNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAP  1453
             P + D     + L +  LP+ ED+R++ F S  N     +P E Q  A D+L+  ++L  
Sbjct  402   PYIKD---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKCIPTEDQLSAVDSLIDSMNLIY  457

Query  1454  SDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQ  1618
              D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  +
Sbjct  458   EDDDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEVPRVVKER  517

Query  1619  NKTVVDEFRRCFEL----------------KDNPKMKKSRKRLIREKPTGSDEEGERAST  1750
              +  + + +  F L                KDN      +K      P   DEEG  +  
Sbjct  518   CQAPLAKVKALFPLKEVGKKKEEKTAQDIFKDNEDGPNPKK------PKIEDEEGSFSII  571

Query  1751  KVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKAL  1921
             K+       +G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K +
Sbjct  572   KLAEGNVTSVGSVNPAEDFRILVRQKNAD--FKDVSQQLINRIDQFLENK-SSQYYMKGI  628

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
              C+   R   +   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V
Sbjct  629   NCIRVFREEAVKLSKVQCFNDFLQALKSKVEDKALSDFWEIMIQDRISLITKNEAEGSLV  688

Query  2102  LESEA  2116
                EA
Sbjct  689   TSEEA  693



>dbj|BAE41402.1| unnamed protein product [Mus musculus]
Length=708

 Score =   200 bits (508),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 183/729 (25%), Positives = 338/729 (46%), Gaps = 89/729 (12%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M    P       + +KV ++ V++++     DE+ ++L+GT  T 
Sbjct  6     NKAAVVLCVDVGVAMGNSFPGEESPIEQAKKVMTMFVQRQVFSESKDEIALVLYGTDGTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQAL-EQLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L  +   Y+++TV R + + D DLL+ +  ++   S   DFLDA+IV MD++ ++   
Sbjct  66    NALAGKDQ-YQNITVCRHLMLPDFDLLEDIGNKIQPSSQQADFLDALIVCMDLIQRETIG  124

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRM--KQDLDAE  640
                GKK + + T+   P         +DQ+  I   +K  G+ +   +     K     E
Sbjct  125   KKFGKKHIEVFTDLSSPF-------SQDQLDVIICNLKKSGISLQFFLPFPIDKNGEPGE  177

Query  641   KGIIDEN-DFLLSVFSKE--TSSKAAYVESATSLMGAIR-----------TRNIAPVTLY  778
             +G +D   D L   F ++  T  +   +   T +M ++            + ++  + ++
Sbjct  178   RGDLDSGLDHLKPSFPQKGLTEQQKEGIRMVTRVMLSLEGEDGLDEIYSFSESLRQLCVF  237

Query  779   RG----------DFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSY  928
             +              +   L IK+  YK   +E+F    +  D         K +I    
Sbjct  238   KKIERRSMPWPCQLTIGPNLSIKIVAYKSIVQEKFKKSWVVVD----ARTLKKEDIQKET  293

Query  929   EYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMR  1105
              Y +  D   +V  E  I+GYRYG  ++P S  + E +K+K E K   +LGF  +S + R
Sbjct  294   VYCLNDDDETEVSKEDTIQGYRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVHR  353

Query  1106  HYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPN  1279
              ++M      VF A  + + A+ A+S+L  A+ ++N VAIVR  + + + N  +GV  P 
Sbjct  354   RFFMGHQVLKVFAAKDDEAAAV-ALSSLVHALDELNMVAIVRYAYDK-RSNPQVGVAFPY  411

Query  1280  VSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD  1459
             + D     + L +  LPF ED+R++ F S  N      P E Q  A D+L+  + L   +
Sbjct  412   IKD---AYECLVYVQLPFMEDLRQYMFSSLKN-NKKCTPTEAQLSAIDDLIDSMSLVKKN  467

Query  1460  SQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNK  1624
              +E ++ +       PNP  QR Y  L  ++ H    +PP+ + +  + DP  E+ ++ +
Sbjct  468   EEEDIVEDLFPTSKIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTEMKAKCE  527

Query  1625  TVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE-------------  1765
             + + + +  F L +   +KK  +   ++    + EEG  A+ K K+E             
Sbjct  528   SPLSKVKTLFPLTE--VIKKKNQVTAQDVFQDNHEEGP-AAKKYKTEKEEDHISISSLAE  584

Query  1766  ----KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQKALE  1924
                 K+G++NPV++F  ++ ++ +      + +E   ++   +E  L+ +    + K+++
Sbjct  585   GNITKVGSVNPVENFRFLVRQKIA------SFEEASLQLISHIEQFLDTNETLYFMKSMD  638

Query  1925  CLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVL  2104
             C+ A R   I   E ++FN  L  L    + K L  F + +   G+ LITK E P S + 
Sbjct  639   CIKAFREEAIQFSEEQRFNSFLEALREKVEIKQLNHFWEIVVQDGVTLITKDEGPGSSIT  698

Query  2105  ESEARSFMT  2131
               EA  F+ 
Sbjct  699   AEEATKFLA  707



>gb|AAH29218.1| Xrcc5 protein, partial [Mus musculus]
Length=731

 Score =   200 bits (509),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 183/729 (25%), Positives = 338/729 (46%), Gaps = 89/729 (12%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M    P       + +KV ++ V++++     DE+ ++L+GT  T 
Sbjct  5     NKAAVVLCVDVGVAMGNSFPGEESPIEQAKKVMTMFVQRQVFSESKDEIALVLYGTDGTD  64

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQAL-EQLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L  +   Y+++TV R + + D DLL+ +  ++   S   DFLDA+IV MD++ ++   
Sbjct  65    NALAGKDQ-YQNITVCRHLMLPDFDLLEDIGNKIQPSSQQADFLDALIVCMDLIQRETIG  123

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRM--KQDLDAE  640
                GKK + + T+   P         +DQ+  I   +K  G+ +   +     K     E
Sbjct  124   KKFGKKHIEVFTDLSSPF-------SQDQLDVIICNLKKSGISLQFFLPFPIDKNGEPGE  176

Query  641   KGIIDEN-DFLLSVFSKE--TSSKAAYVESATSLMGAIR-----------TRNIAPVTLY  778
             +G +D   D L   F ++  T  +   +   T +M ++            + ++  + ++
Sbjct  177   RGDLDSGLDHLKPSFPQKGLTEQQKEGIRMVTRVMLSLEGEDGLDEIYSFSESLRQLCVF  236

Query  779   RG----------DFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSY  928
             +              +   L IK+  YK   +E+F    +  D         K +I    
Sbjct  237   KKIERRSMPWPCQLTIGPNLSIKIVAYKSIVQEKFKKSWVVVD----ARTLKKEDIQKET  292

Query  929   EYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMR  1105
              Y +  D   +V  E  I+GYRYG  ++P S  + E +K+K E K   +LGF  +S + R
Sbjct  293   VYCLNDDDETEVSKEDTIQGYRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVHR  352

Query  1106  HYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPN  1279
              ++M      VF A  + + A+ A+S+L  A+ ++N VAIVR  + + + N  +GV  P 
Sbjct  353   RFFMGHQVLKVFAAKDDEAAAV-ALSSLVHALDELNMVAIVRYAYDK-RSNPQVGVAFPY  410

Query  1280  VSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD  1459
             + D     + L +  LPF ED+R++ F S  N      P E Q  A D+L+  + L   +
Sbjct  411   IKD---AYECLVYVQLPFMEDLRQYMFSSLKN-NKKCTPTEAQLSAIDDLIDSMSLVKKN  466

Query  1460  SQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNK  1624
              +E ++ +       PNP  QR Y  L  ++ H    +PP+ + +  + DP  E+ ++ +
Sbjct  467   EEEDIVEDLFPTSKIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTEMKAKCE  526

Query  1625  TVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE-------------  1765
             + + + +  F L +   +KK  +   ++    + EEG  A+ K K+E             
Sbjct  527   SPLSKVKTLFPLTE--VIKKKNQVTAQDVFQDNHEEGP-AAKKYKTEKEEDHISISSLAE  583

Query  1766  ----KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQKALE  1924
                 K+G++NPV++F  ++ ++ +      + +E   ++   +E  L+ +    + K+++
Sbjct  584   GNITKVGSVNPVENFRFLVRQKIA------SFEEASLQLISHIEQFLDTNETLYFMKSMD  637

Query  1925  CLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVL  2104
             C+ A R   I   E ++FN  L  L    + K L  F + +   G+ LITK E P S + 
Sbjct  638   CIKAFREEAIQFSEEQRFNSFLEALREKVEIKQLNHFWEIVVQDGVTLITKDEGPGSSIT  697

Query  2105  ESEARSFMT  2131
               EA  F+ 
Sbjct  698   AEEATKFLA  706



>dbj|BAE39415.1| unnamed protein product [Mus musculus]
Length=732

 Score =   200 bits (509),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 183/729 (25%), Positives = 338/729 (46%), Gaps = 89/729 (12%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M    P       + +KV ++ V++++     DE+ ++L+GT  T 
Sbjct  6     NKAAVVLCVDVGVAMGNSFPGEESPIEQAKKVMTMFVQRQVFSESKDEIALVLYGTDGTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQAL-EQLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L  +   Y+++TV R + + D DLL+ +  ++   S   DFLDA+IV MD++ ++   
Sbjct  66    NALAGKDQ-YQNITVCRHLMLPDFDLLEDIGNKIQPSSQQADFLDALIVCMDLIQRETIG  124

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRM--KQDLDAE  640
                GKK + + T+   P         +DQ+  I   +K  G+ +   +     K     E
Sbjct  125   KKFGKKHIEVFTDLSSPF-------SQDQLDVIICNLKKSGISLQFFLPFPIDKNGEPGE  177

Query  641   KGIIDEN-DFLLSVFSKE--TSSKAAYVESATSLMGAIR-----------TRNIAPVTLY  778
             +G +D   D L   F ++  T  +   +   T +M ++            + ++  + ++
Sbjct  178   RGDLDSGLDHLKPSFPQKGLTEQQKEGIRMVTRVMLSLEGEDGLDEIYSFSESLRQLCVF  237

Query  779   RG----------DFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSY  928
             +              +   L IK+  YK   +E+F    +  D         K +I    
Sbjct  238   KKIERRSMPWPCQLTIGPNLSIKIVAYKSIVQEKFKKSWVVVD----ARTLKKEDIQKET  293

Query  929   EYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMR  1105
              Y +  D   +V  E  I+GYRYG  ++P S  + E +K+K E K   +LGF  +S + R
Sbjct  294   VYCLNDDDETEVSKEDTIQGYRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVHR  353

Query  1106  HYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPN  1279
              ++M      VF A  + + A+ A+S+L  A+ ++N VAIVR  + + + N  +GV  P 
Sbjct  354   RFFMGHQVLKVFAAKDDEAAAV-ALSSLVHALDELNMVAIVRYAYDK-RSNPQVGVAFPY  411

Query  1280  VSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD  1459
             + D     + L +  LPF ED+R++ F S  N      P E Q  A D+L+  + L   +
Sbjct  412   IKD---AYECLVYVQLPFMEDLRQYMFSSLKN-NKKCTPTEAQLSAIDDLIDSMSLVKKN  467

Query  1460  SQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNK  1624
              +E ++ +       PNP  QR Y  L  ++ H    +PP+ + +  + DP  E+ ++ +
Sbjct  468   EEEDIVEDLFPTSKIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTEMKAKCE  527

Query  1625  TVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE-------------  1765
             + + + +  F L +   +KK  +   ++    + EEG  A+ K K+E             
Sbjct  528   SPLSKVKTLFPLTE--VIKKKNQVTAQDVFQDNHEEGP-AAKKYKTEKEEDHISISSLAE  584

Query  1766  ----KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQKALE  1924
                 K+G++NPV++F  ++ ++ +      + +E   ++   +E  L+ +    + K+++
Sbjct  585   GNITKVGSVNPVENFRFLVRQKIA------SFEEASLQLISHIEQFLDTNETLYFMKSMD  638

Query  1925  CLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVL  2104
             C+ A R   I   E ++FN  L  L    + K L  F + +   G+ LITK E P S + 
Sbjct  639   CIKAFREEAIQFSEEQRFNSFLEALREKVEIKQLNHFWEIVVQDGVTLITKDEGPGSSIT  698

Query  2105  ESEARSFMT  2131
               EA  F+ 
Sbjct  699   AEEATKFLA  707



>ref|XP_004674863.1| PREDICTED: X-ray repair cross-complementing protein 5 [Condylura 
cristata]
Length=740

 Score =   200 bits (509),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 190/739 (26%), Positives = 343/739 (46%), Gaps = 101/739 (14%)
 Frame = +2

Query  122   MARNRE--GLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR+R    ++L +DVGP+M+   P  E       KV ++ V++++     DE+ ++LFG
Sbjct  1     MARSRSKAAVVLCLDVGPAMNNSFPGEESPFELAKKVMTMFVQRQVFAESKDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  E   Y ++TV R + + D DLL+ +E ++  GS   DF+DA+IV MD+ I
Sbjct  61    TDGTENALAGEGQ-YRNITVHRHLMLPDFDLLEDIESKIQLGSQHADFVDALIVCMDV-I  118

Query  452   KKYGITNKGKKR-LCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVR--MK  622
             ++  +  K +KR + + T+   P         +DQ+  I   +K  G+ +   +     K
Sbjct  119   QQETVGKKFEKRHIEVFTDLSSPFS-------KDQLDIIIQNLKKFGISLQFFLPFPVGK  171

Query  623   QDLDAE-----------------KGIIDENDFLLSVFSKETSSKA---------AYVESA  724
             +D   +                 KGI ++    + +  +   S           ++ ES 
Sbjct  172   EDGTGDSGNSKLGSGHQGPSFPPKGITEQQKEGIQIVKQVMMSLEGEDGLDEIYSFSESL  231

Query  725   TSLMGAIRT-RNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKF  901
               L    +T R+  P   +     + + L IK+  YK  ++E+        D        
Sbjct  232   RQLCVFKKTERHSMP---WPCQLTIGSNLSIKIVAYKSITQEKVKKTWTVVD----ARTL  284

Query  902   AKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLG  1078
              + +I     Y +  D   +VP E  I+GYRYG  ++P S  + E +K+K E K   +LG
Sbjct  285   RREDIQKETVYCLNDDDETEVPKEDIIQGYRYGSDIIPFSKVDQEQMKYKSEGKCFSVLG  344

Query  1079  FTDASNIMRHYYM--KDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             F  +S + R Y+M  +   VF A  + + A+ A+S+L  A+++++ VA+VR  + + + N
Sbjct  345   FCRSSQVHRRYFMGYQVLKVFAAKDDQAAAV-ALSSLIHALEELDMVAVVRYAYDK-RAN  402

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
               +GV  P + D     + L +  LPF ED+R++ F S  N      P E Q  A D L+
Sbjct  403   PQVGVAFPYIKD---TYECLVYVQLPFMEDLRQYMFSSLKN-NKKYTPTEAQLSAVDALI  458

Query  1433  KMLDLAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDP  1597
               + L   D +E  + +       PNP  QR +  L  ++ H    +PP+ + +  + DP
Sbjct  459   DSMSLVKKDEEEDTIEDLFPNTKIPNPQFQRLFQCLLHRALHPQEPLPPIQQHILNMLDP  518

Query  1598  DPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGER-ASTKVKSEK--  1768
               E+ ++ +  + + +  F L +  K    ++  +  +    D +GE   S K K+E+  
Sbjct  519   PMEVTAKCQVPLSKIKSLFPLTEAVK----KRDQVTAQDIFQDNQGEGPISKKFKTEEGE  574

Query  1769  ---------------IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGD  1903
                            +G++NP ++F  ++ ++      N + +E+ +++   +E  L+ +
Sbjct  575   ANFSVSNLAEGHVTSVGSVNPAENFRVLVRQK------NTSFEEVSHQLISRIEQFLDTN  628

Query  1904  T---YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALIT  2074
                 + K+++C+   R   I   E ++FND L+ L    + K L  F + +   G+ LIT
Sbjct  629   ETPYFMKSMDCIKVFREEAIQFSEERRFNDFLKALREKVEMKQLNHFWEIIIQDGVTLIT  688

Query  2075  KTEAPDSDVLESEARSFMT  2131
             K E   S V   EA+ F+ 
Sbjct  689   KDEVSGSSVTAEEAKKFLA  707



>ref|XP_009580184.1| PREDICTED: X-ray repair cross-complementing protein 5 [Fulmarus 
glacialis]
Length=710

 Score =   200 bits (508),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 193/706 (27%), Positives = 329/706 (47%), Gaps = 89/706 (13%)
 Frame = +2

Query  185   LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDD  364
             L + +KV +  V++++     DEV V+LFGT  T N+L  E   Y+++TV RS+ + D D
Sbjct  12    LEQAKKVMTKFVQRQVFAESKDEVAVVLFGTDGTGNDLASEDQ-YQNITVHRSLMLPDFD  70

Query  365   LLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGT  541
             LL+ ++ + + GS   DFLDA+IV MD++ K+       K+ + L T+   P+       
Sbjct  71    LLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKYEKRHIELFTDLSSPVS------  124

Query  542   KEDQVSTIAAQMKAHGMRMD-----------------SVIVRMKQDLDAEKGIIDEND--  664
              EDQ+  I A +K  G+ +                  SV  ++ ++    KG+ ++ +  
Sbjct  125   -EDQLEIIIANLKKTGISLQFFLPFPVDVDGGGDTSASVCSQVHRNSFPRKGLTEQQNEG  183

Query  665   -----FLLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTLYRGDFELSTKLKI  814
                   L+    +E   +  Y    +    S+   I  R++A P  L  G     + L I
Sbjct  184   IHVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIERRSMAWPCQLTIG-----SNLSI  238

Query  815   KVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYR  994
             ++  YK   EE+    KM++     T    K ++     Y +  D   +V  +  I+G+R
Sbjct  239   RIVAYKSVMEEKVK--KMWTVVDAKT--LRKDDVQKETVYCLNDDDETEVQKDDTIQGFR  294

Query  995   YGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIADPENSKAI  1165
             YG  +VP S  + E +K+K E K   +LGF+ +S I RHYYM +    VF A  ++  A 
Sbjct  295   YGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHYYMGNQVLKVF-AGKDDENAA  353

Query  1166  LAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDV  1345
             +A SAL  A+ ++  VAIVR  + + + N  IGV  P + D     + L +  LP+ ED+
Sbjct  354   VAFSALVHALNELKVVAIVRYAYDR-RCNPQIGVAFPYIKD---AYECLIYVQLPYMEDL  409

Query  1346  REFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD-----SQEALLPEFTPNPVLQR  1510
             R++ F S  N     +P   Q  A D+L+   +L   +     S++   P   PNP  QR
Sbjct  410   RQYIFSSLKN-NKKFVPTADQLSAVDSLIDSTNLVCENDDGETSEDLFKPSKIPNPHFQR  468

Query  1511  YYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL----------  1660
              Y  L+ K+ H +  +PP+++ L  + +    +  + +  +++ +  F L          
Sbjct  469   LYQCLQHKAFHPNEPLPPIEQHLLEMLEMPRVVKERCQAPLEKVKALFPLKEVGKKKEEK  528

Query  1661  ------KDNPKMKKSRKRLIREKPTGSDEEGERASTKVKS---EKIGNINPVQDFEDMIS  1813
                   KDN      +K      P   DEEG  +  K+       +G++NP +DF  ++ 
Sbjct  529   TAQDIFKDNEDGPNPKK------PKIEDEEGSFSIIKLAEGNVTSVGSVNPAEDFRILVR  582

Query  1814  RRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLR  1993
             ++++        Q++ N++   +EN      Y K + C+   R   I   + + FND L+
Sbjct  583   QKNTD--FEDVSQQLINRVDQFLENK-GSQYYMKGINCIRVFREEAIKLSKVQCFNDFLQ  639

Query  1994  NLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
              L +  ++K L  F + +    I+LITK EA  S V   EA  F+ 
Sbjct  640   ALKSKVEDKALADFWEVMTQDRISLITKDEAEGSLVTTEEAEKFLA  685



>dbj|BAE38207.1| unnamed protein product [Mus musculus]
Length=732

 Score =   200 bits (508),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 183/729 (25%), Positives = 338/729 (46%), Gaps = 89/729 (12%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M    P       + +KV ++ V++++     DE+ ++L+GT  T 
Sbjct  6     NKAAVVLCVDVGVAMGNSFPGEESPIEQAKKVMTMFVQRQVFSESKDEIALVLYGTDGTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQAL-EQLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L  +   Y+++TV R + + D DLL+ +  ++   S   DFLDA+IV MD++ ++   
Sbjct  66    NALAGKDQ-YQNITVCRHLMLPDFDLLEDIGNKIQPSSQQADFLDALIVCMDLIQRETIG  124

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRM--KQDLDAE  640
                GKK + + T+   P         +DQ+  I   +K  G+ +   +     K     E
Sbjct  125   KKFGKKHIEVFTDLGSPF-------SQDQLDVIICNLKKSGISLQFFLPFPIDKNGEPGE  177

Query  641   KGIIDEN-DFLLSVFSKE--TSSKAAYVESATSLMGAIR-----------TRNIAPVTLY  778
             +G +D   D L   F ++  T  +   +   T +M ++            + ++  + ++
Sbjct  178   RGDLDSGLDHLKPSFPQKGLTEQQKEGIRMVTRVMLSLEGEDGLDEIYSFSESLRQLCVF  237

Query  779   RG----------DFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSY  928
             +              +   L IK+  YK   +E+F    +  D         K +I    
Sbjct  238   KKIERRSMPWPCQLTIGPNLSIKIVAYKSIVQEKFKKSWVVVD----ARTLKKEDIQKET  293

Query  929   EYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMR  1105
              Y +  D   +V  E  I+GYRYG  ++P S  + E +K+K E K   +LGF  +S + R
Sbjct  294   VYCLNDDDETEVSKEDTIQGYRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVHR  353

Query  1106  HYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPN  1279
              ++M      VF A  + + A+ A+S+L  A+ ++N VAIVR  + + + N  +GV  P 
Sbjct  354   RFFMGHQVLKVFAAKDDEAAAV-ALSSLVHALDELNMVAIVRYAYDK-RSNPQVGVAFPY  411

Query  1280  VSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD  1459
             + D     + L +  LPF ED+R++ F S  N      P E Q  A D+L+  + L   +
Sbjct  412   IKD---AYECLVYVQLPFMEDLRQYMFSSLKN-NKKCTPTEAQLSAIDDLIDSMSLVKKN  467

Query  1460  SQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNK  1624
              +E ++ +       PNP  QR Y  L  ++ H    +PP+ + +  + DP  E+ ++ +
Sbjct  468   EEEDIVEDLFPTSKIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTEMKAKCE  527

Query  1625  TVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE-------------  1765
             + + + +  F L +   +KK  +   ++    + EEG  A+ K K+E             
Sbjct  528   SPLSKVKTLFPLTE--VIKKKNQVTAQDVFQDNHEEGP-AAKKYKTEKEEDHISISSLAE  584

Query  1766  ----KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQKALE  1924
                 K+G++NPV++F  ++ ++ +      + +E   ++   +E  L+ +    + K+++
Sbjct  585   GNITKVGSVNPVENFRFLVRQKIA------SFEEASLQLISHIEQFLDTNETLYFMKSMD  638

Query  1925  CLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVL  2104
             C+ A R   I   E ++FN  L  L    + K L  F + +   G+ LITK E P S + 
Sbjct  639   CIKAFREEAIQFSEEQRFNSFLEALREKVEIKQLNHFWEIVVQDGVTLITKDEGPGSSIT  698

Query  2105  ESEARSFMT  2131
               EA  F+ 
Sbjct  699   AEEATKFLA  707



>ref|XP_009951473.1| PREDICTED: X-ray repair cross-complementing protein 5 [Leptosomus 
discolor]
Length=711

 Score =   200 bits (508),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 190/708 (27%), Positives = 326/708 (46%), Gaps = 78/708 (11%)
 Frame = +2

Query  164   GPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRS  343
              P     L + +K+ +  V++++     DEV V+LFGT  T N L      Y+++TV RS
Sbjct  5     APGEESSLEQAKKIMTKFVQRQVFAESKDEVAVVLFGTDGTRNGLASGDQ-YQNITVHRS  63

Query  344   IKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPI  520
             + + D DLL+ ++ + + GS   DFLDA+IV MD++ K+       K+ + L T+   P+
Sbjct  64    LMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKYEKRHIELFTDLSSPV  123

Query  521   KDPYEGTKEDQVSTIAAQMKAHGMRMD----------------SVIVR--MKQDLDAEKG  646
                     EDQ+  I A +K  G+ +                 S  +R  M ++    KG
Sbjct  124   S-------EDQLEIIIANLKKTGISLQFFLPFPVDVDDGGGDTSATIRSHMHRNCFPRKG  176

Query  647   IIDENDFLLSVFSK--ETSSKAAYVESA---------TSLMGAIRTRNIA-PVTLYRGDF  790
             + ++    + V  K   T  +   +E            S+   I  R +A P  L  G  
Sbjct  177   LTEQQKEGVDVVRKLMHTLDEGGGLEEIYTFRESLERLSMFKKIERRPMAWPCQLTIG--  234

Query  791   ELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPP  970
                + L I++  YK  +EE+   +    D         K ++     Y +  D   +V  
Sbjct  235   ---SNLSIRIVAYKSVTEEKVKKIWTVVD----AKTLRKDDVQKETVYCLNDDDETEVQR  287

Query  971   EQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA  1141
             +  I+G+RYG  ++P S  + E +K+K E K   +LGF+ +S + RH YM +    VF A
Sbjct  288   DDTIQGFRYGSDIIPFSKEDEEQMKYKTEAKCFSVLGFSRSSQVQRHCYMGNQVLKVFAA  347

Query  1142  DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFN  1321
               + + A+ A SAL  A+ ++  VAIVR  + + + N  +GV  P + D     + L + 
Sbjct  348   KGDENAAV-AFSALVHALDELKVVAIVRYAYDR-RCNPQVGVAFPYIKD---AYECLIYV  402

Query  1322  ALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLPEF  1486
              LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   D      ++   P  
Sbjct  403   QLPYMEDLRQYIFSSLKN-NKKCIPTADQLSAVDSLIDSMNLVSEDDDGETFEDLFKPSK  461

Query  1487  TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKD  1666
              PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  + +  +++ +  F LK+
Sbjct  462   IPNPQFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPSVVKERCQAPLEKIKALFPLKE  521

Query  1667  NPK----------MKKSRKRLIREKPTGSDEEGERASTKVKS---EKIGNINPVQDFEDM  1807
               K           K +    I +KP   DEEG  +  K+       +G++NP +DF  +
Sbjct  522   VGKKKEEKTAQDIFKDNEDGPIPKKPKMEDEEGGFSIMKLAEGNVTSVGSVNPGEDFRIL  581

Query  1808  ISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDL  1987
             + ++++        Q++ N+I   +EN      Y K + C+   R   +   + + FND 
Sbjct  582   VKQKNAD--FRDVSQQLINRIDQFLENK-GSQYYMKGINCIRVFREEAVKLSKVQCFNDF  638

Query  1988  LRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             LR L +  ++K L  F + +    I+LITK EA  S V   EA  F+ 
Sbjct  639   LRALKSKVEDKALADFWEIMIQDRISLITKDEAEGSSVTSEEAEKFLA  686



>ref|XP_008823904.1| PREDICTED: X-ray repair cross-complementing protein 5 [Nannospalax 
galili]
Length=731

 Score =   200 bits (508),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 188/731 (26%), Positives = 340/731 (47%), Gaps = 94/731 (13%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M    P       + +KV ++ +++++     DE+ ++LFGT  T 
Sbjct  6     NKAAVVLCMDVGFAMGNSFPGEESPFEQAKKVMTMFIQRQVFSESKDEIALVLFGTDSTE  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L  E   Y+++TV R + + D DLL+ +E ++  G    DFLDA+IV MD++ ++   
Sbjct  66    NALAGEDQ-YQNITVHRHLMLPDFDLLEDIESRIQLGPQQADFLDALIVCMDLIQRETIG  124

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRM-----------DSVIV  613
                 +K + + T+   P         +DQ+  I   +K  G+ +           D    
Sbjct  125   KKFERKHIEVFTDLSSPFS-------QDQLDIIIHNLKKSGISLQFFLPFPLGKNDETGD  177

Query  614   RMKQDLDA--------EKGIIDEND--------FLLSVFSKETSSKA-AYVESATSL--M  736
             R    L          +KGI ++           ++S+  +E   +  ++ ES   L   
Sbjct  178   RGDGSLGLDHRGPSFPQKGITEQQKEGARMVKKVMMSLEGEEGLDEIYSFSESLRQLCVF  237

Query  737   GAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHE  913
               I  R++  P  L  G     + L IK+  YK   +E+     +  D         K +
Sbjct  238   KKIERRSMPWPCQLTIG-----SNLSIKIIAYKSILQEKVKKTWVVVD----ARSLKKED  288

Query  914   ITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDA  1090
             I     Y +  D   +V  E  I+G+RYG  +VP S  + E +K+K E K   +LGF  +
Sbjct  289   IQKETVYCLNDDDETEVSKEDTIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCRS  348

Query  1091  SNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIG  1264
             S + R ++M +    VF A  + + A+ A+S+L  A+ +++ VAIVR V+ + + N  +G
Sbjct  349   SQVHRRFFMGNQILKVFAAKDDEAAAV-ALSSLVHALDELDMVAIVRYVYDR-RSNPQVG  406

Query  1265  VLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLD  1444
             V  P + D     + L +  LPF ED+R++ F S  N   +  P E Q  A D+L+  + 
Sbjct  407   VAFPYIKD---AYECLVYVQLPFMEDLRQYMFSSLKNKKCT--PTEAQLSAIDDLIDSMS  461

Query  1445  LAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPEL  1609
             L   D +E    +       PNP  QR +H L  ++ H    +PP+ + +  + DP  E+
Sbjct  462   LVKKDEEEDTFEDLFPTTKIPNPEFQRLFHCLLHRALHPKERLPPIQQHILSMLDPPTEV  521

Query  1610  LSQNKTVVDEFRRCFELKDNPKMKK--SRKRLIREKPTGSD---------EEGERASTKV  1756
              ++ +  + + +  F L ++ K K   + + + ++   G+          EEG  + + +
Sbjct  522   TAKCQVPLSKIKTLFPLTESIKRKDQVTAQDIFQDNDEGASIAKKCKTGGEEGHFSVSSL  581

Query  1757  KS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQKA  1918
                   K+G++NPV++F  ++ ++ +      + +E+  ++   +E  L+ +    + K+
Sbjct  582   AEGNVTKVGSVNPVENFRALVRQKIT------SFEEVSLQLINHIEQFLDTNETPYFMKS  635

Query  1919  LECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSD  2098
             +EC+ A R   I   E + FN  L+      + K    F + +   GI LITK EAP S 
Sbjct  636   IECIKAFREEAIQFSEEQHFNSFLKAFREKVEIKQFSHFWEIVVQDGITLITKDEAPGSS  695

Query  2099  VLESEARSFMT  2131
             V   EA+ F+ 
Sbjct  696   VTAEEAKKFLV  706



>ref|XP_009470504.1| PREDICTED: X-ray repair cross-complementing protein 5 [Nipponia 
nippon]
Length=712

 Score =   199 bits (507),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 195/708 (28%), Positives = 327/708 (46%), Gaps = 91/708 (13%)
 Frame = +2

Query  185   LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDD  364
             L + +K+ +  V++++     DEV V+LFGT  T N+L      Y+++TV RS+ + D D
Sbjct  12    LEQAKKIMTKFVQRQVFAESKDEVAVVLFGTDGTMNDLGRGDQ-YQNITVHRSLMLPDFD  70

Query  365   LLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGT  541
             LL+ ++ + + GS   DFLDA+IV MD++ K+       K+ + L T+   P+       
Sbjct  71    LLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKYEKRHIELFTDLSSPVS------  124

Query  542   KEDQVSTIAAQMKAHGMRMD------------------SVIVRMKQDLDAEKGIIDENDF  667
              EDQ+  I A +K  G+ +                   SV  +M ++    KG+ ++   
Sbjct  125   -EDQLEIIIANLKKTGISLQFFLPFPVDVDDGGGNTSASVHSQMHRNSFPRKGLTEQQKK  183

Query  668   LLSVFSK--ETSSKAAYVESA---------TSLMGAIRTRNIA-PVTLYRGDFELSTKLK  811
              + V  K   T  +   +E            S+   I  R +A P  L  G     + L 
Sbjct  184   GIDVVRKLMHTLDEGGGLEEIYTFRESLERLSMFKKIERRPMAWPCQLTIG-----SNLS  238

Query  812   IKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGY  991
             I++  YK  +EE+   +    D         + ++     Y +  D   +V  +  I+G+
Sbjct  239   IRIVAYKSVTEEKVKKIWTVVD----AKTLRRDDVQKETVYCLNDDDETEVQKDDTIQGF  294

Query  992   RYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA-DPENSK  1159
             RYG  +VP S  + E +K+K E K   +LGF+ +S I RHYYM +    VF A D EN  
Sbjct  295   RYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHYYMGNQVLKVFAAKDDEN--  352

Query  1160  AILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAE  1339
             A +A SAL  A+ ++  VAIVR  + + + N  IGV  P + D     + L +  LP+ E
Sbjct  353   AAVAFSALVHALDELKVVAIVRYAYDR-RCNPQIGVAFPYIKD---AYECLIYVQLPYME  408

Query  1340  DVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLPEFTPNPVL  1504
             D+R++ F S  N     +P   Q  A D+L+  ++L   D      ++   P   PNP  
Sbjct  409   DLRQYIFSSLKN-NKKFIPTVDQLSAVDSLIDSMNLVYEDDDGETFEDLFKPSKIPNPHF  467

Query  1505  QRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL--------  1660
             QR Y  L+ K+ H +  +PP+++ L  + +    +  + +  +++ +  F L        
Sbjct  468   QRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPHVVKERCQAPLEKVKALFPLKEVGKKKE  527

Query  1661  --------KDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSEKI---GNINPVQDFEDM  1807
                     KDN +   + K     KP   DEEG  +  K+    I   G++NP +DF  +
Sbjct  528   EKTAQDIFKDNSEDGPNPK-----KPKIEDEEGSFSIIKLAEGNITSVGSVNPAEDFRIL  582

Query  1808  ISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDL  1987
             + ++++        Q++ N+I   +EN      Y K + C+   R   +   + + FND 
Sbjct  583   VRQKNAD--FKDVSQQLINRIDQFLENK-GSQYYMKGINCIRVFREEAVKLSKVQCFNDF  639

Query  1988  LRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             L+ L +  ++K L  F + +    I+LITK EA  S V   EA  F+ 
Sbjct  640   LQALKSKMEDKALADFWEIMIQDRISLITKDEAEGSSVTSEEAEKFLA  687



>gb|EDL75243.1| X-ray repair complementing defective repair in Chinese hamster 
cells 5, isoform CRA_a [Rattus norvegicus]
Length=732

 Score =   199 bits (507),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 191/729 (26%), Positives = 334/729 (46%), Gaps = 89/729 (12%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M    P       + +KV ++ V++++     DE+ ++L+GT  T 
Sbjct  6     NKAAVVLCMDVGVAMGNSFPGEESPLEQAKKVMTMFVQRQVFSESKDEIALVLYGTESTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQAL-EQLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L  +   Y+++TV R + + D DLL+ +  ++   S   DFLDA+IV MD++ ++   
Sbjct  66    NALAGKDQ-YQNITVHRHLMLPDFDLLEDIGNKIQPSSQQADFLDALIVCMDLIQRETIG  124

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKG  646
                GKK + + T+   P         +DQ+  I   +K   + +    +    D + E G
Sbjct  125   KKFGKKHIEVFTDLSSPFS-------QDQLDIIICNLKKSSISL-QFFLPFPIDKNGEPG  176

Query  647   IIDEND----------------------------FLLSVFSKETSSKA-AYVESATSL--  733
               +++D                             +LS+  K+   +  ++ ES   L  
Sbjct  177   ETEDHDSSFDHCAPSFPQKGLTEQQKEGIHMVTRVMLSLEGKDGLDEIYSFSESLQQLCI  236

Query  734   MGAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKH  910
                I  R++  P  L  G       L I++  YK   +E+F    +  D         K 
Sbjct  237   FKKIERRSLPWPCQLTIG-----PNLSIRIVAYKSIVQEKFKKSWVVVD----ARTLKKE  287

Query  911   EITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTD  1087
             +I     Y +  D   +V  E  I+G+RYG  ++P S  + E +K+K E K   +LGF  
Sbjct  288   DIQKETVYCLNDDDETEVSKEDTIQGFRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCK  347

Query  1088  ASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTI  1261
             +S + R ++M      VF A  + + A+ A+S+L  A+ ++N VAIVR  + + + N  +
Sbjct  348   SSQVHRRFFMGHQVLKVFAAKDDEAAAV-ALSSLVHALDELNMVAIVRYAYDK-RANPQV  405

Query  1262  GVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKML  1441
             GV  P + D     + L +  LPF ED+R++ F S  N      P E Q  A D+L+  +
Sbjct  406   GVAFPFIKD---AYECLVYVQLPFMEDLRQYMFSSLKN-NKKCTPTEAQLSAIDDLIDSM  461

Query  1442  DLAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPE  1606
              L   + +E ++ +       PNP  QR Y  L  ++ H    +PP+ + +  + DP  E
Sbjct  462   SLVKKNEEEDIIEDLFPTSKIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTE  521

Query  1607  LLSQNKTVVDEFRRCFEL------KDNPKMKKSRKRLIREKPTG-----SDEEGERASTK  1753
             + ++ +  + + +  F L      KD    +   +  I E P         EEG  + + 
Sbjct  522   MKAKCEIPLSKVKTLFPLTEVVKKKDQVTAQDVFQDNIEEGPAAKKYKTEKEEGHISISS  581

Query  1754  VKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALE  1924
             +      K+G++NPV++F  ++ R+    +   ++Q M +   +L  N  E   + K+++
Sbjct  582   LAEGNVTKVGSVNPVENFRVLV-RQKIASFEEASLQLMSHIEQFLDTN--ETLYFMKSMD  638

Query  1925  CLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVL  2104
             C+ ALR   I   E ++FN  L  L    + K L  F + +   GI LITK E+P S V 
Sbjct  639   CIKALREEAIQFSEEQRFNSFLEGLREKVEIKQLNHFWEIVVQDGITLITKDESPGSSVT  698

Query  2105  ESEARSFMT  2131
               EA  F+T
Sbjct  699   AEEATKFLT  707



>ref|XP_006972290.1| PREDICTED: X-ray repair cross-complementing protein 5 [Peromyscus 
maniculatus bairdii]
Length=730

 Score =   199 bits (507),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 188/726 (26%), Positives = 335/726 (46%), Gaps = 81/726 (11%)
 Frame = +2

Query  125   ARNREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtte  283
             + N+  ++L +DVG +M    P       + +KV ++ V++++     DE+ ++LFGT  
Sbjct  4     SSNKAAVVLCMDVGVAMGNSFPGEESPFEQAKKVMTMFVQRQVFSESKDEIALVLFGTDR  63

Query  284   tanelteelggYEHVTVLRSIKVVDDDLLQAL-EQLPRGSVDGDFLDAVIVGMDMMIKKY  460
             T N L  E   Y+++TV R + + D DLL+ +  ++  GS   DFLDA+IV MD++ ++ 
Sbjct  64    TDNALAGEDQ-YQNITVHRHLMLPDFDLLEDIGSKIQLGSRQADFLDALIVCMDLIQRET  122

Query  461   GITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVI-VRMKQDLDA  637
                  GKK + + T+   P         +DQ+  I   +K  G+ +   +   + ++ + 
Sbjct  123   IGKKFGKKHIEVFTDLSSPFS-------QDQLDVIICNLKKSGISLQFFLPFSIGKNRET  175

Query  638   ----------------EKGIIDENDFLLSVFSKETSSKAAY--VESATSLMGAIRTRNIA  763
                             +KGI ++    + +  +   S      +E   S   ++R   + 
Sbjct  176   GNRGDGGSDHRGPSFPQKGITEQQKEGIRMVERVMVSLEGEDGLEEIYSFSESLRQLCVF  235

Query  764   PVTLYRG-----DFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSY  928
                  R         +S  L IK+  YK   +ER     +  D         K +I    
Sbjct  236   KKIERRSMPWPCQLTISPNLSIKIVAYKSIVQERVKKTWIAVD----ARTLKKEDIQKET  291

Query  929   EYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMR  1105
              Y +  D   +V  E  I+G+RYG  +VP S  + E +K+K E K   +LGF  +S + R
Sbjct  292   VYCLNDDDETEVSKEDTIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCRSSQVHR  351

Query  1106  HYYM--KDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPN  1279
              ++M  +   VF A  + + A+ A+S+L  A+ ++N VAIVR  + + + N  +GV  P+
Sbjct  352   RFFMGYQVLKVFAAKDDEAAAV-ALSSLIHALDELNMVAIVRYAYDR-RANPQVGVAFPH  409

Query  1280  VSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAP--  1453
             + D     + L +  LPF ED+R++ F S  N      P E Q  A D+L++ + L    
Sbjct  410   IKD---AYECLVYVQLPFMEDLRQYMFSSLKN-NKKCTPTEAQLSAIDDLIESMSLVKKS  465

Query  1454  --SDSQEALLPEF-TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNK  1624
                D+ E L P    PNP  QR +  L  ++ H    +PP+ + +  + DP  E+ ++ +
Sbjct  466   EEEDAIEDLFPTSKIPNPEFQRLFQCLLHRALHPQERLPPIPQHILNMLDPPIEIQAKGE  525

Query  1625  TVVDEFRRCFELKDNPKMKK--SRKRLIR----EKPTGSDEEGERASTKV--------KS  1762
               + + +  F L D  K K   + + + +    E P     + E+    +        K 
Sbjct  526   IPLSKVKTLFPLTDADKKKDHVTAQDIFQDNHQEGPAAKKCKTEKEEIHISVSSLAEGKV  585

Query  1763  EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQKALECLV  1933
              K+G++NPV++F  ++ ++ +      + +E   ++  L+E  L+ +    + K++EC+ 
Sbjct  586   TKVGSVNPVENFRVLVRQKIA------SFEEASLQLISLIEQFLDTNETLYFMKSMECIR  639

Query  1934  ALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESE  2113
             A R   I   E ++FN  L  L    + K L  F + +   G+ LITK E P S V   E
Sbjct  640   AFREEAIQFSEEQRFNRFLEALREKVEIKQLNHFWEIVVQDGVTLITKDEGPGSSVTTEE  699

Query  2114  ARSFMT  2131
             A  F+ 
Sbjct  700   AAKFLA  705



>ref|XP_006935603.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X2 [Felis catus]
Length=733

 Score =   199 bits (507),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 187/733 (26%), Positives = 342/733 (47%), Gaps = 85/733 (12%)
 Frame = +2

Query  122   MARNRE--GLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR+R    ++L +DVG +M   LP  E       K+ +V V++++     DE+ ++LFG
Sbjct  1     MARSRSKAAIVLCMDVGSAMSNSLPGEESPFELAKKLMTVFVQRQVFAESKDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  +   Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD++ 
Sbjct  61    TDGTENALAGKDQ-YQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVCMDVIQ  119

Query  452   KKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVR--MKQ  625
             ++      GK+ + + T+   P         +DQ+  I   ++  G+ +   +     K+
Sbjct  120   QETVGKKFGKRHIEVFTDLSSPFS-------QDQLDIIIHNLEKSGISLQFFLPFPVGKE  172

Query  626   DLDAEKG----IIDEN--DFLLSVFSKETSSKAAYVESAT-SLMG------------AIR  748
             D   ++G     +D++   F L   +++       V+    SL G            ++R
Sbjct  173   DGTGDRGDGNSCLDQHGPSFPLKGITEQQKEGIRMVKKVMMSLEGEDGLDEIYSFSESLR  232

Query  749   TRNIAPVTL-----YRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHE  913
                +   T      +     + + L IK+  YK   +E+        D         K +
Sbjct  233   QLRVFKKTERYSVPWLCTLTIGSNLAIKIVAYKAIMQEKVKKSWTVVD----ARTLKKED  288

Query  914   ITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDA  1090
             I     Y +  D   +VP E  I+G+RYG  +VP S  + E +++K E K   +LGF  +
Sbjct  289   IQKETVYCLQDDDETEVPKEDTIQGFRYGSDIVPFSKVDEEQMRYKSEGKCFSVLGFCRS  348

Query  1091  SNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIG  1264
             S + R Y++ +    VF A  + + A+ A+S+L  A+ +++ VA+VR  +  G+ N  +G
Sbjct  349   SQVHRRYFVGNQVLKVFAAKDDEAAAV-ALSSLIHALDELDMVAVVRYAY-AGRTNPQVG  406

Query  1265  VLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLD  1444
             +  P + D     + L +  LPF ED+R++ F S  N      P E Q  A D L+  + 
Sbjct  407   MAFPYIKD---AYECLMYVQLPFMEDLRQYMFSSLKN-SKKCTPTEAQLSAVDALIDSMS  462

Query  1445  LAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPEL  1609
             L   D +E  + +       PNP  QR Y  L  ++ H    +PP+ + +  + DP  E+
Sbjct  463   LVKKDEKEDTIEDLFPTTKIPNPQHQRLYQCLAHRALHPQEPLPPIQQHILNMLDPPAEV  522

Query  1610  LSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE--------  1765
              ++ +  + + +  F L +  K K    ++  +     + E   AS K+K++        
Sbjct  523   TAKCQIPLSKIKTVFPLTEATKKKD---QVPAQNIFPDNHEEGPASKKLKTQEGEACFSV  579

Query  1766  ---------KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKA  1918
                      ++G++NP ++F  ++ ++ +     +A +++ N+I   ++ + E   + K+
Sbjct  580   SSLAEGSVTRVGSVNPAENFRVLVRQKKAS--FEEASRQLINQIEQFLDTN-ETPYFMKS  636

Query  1919  LECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSD  2098
             ++C+   R   I   E + FN+ L+ L    + K L+ F   +   GI LITK EAP S 
Sbjct  637   MDCITVFREEAIQVSEEQCFNNFLKALREKVEIKQLKHFWDIVVQDGITLITKDEAPGSS  696

Query  2099  VLESEARSFMTES  2137
             +   EA+   + S
Sbjct  697   ITAEEAKKVFSRS  709



>gb|KDR13452.1| ATP-dependent DNA helicase 2 subunit 2 [Zootermopsis nevadensis]
Length=714

 Score =   199 bits (506),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 191/719 (27%), Positives = 348/719 (48%), Gaps = 80/719 (11%)
 Frame = +2

Query  122   MARN-REGLILVIDVGPSMHCV--------LPEIEKVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR+ +E +++++DVG S+  V        L    +  S+++++K+  +  DEV +IL G
Sbjct  1     MARSQKEAIVIIVDVGHSISSVVKDKKMGFLENARQCVSMILKRKIFANLKDEVALILLG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVDGDFLDAVIVGMDMMIK  454
             + ET N L      Y++++V  S+ +   +++Q +E L    VD D++DA++V +D + +
Sbjct  61    SEETNNNLN-----YKNISVAHSLGLPSWEMVQFVEDLKETVVDADWIDAIVVAVDFLKE  115

Query  455   KYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDS----VIVRMK  622
             +       ++++ L++N    +        EDQV TI   +K+  + + +    V + +K
Sbjct  116   ETVGKKFSERKVVLLSNLDTTVS-------EDQVDTIIKAVKSEEVNLIAIGPDVNLSIK  168

Query  623   QD--------------LDAEKGIIDE---NDFLLSVFSKETSSKAAYVESATSLMGAIRT  751
             Q+              +DAEK    +    + LL    +ET         A   +   + 
Sbjct  169   QETMDDDDGTKCWTNGIDAEKSKTKQQLVGESLLYHVLRETDGVICSFSDAVPQLMYFQK  228

Query  752   RNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYE  931
             RNI P T +    ++   ++I V  Y+K +    P+ K  S      ++ A+ E  +SY 
Sbjct  229   RNIRP-TPWNVVMDIGPDIRIAVSGYRKITPATLPSWKTSS----SLEEGARVESETSY-  282

Query  932   YKVVQDPTKQV-PPEQRIKGYRYGPQVVPISSAEWEAVKFKP-EKGVKLLGFTDASNIMR  1105
               + QD  + V   +  I+G+ +G  +VP S  +   + +   +K   +LGFT   N+ R
Sbjct  283   --IRQDENQTVIDRDDVIEGFSFGTTLVPFSDVDKAMMSYNSGDKCFSVLGFTKLRNVPR  340

Query  1106  HYYMKDANVFI-ADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNV  1282
             H +M    ++I A   +S A +A+S+L  A+ +   VAI R V+R     V +G L P +
Sbjct  341   HLFMGRGILYITAQRGDSSAEVALSSLIHALDEEKLVAIARKVYRINTKPV-LGALFPRI  399

Query  1283  SDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAP---  1453
             + +    + L F  LP++ED+REF FP    +  +  P ++Q ++ D L+ ++DL     
Sbjct  400   ASEY---ECLVFIELPYSEDMREFVFPPI--VSDTNKPTKEQLDSVDALIDIMDLQAVKN  454

Query  1454  --SDSQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKT  1627
                +  EA   +   NP  Q  YH L  ++ + DA +PP+++ +  +     E  +  K 
Sbjct  455   EYGEVSEAFKSKSVVNPYHQHVYHSLAYRAMNPDAEIPPVNDYVINLLKSPHENKASYKV  514

Query  1628  VVDEFRRCFELKD-----NPK-----MKKSRKRLIREKPTGSDEEGERASTKVKSE--KI  1771
              V+E ++ F+L +     N K      KK+ K    E P+  D +    ++ V++   ++
Sbjct  515   AVEEIKKQFQLNEVKSKMNHKSAAEVFKKNAKDESDEAPSNVDLKDVTMASLVEATVVEV  574

Query  1772  GNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGC  1951
             G + P+QDF+ ++ R    E  NK   +M+  I  LV  S   D + KA   L  LR  C
Sbjct  575   GTVRPIQDFKALLER---GEDFNKVCSQMQKVILNLVIYSFGADNFVKAEMALQTLRETC  631

Query  1952  IVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFM  2128
             I+ ++P  +ND +     S  E+D R+F   L    + LI+  E+ +S V + +AR F+
Sbjct  632   II-KDPSLYNDWVVQFRDSLFERDKRAFWDILVKAKLGLISSQESAESSVTDDDARKFL  689



>ref|XP_005883444.1| PREDICTED: X-ray repair cross-complementing protein 5 [Myotis 
brandtii]
Length=732

 Score =   199 bits (506),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 205/753 (27%), Positives = 341/753 (45%), Gaps = 130/753 (17%)
 Frame = +2

Query  122   MAR--NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR  N+  ++L +DVG +M    P  E       KV ++ V++++     DE+ ++LFG
Sbjct  1     MARSGNKAAVVLCMDVGFAMSNSFPGEESPFELAKKVMTMFVQRQVFAESKDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  E   Y+++TV R + + D +LL+ +E ++  GS   DFLDA+IV MD+ I
Sbjct  61    TDGTENALACEDQ-YQNITVHRHLMLPDFNLLEDIESKIQPGSQQADFLDALIVCMDV-I  118

Query  452   KKYGITNKGKKR-LCLITNAMCPI-KD--------------------PYEGTKEDQ----  553
             ++  +  K +KR + + T+   P  KD                    P+   KED     
Sbjct  119   QQETVGKKFEKRHIEVFTDLSSPFSKDQLDTIIHNLKKSNISLQFFLPFPIGKEDGAGDR  178

Query  554   ---------------VSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDF-----LL  673
                            +  I  Q K  G+RM   + R+   L+ E G+ +   F      L
Sbjct  179   GDGNLPLDNHGPSFPLKGITEQQK-EGIRM---VKRVMMSLEGEDGLDEIYSFSESLRQL  234

Query  674   SVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERF  853
              VF K   S  A+                 P  L  G     + L IK+  YK   +E+ 
Sbjct  235   CVFKKTERSSMAW-----------------PCQLTIG-----SNLSIKILAYKSILQEKV  272

Query  854   PTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEW  1033
                 +  D         K ++     Y +  D   +VP E  I+G+RYG  ++P S  + 
Sbjct  273   KKSWIVVD----ARTLKKEDVKKETVYCLNDDDETEVPKEDTIQGFRYGSDIIPFSKVDE  328

Query  1034  EAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDM  1204
             E +K+K E K   +LGF  +S + R Y+M +    VF A  + + A+ A+S+L  A+ ++
Sbjct  329   EQMKYKSEGKCFSVLGFCRSSQVHRKYFMGNQVLKVFAAKDDEAAAV-ALSSLIHALDEL  387

Query  1205  NRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPS  1384
               VAIVR  + + + N  +GV  P++ D     + L +  LPF ED+R++ F S  N   
Sbjct  388   AMVAIVRYAYDR-RSNPQVGVAFPHIKD---TYECLVYVQLPFMEDLRQYMFSSLKN-NK  442

Query  1385  SMLPNEQQQEAADNLVKMLDLAPSDSQ----EALLPEF-TPNPVLQRYYHYLEMKSKHHD  1549
                P E Q  A D L+  + L   D +    E L P    PNP  QR +  L  ++ H  
Sbjct  443   KYTPTEAQLSAVDALIDSMSLVKKDEEGDTIEDLFPTTKIPNPQFQRLFQCLLHRALHPQ  502

Query  1550  AAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDE  1729
               +PP+ + +  + DP  E+ +  +  + + +  F L +   +KK  +   ++      E
Sbjct  503   EPLPPVQQHVLNMLDPPTEVTANCEIPLSKIKTLFPLTE--AIKKKDQLTAQDVFQDKHE  560

Query  1730  EGERASTKVKSE----------------KIGNINPVQDFEDMISRRDSPEWVNKAIQEMK  1861
             EG   S K+K+E                K+G++NP ++F  ++ ++      N + +E  
Sbjct  561   EGP-TSKKLKTEEEAHFSLSSLAEGTVTKVGSVNPAENFRVLVRQK------NASFEEAS  613

Query  1862  NKIFYLVENSL---EGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRS  2032
              ++   +E  L   E   + K+++C+ A R   I   E ++FN+ L++L    + K L +
Sbjct  614   RQLISHIEQFLDTKETPYFMKSMDCIKAFREEAIQFSEDQRFNNFLKDLREKVEIKQLNN  673

Query  2033  FCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             F + +   GI LITK EA  S V   EA+ F+ 
Sbjct  674   FWEIIIQDGITLITKDEASGSSVTAEEAKKFLA  706



>ref|XP_006082557.1| PREDICTED: X-ray repair cross-complementing protein 5 [Myotis 
lucifugus]
Length=732

 Score =   199 bits (505),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 205/753 (27%), Positives = 341/753 (45%), Gaps = 130/753 (17%)
 Frame = +2

Query  122   MAR--NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR  N+  ++L +DVG +M    P  E       KV ++ V++++     DE+ ++LFG
Sbjct  1     MARSGNKAAVVLCMDVGFAMSNSFPGEESPFELAKKVMTMFVQRQVFAESKDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  E   Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD+ I
Sbjct  61    TDGTENALACEDQ-YQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVCMDV-I  118

Query  452   KKYGITNKGKKR-LCLITNAMCPI-KD--------------------PYEGTKEDQ----  553
             ++  +  K +KR + + T+   P  KD                    P+   KED     
Sbjct  119   QQETVGKKFEKRHIEVFTDLSSPFSKDQLDTIIHNLKKSNISLQFFLPFPIGKEDGAGER  178

Query  554   ---------------VSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDF-----LL  673
                            +  I  Q K  G+RM   + R+   L+ E G+ +   F      L
Sbjct  179   GDGNLPLDNHGPSFPLKGITEQQK-EGIRM---VKRVMMSLEGEDGLDEIYSFSESLRQL  234

Query  674   SVFSKETSSKAAYVESATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERF  853
              VF K   S  A+                 P  L  G     + L IK+  YK   +E+ 
Sbjct  235   CVFKKTERSSMAW-----------------PCQLTIG-----SNLSIKILAYKSILQEKV  272

Query  854   PTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEW  1033
                 +  D         K ++     Y +  D   +VP E  I+G+RYG  ++P S  + 
Sbjct  273   KKSWIVVD----ARTLKKEDVRKETVYCLNDDDETEVPKEDTIQGFRYGSDIIPFSKVDE  328

Query  1034  EAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDM  1204
             E +K+K E K   +LGF  +S + R Y+M +    VF A  + + A+ A+S+L  A+ ++
Sbjct  329   EQMKYKSEGKCFSVLGFCRSSQVHRKYFMGNQVLKVFAAKDDEAAAV-ALSSLIHALDEL  387

Query  1205  NRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPS  1384
               VAIVR  + + + N  +GV  P++ D     + L +  LPF ED+R++ F S  N   
Sbjct  388   AMVAIVRYAYDR-RSNPQVGVAFPHIKD---TYECLVYVQLPFMEDLRQYMFSSLKN-NK  442

Query  1385  SMLPNEQQQEAADNLVKMLDLAPSDSQ----EALLPEF-TPNPVLQRYYHYLEMKSKHHD  1549
                P E Q  A D L+  + L   D +    E L P    PNP  QR +  L  ++ H  
Sbjct  443   KYTPTEAQLSAVDALIDSMSLVKKDEEGDTIEDLFPTTKIPNPQFQRLFQCLLHRALHPQ  502

Query  1550  AAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDE  1729
               +PP+ + +  + +P  E+ +  +  + + +  F L +   +KK  +   ++      E
Sbjct  503   EPLPPVQQHVLNMLNPPTEVTANCEIPLSKIKTLFPLTE--AIKKKDQLTAQDVFQDKHE  560

Query  1730  EGERASTKVKSE----------------KIGNINPVQDFEDMISRRDSPEWVNKAIQEMK  1861
             EG   S K+K+E                K+G++NP ++F  ++ ++      N + +E  
Sbjct  561   EGP-TSKKLKTEEEAHFSLSSLAEGTVTKVGSVNPAENFRVLVRQK------NASFEEAS  613

Query  1862  NKIFYLVENSL---EGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRS  2032
              ++   +E  L   E   + K+++C+ A R   I   E ++FN+ L++L    + K L +
Sbjct  614   RQLISHIEQFLDTKETPYFMKSMDCIKAFREEAIQFSEDQRFNNFLKDLREKVEIKQLNN  673

Query  2033  FCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             F + +   GI LITK EA  S V   EA+ F+ 
Sbjct  674   FWEIIIQDGITLITKDEASGSSVTAEEAKKFLA  706



>gb|EMC84191.1| ATP-dependent DNA helicase 2 subunit 2, partial [Columba livia]
Length=730

 Score =   199 bits (505),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 200/730 (27%), Positives = 328/730 (45%), Gaps = 99/730 (14%)
 Frame = +2

Query  140   GLILVIDVGPSM-------HCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M          L + +KV +  V++++     DEV V+LFGT  T N L
Sbjct  1     AIVLCLDVGCAMSNSASGEESSLEQAKKVMTKFVQRQVFAETKDEVAVVLFGTDGTRNAL  60

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ K+      
Sbjct  61    ASRDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKY  119

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+        EDQ+  I A +K  G+ +                   
Sbjct  120   EKRHIELFTDLSSPVS-------EDQLDIIIANLKKTGISLQFFLPFPVDDDDGGGDKSA  172

Query  602   SVIVRMKQDLDAEKGI-------IDENDFLLSVFSKETSSKAAYVESAT----SLMGAIR  748
             SV  +M ++    KG+       ID    L+    +E   +  Y    +    S+   I 
Sbjct  173   SVCSQMHRNSFPRKGLTEQQKEGIDVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIE  232

Query  749   TRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
              +++  P  L  G     + L I++  YK   EE+   +    D         K +I   
Sbjct  233   RKSLPWPCQLTIG-----SNLSIRIVAYKSVIEEKVKKVWTVVD----AKTLRKEDIQKE  283

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I 
Sbjct  284   TVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQ  343

Query  1103  RHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLT  1273
             R YYM +    VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N  IGV  
Sbjct  344   RQYYMGNQVLKVFAAKDDEN--AAVAFSALVHALDELKVVAIVRYAYDR-RCNPQIGVAF  400

Query  1274  PNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAP  1453
             P + D     + L +  LP+ ED+R + F S  N      P   Q  A D+L+  ++L  
Sbjct  401   PYIKD---AYECLIYVQLPYMEDLRPYIFSSLKN-NKKCTPTVDQLSAVDSLIDSMNLVS  456

Query  1454  SDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQ  1618
              D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  +
Sbjct  457   EDDDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPHVVKER  516

Query  1619  NKTVVDEFRRCFEL----------------KDNPKMKKSRKRLIREKPTGSDEEGERAST  1750
              +  + + +  F L                KDN      +K      P   DEEG  +  
Sbjct  517   CQAPLGKVKALFPLKEVSKKKEEKTAQDIFKDNEDGPNPKK------PKIEDEEGSFSIM  570

Query  1751  KVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKAL  1921
             K+       +G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K +
Sbjct  571   KLAEGSVTSVGSVNPAEDFRILVRQKNTN--FKDVSQQLINRIHQFLENK-GSQYYMKGI  627

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
              C+   R   I   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V
Sbjct  628   NCIRVFREEAIKLSKVQCFNDFLQALKSKMEDKALADFWEIIIQDRISLITKDEAEGSSV  687

Query  2102  LESEARSFMT  2131
                EA  F+ 
Sbjct  688   TSEEAEKFLA  697



>dbj|BAC38276.1| unnamed protein product [Mus musculus]
Length=708

 Score =   198 bits (504),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 184/729 (25%), Positives = 339/729 (47%), Gaps = 89/729 (12%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M    P       + +KV ++ V++++     DE+ ++L+GT  T 
Sbjct  6     NKAAVVLCVDVGVAMGNSFPGEESPIEQAKKVMTMFVQRQVFSESKDEIALVLYGTDGTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQAL-EQLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L  +   Y+++TV R + + D DLL+ +  ++   S   DFLDA+IV MD++ ++   
Sbjct  66    NALAGKDQ-YQNITVCRHLMLPDFDLLEDIGNKIQPSSQQADFLDALIVCMDLIQRETIG  124

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRM--KQDLDAE  640
                GKK + + T+   P         +DQ+  I   +K  G+ +   +     K     E
Sbjct  125   KKFGKKHIEVFTDLSSPF-------SQDQLDVIICNLKKSGISLQFFLPFPIDKNGEPGE  177

Query  641   KGIIDEN-DFLLSVFSKE--TSSKAAYVESATSLMGAIR-----------TRNIAPVTLY  778
             +G +D   D L   F ++  T  +   +   T +M ++            + ++  + ++
Sbjct  178   RGDLDSGLDHLKPSFPQKGLTEQQKEGIRMVTRVMLSLEGEDGLDEIYSFSESLRQLCVF  237

Query  779   RG----------DFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSY  928
             +              +   L IK+  YK   +E+F    +  D         K +I    
Sbjct  238   KKIERRSMPWPCQLTIGPNLSIKIVAYKSIVQEKFKKSWVVVD----ARTLKKEDIQKET  293

Query  929   EYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMR  1105
              Y +  D   +V  E  I+GYRYG  ++P S  + E +K+K E K   +LGF  +S + R
Sbjct  294   VYCLNDDDETEVSKEDTIQGYRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVHR  353

Query  1106  HYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPN  1279
              ++M      VF A  + + A+ A+S+L  A+ ++N VAIVR  + + + N  +GV  P 
Sbjct  354   RFFMGHQVLKVFAAKDDEAAAV-ALSSLVHALDELNMVAIVRYAYDK-RSNPQVGVAFPY  411

Query  1280  VSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD  1459
             +  KG   + L +  LPF ED+R++ F S  N      P E Q  A D+L+  + L   +
Sbjct  412   I--KGAY-ECLVYVQLPFMEDLRQYMFSSLKN-NKKCTPTEAQLSAIDDLIDSMSLVKKN  467

Query  1460  SQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNK  1624
              +E ++ +       PNP  QR Y  L  ++ H    +PP+ + +  + DP  E+ ++ +
Sbjct  468   EEEDIVEDLFPTSKIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTEMKAKCE  527

Query  1625  TVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE-------------  1765
             + + + +  F L +   +KK  +   ++    + EEG  A+ K K+E             
Sbjct  528   SPLSKVKTLFPLTE--VIKKKNQVTAQDVFQDNHEEGP-AAKKYKTEKEEDHISISSLAE  584

Query  1766  ----KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQKALE  1924
                 K+G++NPV++F  ++ ++ +      + +E   ++   +E  L+ +    + K+++
Sbjct  585   GNITKVGSVNPVENFRFLVRQKIA------SFEEASLQLISHIEQFLDTNETLYFMKSMD  638

Query  1925  CLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVL  2104
             C+ A R   I   E ++FN  L  L    + K L  F + +   G+ LITK E P S + 
Sbjct  639   CIKAFREEAIQFSEEQRFNSFLEALREKVEIKQLNHFWEIVVQDGVTLITKDEGPGSSIT  698

Query  2105  ESEARSFMT  2131
               EA  F+ 
Sbjct  699   AEEATKFLA  707



>ref|XP_003405959.2| PREDICTED: X-ray repair cross-complementing protein 5 [Loxodonta 
africana]
Length=732

 Score =   198 bits (504),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 188/735 (26%), Positives = 342/735 (47%), Gaps = 93/735 (13%)
 Frame = +2

Query  122   MAR--NREGLILVIDVGPSM-------HCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR  N+  ++L  DVG +M          L + +KV ++ V++++     DEV ++LFG
Sbjct  1     MARPGNKAAVVLCADVGFAMSNSFLDEESSLEQAKKVMTMFVQRQVFAESKDEVALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L +E   Y+++TV R + + D DLL+ +E ++  GS   D LDA++V MD+ I
Sbjct  61    TDGTDNALAQENQ-YQNITVHRHLMLPDFDLLEDIESKIQPGSKHADILDALVVCMDL-I  118

Query  452   KKYGITNKGKKR-LCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVI------  610
             ++  +  K +KR + + T+   P         +DQ+  I   +K  G+ +   +      
Sbjct  119   QQETVGKKFEKRHIEVFTDLSSPFS-------KDQLDVIIHNLKQSGISLQFFLPFSVGG  171

Query  611   -----------VRMKQDLDA--EKGIIDENDFLLSV-----FSKETSSKAAYVES-ATSL  733
                        +R+     +  +KGI ++    + V      S E  S    + S + SL
Sbjct  172   EDGTGDRGDGSLRLGHHGPSFPQKGITEQQKEGIQVVKRMMMSLEGDSGLDEIYSFSESL  231

Query  734   MGAIRTRNIAPVTL-YRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKH  910
                   + I   ++ +     + + L IK+  YK   +E         D         K 
Sbjct  232   RQLCVFKKIERRSMPWHCQLTVGSNLAIKIVAYKSIQQETIKKTWAVVD----ARTLKKE  287

Query  911   EITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTD  1087
             +I     Y +  D   +VP E  I+G+RYG  +VP S  + E +K++ E K   +LGF  
Sbjct  288   DIQKETVYCLNDDDETEVPKEDTIQGFRYGSDIVPFSKVDEEQMKYRSEGKCFSVLGFCR  347

Query  1088  ASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTI  1261
             +  + R ++M +    VF A+ ++  A +A+S+L  A+ +++ VA+VR  + + + N  +
Sbjct  348   SPQVQRRFFMGNQVLKVF-AEKDDEAAAVALSSLIHALDELDMVAVVRYAYDK-KANPQV  405

Query  1262  GVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKML  1441
             GV  P++ D     + L +  LPF ED+R++ F S  N      P E Q  A D L+  +
Sbjct  406   GVAFPHIKD---AYECLVYVQLPFMEDLRQYMFSSLKN-NKKYTPTEAQLNAVDALIDSM  461

Query  1442  DLAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPE  1606
              L   D +E  + +       PNP  QR++  L  ++ H    +PP+ + +  + DP  E
Sbjct  462   SLVKKDEEEDTIEDLFPTTKIPNPQFQRFFQCLLHRALHPQEPLPPIQQHILNMLDPPTE  521

Query  1607  LLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSEK------  1768
             + ++++  + E +  F L +     K R ++  +     ++E    S K K+E+      
Sbjct  522   VTAKSQIPLSEIKTLFPLTE---AIKKRDQITAQDIFQDNQEEGSVSKKCKTEEADIPFS  578

Query  1769  -----------IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---  1906
                        +G++NP ++F  ++ ++      N +  E+ +++   +E  L+ +    
Sbjct  579   ITSMAEGRVTSVGSVNPAENFRVLVRQK------NASFGEVSHQLISHIEQFLDSNETPY  632

Query  1907  YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEA  2086
             + K+++C+ A R   I   E ++FN  L+ L    K K L  F + +   GI LI+K EA
Sbjct  633   FMKSMDCIKAFREEAIQFSEEQRFNSFLKALQEKVKMKRLHHFWEIVVQDGITLISKDEA  692

Query  2087  PDSDVLESEARSFMT  2131
               S V   EA+ F+ 
Sbjct  693   SGSSVTAEEAKKFLA  707



>ref|XP_005676574.1| PREDICTED: X-ray repair cross-complementing protein 5 [Capra 
hircus]
Length=733

 Score =   198 bits (504),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 198/734 (27%), Positives = 339/734 (46%), Gaps = 93/734 (13%)
 Frame = +2

Query  122   MAR--NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR  N+  ++L +DVG +M    P  E       KV ++ V++++     DEV ++LFG
Sbjct  1     MARSWNKAAVVLCMDVGLAMSNSFPGEESPFELAKKVITMFVQRQVFAENKDEVALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  E   Y+++TV R +   D DLL+ +E ++  GS   DFLDA+IV MD+ I
Sbjct  61    TDGTENALAGEDQ-YQNITVHRHLMRPDFDLLEDIESKIQPGSQQADFLDALIVCMDL-I  118

Query  452   KKYGITNKGKKR-LCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSV----IVR  616
             +K  +  K +KR + + T+   P          DQ+  I   +K  GM +       IV+
Sbjct  119   QKETLGKKFEKRHIEVFTDLSSPFS-------RDQLDIIIDNLKKSGMSLQFFLPFPIVK  171

Query  617   MKQDLDAE---------------KGIIDENDFLLSVFSKETSSKA---------AYVESA  724
                  D                 KGI ++    + +  K   S           ++ ES 
Sbjct  172   KGGTGDRGDGSLLLDDHGPSFPPKGITEQQKEGIQMVKKVMMSLEGEDGLEEIYSFSESL  231

Query  725   TSLMGAIRT-RNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKF  901
               L    +T R+  P   +     + + L IK+  YK  ++E+        D        
Sbjct  232   RQLCVFKKTERHSMP---WSCQLTIGSNLSIKIVAYKSITQEKVKKSWTVVD----ARTL  284

Query  902   AKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLG  1078
              K +I     Y +  D   +V  E  I+G+RYG  ++P S  + E +K++ E K   +LG
Sbjct  285   KKEDIQKETVYCLNDDDETEVSKEDTIQGFRYGSDIIPFSKVDEEQMKYRSEGKCFSVLG  344

Query  1079  FTDASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             F  +S +   Y+M +    VF A  + + A+ A+S+L  A+ +++ VA+VR  + Q + N
Sbjct  345   FCRSSQVHMKYFMGNQVLKVFAAKDDEAAAV-ALSSLIHALDELDMVAVVRYAYDQ-RTN  402

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
               +GV  P + D     + L +  LPF ED+R++ F S  N      P E Q  A D L+
Sbjct  403   PQVGVAFPLIKD---TYECLAYIQLPFMEDLRQYMFSSLKN-NRKCTPTEAQLSAVDALI  458

Query  1433  KMLDLAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDP  1597
               + L   D +E  + +       PNP  QR +  L  ++ H    +PP+ + +  + DP
Sbjct  459   DSMSLVQKDEEEGTIEDLFPTSKIPNPQFQRLFQCLLHRALHPQEPLPPIQQHILSMLDP  518

Query  1598  DPELLSQNKTVVDEFRRCFELKDNPKMKK--SRKRLIR----EKPT----GSDEEGERAS  1747
               E+ ++ +  V + +  F L +  K K   + + L +    E PT     ++EE  R S
Sbjct  519   PTEVTAKGQVPVSKIKTLFPLTEVIKKKNQVTGQDLFQDNHEEGPTCKRLKTEEEEARFS  578

Query  1748  TKVKSEK----IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---  1906
                 +E     +G++NP  +F  ++ ++ +      + +E  +++   +E  L+ +    
Sbjct  579   VSSLAEGTVTCVGSVNPADNFRVLVRQKKA------SFEEASHQLINHIEQFLDTNETLY  632

Query  1907  YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEA  2086
             + K+++C+ A R   I   E ++FN+ L+ L    + K L  F + +   G+ LITK EA
Sbjct  633   FMKSMDCIKAFREEAIQFSEEQRFNNFLKALQEKVEVKQLNHFWEIVIHDGVTLITKDEA  692

Query  2087  PDSDVLESEARSFM  2128
             P S V   EA+ F+
Sbjct  693   PGSSVTTEEAKKFL  706



>ref|NP_001126362.1| X-ray repair cross-complementing protein 5 [Pongo abelii]
 emb|CAH92321.1| hypothetical protein [Pongo abelii]
Length=732

 Score =   198 bits (504),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 199/732 (27%), Positives = 342/732 (47%), Gaps = 96/732 (13%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M   +P IE       KV ++ V++++     DE+ ++LFGT  T 
Sbjct  6     NKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L+     Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD+ I+   I
Sbjct  66    NPLSGGDQ-YQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDV-IQHETI  123

Query  467   TNKGKKR----------------LCLITNAM--CPIKD----PYEGTKEDQVSTIA---A  571
               K +KR                L +I +++  C I      P+   KED          
Sbjct  124   GKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGTF  183

Query  572   QMKAHG--MRMDSVIVRMKQDLDAEKGI---IDENDFLLSVFSKETSSKAAYVESATSLM  736
             ++  HG    +  +  + K+ L+  K +   ++  D L  ++S   S +   V       
Sbjct  184   RLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCV------F  237

Query  737   GAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHE  913
               I   +I  P  L  G     + L I++  YK   +ER        D         K +
Sbjct  238   KKIERHSIHWPCRLTIG-----SNLSIRIAAYKSILQERVKKTWTVVD----AKTLKKED  288

Query  914   ITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDA  1090
             I     Y +  D   +V  E  I+G+RYG  +VP S A+ E +K+K E K   +LGF  +
Sbjct  289   IQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKADEEQMKYKSEGKCFSVLGFCKS  348

Query  1091  SNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIG  1264
             S + R ++M +    VF A  + + A+ A+S+L  A+ D++ VAIVR  + + + N  +G
Sbjct  349   SQVQRRFFMGNQVLKVFAARDDEAAAV-ALSSLIHALDDLDMVAIVRYAYDK-RANPQVG  406

Query  1265  VLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLD  1444
             V  P++  K N  + L +  LPF ED+R++ F S  N      P E Q  A D L+  + 
Sbjct  407   VAFPHI--KHNY-ECLVYVQLPFMEDLRQYMFSSLKN-SKKYAPTEAQLNAVDALIDSMS  462

Query  1445  LAP----SDSQEALLPEF-TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPEL  1609
             LA     +D+ E L P    PNP  QR +  L  ++ H    +PP+ + +  + +P  E+
Sbjct  463   LAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEV  522

Query  1610  LSQNKTVVDEFRRCFEL---------------KDNPKMKKSRKRLIREKPTGSDEEGERA  1744
              ++++  + + +  F L               +DN +   + K+L  E+          A
Sbjct  523   TTKSQIPLSKIKTLFPLIEAKKKDQVTAQDIFQDNHEDGPTAKKLKTEQGGAHFSVSSLA  582

Query  1745  STKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQK  1915
                V S  +G++NP ++F  ++ ++ +      + +E  N++   +E  L+ +    + K
Sbjct  583   EGSVTS--VGSVNPAENFRVLVKQKKA------SFEEASNQLINHIEQFLDTNETPYFMK  634

Query  1916  ALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDS  2095
             +++C+ A R   I   E ++FN+ L+ L    + K L  F + +   GI LITK EA  S
Sbjct  635   SMDCIRAFREEAIKFSEEQRFNNFLKALREKVEVKQLNHFWEIVVQDGITLITKEEASGS  694

Query  2096  DVLESEARSFMT  2131
              V   EA+ F+ 
Sbjct  695   SVTAEEAKKFLA  706



>ref|XP_005610646.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X1 [Equus caballus]
Length=733

 Score =   198 bits (504),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 195/738 (26%), Positives = 343/738 (46%), Gaps = 99/738 (13%)
 Frame = +2

Query  122   MAR--NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR  ++  ++L IDVG +M    P  E       KV ++ V++++     DE+ ++LFG
Sbjct  1     MARWGSKAAVVLCIDVGFAMSNSFPGEESPFELAKKVMTMFVQRQVFAESKDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  E   Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD++ 
Sbjct  61    TDGTKNALAGEDQ-YQNITVHRHLMLPDFDLLEDIESKIQPGSRQADFLDALIVCMDVIQ  119

Query  452   KKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMK-----------------  580
             ++       KK + + T+   P         +DQ+  I   +K                 
Sbjct  120   RETVGKKFEKKHIEVFTDLSSPFS-------KDQLDIIIHNLKKSSISLQFFLPFPIGKE  172

Query  581   -AHGMRMDSVIVRMKQDLDAE-KGIIDEND--------FLLSVFSKETSSKA-AYVESAT  727
                G R D  +      LD   KGI ++           ++S+  +E   +  ++ ES  
Sbjct  173   DGTGDRGDGNLGSDHHGLDFPLKGITEQQKEGIQMVKKVMMSLEGEEGLDEIYSFSESLR  232

Query  728   SL--MGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKF  901
              L     I  R+I     +     + + L IK+  YK   +E+    K ++     T K 
Sbjct  233   RLCVFKKIERRSIP----WACQLTIGSNLSIKIVAYKSIVQEKVK--KSWTVVDARTVK-  285

Query  902   AKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLG  1078
              K ++     Y +  D   +VP E+ I+GYRYG  ++P S  + E +K+K E K   +LG
Sbjct  286   -KEDVQKETVYCLNDDDETEVPKEETIQGYRYGSDIIPFSKVDEEQMKYKSEGKCFSVLG  344

Query  1079  FTDASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             F  +S + R Y+M +    VF A  + + A+ A+S+L  A+ +++ VA+VR V+ + + N
Sbjct  345   FCRSSQVHRRYFMGNQVLKVFAARDDKAAAV-ALSSLIHALDELDMVAVVRYVYDR-RAN  402

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
               +GV  P + D     + L +  LPF ED+R++ F S  N      P E Q  A   L+
Sbjct  403   PQVGVAFPCIKD---TYECLVYVQLPFMEDLRQYMFSSLKN-NKKCTPTEAQLSAVGALI  458

Query  1433  KMLDLAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDP  1597
               + L   D +E  + +       PNP  QR +  L  ++ H    +PP+ + +  + DP
Sbjct  459   DSMSLVKKDEEENTIEDLFPTTKIPNPEFQRLFQCLLHRALHPQEPLPPIQQHILNMLDP  518

Query  1598  DPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSEK---  1768
               E+ ++ +  + + +  F L +   +KK  +   ++  + + EEG   S K K+E+   
Sbjct  519   PTEVTTKCQVPLSKIKTLFPLTE--AIKKKDQVTAQDVFSDNHEEGP-TSKKFKTEEAEV  575

Query  1769  --------------IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT  1906
                           +G++NP ++F  ++ ++      N + +E  +++   +E  L+ + 
Sbjct  576   SFSISSLAEGRITSVGSVNPAENFRVLVRQK------NASFEEASHQLIKHIEQFLDTNE  629

Query  1907  ---YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITK  2077
                + K+++C+   R   I   E ++FN  LR L    + K L  F + +   GI LIT+
Sbjct  630   TPYFMKSMDCIRVFREEAIESSEEQRFNSFLRALRERVEAKQLHHFWEIVIQDGITLITQ  689

Query  2078  TEAPDSDVLESEARSFMT  2131
              EA  S V   EA+ F+ 
Sbjct  690   DEASGSSVTAEEAKKFLA  707



>ref|XP_004376438.1| PREDICTED: X-ray repair cross-complementing protein 5 [Trichechus 
manatus latirostris]
Length=732

 Score =   198 bits (503),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 181/729 (25%), Positives = 335/729 (46%), Gaps = 89/729 (12%)
 Frame = +2

Query  131   NREGLILVIDVG-------PSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG       P       + +KV ++ V++++     DE+ ++LFGT  T 
Sbjct  6     NKAAVVLCMDVGFATSNSSPGEESPFEQAKKVMTMFVQRQVFAESKDEIALVLFGTDGTE  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L +    Y+++TV R + + D DLL+ ++ ++  GS   D LDA++V MD++ ++   
Sbjct  66    NALAQADQ-YQNITVHRHLMLPDFDLLEDIQSKIQPGSQHADVLDALVVCMDVIQQETVG  124

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKG  646
                 K+ + + T+   P         +DQ+  I   +K  G+   S+   +   L  E G
Sbjct  125   KKFDKRHIEVFTDLSSPFS-------KDQLDVIIHNLKQSGI---SLQFFLPFPLGKEDG  174

Query  647   IIDENDFLLSVFSKE--------TSSKAAYVESATSLMGAIR-----------TRNIAPV  769
               D  D  L +   E        T  +   +E    +M ++            + ++  +
Sbjct  175   TGDRGDGNLLLDHHEPSFPQKGITEQQKEGIEVVKRVMISLEGEDGLDEIYSFSESLRQL  234

Query  770   TLYRG----------DFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEIT  919
              +++              + + L IK+  YK   +E+        D         K +I 
Sbjct  235   CVFKKIERRSVPWPCQLTIGSHLSIKIVAYKSIIQEKIKKTWTVVD----ARTLKKEDIQ  290

Query  920   SSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASN  1096
                 Y +  D   +VP E  I+G+RYG  +VP S  + E +K+K E K   +LGF  +S 
Sbjct  291   KETVYCLNDDDETEVPKEDTIQGFRYGSDIVPFSKVDEEQMKYKLEGKCFSVLGFCRSSQ  350

Query  1097  IMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVL  1270
             + R ++M +    VF A  + + A+ A+S+L  A+ ++N VAIVR  + + + N+ +GV 
Sbjct  351   VQRKFFMGNQVLKVFAAKDDEAAAV-ALSSLIHALDELNMVAIVRYAYDK-RANLQVGVA  408

Query  1271  TPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLA  1450
              P++ D     + L +  LPF ED+R++ F S  N      P E Q  A D L+  + L 
Sbjct  409   FPHIKD---AYECLVYIQLPFMEDLRQYMFSSLKN-NKKYTPTEVQLNAVDALIDSMSLV  464

Query  1451  PSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLS  1615
               D +E  + +       PNP  QR++  L  ++ +    +PP+ + +  + DP  E+ +
Sbjct  465   KKDEEEDTIEDLFPTTKIPNPEFQRFFQCLLHRALYPQEPLPPIQQHILNMLDPPTEVTA  524

Query  1616  QNKTVVDEFRRCFELKDNPKMK---KSRKRLIREKPTGSD------EEGE-----RASTK  1753
             +++  + E +  F L +  K K    ++         G D      EEG+      + T+
Sbjct  525   KSQIALSEIKTLFPLTEAIKKKDQITAQDIFQDNHEEGPDSKKRKTEEGDIHFSISSMTE  584

Query  1754  VKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQKALE  1924
                  +G++NP ++F  ++ ++      N + +E+ +++   +E  L+ +    + K+++
Sbjct  585   GSVTSVGSVNPAENFRVLVRQK------NASFEEVSHQLISRIEQFLDTNETLYFMKSMD  638

Query  1925  CLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVL  2104
             C+ A R   I   E ++FN  L+ L    K K L  F + +   GI LI+K EA  S V 
Sbjct  639   CIKAFREEAIQFSEEQRFNSFLKALQEKVKMKQLNHFWEIVVQDGITLISKDEASGSSVT  698

Query  2105  ESEARSFMT  2131
               EA+ F+ 
Sbjct  699   AEEAKKFLA  707



>ref|XP_009086125.1| PREDICTED: X-ray repair cross-complementing protein 5 [Serinus 
canaria]
Length=710

 Score =   198 bits (503),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 196/709 (28%), Positives = 320/709 (45%), Gaps = 83/709 (12%)
 Frame = +2

Query  167   PSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSI  346
             P     L + +K+ +  V++++     DEV V+LFGT  T N L  E   Y+++TV RS+
Sbjct  6     PGEESSLDQAKKIMTKFVQRQVFAESKDEVAVVLFGTNGTRNGLASEDQ-YQNITVHRSL  64

Query  347   KVVDDDLLQALEQ-LPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIK  523
              + D DLL+ ++  +  GS   DFLDA+IV MD++ K+       K+ + L T+   P+ 
Sbjct  65    MLPDFDLLEDIQNGIKAGSAQADFLDAIIVCMDLLQKETIGKKYEKRHIELFTDLSSPVS  124

Query  524   DPYEGTKEDQVSTIAAQMKAHGMRMD------------------SVIVRMKQDLDAEKGI  649
                    EDQ+  I A +K  G  +                    V   M++     KG+
Sbjct  125   -------EDQMGIIIANLKKTGTSLQFFLPFPVSVDDGSGDKSAGVHAHMRRSSFPIKGL  177

Query  650   -------IDENDFLLSVFSKETSSKAAYV--ESATSL-MGAIRTRNIAPVTLYRGDFELS  799
                    ID    L+    +E   +  Y   ES   L M     R   P   +     + 
Sbjct  178   TEQQKQGIDVVRKLMYTLDEEGGLEEIYTFRESLERLSMFKKMERKPMP---WPCQLTIG  234

Query  800   TKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQR  979
               L I++  YK  +EER   L    D         K ++     Y +  D   +V  +  
Sbjct  235   PNLSIRIVAYKSVTEERVKKLWAVVD----AKTLRKEDVQKETVYCLNDDDETEVQKDDT  290

Query  980   IKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIADPE  1150
             I+G+RYG  +VP S  + E +K+K E K   +LGFT +S I RHYYM +    VF A  +
Sbjct  291   IQGFRYGSDIVPFSKEDEEQMKYKTEGKCFSVLGFTRSSQIQRHYYMGNQALKVFAAKGD  350

Query  1151  NSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALP  1330
              + A+ A SAL RA+ ++  VA+VR  + + +    IGV  P + D     + L +  LP
Sbjct  351   ENAAV-AFSALVRALDELKVVAVVRYAYDR-RCYPQIGVAFPYIKD---TYECLIYVQLP  405

Query  1331  FAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQ---EALLPEFTPNPV  1501
             + ED+R++ F S  N     +P   Q  A D+L+  ++L   D +   +   P   PNP 
Sbjct  406   YMEDLRQYVFSSLKN-SKKYIPTVDQLSAVDSLIDSMNLVHEDGETFEDLFKPSKIPNPH  464

Query  1502  LQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL-------  1660
              QR Y  L+ K+ H D  +PP+++ L  + +    +  + +  ++  +  F L       
Sbjct  465   FQRLYQCLQHKAFHSDKPLPPVEQHLLEMLEMPCVVRERCQAPLERVKALFPLKEVGKKK  524

Query  1661  ---------KDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSEKI---GNINPVQDFED  1804
                      KDN + + S K     KP   DEE   +  K+    I   G++NP +DF  
Sbjct  525   EEKTAQDIFKDNHEDEASLK-----KPKIEDEEESFSLMKLAEGNITSVGSVNPAEDFRI  579

Query  1805  MISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFND  1984
             ++ ++++        Q++  +I   +EN      Y K ++C+ A R   +   + + FND
Sbjct  580   LVRKKNAD--FKDVSQQLIKRIDQFLENK-GSQYYMKGIDCIRAFREEAMKLAKVQCFND  636

Query  1985  LLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
              L+ L +  ++K L  F + +    I+LI+K EA  S V   EA  F+ 
Sbjct  637   FLQALKSKLEDKALSDFWEIMVQERISLISKDEAEGSLVTGEEAEKFLA  685



>ref|XP_009923647.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X2 [Haliaeetus albicilla]
 ref|XP_010566749.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X2 [Haliaeetus leucocephalus]
Length=686

 Score =   197 bits (502),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 194/715 (27%), Positives = 325/715 (45%), Gaps = 93/715 (13%)
 Frame = +2

Query  164   GPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRS  343
              P     L + +K+    V++++     DEV VILFGT  T N+L      Y+++TV RS
Sbjct  5     APGEESSLEQAKKIMMKFVQRQVFAESKDEVAVILFGTDGTRNDLASGDQ-YQNITVHRS  63

Query  344   IKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPI  520
             + + D DLL+ ++ + + GS   DFLDA+IV MD++ K+       K+ + L T+   P+
Sbjct  64    LMLPDFDLLEDIQDVIKPGSEKADFLDAIIVCMDLLQKETIGKKYEKRHIELFTDLSSPV  123

Query  521   KDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIID--------ENDF---  667
                     EDQ+  I A +K  G+ +  + +    D+D   G +          N F   
Sbjct  124   S-------EDQLEIIIANLKKTGISL-QIFLPFPMDVDDGGGDVSASVHSHMHRNSFPKN  175

Query  668   ---------------LLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTLYRGD  787
                            L+    +E   +  Y    +    S+   I  R +A P  L  G 
Sbjct  176   GLTEQQKEGIDVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIERRPMAWPCQLTIG-  234

Query  788   FELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVP  967
                 + L I++  YK  +EE+   +    D         K ++     Y +  D   +V 
Sbjct  235   ----SNLSIRIVAYKSVTEEKVKKIWTVVD----AKTLRKDDVQKETVYCLNDDDETEVQ  286

Query  968   PEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFI  1138
              +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I +HYYM +    VF 
Sbjct  287   KDDTIQGFRYGSDIVPFSKEDEEQMKYKTEGKCFSVLGFSRSSQIQQHYYMGNQVLKVFA  346

Query  1139  A-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLY  1315
             A D EN  A +A SAL  A+ ++  VAIVR  + + + N  IGV  P + D     + L 
Sbjct  347   AKDDEN--AAVAFSALVHALDELKAVAIVRYAYDR-RCNPQIGVAFPYIKD---AYECLI  400

Query  1316  FNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLP  1480
             +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   +      ++   P
Sbjct  401   YVQLPYMEDLRQYIFSSLKN-NKKCIPTADQLSAVDSLIDSMNLVYENDDGETFEDLFKP  459

Query  1481  EFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL  1660
                PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  + +  +++ +  F L
Sbjct  460   SKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPCVVKERCQAPLEKVKALFPL  519

Query  1661  ----------------KDNPKMKKSRKRLIREKPTGSDEEGERASTKVKS---EKIGNIN  1783
                             KDN +   + K     KP   DEEG  +  K+       +G++N
Sbjct  520   KEVGKKKEEKTAQDIFKDNSEDGPNPK-----KPKTEDEEGSFSIIKLAEGNVTSVGSVN  574

Query  1784  PVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQ  1963
             P +DF  ++ ++++        Q++ N+I   +EN      Y K + C+   R   +   
Sbjct  575   PAEDFRILVRQKNAD--FKDVSQQLINRIDQFLENK-SSQYYMKGISCIRVFREEAMKLF  631

Query  1964  EPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFM  2128
             + + FND L+ L +  ++K L  F + L    I+LITK E  +S V   EA  F+
Sbjct  632   KVQCFNDFLQALKSKVEDKALADFWEILIQDRISLITKDETEESSVTSEEAEKFL  686



>gb|AAD49720.1|AF166486_1 Ku autoantigen [Mus musculus]
Length=732

 Score =   198 bits (503),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 183/729 (25%), Positives = 336/729 (46%), Gaps = 89/729 (12%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M    P       + +KV ++ V++++     DE+ ++L+GT  T 
Sbjct  6     NKAAVVLCVDVGVAMGNSFPGEESPIEQAKKVMTMFVQRQVFSESKDEIALVLYGTDGTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQAL-EQLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L  +   Y+++TV R + + D DLL+ +  ++   S   DFLDA+IV MD++  +   
Sbjct  66    NALAGKDQ-YQNITVCRHLMLPDFDLLEDIGNKIQPSSQQADFLDALIVCMDLIQHETIG  124

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRM--KQDLDAE  640
                GKK + + T+   P         +DQ+  I   +K  G+ +   +     K     E
Sbjct  125   KKFGKKHIEVFTDLSSPF-------SQDQLDVIICNLKKSGISLQFFLPFPIDKNGEPGE  177

Query  641   KGIIDEN-DFLLSVFSKE--TSSKAAYVESATSLMGAIR-----------TRNIAPVTLY  778
             +G +D   D L   F ++  T  +   +   T +M ++            + ++  + ++
Sbjct  178   RGDLDSGLDHLKPSFPQKGLTEQQKEGIRMVTRVMLSLEGEDGLDEIYFFSESLRQLCVF  237

Query  779   RG----------DFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSY  928
             +              +   L IK+  YK   +E+F    +  D         K +I    
Sbjct  238   KKIERRSMPWPCQLTIGPNLSIKIVAYKSIVQEKFKKSWVVVD----ARTLKKEDIQKET  293

Query  929   EYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMR  1105
              Y +  D   +V  E  I+GYRYG  ++P S  + E +K+K E K   +LGF  +S + R
Sbjct  294   VYCLNDDDETEVSKEDTIQGYRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVHR  353

Query  1106  HYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPN  1279
              ++M      VF A  + + A+ A+S+L  A+ ++N VAIVR  + + + N  +GV  P 
Sbjct  354   RFFMGHQVLKVFAAKDDEAAAV-ALSSLVHALDELNMVAIVRYAYDK-RSNPQVGVAFPY  411

Query  1280  VSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD  1459
             + D     + L +  LPF ED+R++ F S  N      P E Q  A D+L+  + L   +
Sbjct  412   IKD---TYECLVYVQLPFMEDLRQYMFSSLKN-NMKCTPTEAQLSAIDDLIDSMSLVKKN  467

Query  1460  SQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNK  1624
              +E ++ +       PNP  QR Y  L  ++ H    +PP+ + +  + DP  E+ ++ +
Sbjct  468   EEEDIVEDLFPTSKIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTEMKAKCE  527

Query  1625  TVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE-------------  1765
             + + + +  F L +   +KK  +   ++      EEG  A+ K K+E             
Sbjct  528   SPLSKVKTLFPLTE--VIKKKNQVTAQDVFQDHHEEGP-AAKKYKTEKEEDHISISSLAE  584

Query  1766  ----KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQKALE  1924
                 K+G++NPV++F  ++ ++ +      + +E   ++   +E  L+ +    + K+++
Sbjct  585   GNITKVGSVNPVENFRFLVRQKIA------SFEEASLQLISHIEQFLDTNETLYFMKSMD  638

Query  1925  CLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVL  2104
             C+ A R   I   E ++FN  L  L    + K L  F + +   G+ LITK E P S + 
Sbjct  639   CIKAFREEAIQFSEEQRFNSFLEALREKVEIKQLNHFWEIVVQDGVTLITKDEGPGSSIT  698

Query  2105  ESEARSFMT  2131
               EA  F+ 
Sbjct  699   AEEATKFLA  707



>ref|XP_009923646.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X1 [Haliaeetus albicilla]
 ref|XP_010566741.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X1 [Haliaeetus leucocephalus]
Length=712

 Score =   197 bits (502),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 194/716 (27%), Positives = 325/716 (45%), Gaps = 93/716 (13%)
 Frame = +2

Query  164   GPSMHCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRS  343
              P     L + +K+    V++++     DEV VILFGT  T N+L      Y+++TV RS
Sbjct  5     APGEESSLEQAKKIMMKFVQRQVFAESKDEVAVILFGTDGTRNDLASGDQ-YQNITVHRS  63

Query  344   IKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPI  520
             + + D DLL+ ++ + + GS   DFLDA+IV MD++ K+       K+ + L T+   P+
Sbjct  64    LMLPDFDLLEDIQDVIKPGSEKADFLDAIIVCMDLLQKETIGKKYEKRHIELFTDLSSPV  123

Query  521   KDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIID--------ENDF---  667
                     EDQ+  I A +K  G+ +  + +    D+D   G +          N F   
Sbjct  124   S-------EDQLEIIIANLKKTGISL-QIFLPFPMDVDDGGGDVSASVHSHMHRNSFPKN  175

Query  668   ---------------LLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTLYRGD  787
                            L+    +E   +  Y    +    S+   I  R +A P  L  G 
Sbjct  176   GLTEQQKEGIDVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIERRPMAWPCQLTIG-  234

Query  788   FELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVP  967
                 + L I++  YK  +EE+   +    D         K ++     Y +  D   +V 
Sbjct  235   ----SNLSIRIVAYKSVTEEKVKKIWTVVD----AKTLRKDDVQKETVYCLNDDDETEVQ  286

Query  968   PEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFI  1138
              +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I +HYYM +    VF 
Sbjct  287   KDDTIQGFRYGSDIVPFSKEDEEQMKYKTEGKCFSVLGFSRSSQIQQHYYMGNQVLKVFA  346

Query  1139  A-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLY  1315
             A D EN  A +A SAL  A+ ++  VAIVR  + + + N  IGV  P + D     + L 
Sbjct  347   AKDDEN--AAVAFSALVHALDELKAVAIVRYAYDR-RCNPQIGVAFPYIKD---AYECLI  400

Query  1316  FNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLP  1480
             +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L   +      ++   P
Sbjct  401   YVQLPYMEDLRQYIFSSLKN-NKKCIPTADQLSAVDSLIDSMNLVYENDDGETFEDLFKP  459

Query  1481  EFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL  1660
                PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  + +  +++ +  F L
Sbjct  460   SKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPCVVKERCQAPLEKVKALFPL  519

Query  1661  ----------------KDNPKMKKSRKRLIREKPTGSDEEGERASTKVKS---EKIGNIN  1783
                             KDN +   + K     KP   DEEG  +  K+       +G++N
Sbjct  520   KEVGKKKEEKTAQDIFKDNSEDGPNPK-----KPKTEDEEGSFSIIKLAEGNVTSVGSVN  574

Query  1784  PVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQ  1963
             P +DF  ++ ++++        Q++ N+I   +EN      Y K + C+   R   +   
Sbjct  575   PAEDFRILVRQKNAD--FKDVSQQLINRIDQFLENK-SSQYYMKGISCIRVFREEAMKLF  631

Query  1964  EPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             + + FND L+ L +  ++K L  F + L    I+LITK E  +S V   EA  F+ 
Sbjct  632   KVQCFNDFLQALKSKVEDKALADFWEILIQDRISLITKDETEESSVTSEEAEKFLA  687



>gb|KFW66754.1| X-ray repair cross-complementing protein 5, partial [Pygoscelis 
adeliae]
Length=695

 Score =   197 bits (501),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 201/725 (28%), Positives = 335/725 (46%), Gaps = 99/725 (14%)
 Frame = +2

Query  140   GLILVIDVGPSM-------HCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M          L + +KV +  V++++     DEV V+LFGT  T N+L
Sbjct  2     AVVLCLDVGFTMSNSASGEESSLEQAKKVMTKFVQRQIFAESKDEVAVVLFGTDGTRNDL  61

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++ + +  S   DFLDA+IV MD++ K+      
Sbjct  62    ASGDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPDSEQADFLDAIIVCMDLLQKETIGKRY  120

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+        EDQ+  I A +K  G+ +                   
Sbjct  121   EKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGISLQFFLPFPVDVDDGGGDTNA  173

Query  602   SVIVRMKQDLDAEKGI-------IDENDFLLSVFSKETSSKAAYVESAT----SLMGAIR  748
             SV  +M ++    KG+       ID    L+    +E   +  Y    +    S+   I 
Sbjct  174   SVHSQMHRNSFPRKGLTEQQKEGIDVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIE  233

Query  749   TRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
              R +A P  L  G     + L I++  YK  +EE+    KM++     T    K ++   
Sbjct  234   RRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVK--KMWTVVDAKT--LRKDDVQKE  284

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I 
Sbjct  285   TVYCLNDDDETEVQRDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQ  344

Query  1103  RHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLT  1273
             RHYYM +    VF A D EN  A +A SAL  A+ ++  VAIVR V+ + + N  IGV  
Sbjct  345   RHYYMGNQVLKVFAAKDDEN--AAVAFSALVHALDELKVVAIVRYVYDR-RCNPQIGVAF  401

Query  1274  PNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAP  1453
             P + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L  
Sbjct  402   PYIKD---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKCIPTADQLSAVDSLIDSMNLIY  457

Query  1454  SDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQ  1618
              D      ++   P    NP  QR Y  L+ K+ H +  +PP+++ +  + +    +  +
Sbjct  458   EDDDGETFEDLFKPSKISNPHFQRLYQCLQHKAFHPNEPLPPVEQHILEMLEVPRVVKER  517

Query  1619  NKTVVDEFRRCFEL----------------KDNPKMKKSRKRLIREKPTGSDEEGERAST  1750
              +  +++ +  F L                KDN      +K      P   DEEG  +  
Sbjct  518   CQAPLEKVKALFPLKEVGKKKEEKTAQDIFKDNEDGPNPKK------PKIDDEEGSFSII  571

Query  1751  KVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKAL  1921
             K+       +G++NP +DF  ++ ++++        Q++ N+I   +EN  +   Y K +
Sbjct  572   KLAEGNVTSVGSVNPAEDFRILVRQKNAD--FKDVSQQLINRIDQFLENK-DSQYYMKGI  628

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
              C+   R   I   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V
Sbjct  629   SCISVFREEAIKLSKVQCFNDFLQALKSKVEDKALADFWEIMIQDRISLITKDEAEGSLV  688

Query  2102  LESEA  2116
                EA
Sbjct  689   TSEEA  693



>ref|XP_007908297.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X1 [Callorhinchus milii]
Length=733

 Score =   197 bits (502),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 182/729 (25%), Positives = 346/729 (47%), Gaps = 88/729 (12%)
 Frame = +2

Query  119   QMAR-NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFg  274
             +MAR ++  ++L +DVG +M    P       + ++V  + V++++     DE  ++L+G
Sbjct  8     KMARASKSAVVLCLDVGHTMGHAPPGHESPFEQAKRVLLMFVQRQVFAESKDETALVLYG  67

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             +  T+N L      Y+H+TV R++ + D  LL+ ++ ++  G    DFLDA++V MD++ 
Sbjct  68    SDATSNPLAGADQ-YQHITVHRNLMIPDFSLLEDVQSRIEPGLQQADFLDALVVCMDVLQ  126

Query  452   KKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDL  631
             K+      GKK   L       +  P+     DQ+  I A ++  G+ +    +    D 
Sbjct  127   KQ----TLGKKYEKLHIAVFTDLNSPFSS---DQLDIIIANLRQAGITL-QFFLPFPLDS  178

Query  632   DAEKGIIDENDF-----------------------------LLSVFSKETSSKAAYV--E  718
             D E G   + D                              +++ F +E      +   E
Sbjct  179   DGEGGGCGDADSGVQSDRSRGHPPGKGLTTQQKEGVKMVRKVMTAFDEEFGLDEVFTFSE  238

Query  719   SATSLMGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDK  898
             SA  L G  +     P+  +     + + + I++  YK   EE+     +  D       
Sbjct  239   SAERL-GLFKKLERRPMP-WPCQLTIGSNISIRIVGYKAMCEEKVKKAWISVD----AKT  292

Query  899   FAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLL  1075
               K ++     Y +  D   ++  ++ I+G+RYG  ++P S  + + +K+K + K   +L
Sbjct  293   LQKEDVRKEVVYCLNDDDETEILKDETIQGFRYGSDIIPFSRIDQDQMKYKTDGKCFSVL  352

Query  1076  GFTDASNIMRHYYMKDANVFIADP-ENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             GFT +S ++RHY +    + +  P ++  A +A+SAL +A+++M+ VAIVR V+ + + N
Sbjct  353   GFTKSSQVLRHYNIGRQTLKVLPPKDDEHAAVALSALIQALEEMDMVAIVRYVYDR-RSN  411

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
               +GV  P + ++      L +  LPF ED+R+F F S S+       +E+Q  A D+L+
Sbjct  412   PQVGVAFPLIKEEYQC---LVYIQLPFMEDLRQFTFASLSH--KRWAASEEQLAAVDSLI  466

Query  1433  KMLDLAPSD---SQEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDP  1603
               + L   D   +Q+       PNP  QR +  L+ K+ H D  +PP++  L  + +   
Sbjct  467   DSMGLVQEDGEKTQDLFKVSKIPNPHYQRLFQCLQYKAFHPDQPLPPIEAQLTAMLERPQ  526

Query  1604  ELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSEK-----  1768
             E+    +  +   +  F L+D  K K+ +   I +K   + EE +    ++  E+     
Sbjct  527   EVSVSCQPALQHLKSLFTLQDAGKKKEPK---IAQKIFNNVEEPDAKRARLDDEEFCITR  583

Query  1769  --------IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEG-DTYQKAL  1921
                     +G+++P +DF  +IS++     V+    ++K +++  +  +++G + Y K++
Sbjct  584   LAEGRVTSVGSLHPAKDFRFLISQKSDFREVSS---QLKERVWQFL--AVKGREYYIKSM  638

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
             +C+ A R   +   + + FN  ++ L  S +EK L  F   L   G++LIT+ EA DS V
Sbjct  639   DCISAFREEAVKAGKAQLFNTFIKTLKESVEEKGLYDFWDLLVQDGVSLITQDEAGDSAV  698

Query  2102  LESEARSFM  2128
              E EA+ F+
Sbjct  699   TEDEAKRFL  707



>gb|KFP03339.1| X-ray repair cross-complementing protein 5, partial [Calypte 
anna]
Length=719

 Score =   197 bits (502),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 193/732 (26%), Positives = 332/732 (45%), Gaps = 103/732 (14%)
 Frame = +2

Query  140   GLILVIDVGPSM-------HCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M            + +KV +  V++++     DEV V+LFGT+ T N L
Sbjct  1     AIVLCLDVGFTMSNSASGEESPFEQAKKVMTKFVQRQVFAESKDEVAVVLFGTSGTRNGL  60

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++ + + G+   DFLDA+IV MD++ K+      
Sbjct  61    ASGDQ-YQNITVHRSLMLADFDLLEDIQDVIKPGTEQADFLDAIIVCMDLLQKETIGKKY  119

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+        EDQ+  I A +K  G+ +                   
Sbjct  120   EKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGISLQFFLPFPVDVDDEGGDTSA  172

Query  602   SVIVRMKQDLDAEKGI-------IDENDFLLSVFSKETSSKAAYVESAT----SLMGAIR  748
             S+  +M ++    KG+       ID    L+    +E   +  Y    +    S+   I 
Sbjct  173   SIHSQMCRNSFPRKGLTEQQKEGIDVVKKLMHTLDEEGGLEEIYTFRESLERLSMFKKIE  232

Query  749   TRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
              R +A P  L  G     + L I++  YK  +EE+   +    D         K ++   
Sbjct  233   RRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVKKVWTVVD----AKTLRKDDVRKE  283

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   ++  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I 
Sbjct  284   TVYCLNDDDETEIQKDDIIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSKSSQIQ  343

Query  1103  RHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTP  1276
             R YYM +    VF A  + + A+ A SAL  A+ ++  VAIVR  + + + N  IGV  P
Sbjct  344   RQYYMGNQALKVFAAKGDENAAV-AFSALVHALDELKVVAIVRYAYDR-RSNPQIGVAFP  401

Query  1277  NVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPS  1456
              + D     + L +  LP+ ED+R++ F S  N     +P E Q  A D+L+  ++L   
Sbjct  402   YIKD---AYECLIYVQLPYMEDLRQYIFSSLKN-NKKCIPTEDQLSAIDSLIDSMNLVYE  457

Query  1457  DS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQN  1621
             D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  + 
Sbjct  458   DDDGETFEDLFKPSKIPNPRFQRLYQCLQHKAFHPNEPLPPIEQHLLEMMEIPHVVKERC  517

Query  1622  KTVVDEFRRCFEL-------------------KDNPKMKKSRKRLIREKPTGSDEEGERA  1744
             +  +++ +  F L                   +D P +KK         P   DEEG  +
Sbjct  518   QAPLEKVKALFPLKEVSKKKEEKTAQDIFKDNEDGPNVKK---------PKIEDEEGSFS  568

Query  1745  STKVKSEKI---GNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQK  1915
               ++    I   G++NP +DF  ++ ++++        Q++ ++I   +EN      Y K
Sbjct  569   IMRLAEGNITSVGSVNPAEDFRILVRQKNAD--FKDVSQQLIHRIDQFLENK-GSQYYMK  625

Query  1916  ALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDS  2095
              + C+   R   I   + + FND L+ L +  ++K    F + +    I+LITK EA  S
Sbjct  626   GINCIRVFREEAIKLSKVQCFNDFLQALKSKVEDKAFADFWEIVIQDRISLITKVEAEGS  685

Query  2096  DVLESEARSFMT  2131
              V   EA  F+ 
Sbjct  686   LVTSEEAEQFLA  697



>ref|XP_001023138.1| Ku70/Ku80 beta-barrel domain containing protein [Tetrahymena 
thermophila]
 gb|EAS02893.1| Ku70/Ku80 beta-barrel domain protein [Tetrahymena thermophila 
SB210]
Length=757

 Score =   198 bits (503),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 195/764 (26%), Positives = 329/764 (43%), Gaps = 132/764 (17%)
 Frame = +2

Query  134   REGLILVIDVGPSMHCVLP----------EIEKVC-SVLVEKKLIYSKYDEVGVILFgtt  280
             +E  I+++D+G SM   L           EI   C  +L+++K+  +K  EVG+ILFG  
Sbjct  4     KEATIILLDMGSSMQQYLGDRGTNGQKRIEIAVNCIKLLLQQKMFNTKTHEVGLILFGLK  63

Query  281   etanelteelggYEHVTVLRSIKVVDDDLLQALEQLPRGSVD----GDFLDAVIVGMD--  442
             +  +         + +  +R I   D D L+ ++ L     D    GD  +A+   +D  
Sbjct  64    DEGD---------DKIMYIRGIGKPDIDFLKNVQDLKDYQSDECEGGDIFEAIEQTIDVI  114

Query  443   --------------MMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQ--VSTIAAQ  574
                           +M   +G T+  +K+          I D  E  ++ Q  ++ I   
Sbjct  115   HDYVKEKKYEKKIQLMTAGFGKTSYKEKQ----------IMDLIEKARKVQTKINVIGFD  164

Query  575   MKAHGMRMDSVIVRMKQDLDAEKGIIDENDFLLSVFSKETSSKAAYVES--ATSLMGAIR  748
                     +S    +K+D  A+    + N  L SV   E   +     S  A  +    R
Sbjct  165   FLKKYNPEESNTDVLKKDDAAQNTRQNLNQKLFSVVKDELGEQIQLFPSDVAIKIYEQFR  224

Query  749   TRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSY  928
             TR +   + + GD +L+  L I V ++ KTSEE+ P LKMYS        F  H  +   
Sbjct  225   TRQVNLRSKFNGDLQLAPNLNIAVQMFTKTSEEKLPGLKMYSLAV----DFNPHCESGQI  280

Query  929   EYKVV----QDPTKQVPPEQRI-KGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDAS  1093
             E  V+    +DP      +  I K Y YG Q++P++ A    + +   + +K+LGF D+ 
Sbjct  281   ERDVIMALQEDPNLNPIDKSNITKAYHYGKQLIPVTQALEAQMNYTSNRELKVLGFVDSK  340

Query  1094  NIMRHYYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLT  1273
              + R  +M   ++ IA+  +S A   ++AL  +M   N+ AI R VWR   G   + VLT
Sbjct  341   KVPRQSFMAGVDIIIANKNDSVAKKGIAALCHSMIQTNKYAIARYVWR-NNGAPKLCVLT  399

Query  1274  PNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAP  1453
             P +   G   + LY   +P +E VR+FQF S           ++QQ+   +L+  +DL  
Sbjct  400   PQI---GKDYECLYMCQIPTSESVRDFQFNSLKE------STKEQQDLMGSLIDKMDLMN  450

Query  1454  -SDSQEALLPEFTPNPVLQRYYHYLEMKSKH---HDAAVPPLDEILRRITDPDPELLSQN  1621
               D +EAL  ++T NP  Q +Y  +  +  +    D  +PPLD  +R    P+ ++  + 
Sbjct  451   LEDGEEALQMKYTFNPTRQYFYQTVFHRVFNPPDADTKIPPLDPNIRDYITPEKKVYPKA  510

Query  1622  KTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSD-----------------EEGERAST  1750
                + + +  F+L++     +  K++  ++    +                 E G+  S 
Sbjct  511   AEELKKIKESFQLQEQEIKDEISKKIFWQQLFNPNYQVPAANINAPQVQIKMENGQMESE  570

Query  1751  KVKSE--------------------------------KIGNINPVQDFEDMISRRDSPEW  1834
              V+ +                                K+ +++PV DF  M++ +   + 
Sbjct  571   DVEQQAQILVDVKEELENIPISKKFAFDDYNKDDVVRKVSSVSPVDDFFKMMTNK-REDL  629

Query  1835  VNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQE----PKQFNDLLRNLY  2002
             V+ AI +++  I  L+E S+ G  Y+KALEC+ A R GC  E E    PK FN+ L    
Sbjct  630   VSDAISQIQGMISQLIETSIRGSYYEKALECIKAFRKGCTSEYEQLEAPK-FNNFLNTFK  688

Query  2003  ASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMTE  2134
                 + D + F K L   GI LIT  E+  S+    EA  F+ +
Sbjct  689   DKLLKSDQKGFWKMLIQQGITLITDKESTKSNFTTKEALQFLHQ  732



>ref|XP_006495955.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X1 [Mus musculus]
Length=748

 Score =   197 bits (502),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 186/739 (25%), Positives = 338/739 (46%), Gaps = 93/739 (13%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M    P       + +KV ++ V++++     DE+ ++L+GT  T 
Sbjct  6     NKAAVVLCVDVGVAMGNSFPGEESPIEQAKKVMTMFVQRQVFSESKDEIALVLYGTDGTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQAL-EQLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L  +   Y+++TV R + + D DLL+ +  ++   S   DFLDA+IV MD++ ++   
Sbjct  66    NALAGKDQ-YQNITVCRHLMLPDFDLLEDIGNKIQPSSQQADFLDALIVCMDLIQRETIG  124

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRM--KQDLDAE  640
                GKK + + T+   P         +DQ+  I   +K  G+ +   +     K     E
Sbjct  125   KKFGKKHIEVFTDLSSPF-------SQDQLDVIICNLKKSGISLQFFLPFPIDKNGEPGE  177

Query  641   KGIIDEN-DFLLSVFSKE--TSSKAAYVESATSLMGAIR-----------TRNIAPVTLY  778
             +G +D   D L   F ++  T  +   +   T +M ++            + ++  + ++
Sbjct  178   RGDLDSGLDHLKPSFPQKGLTEQQKEGIRMVTRVMLSLEGEDGLDEIYSFSESLRQLCVF  237

Query  779   RG----------DFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSY  928
             +              +   L IK+  YK   +E+F    +  D         K +I    
Sbjct  238   KKIERRSMPWPCQLTIGPNLSIKIVAYKSIVQEKFKKSWVVVD----ARTLKKEDIQKET  293

Query  929   EYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMR  1105
              Y +  D   +V  E  I+GYRYG  ++P S  + E +K+K E K   +LGF  +S + R
Sbjct  294   VYCLNDDDETEVSKEDTIQGYRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVHR  353

Query  1106  HYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPN  1279
              ++M      VF A  + + A+ A+S+L  A+ ++N VAIVR  + + + N  +GV  P 
Sbjct  354   RFFMGHQVLKVFAAKDDEAAAV-ALSSLVHALDELNMVAIVRYAYDK-RSNPQVGVAFPY  411

Query  1280  VSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD  1459
             + D     + L +  LPF ED+R++ F S  N      P E Q  A D+L+  + L   +
Sbjct  412   IKD---AYECLVYVQLPFMEDLRQYMFSSLKN-NKKCTPTEAQLSAIDDLIDSMSLVKKN  467

Query  1460  SQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNK  1624
              +E ++ +       PNP  QR Y  L  ++ H    +PP+ + +  + DP  E+ ++ +
Sbjct  468   EEEDIVEDLFPTSKIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTEMKAKCE  527

Query  1625  TVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSE-------------  1765
             + + + +  F L +   +KK  +   ++    + EEG  A+ K K+E             
Sbjct  528   SPLSKVKTLFPLTE--VIKKKNQVTAQDVFQDNHEEGP-AAKKYKTEKEEDHISISSLAE  584

Query  1766  ----KIGNINPVQDFEDMISRRDS-------PEWVNKAIQEMKNKIFYLVE------NSL  1894
                 K+G++NPV++F  ++ ++ +       P+  N   QE       L+       ++ 
Sbjct  585   GNITKVGSVNPVENFRFLVRQKIASFEEDCKPKAKNTLTQEEVATSLQLISHIEQFLDTN  644

Query  1895  EGDTYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALIT  2074
             E   + K+++C+ A R   I   E ++FN  L  L    + K L  F + +   G+ LIT
Sbjct  645   ETLYFMKSMDCIKAFREEAIQFSEEQRFNSFLEALREKVEIKQLNHFWEIVVQDGVTLIT  704

Query  2075  KTEAPDSDVLESEARSFMT  2131
             K E P S +   EA  F+ 
Sbjct  705   KDEGPGSSITAEEATKFLA  723



>ref|XP_009321814.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X1 [Pygoscelis adeliae]
Length=712

 Score =   197 bits (501),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 198/708 (28%), Positives = 330/708 (47%), Gaps = 91/708 (13%)
 Frame = +2

Query  185   LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDD  364
             L + +KV +  V++++     DEV V+LFGT  T N+L      Y+++TV RS+ + D D
Sbjct  12    LEQAKKVMTKFVQRQIFAESKDEVAVVLFGTDGTRNDLASGDQ-YQNITVHRSLMLPDFD  70

Query  365   LLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGT  541
             LL+ ++ + +  S   DFLDA+IV MD++ K+       K+ + L T+   P+       
Sbjct  71    LLEDIQDVIKPDSEQADFLDAIIVCMDLLQKETIGKRYEKRHIELFTDLSSPVS------  124

Query  542   KEDQVSTIAAQMKAHGMRMD------------------SVIVRMKQDLDAEKGI------  649
              EDQ+  I A +K  G+ +                   SV  +M ++    KG+      
Sbjct  125   -EDQLEIIIANLKKTGISLQFFLPFPVDVDDGGGDTNASVHSQMHRNSFPRKGLTEQQKE  183

Query  650   -IDENDFLLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTLYRGDFELSTKLK  811
              ID    L+    +E   +  Y    +    S+   I  R +A P  L  G     + L 
Sbjct  184   GIDVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIERRPMAWPCQLTIG-----SNLS  238

Query  812   IKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGY  991
             I++  YK  +EE+    KM++     T    K ++     Y +  D   +V  +  I+G+
Sbjct  239   IRIVAYKSVTEEKVK--KMWTVVDAKT--LRKDDVQKETVYCLNDDDETEVQRDDTIQGF  294

Query  992   RYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA-DPENSK  1159
             RYG  +VP S  + E +K+K E K   +LGF+ +S I RHYYM +    VF A D EN  
Sbjct  295   RYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHYYMGNQVLKVFAAKDDEN--  352

Query  1160  AILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAE  1339
             A +A SAL  A+ ++  VAIVR V+ + + N  IGV  P + D     + L +  LP+ E
Sbjct  353   AAVAFSALVHALDELKVVAIVRYVYDR-RCNPQIGVAFPYIKD---AYECLIYVQLPYME  408

Query  1340  DVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLPEFTPNPVL  1504
             D+R++ F S  N     +P   Q  A D+L+  ++L   D      ++   P    NP  
Sbjct  409   DLRQYIFSSLKN-NKKCIPTADQLSAVDSLIDSMNLIYEDDDGETFEDLFKPSKISNPHF  467

Query  1505  QRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL--------  1660
             QR Y  L+ K+ H +  +PP+++ +  + +    +  + +  +++ +  F L        
Sbjct  468   QRLYQCLQHKAFHPNEPLPPVEQHILEMLEVPRVVKERCQAPLEKVKALFPLKEVGKKKE  527

Query  1661  --------KDNPKMKKSRKRLIREKPTGSDEEGERASTKVKS---EKIGNINPVQDFEDM  1807
                     KDN +   + K     KP   DEEG  +  K+       +G++NP +DF  +
Sbjct  528   EKTAQDIFKDNSEDGPNPK-----KPKIDDEEGSFSIIKLAEGNVTSVGSVNPAEDFRIL  582

Query  1808  ISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDL  1987
             + ++++        Q++ N+I   +EN  +   Y K + C+   R   I   + + FND 
Sbjct  583   VRQKNAD--FKDVSQQLINRIDQFLENK-DSQYYMKGISCISVFREEAIKLSKVQCFNDF  639

Query  1988  LRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             L+ L +  ++K L  F + +    I+LITK EA  S V   EA  F+ 
Sbjct  640   LQALKSKVEDKALADFWEIMIQDRISLITKDEAEGSLVTSEEAEKFLA  687



>ref|XP_002712509.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X1 [Oryctolagus cuniculus]
Length=733

 Score =   197 bits (501),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 183/734 (25%), Positives = 338/734 (46%), Gaps = 91/734 (12%)
 Frame = +2

Query  122   MAR--NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR  N+  ++L +DVG +M    P       + +KV ++ V++++     DE+ ++LFG
Sbjct  1     MARFWNKAAVVLCMDVGFAMGNSFPGEESPFEQAKKVMTMFVQRQVFAESKDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T +T N L +    Y+++TV R + + D DLL+ ++ ++  GS   DFLDA+IV MD++ 
Sbjct  61    TDDTKNALADGDQ-YQNITVHRHLMLPDFDLLEDIDSKIQLGSQQADFLDALIVCMDVIQ  119

Query  452   KKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDL  631
             ++       K+ + + T+   P         +DQ+  I   +K  G+   S+   +   +
Sbjct  120   RETVGKRFEKRHIEVFTDLSSPF-------SKDQLDIIIHNLKKSGI---SLQFFLPFPI  169

Query  632   DAEKGIIDENDFLLSVFSKETS--------SKAAYVESATSLMGAIR-----------TR  754
               E G  D  D  L ++   +S         +   ++    +M ++            + 
Sbjct  170   GKEDGTGDRGDGNLPLYHHGSSFPPKGITEQQKEGIQMVKMMMVSLEGEDGLDEIYSFSE  229

Query  755   NIAPVTLYRG----------DFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFA  904
             ++  + +++              + + L IK+  YK   +E+        D         
Sbjct  230   SLRQLCVFKKIEKRSMPWPCQLTIGSNLSIKIVAYKSIVQEKVKKTWTVVD----ARTLK  285

Query  905   KHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGF  1081
             K +I     Y +  D   +VP E  ++G+RYG  +VP S  + E +K+K E K   +LGF
Sbjct  286   KEDIQKETVYCLNDDDETEVPKEDTLQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGF  345

Query  1082  TDASNIMRHYYM--KDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNV  1255
               +S + R ++M  +   VF A  + + A+ A+S+L  A+ +++ VAIVR  + + + N 
Sbjct  346   CRSSQVQRKFFMGYQVLKVFAAKDDEAAAV-ALSSLVHALDELDMVAIVRYAYDR-RSNP  403

Query  1256  TIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVK  1435
              +GV  P + D     + L +  LPF ED+R++ F S  N      P E Q  A D L+ 
Sbjct  404   QVGVAFPYIKD---AYECLVYVQLPFMEDLRQYMFSSLKN-NKKFTPTEAQLNAVDALID  459

Query  1436  MLDLAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPD  1600
              + L   D +E  + +       PNP  QR +  L  ++ H    +PP+ + +  + DP 
Sbjct  460   SMSLVKKDEEEGTVEDLFQTTKIPNPEFQRLFQCLLHRALHPQEPLPPIQQHILNMLDPP  519

Query  1601  PELLSQNKTVVDEFRRCFEL------KDNPKMKKSRKRLIREKPTG----SDEEGERAST  1750
              E+ ++++T + + +  F L      KD    +   K    E P      ++EE    S 
Sbjct  520   AEVTAKSQTPLSKIKSLFPLTEAIKRKDQVTAQDIFKDNHEEGPIAKKCKTEEEEAHFSV  579

Query  1751  KVKSE----KIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---Y  1909
                +E     +G++NP ++F  ++ ++      N + +E  +++   +E  L+ +    +
Sbjct  580   SSLAEGRVTSVGSVNPAENFRVIVRQK------NASFEEASHQLINHIEQFLDTNETPYF  633

Query  1910  QKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAP  2089
              K+++C+ A R   I   E + FN  L+ L    + K L  F + +   GI LI+K EA 
Sbjct  634   MKSIDCIKAFREEAIEFSEEQHFNSFLKGLREKVEIKQLNHFWEIVVQDGITLISKDEAS  693

Query  2090  DSDVLESEARSFMT  2131
              S V   EA+ F+ 
Sbjct  694   GSSVTAEEAKQFLA  707



>dbj|BAD96323.1| ATP-dependent DNA helicase II variant [Homo sapiens]
Length=732

 Score =   197 bits (500),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 198/732 (27%), Positives = 341/732 (47%), Gaps = 96/732 (13%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M   +P IE       KV ++ V++++     DE+ ++LFGT  T 
Sbjct  6     NKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L+     Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD+ I+   I
Sbjct  66    NPLSGGDQ-YQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDV-IQHETI  123

Query  467   TNKGKKR----------------LCLITNAM--CPIKD----PYEGTKEDQVSTIA---A  571
               K +KR                L +I +++  C I      P+   KED          
Sbjct  124   GKKFEKRHIEVFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDSGDGPF  183

Query  572   QMKAHG--MRMDSVIVRMKQDLDAEKGI---IDENDFLLSVFSKETSSKAAYVESATSLM  736
             ++  HG    +  +  + K+ L+  K +   ++  D L  ++S   S +   V       
Sbjct  184   RLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCV------F  237

Query  737   GAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHE  913
               I   +I  P  L  G     + L I++  YK   +ER        D         K +
Sbjct  238   KKIERHSIHWPCRLTIG-----SNLSIRIAAYKSILQERVKKTWTVVD----AKTLKKED  288

Query  914   ITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDA  1090
             I     Y +  D   +V  E  I+G+RYG  +VP S  + E +K+K E K   +LGF  +
Sbjct  289   IQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKS  348

Query  1091  SNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIG  1264
             S + R ++M +    VF A  + + A+ A+S+L  A+ D++ VAIVR  + + + N  +G
Sbjct  349   SQVQRRFFMGNQVLKVFAARDDEAAAV-ALSSLIHALDDLDMVAIVRYAYDK-RANPQVG  406

Query  1265  VLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLD  1444
             V  P++  K N  + L +  LPF ED+R++ F S  N      P E Q  A D L+  + 
Sbjct  407   VAFPHI--KHNY-ECLVYVQLPFMEDLRQYMFSSLKN-SKKYAPTEAQLNAVDALIDSMS  462

Query  1445  LAP----SDSQEALLPEF-TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPEL  1609
             LA     +D+ E L P    PNP  QR +  L  ++ H    +PP+ + +  + +P  E+
Sbjct  463   LAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEV  522

Query  1610  LSQNKTVVDEFRRCFEL---------------KDNPKMKKSRKRLIREKPTGSDEEGERA  1744
              ++++  + + +  F L               +DN +   + K+L  E+          A
Sbjct  523   TTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLA  582

Query  1745  STKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQK  1915
                V S  +G++NP ++F  ++ ++ +      + +E  N++   +E  L+ +    + K
Sbjct  583   EGSVTS--VGSVNPAENFRVLVKQKKA------SFEEASNQLINHIEQFLDTNETPYFMK  634

Query  1916  ALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDS  2095
             +++C+ A R   I   E ++FN+ L+ L    + K L  F + +   GI LITK EA  S
Sbjct  635   SIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGS  694

Query  2096  DVLESEARSFMT  2131
              V   EA+ F+ 
Sbjct  695   SVTAEEAKKFLA  706



>gb|KFM04654.1| X-ray repair cross-complementing protein 5, partial [Aptenodytes 
forsteri]
Length=695

 Score =   196 bits (499),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 199/725 (27%), Positives = 335/725 (46%), Gaps = 99/725 (14%)
 Frame = +2

Query  140   GLILVIDVGPSM-------HCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M          L + +KV +  V++++     DEV V+LFGT  T N+L
Sbjct  2     AIVLCLDVGFTMSNSASGEESSLEQAKKVMTKFVQRQVFAESKDEVAVVLFGTDGTRNDL  61

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++ + +  S   DFLDA+IV MD++ K+      
Sbjct  62    ARGDQ-YQNITVHRSLMLPDFDLLEDIQDVIKPDSEQADFLDAIIVCMDLLQKETIGKRY  120

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD------------------  601
              K+ + L T+   P+        EDQ+  I A +K  G+ +                   
Sbjct  121   EKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGISLQFFLPFPVDVDDGGGDTNA  173

Query  602   SVIVRMKQDLDAEKGIIDEND-------FLLSVFSKETSSKAAYVESAT----SLMGAIR  748
             SV  +M ++    KG+ ++          L+    +E   +  Y    +    S+   I 
Sbjct  174   SVHSQMHRNSFPRKGLTEQQKEGVDVVMKLMHTLDEEGGLEEIYTFRESLERLSMFKKIE  233

Query  749   TRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
              R +A P  L  G     + L I++  YK  +EE+    KM++     T    K ++   
Sbjct  234   RRPMAWPCQLTIG-----SNLSIRIVAYKSVTEEKVK--KMWTVVDAKT--LRKDDVQKE  284

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +S I 
Sbjct  285   TVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQ  344

Query  1103  RHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLT  1273
             RHYYM +    VF A D EN  A +A SAL  A+ ++  VAIVR V+ + + N  IGV  
Sbjct  345   RHYYMGNQVLKVFAAKDDEN--AAVAFSALVHALDELKVVAIVRYVYDR-RCNPQIGVAF  401

Query  1274  PNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAP  1453
             P + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L  
Sbjct  402   PYIKD---AYECLIYVQLPYMEDLRQYLFSSLKN-NKKCIPTVDQLSAVDSLIDSMNLIY  457

Query  1454  SDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQ  1618
              D      ++   P    NP  QR Y  L+ K+ H +  +PP+++ +  + +    +  +
Sbjct  458   EDDDGETFEDLFKPSKISNPHFQRLYQCLQHKAFHPNEPLPPVEQHILEMLEVPHVVKER  517

Query  1619  NKTVVDEFRRCFEL----------------KDNPKMKKSRKRLIREKPTGSDEEGERAST  1750
              +  +++ +  F L                KDN      +K      P   DEEG  +  
Sbjct  518   CQAPLEKVKALFPLKEVGKKKEEKTAQDIFKDNEDGPNPKK------PKIDDEEGSFSII  571

Query  1751  KVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKAL  1921
             K+       +G++NP +DF  ++ ++++        Q++ N+I   +EN  +   Y K +
Sbjct  572   KLAEGNVTSVGSVNPAEDFRILVRQKNAD--FKDVSQQLINRIDQFLENK-DSQYYMKGI  628

Query  1922  ECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDV  2101
              C+   R   I   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V
Sbjct  629   SCISVFREEAIKLSKVQCFNDFLQALKSKVEDKALADFWEIMIQDRISLITKDEAEGSLV  688

Query  2102  LESEA  2116
                EA
Sbjct  689   TSEEA  693



>gb|KGL95186.1| X-ray repair cross-complementing protein 5, partial [Charadrius 
vociferus]
Length=697

 Score =   196 bits (499),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 199/732 (27%), Positives = 334/732 (46%), Gaps = 105/732 (14%)
 Frame = +2

Query  140   GLILVIDVGPSM-------HCVLPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M          L + +KV +  V++++     DEV V+LFGT  T N L
Sbjct  2     AIVLCLDVGFTMSYSASGEESSLEQAKKVMTKFVQRQVFAESKDEVAVVLFGTGGTRNAL  61

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQ-LPRGSVDGDFLDAVIVGMDMMIKKYGITNK  475
                   Y+++TV RS+ + D DLL+ ++  +   S   DFLDA+IV MD++  +      
Sbjct  62    ASGDQ-YQNITVHRSLMLPDFDLLEDIQDGIKPDSEHADFLDAIIVCMDLLQNETLGKKF  120

Query  476   GKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD----------------SV  607
              K+ + L T+   P+        EDQ+  I A +K  G+ +                 S 
Sbjct  121   EKRHIELFTDLSSPVS-------EDQLEIIIANLKKTGISIQFFLPFPVDVGDGGGDTSA  173

Query  608   IVRMKQDLDA--EKGIIDEND-------FLLSVFSKETSSKAAYVESAT----SLMGAIR  748
              V  +  L+A   KG+ ++          L+    +E   +  Y    +    S+   I 
Sbjct  174   SVHSQTHLNAFPSKGLTEQQKEGIVVVRKLMHTLDEEGGLEEVYTFRESLERLSMFKKIE  233

Query  749   TRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSS  925
              R +A P  L  G     + L I++  YK  +EE+    K+++     T +  K ++   
Sbjct  234   RRPMAWPCQLTIG-----SNLSIRIVAYKSMTEEKVK--KIWTVVDAKTHR--KDDVQKE  284

Query  926   YEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIM  1102
               Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGF+ +  I 
Sbjct  285   TVYCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSFQIQ  344

Query  1103  RHYYMKDA--NVFIA-DPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLT  1273
             RHYYM +    VF A D EN  A +A SAL  A+ ++  VAIVR  + + + N  IGV  
Sbjct  345   RHYYMGNQVLKVFAAKDDEN--AAVAFSALVHALDELKVVAIVRYAYDR-RCNPQIGVAF  401

Query  1274  PNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAP  1453
             P + D     + L +  LP+ ED+R++ F S  N     +P   Q  A D+L+  ++L  
Sbjct  402   PYIKD---TYECLIYVQLPYVEDLRQYIFSSLKN-NKKCIPTADQLSAVDSLIDSMNLVC  457

Query  1454  SDS-----QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQ  1618
              D      ++   P   PNP  QR Y  L+ K+ H +  +PP+++ L  + +    +  +
Sbjct  458   EDDDGETFEDLFKPSKIPNPHFQRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPSVVKER  517

Query  1619  NKTVVDEFRRCFEL-------------------KDNPKMKKSRKRLIREKPTGSDEEGER  1741
              +  +++ +  F L                   +D PK+KK         P   DEEG  
Sbjct  518   CQAALEKVKALFPLKEVGKKKEEKTAQDIFKDNEDGPKLKK---------PKIEDEEGSF  568

Query  1742  ASTKVKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQ  1912
             +  K+       +G++NP +DF  ++ ++++        Q++ N+I   +EN      Y 
Sbjct  569   SIMKLAEGNVTSVGSVNPAEDFRILVRQKNAD--FKDVSQQLINRIDQFLENK-GSQYYM  625

Query  1913  KALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPD  2092
             K + C+   R   I   + + FND L+ L +  ++K L  F + +    I+LITK EA  
Sbjct  626   KGINCVRVFREEAIKLSKVQCFNDFLQALKSKVEDKALADFWEIIIQDRISLITKDEAEG  685

Query  2093  SDVLESEARSFM  2128
             S V   EA   +
Sbjct  686   SLVTSEEAEKVL  697



>ref|NP_803154.1| X-ray repair cross-complementing protein 5 [Rattus norvegicus]
 gb|AAH61576.1| X-ray repair complementing defective repair in Chinese hamster 
cells 5 [Rattus norvegicus]
Length=732

 Score =   197 bits (500),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 191/729 (26%), Positives = 334/729 (46%), Gaps = 89/729 (12%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M    P       + +KV ++ V++++     DE+ ++L+GT  T 
Sbjct  6     NKAAVVLCMDVGVAMGNSFPGEESPLEQAKKVMTMFVQRQVFSESKDEIALVLYGTESTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQAL-EQLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L  +   Y+++TV R + + D DLL+ +  ++   S   DFLDA+IV MD++ ++   
Sbjct  66    NALAGKDQ-YQNITVHRHLMLPDFDLLEDIGNKIQPSSQQADFLDALIVCMDLIQRETIG  124

Query  467   TNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKG  646
                GKK + + T+   P         +DQ+  I   +K  G+ +    +    D + E G
Sbjct  125   KKFGKKHIEVFTDLSSPFS-------QDQLDIIICNLKKSGISL-QFFLPFPIDKNGEPG  176

Query  647   IIDEND----------------------------FLLSVFSKETSSKA-AYVESATSL--  733
               +++D                             +LS+  K+   +  ++ ES   L  
Sbjct  177   ETEDHDSSFDHCAPSFPQKGLTEQQKEGIHMVTRVMLSLEGKDGLDEIYSFSESLQQLCI  236

Query  734   MGAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKH  910
                I  R++  P  L  G       L I++  YK   +E+F    +  D         K 
Sbjct  237   FKKIERRSLPWPCQLTIG-----PNLSIRIVAYKSIVQEKFKKSWVVVD----ARTLKKE  287

Query  911   EITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTD  1087
             +I     Y +  D   +V  E  I+G+RYG  ++P S  + E +K+K E K   +LGF  
Sbjct  288   DIQKETVYCLNDDDETEVSKEDTIQGFRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCK  347

Query  1088  ASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTI  1261
             +S + R ++M      VF A  + + A+ A+S+L  A+ ++N VAIVR  + + + N  +
Sbjct  348   SSQVHRRFFMGHQVLKVFAAKDDEAAAV-ALSSLVHALDELNMVAIVRYAYDK-RANPQV  405

Query  1262  GVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKML  1441
             GV  P + D     + L +  LPF ED+R++ F S  N      P E Q  A D+L+  +
Sbjct  406   GVAFPFIKD---AYECLVYVQLPFMEDLRQYMFSSLKN-NKKCTPTEAQLSAIDDLIDSM  461

Query  1442  DLAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPE  1606
              L   + +E ++ +       PNP  QR Y  L  ++ H    +PP+ + +  + DP  E
Sbjct  462   SLVKKNEEEDIIEDLFPTSKIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTE  521

Query  1607  LLSQNKTVVDEFRRCFEL------KDNPKMKKSRKRLIREKPTG-----SDEEGERASTK  1753
             + ++ +  + + +  F L      KD    +   +  I E P         EEG  + + 
Sbjct  522   MKAKCEIPLSKVKTLFPLTEVVKKKDQVTAQDVFQDNIEEGPAAKKYKTEKEEGHISISS  581

Query  1754  VKS---EKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALE  1924
             +      K+G++NPV++F  ++ R+    +   ++Q M +   +L  N  E   + K+++
Sbjct  582   LAEGNVTKVGSVNPVENFRVLV-RQKIASFEEASLQLMSHIEQFLDTN--ETLYFMKSMD  638

Query  1925  CLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVL  2104
              + ALR   I   E ++FN  L  L    + K L  F + +   GI LITK E+P S V 
Sbjct  639   RIKALREEAIQFSEEQRFNSFLEGLREKVEIKQLNHFWEIVVQDGITLITKDESPGSSVT  698

Query  2105  ESEARSFMT  2131
               EA  F+T
Sbjct  699   AEEATKFLT  707



>ref|XP_009273242.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X1 [Aptenodytes forsteri]
Length=712

 Score =   196 bits (499),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 196/708 (28%), Positives = 330/708 (47%), Gaps = 91/708 (13%)
 Frame = +2

Query  185   LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDD  364
             L + +KV +  V++++     DEV V+LFGT  T N+L      Y+++TV RS+ + D D
Sbjct  12    LEQAKKVMTKFVQRQVFAESKDEVAVVLFGTDGTRNDLARGDQ-YQNITVHRSLMLPDFD  70

Query  365   LLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGT  541
             LL+ ++ + +  S   DFLDA+IV MD++ K+       K+ + L T+   P+       
Sbjct  71    LLEDIQDVIKPDSEQADFLDAIIVCMDLLQKETIGKRYEKRHIELFTDLSSPVS------  124

Query  542   KEDQVSTIAAQMKAHGMRMD------------------SVIVRMKQDLDAEKGIIDEND-  664
              EDQ+  I A +K  G+ +                   SV  +M ++    KG+ ++   
Sbjct  125   -EDQLEIIIANLKKTGISLQFFLPFPVDVDDGGGDTNASVHSQMHRNSFPRKGLTEQQKE  183

Query  665   ------FLLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTLYRGDFELSTKLK  811
                    L+    +E   +  Y    +    S+   I  R +A P  L  G     + L 
Sbjct  184   GVDVVMKLMHTLDEEGGLEEIYTFRESLERLSMFKKIERRPMAWPCQLTIG-----SNLS  238

Query  812   IKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGY  991
             I++  YK  +EE+    KM++     T    K ++     Y +  D   +V  +  I+G+
Sbjct  239   IRIVAYKSVTEEKVK--KMWTVVDAKT--LRKDDVQKETVYCLNDDDETEVQKDDTIQGF  294

Query  992   RYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA-DPENSK  1159
             RYG  +VP S  + E +K+K E K   +LGF+ +S I RHYYM +    VF A D EN  
Sbjct  295   RYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHYYMGNQVLKVFAAKDDEN--  352

Query  1160  AILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAE  1339
             A +A SAL  A+ ++  VAIVR V+ + + N  IGV  P + D     + L +  LP+ E
Sbjct  353   AAVAFSALVHALDELKVVAIVRYVYDR-RCNPQIGVAFPYIKD---AYECLIYVQLPYME  408

Query  1340  DVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLPEFTPNPVL  1504
             D+R++ F S  N     +P   Q  A D+L+  ++L   D      ++   P    NP  
Sbjct  409   DLRQYLFSSLKN-NKKCIPTVDQLSAVDSLIDSMNLIYEDDDGETFEDLFKPSKISNPHF  467

Query  1505  QRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL--------  1660
             QR Y  L+ K+ H +  +PP+++ +  + +    +  + +  +++ +  F L        
Sbjct  468   QRLYQCLQHKAFHPNEPLPPVEQHILEMLEVPHVVKERCQAPLEKVKALFPLKEVGKKKE  527

Query  1661  --------KDNPKMKKSRKRLIREKPTGSDEEGERASTKVKS---EKIGNINPVQDFEDM  1807
                     KDN +   + K     KP   DEEG  +  K+       +G++NP +DF  +
Sbjct  528   EKTAQDIFKDNSEDGPNPK-----KPKIDDEEGSFSIIKLAEGNVTSVGSVNPAEDFRIL  582

Query  1808  ISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDL  1987
             + ++++        Q++ N+I   +EN  +   Y K + C+   R   I   + + FND 
Sbjct  583   VRQKNAD--FKDVSQQLINRIDQFLENK-DSQYYMKGISCISVFREEAIKLSKVQCFNDF  639

Query  1988  LRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             L+ L +  ++K L  F + +    I+LITK EA  S V   EA  F+ 
Sbjct  640   LQALKSKVEDKALADFWEIMIQDRISLITKDEAEGSLVTSEEAEKFLA  687



>ref|XP_008116997.1| PREDICTED: X-ray repair cross-complementing protein 5 isoform 
X1 [Anolis carolinensis]
Length=729

 Score =   196 bits (499),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 200/733 (27%), Positives = 344/733 (47%), Gaps = 92/733 (13%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSM-HCVLPE------IEKVCSVLVEKKLIYSKYDEVGVILFgtt  280
             M R +  ++L +DVG SM H  L E       +KV +V V++++     DE+ ++LFGT 
Sbjct  1     MWRAKSAVVLCMDVGFSMSHSGLGEESPFEQAKKVITVFVQRQVFAESKDEISLVLFGTE  60

Query  281   etanelteelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKK  457
              TAN L  E   Y+H+ V R + + D DLL+ ++ + +  S  GD LDA+IV MD++ ++
Sbjct  61    NTANSLASEDQ-YQHIAVHRHLMLPDFDLLEDIQNVIQPTSEQGDILDALIVSMDLLQRE  119

Query  458   YGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDA  637
                   GKK   L       +  P+    EDQ+  I A +K  G+   S+   +   ++ 
Sbjct  120   ----TVGKKYEKLHIEVFTDLGSPF---SEDQLDVIIANLKKTGI---SLQFFLPFPMND  169

Query  638   EKGIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNIA--------PVTLYRGDFE  793
             E G  D+ D   S   + +  +    E     +  +R   ++         +  +R   E
Sbjct  170   EGGSGDKTDCAHSHKPQNSFPRKGLSEQQKEGLKMVRKLMVSLDKEDGLEEIYTFRESLE  229

Query  794   --------------------LSTKLKIKVWVYKKTSEERFPTLKMYSD-KAPPTDKFAKH  910
                                 + +KL IK+  YK  +EE+     +  D K    D   K 
Sbjct  230   QLSMFKKVERRPMPWPCQLTIGSKLSIKIVAYKSFTEEKTKKSWIVVDAKTSKKDDLQKE  289

Query  911   EITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTD  1087
              +     Y +  D   +V  E  I+G+RYG +++P S  + E +K+K + K   +LGF+ 
Sbjct  290   TV-----YCLNDDDETEVQKEDVIQGFRYGSEIIPFSKVDEEQMKYKTDGKCFAVLGFSK  344

Query  1088  ASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVW-RQGQGNVT  1258
             AS ++RH YM      VF A  + + A+ A+S+L  A+ +++ VAIVR V+ R+ Q  V 
Sbjct  345   ASQVLRHRYMGHQVLKVFAAKDDEAAAV-ALSSLIHALDELDMVAIVRYVYDRRSQPQV-  402

Query  1259  IGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKM  1438
              G   P +    N  + L +  LP+ ED+R++ F S  N      P E Q  A D+L+  
Sbjct  403   -GAAFPLIK---NEYECLAYVQLPYMEDLRQYMFSSLKN-NKKCTPTEDQLLAVDSLIDS  457

Query  1439  LDLAPSDSQEALLPEFT-----PNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDP  1603
             + L   D  E  + +       PNP  QR Y  L+ K+ H D+ +PP+++ L  + +   
Sbjct  458   MSLVYEDESEGTVEDTFKTSKFPNPQFQRLYQCLQHKAFHPDSPLPPIEKHLLDMLEAPQ  517

Query  1604  ELLSQNKTVVDEFRRCFELKDNPKMK--KSRKRLIREKPTGS----------DEEGERAS  1747
              +  + +  +++ +  F LKD  KMK  K+ + + ++               D+ G R +
Sbjct  518   VVREKCQAPLEKVKSLFPLKDAGKMKEQKTAQHIFKDNTVDGPSSQKAKVEDDDVGFRIA  577

Query  1748  TKVKSE--KIGNINPVQDFEDMISRR--DSPEWVNKAIQEMKNKIFYLVENSLEGDT-YQ  1912
                +     +G++NPV++F  ++ ++  D  E VN   Q++   I   +EN   G   Y 
Sbjct  578   DLAEGNVTAVGSVNPVENFRVLVRQKTVDFKE-VN---QQLIKHIHQFLEN--RGHLYYS  631

Query  1913  KALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPD  2092
             K+++C+   R   I   E + FND L  L    ++K+L  F + +    I+LITK E+  
Sbjct  632   KSIDCIKIFREEAIKLSEVQCFNDFLETLKKRVEDKNLTDFWEIIVQDKISLITKEESEG  691

Query  2093  SDVLESEARSFMT  2131
             S +   +++ F+ 
Sbjct  692   SLMTAEDSKKFLA  704



>ref|NP_066964.1| X-ray repair cross-complementing protein 5 [Homo sapiens]
 sp|P13010.3|XRCC5_HUMAN RecName: Full=X-ray repair cross-complementing protein 5; AltName: 
Full=86 kDa subunit of Ku antigen; AltName: Full=ATP-dependent 
DNA helicase 2 subunit 2; AltName: Full=ATP-dependent 
DNA helicase II 80 kDa subunit; AltName: Full=CTC box-binding 
factor 85 kDa subunit; Short=CTC85; Short=CTCBF; AltName: 
Full=DNA repair protein XRCC5; AltName: Full=Ku80; AltName: 
Full=Ku86; AltName: Full=Lupus Ku autoantigen protein p86; 
AltName: Full=Nuclear factor IV; AltName: Full=Thyroid-lupus 
autoantigen; Short=TLAA; AltName: Full=X-ray repair complementing 
defective repair in Chinese hamster cells 5 (double-strand-break 
rejoining) [Homo sapiens]
 gb|AAA59475.1| Ku antigen [Homo sapiens]
 gb|AAA36154.1| Ku (p70/p80) subunit [Homo sapiens]
 gb|AAH19027.1| X-ray repair complementing defective repair in Chinese hamster 
cells 5 (double-strand-break rejoining) [Homo sapiens]
 gb|AAH95442.1| X-ray repair complementing defective repair in Chinese hamster 
cells 5 (double-strand-break rejoining) [Homo sapiens]
 gb|ABG46942.1| X-ray repair complementing defective repair in Chinese hamster 
cells 5 (double-strand-break rejoining; Ku autoantigen, 80kDa) 
[Homo sapiens]
 gb|EAW70562.1| X-ray repair complementing defective repair in Chinese hamster 
cells 5 (double-strand-break rejoining; Ku autoantigen, 80kDa), 
isoform CRA_a [Homo sapiens]
 gb|ABM83586.1| X-ray repair complementing defective repair in Chinese hamster 
cells 5 (double-strand-break rejoining; Ku autoantigen, 80kDa) 
[synthetic construct]
 gb|ABM86851.1| X-ray repair complementing defective repair in Chinese hamster 
cells 5 (double-strand-break rejoining; Ku autoantigen, 80kDa) 
[synthetic construct]
 dbj|BAH24115.1| X-ray repair complementing defective repair in Chinese hamster 
cells 5 [synthetic construct]
Length=732

 Score =   196 bits (499),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 198/732 (27%), Positives = 341/732 (47%), Gaps = 96/732 (13%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M   +P IE       KV ++ V++++     DE+ ++LFGT  T 
Sbjct  6     NKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L+     Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD+ I+   I
Sbjct  66    NPLSGGDQ-YQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDV-IQHETI  123

Query  467   TNKGKKR----------------LCLITNAM--CPIKD----PYEGTKEDQVSTIA---A  571
               K +KR                L +I +++  C I      P+   KED          
Sbjct  124   GKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPF  183

Query  572   QMKAHG--MRMDSVIVRMKQDLDAEKGI---IDENDFLLSVFSKETSSKAAYVESATSLM  736
             ++  HG    +  +  + K+ L+  K +   ++  D L  ++S   S +   V       
Sbjct  184   RLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCV------F  237

Query  737   GAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHE  913
               I   +I  P  L  G     + L I++  YK   +ER        D         K +
Sbjct  238   KKIERHSIHWPCRLTIG-----SNLSIRIAAYKSILQERVKKTWTVVD----AKTLKKED  288

Query  914   ITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDA  1090
             I     Y +  D   +V  E  I+G+RYG  +VP S  + E +K+K E K   +LGF  +
Sbjct  289   IQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKS  348

Query  1091  SNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIG  1264
             S + R ++M +    VF A  + + A+ A+S+L  A+ D++ VAIVR  + + + N  +G
Sbjct  349   SQVQRRFFMGNQVLKVFAARDDEAAAV-ALSSLIHALDDLDMVAIVRYAYDK-RANPQVG  406

Query  1265  VLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLD  1444
             V  P++  K N  + L +  LPF ED+R++ F S  N      P E Q  A D L+  + 
Sbjct  407   VAFPHI--KHNY-ECLVYVQLPFMEDLRQYMFSSLKN-SKKYAPTEAQLNAVDALIDSMS  462

Query  1445  LAP----SDSQEALLPEF-TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPEL  1609
             LA     +D+ E L P    PNP  QR +  L  ++ H    +PP+ + +  + +P  E+
Sbjct  463   LAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEV  522

Query  1610  LSQNKTVVDEFRRCFEL---------------KDNPKMKKSRKRLIREKPTGSDEEGERA  1744
              ++++  + + +  F L               +DN +   + K+L  E+          A
Sbjct  523   TTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLA  582

Query  1745  STKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQK  1915
                V S  +G++NP ++F  ++ ++ +      + +E  N++   +E  L+ +    + K
Sbjct  583   EGSVTS--VGSVNPAENFRVLVKQKKA------SFEEASNQLINHIEQFLDTNETPYFMK  634

Query  1916  ALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDS  2095
             +++C+ A R   I   E ++FN+ L+ L    + K L  F + +   GI LITK EA  S
Sbjct  635   SIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGS  694

Query  2096  DVLESEARSFMT  2131
              V   EA+ F+ 
Sbjct  695   SVTAEEAKKFLA  706



>ref|XP_004825919.1| PREDICTED: X-ray repair cross-complementing protein 5 [Mustela 
putorius furo]
Length=747

 Score =   196 bits (499),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 200/735 (27%), Positives = 344/735 (47%), Gaps = 95/735 (13%)
 Frame = +2

Query  122   MAR--NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR  N+  ++L +DVG +M   LP  E       KV ++ V++++     DE+ ++LFG
Sbjct  1     MARPGNKAAVVLCMDVGSAMSNSLPGEESPFELARKVMTMFVQRQVFAESRDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  +   Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD+ I
Sbjct  61    TDGTENALAGKDQ-YQNITVHRHLMLPDFDLLEDIERKIQPGSQQADFLDALIVCMDV-I  118

Query  452   KKYGITNKGKKR-LCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVI------  610
             ++  +  K +KR + + T+   P         +DQ+  I   +K  G+ +   +      
Sbjct  119   QQETVGKKFEKRHIEVFTDLSSPFS-------KDQLDVIIHNLKKFGISLQFFLPFPVGK  171

Query  611   ---VRMKQDLDAE----------KGIIDENDFLLSVFSKETSSKA---------AYVESA  724
                   + D +A           KGI ++    + +  K   S           ++ ES 
Sbjct  172   EDGTGDRGDGNARSDHHGPSFPLKGITEQQKEGVRMVKKVMMSLEGEDGLDEIYSFSESL  231

Query  725   TSL--MGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDK  898
               L     I  R+I     +     + + L IK+  YK   +ER        D       
Sbjct  232   RQLCVFKKIEKRSIP----WHCTLTIGSSLSIKIVAYKSIIQERVKKSWTVVD----ART  283

Query  899   FAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLL  1075
               K ++     Y +  D   +V  E  I+G+RYG  +VP S  + E +K+K E K   +L
Sbjct  284   LKKEDLQKETVYCLNDDNETEVLKEDTIQGFRYGSDIVPFSKVDEELMKYKSEGKCFSVL  343

Query  1076  GFTDASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQG  1249
             GF  +S + R Y+M +    VF A  ++  A +A+S+L  A+ +++ VA+VR V+ + + 
Sbjct  344   GFCRSSQVHRRYFMGNQVLKVFAAA-DDEAAAVALSSLIHALDELDMVAVVRYVYDK-RA  401

Query  1250  NVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNL  1429
             N  +G+  P + D     + L +  LPF ED+R++ F S  N     +P E Q  A D L
Sbjct  402   NPQVGMAFPYIKD---TYECLIYVQLPFMEDLRQYMFSSLKN-NKKYIPTEAQLSAVDAL  457

Query  1430  VKMLDLAP----SDSQEALLPEF-TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITD  1594
             +  + L       D+ E L P    PNP  QR +  L  ++ H    +PP+ + +  + D
Sbjct  458   IDSMSLVKKGDKEDTIEDLFPTSKIPNPQFQRLFQCLLHRALHPRERLPPIQQHILNMLD  517

Query  1595  PDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSEK--  1768
             P  E+ +Q +  + + +  F L +   +KK  +   ++    + EEG   S K+K+E+  
Sbjct  518   PPTEVTAQCQIPLSKIKTIFPLTE--AIKKKDQVTAQDIFQDNHEEGP-TSKKLKTEEGA  574

Query  1769  ---------------IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGD  1903
                            +G++NP ++F  ++ ++ +     +A  ++ N+I   +E + E  
Sbjct  575   ADFSVSSLAEGSVTSVGSVNPAENFRVLVRQKKAS--FEEASHQLINRIEQFLETN-ETP  631

Query  1904  TYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTE  2083
              + K+++C+   R   I   E ++FND LR L    + K L  F + +   GI LITK E
Sbjct  632   YFMKSMDCITVFREEAIQFSEEQRFNDFLRALREKVEMKQLNHFWEIVVQDGITLITKDE  691

Query  2084  APDSDVLESEARSFM  2128
             AP S V   EA+ F+
Sbjct  692   APGSSVTAEEAKKFL  706



>ref|XP_004762766.1| PREDICTED: X-ray repair cross-complementing protein 5 [Mustela 
putorius furo]
Length=733

 Score =   196 bits (498),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 200/735 (27%), Positives = 344/735 (47%), Gaps = 95/735 (13%)
 Frame = +2

Query  122   MAR--NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR  N+  ++L +DVG +M   LP  E       KV ++ V++++     DE+ ++LFG
Sbjct  1     MARPGNKAAVVLCMDVGSAMSNSLPGEESPFELARKVMTMFVQRQVFAESRDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  +   Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD+ I
Sbjct  61    TDGTENALAGKDQ-YQNITVHRHLMLPDFDLLEDIERKIQPGSQQADFLDALIVCMDV-I  118

Query  452   KKYGITNKGKKR-LCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVI------  610
             ++  +  K +KR + + T+   P         +DQ+  I   +K  G+ +   +      
Sbjct  119   QQETVGKKFEKRHIEVFTDLSSPFS-------KDQLDVIIHNLKKFGISLQFFLPFPVGK  171

Query  611   ---VRMKQDLDAE----------KGIIDENDFLLSVFSKETSSKA---------AYVESA  724
                   + D +A           KGI ++    + +  K   S           ++ ES 
Sbjct  172   EDGTGDRGDGNARSDHHGPSFPLKGITEQQKEGVRMVKKVMMSLEGEDGLDEIYSFSESL  231

Query  725   TSL--MGAIRTRNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDK  898
               L     I  R+I     +     + + L IK+  YK   +ER        D       
Sbjct  232   RQLCVFKKIEKRSIP----WHCTLTIGSSLSIKIVAYKSIIQERVKKSWTVVD----ART  283

Query  899   FAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLL  1075
               K ++     Y +  D   +V  E  I+G+RYG  +VP S  + E +K+K E K   +L
Sbjct  284   LKKEDLQKETVYCLNDDNETEVLKEDTIQGFRYGSDIVPFSKVDEELMKYKSEGKCFSVL  343

Query  1076  GFTDASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQG  1249
             GF  +S + R Y+M +    VF A  ++  A +A+S+L  A+ +++ VA+VR V+ + + 
Sbjct  344   GFCRSSQVHRRYFMGNQVLKVFAAA-DDEAAAVALSSLIHALDELDMVAVVRYVYDK-RA  401

Query  1250  NVTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNL  1429
             N  +G+  P + D     + L +  LPF ED+R++ F S  N     +P E Q  A D L
Sbjct  402   NPQVGMAFPYIKD---TYECLIYVQLPFMEDLRQYMFSSLKN-NKKYIPTEAQLSAVDAL  457

Query  1430  VKMLDLAP----SDSQEALLPEF-TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITD  1594
             +  + L       D+ E L P    PNP  QR +  L  ++ H    +PP+ + +  + D
Sbjct  458   IDSMSLVKKGDKEDTIEDLFPTSKIPNPQFQRLFQCLLHRALHPRERLPPIQQHILNMLD  517

Query  1595  PDPELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSDEEGERASTKVKSEK--  1768
             P  E+ +Q +  + + +  F L +   +KK  +   ++    + EEG   S K+K+E+  
Sbjct  518   PPTEVTAQCQIPLSKIKTIFPLTE--AIKKKDQVTAQDIFQDNHEEGP-TSKKLKTEEGA  574

Query  1769  ---------------IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGD  1903
                            +G++NP ++F  ++ ++ +     +A  ++ N+I   +E + E  
Sbjct  575   ADFSVSSLAEGSVTSVGSVNPAENFRVLVRQKKAS--FEEASHQLINRIEQFLETN-ETP  631

Query  1904  TYQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTE  2083
              + K+++C+   R   I   E ++FND LR L    + K L  F + +   GI LITK E
Sbjct  632   YFMKSMDCITVFREEAIQFSEEQRFNDFLRALREKVEMKQLNHFWEIVVQDGITLITKDE  691

Query  2084  APDSDVLESEARSFM  2128
             AP S V   EA+ F+
Sbjct  692   APGSSVTAEEAKKFL  706



>ref|XP_002191185.2| PREDICTED: X-ray repair cross-complementing protein 5 [Taeniopygia 
guttata]
Length=879

 Score =   197 bits (502),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 191/728 (26%), Positives = 332/728 (46%), Gaps = 98/728 (13%)
 Frame = +2

Query  140   GLILVIDVGPSMHCV-------LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanel  298
              ++L +DVG +M          L + +K+ +  +++++     DEV V+LFGT  T N+L
Sbjct  161   AIVLCLDVGFTMSSSSPGEESSLDQAKKIMTKFLQRQVFAESKDEVAVVLFGTNGTRNDL  220

Query  299   teelggYEHVTVLRSIKVVDDDLLQALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNK  475
               E   Y+++TV RS+ + D DLL+ ++ + + GS   DFLDA+IV MD++ ++      
Sbjct  221   ASEDQ-YQNITVHRSLMLPDFDLLEDIQNVIKAGSEQADFLDAIIVCMDLLQRQTIGKKY  279

Query  476   GKKRLCLITNAMCPIKD---------------------PY----EGTKEDQVSTIAAQMK  580
              K+ + L T+   P+ +                     P+    EGT  D  +++ A M 
Sbjct  280   EKRHIELFTDLSSPVSEDQLGIIIANLKKTEISLQFFLPFPVSVEGTG-DTSASVHAHMH  338

Query  581   AHGMRMDSVIVRMKQDLDAEKGI---IDENDFLLSVFSKETSSKAAYVESATSLMGAIRT  751
              +   +  +  + KQ +D  + +   +DE   L  +++   S     +E  +      R 
Sbjct  339   KNSFPIKGLTEQQKQGIDVVRKLMYTLDEEGGLEEIYTFRES-----LERLSMFKKIERK  393

Query  752   RNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYE  931
                 P  L  G       L I++  YK  +EE    +    D         K ++     
Sbjct  394   PMPWPCQLTIG-----PDLSIRIVAYKSVTEENVKKVWAVVD----AKTLRKEDVQKETV  444

Query  932   YKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRH  1108
             Y +  D   +V  +  I+G+RYG  +VP S  + E +K+K E K   +LGFT +S I RH
Sbjct  445   YCLNDDDETEVQKDDTIQGFRYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFTRSSQIQRH  504

Query  1109  YYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNV  1282
             YYM +    VF A  + + A+ A SAL RA+ ++  VA+VR  + + + N  IGV  P +
Sbjct  505   YYMGNQALKVFAAKGDENAAV-AFSALVRALDELKMVAVVRYAYDR-RCNPQIGVAFPYI  562

Query  1283  SDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS  1462
              D     + L +  LP+ ED+R++ F S  N      P   Q  A D+L+  ++L   D 
Sbjct  563   KD---AYECLIYVQLPYMEDLRQYVFSSLKN-SKKYFPTVDQLSAVDSLIDSMNLVHEDG  618

Query  1463  Q---EALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVV  1633
             +   +   P   PNP  QR Y  L+ K+ + D  +PP+++ +  + +    +  + +  +
Sbjct  619   ETFEDLFKPSKIPNPRFQRLYQCLQHKAFYPDKPLPPIEQHILEMLEMPCVVRERCQAPL  678

Query  1634  DEFRRCFEL-------------------KDNPKMKKSRKRLIREKPTGSDEEGERASTKV  1756
             +  +  F L                   +D P +KK         P   DEE   +  K+
Sbjct  679   ERVKALFPLKEVGKKKEEKTAQDIFKDNEDEPSLKK---------PKIEDEEESFSIMKL  729

Query  1757  KSEKI---GNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALEC  1927
                 I   G++NP +DF  ++ ++++        Q++ N+I   +EN      Y K ++C
Sbjct  730   AEGNITSVGSVNPAEDFRILVRKKNAD--FKDVSQQLINRIDQFLENK-GSQYYMKGMDC  786

Query  1928  LVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLE  2107
             +   R   +   + + FND L+ L +  ++K L  F + +    I+LITK EA  S V  
Sbjct  787   IRVFREEAMKLSKVQCFNDFLQALKSKLEDKALSDFWEIMVQERISLITKDEAEGSLVTG  846

Query  2108  SEARSFMT  2131
              EA+ F+ 
Sbjct  847   EEAKEFLA  854



>ref|XP_004033222.1| PREDICTED: X-ray repair cross-complementing protein 5 [Gorilla 
gorilla gorilla]
Length=732

 Score =   196 bits (498),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 198/732 (27%), Positives = 341/732 (47%), Gaps = 96/732 (13%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M   +P IE       KV ++ V++++     DE+ ++LFGT  T 
Sbjct  6     NKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L+     Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD+ I+   I
Sbjct  66    NPLSGGDQ-YQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDV-IQHETI  123

Query  467   TNKGKKR----------------LCLITNAM--CPIKD----PYEGTKEDQVSTIA---A  571
               K +KR                L +I +++  C I      P+   KED          
Sbjct  124   GKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPF  183

Query  572   QMKAHG--MRMDSVIVRMKQDLDAEKGI---IDENDFLLSVFSKETSSKAAYVESATSLM  736
             ++  HG    +  +  + K+ L+  K +   ++  D L  ++S   S +   V       
Sbjct  184   RLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCV------F  237

Query  737   GAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHE  913
               I   +I  P  L  G     + L I++  YK   +ER        D         K +
Sbjct  238   KKIERHSIHWPCRLTIG-----SNLSIRIAAYKSILQERVKKTWTVVD----AKTLKKED  288

Query  914   ITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDA  1090
             I     Y +  D   +V  E  I+G+RYG  +VP S  + E +K+K E K   +LGF  +
Sbjct  289   IQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKS  348

Query  1091  SNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIG  1264
             S + R ++M +    VF A  + + A+ A+S+L  A+ D++ VAIVR  + + + N  +G
Sbjct  349   SQVQRRFFMGNQVLKVFAARDDEAAAV-ALSSLIHALDDLDMVAIVRYAYDK-RANPQVG  406

Query  1265  VLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLD  1444
             V  P++  K N  + L +  LPF ED+R++ F S  N      P E Q  A D L+  + 
Sbjct  407   VAFPHI--KHNY-ECLVYVQLPFMEDLRQYMFSSLKN-SKKYAPTEAQLNAVDALIDSMS  462

Query  1445  LAP----SDSQEALLPEF-TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPEL  1609
             LA     +D+ E L P    PNP  QR +  L  ++ H    +PP+ + +  + +P  E+
Sbjct  463   LAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEV  522

Query  1610  LSQNKTVVDEFRRCFEL---------------KDNPKMKKSRKRLIREKPTGSDEEGERA  1744
              ++++  + + +  F L               +DN +   + K+L  E+          A
Sbjct  523   TTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLA  582

Query  1745  STKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQK  1915
                V S  +G++NP ++F  ++ ++ +      + +E  N++   +E  L+ +    + K
Sbjct  583   EGSVTS--VGSVNPAENFRVLVKQKKA------SFEEASNQLINHIEQFLDTNETPYFMK  634

Query  1916  ALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDS  2095
             +++C+ A R   I   E ++FN+ L+ L    + K L  F + +   GI LITK EA  S
Sbjct  635   SIDCIRAFREEAIKFSEEQRFNNFLKALREKVEIKQLNHFWEIVVQDGITLITKEEASGS  694

Query  2096  DVLESEARSFMT  2131
              V   EA+ F+ 
Sbjct  695   SVTAEEAKKFLA  706



>ref|XP_009885633.1| PREDICTED: X-ray repair cross-complementing protein 5 [Charadrius 
vociferus]
Length=711

 Score =   196 bits (497),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 194/711 (27%), Positives = 322/711 (45%), Gaps = 98/711 (14%)
 Frame = +2

Query  185   LPEIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDD  364
             L + +KV +  V++++     DEV V+LFGT  T N L      Y+++TV RS+ + D D
Sbjct  12    LEQAKKVMTKFVQRQVFAESKDEVAVVLFGTGGTRNALASGDQ-YQNITVHRSLMLPDFD  70

Query  365   LLQALEQ-LPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGT  541
             LL+ ++  +   S   DFLDA+IV MD++  +       K+ + L T+   P+       
Sbjct  71    LLEDIQDGIKPDSEHADFLDAIIVCMDLLQNETLGKKFEKRHIELFTDLSSPVS------  124

Query  542   KEDQVSTIAAQMKAHGMRMD----------------SVIVRMKQDLDA--EKGIIDEND-  664
              EDQ+  I A +K  G+ +                 S  V  +  L+A   KG+ ++   
Sbjct  125   -EDQLEIIIANLKKTGISIQFFLPFPVDVGDGGGDTSASVHSQTHLNAFPSKGLTEQQKE  183

Query  665   ------FLLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTLYRGDFELSTKLK  811
                    L+    +E   +  Y    +    S+   I  R +A P  L  G     + L 
Sbjct  184   GIVVVRKLMHTLDEEGGLEEVYTFRESLERLSMFKKIERRPMAWPCQLTIG-----SNLS  238

Query  812   IKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGY  991
             I++  YK  +EE+   +    D         K ++     Y +  D   +V  +  I+G+
Sbjct  239   IRIVAYKSMTEEKVKKIWTVVD----AKTHRKDDVQKETVYCLNDDDETEVQKDDTIQGF  294

Query  992   RYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA-DPENSK  1159
             RYG  +VP S  + E +K+K E K   +LGF+ +  I RHYYM +    VF A D EN  
Sbjct  295   RYGSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSFQIQRHYYMGNQVLKVFAAKDDEN--  352

Query  1160  AILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAE  1339
             A +A SAL  A+ ++  VAIVR  + + + N  IGV  P + D     + L +  LP+ E
Sbjct  353   AAVAFSALVHALDELKVVAIVRYAYDR-RCNPQIGVAFPYIKD---TYECLIYVQLPYVE  408

Query  1340  DVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLPEFTPNPVL  1504
             D+R++ F S  N     +P   Q  A D+L+  ++L   D      ++   P   PNP  
Sbjct  409   DLRQYIFSSLKN-NKKCIPTADQLSAVDSLIDSMNLVCEDDDGETFEDLFKPSKIPNPHF  467

Query  1505  QRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL--------  1660
             QR Y  L+ K+ H +  +PP+++ L  + +    +  + +  +++ +  F L        
Sbjct  468   QRLYQCLQHKAFHPNEPLPPIEQHLLEMLEMPSVVKERCQAALEKVKALFPLKEVGKKKE  527

Query  1661  -----------KDNPKMKKSRKRLIREKPTGSDEEGERASTKVKS---EKIGNINPVQDF  1798
                        +D PK+KK         P   DEEG  +  K+       +G++NP +DF
Sbjct  528   EKTAQDIFKDNEDGPKLKK---------PKIEDEEGSFSIMKLAEGNVTSVGSVNPAEDF  578

Query  1799  EDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQF  1978
               ++ ++++        Q++ N+I   +EN      Y K + C+   R   I   + + F
Sbjct  579   RILVRQKNAD--FKDVSQQLINRIDQFLENK-GSQYYMKGINCVRVFREEAIKLSKVQCF  635

Query  1979  NDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFMT  2131
             ND L+ L +  ++K L  F + +    I+LITK EA  S V   EA  F+ 
Sbjct  636   NDFLQALKSKVEDKALADFWEIIIQDRISLITKDEAEGSLVTSEEAEKFLA  686



>dbj|BAF83429.1| unnamed protein product [Homo sapiens]
Length=732

 Score =   196 bits (498),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 198/732 (27%), Positives = 340/732 (46%), Gaps = 96/732 (13%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M   +P IE       KV ++ V++++     DE+ ++LFGT  T 
Sbjct  6     NKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L+     Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD  I+   I
Sbjct  66    NPLSGGDQ-YQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDA-IQHETI  123

Query  467   TNKGKKR----------------LCLITNAM--CPIKD----PYEGTKEDQVSTIA---A  571
               K +KR                L +I +++  C I      P+   KED          
Sbjct  124   GKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPF  183

Query  572   QMKAHG--MRMDSVIVRMKQDLDAEKGI---IDENDFLLSVFSKETSSKAAYVESATSLM  736
             ++  HG    +  +  + K+ L+  K +   ++  D L  ++S   S +   V       
Sbjct  184   RLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCV------F  237

Query  737   GAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHE  913
               I   +I  P  L  G     + L I++  YK   +ER        D         K +
Sbjct  238   KKIERHSIHWPCRLTIG-----SNLSIRIAAYKSILQERVKKTWTVVD----AKTLKKED  288

Query  914   ITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDA  1090
             I     Y +  D   +V  E  I+G+RYG  +VP S  + E +K+K E K   +LGF  +
Sbjct  289   IQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKS  348

Query  1091  SNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIG  1264
             S + R ++M +    VF A  + + A+ A+S+L  A+ D++ VAIVR  + + + N  +G
Sbjct  349   SQVQRRFFMGNQVLKVFAARDDEAAAV-ALSSLIHALDDLDMVAIVRYAYDK-RANPQVG  406

Query  1265  VLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLD  1444
             V  P++  K N  + L +  LPF ED+R++ F S  N      P E Q  A D L+  + 
Sbjct  407   VAFPHI--KHNY-ECLVYVQLPFMEDLRQYMFSSLKN-SKKYAPTEAQLNAVDALIDSMS  462

Query  1445  LAP----SDSQEALLPEF-TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPEL  1609
             LA     +D+ E L P    PNP  QR +  L  ++ H    +PP+ + +  + +P  E+
Sbjct  463   LAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEV  522

Query  1610  LSQNKTVVDEFRRCFEL---------------KDNPKMKKSRKRLIREKPTGSDEEGERA  1744
              ++++  + + +  F L               +DN +   + K+L  E+          A
Sbjct  523   TTKSQIPLSKIKTLFPLTEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLA  582

Query  1745  STKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQK  1915
                V S  +G++NP ++F  ++ ++ +      + +E  N++   +E  L+ +    + K
Sbjct  583   EGSVTS--VGSVNPAENFRVLVKQKKA------SFEEASNQLINHIEQFLDTNETPYFMK  634

Query  1916  ALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDS  2095
             +++C+ A R   I   E ++FN+ L+ L    + K L  F + +   GI LITK EA  S
Sbjct  635   SIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGS  694

Query  2096  DVLESEARSFMT  2131
              V   EA+ F+ 
Sbjct  695   SVTAEEAKKFLA  706



>ref|XP_003254095.1| PREDICTED: X-ray repair cross-complementing protein 5 [Nomascus 
leucogenys]
Length=732

 Score =   196 bits (498),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 198/732 (27%), Positives = 341/732 (47%), Gaps = 96/732 (13%)
 Frame = +2

Query  131   NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFgtteta  289
             N+  ++L +DVG +M   +P IE       KV ++ V++++     DE+ ++LFGT  T 
Sbjct  6     NKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTD  65

Query  290   nelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMIKKYGI  466
             N L+     Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD+ I+   I
Sbjct  66    NPLSGGDQ-YQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDV-IQHETI  123

Query  467   TNKGKKR----------------LCLITNAM--CPIKD----PYEGTKEDQVSTIA---A  571
               K +KR                L +I +++  C I      P+   KED          
Sbjct  124   GKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGTF  183

Query  572   QMKAHG--MRMDSVIVRMKQDLDAEKGI---IDENDFLLSVFSKETSSKAAYVESATSLM  736
             ++  HG    +  +  + K+ L+  K +   ++  D L  ++S   S +   V       
Sbjct  184   RLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCV------F  237

Query  737   GAIRTRNIA-PVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHE  913
               I   +I  P  L  G     + L I++  YK   +ER        D         K +
Sbjct  238   KKIERHSIHWPCRLTIG-----SNLSIRIAAYKSILQERVKKTWTVVD----AKTLKKED  288

Query  914   ITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDA  1090
             I     Y +  D   +V  E  I+G+RYG  +VP S  + E +K+K E K   +LGF  +
Sbjct  289   IQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKS  348

Query  1091  SNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIG  1264
             S + R ++M +    VF A  + + A+ A+S+L  A+ D++ VAIVR  + + + N  +G
Sbjct  349   SQVQRRFFMGNQVLKVFAARDDEAAAV-ALSSLIHALDDLDMVAIVRYAYDK-RANPQVG  406

Query  1265  VLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLD  1444
             V  P++  K N  + L +  LPF ED+R++ F S  N      P E Q  A D L+  + 
Sbjct  407   VAFPHI--KHNY-ECLVYVQLPFMEDLRQYMFSSLKN-SKKYAPTEAQLNAVDALIDSMS  462

Query  1445  LAP----SDSQEALLPEF-TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPEL  1609
             LA     +D+ E L P    PNP  QR +  L  ++ H    +PP+ + +  + +P  E+
Sbjct  463   LAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEV  522

Query  1610  LSQNKTVVDEFRRCFEL---------------KDNPKMKKSRKRLIREKPTGSDEEGERA  1744
              ++++  + + +  F L               +DN +   + K+L  E+          A
Sbjct  523   TTKSQIPLSKIKTLFPLIEAKKKDQVTAQDIFQDNHEDGPTAKKLKTEQGGAHFSVSSLA  582

Query  1745  STKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT---YQK  1915
                V S  +G++NP ++F  ++ ++ +      + +E  N++   +E  L+ +    + K
Sbjct  583   EGSVTS--VGSVNPAENFRVLVKQKKA------SFEEASNQLINHIEQFLDTNETPYFMK  634

Query  1916  ALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDS  2095
             +++C+ A R   I   E ++FN+ L+ L    + K L  F + +   GI LITK EA  S
Sbjct  635   SMDCIRAFREEAIKFSEEQRFNNFLKALREKVEIKQLNHFWEIVVQDGITLITKEEASGS  694

Query  2096  DVLESEARSFMT  2131
              V   EA+ F+ 
Sbjct  695   SVTAEEAKKFLA  706



>ref|XP_009833210.1| hypothetical protein H257_08842 [Aphanomyces astaci]
 gb|ETV77423.1| hypothetical protein H257_08842 [Aphanomyces astaci]
Length=734

 Score =   196 bits (498),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 189/720 (26%), Positives = 316/720 (44%), Gaps = 69/720 (10%)
 Frame = +2

Query  122   MARNREGLILVIDVGPSMHCVLPEIEKVCSV-------------LVEKKLIYSKYDEVGV  262
             M+R +E +++V+D   +M   L E+ +   V             +V +KL++ K DEVG+
Sbjct  1     MSRTKEAIMIVLDASVAMRSPLAEVTRKVEVGSRFEAAKSAIQGIVNQKLLFRKNDEVGI  60

Query  263   ILFgttetanelteel-ggYEHVTVLRSIKVVDDDLLQALEQLPRGSVD--GDFLDAVIV  433
             +++GT  T N+L  +    Y+HVTV+ S+  V  DL + +  +   SV+   D LD +IV
Sbjct  61    VMYGTEGTDNQLNADDDNSYKHVTVVSSVAPVTIDLAKQVLAMEAASVETPADVLDGIIV  120

Query  434   GMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAH--------G  589
              +D+MI++     K  KRL +IT+A   I +P   +  + V T+   +  H        G
Sbjct  121   ALDLMIRRTD-NKKYDKRLVVITDAATRINNP---SDMEVVCTMIQNLDVHLQIIGIDFG  176

Query  590   MRMDSVIVRM---KQDLDAEKGIIDENDFLLSVFSKETSSKAAYVESATSLMGAIRTRNI  760
             +  D+ + RM   K +  A   I +EN+ +L   + E   +   V      +   + + +
Sbjct  177   LSQDTKLERMDNVKGENVAAPSIKEENEKMLQSIATEVHGEVQSVSKRIDFLAQSKLKPV  236

Query  761   APVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKV  940
                T  RG+ E    + I V+V+ K  E   P+L+  S  A  +  +A+ +       + 
Sbjct  237   LQTTKMRGNLEFGDAMSIPVYVFAKVLEATIPSLQKESQVAKQSTTYAEDDAPGKVRMER  296

Query  941   VQ----DPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPEKGVKLLGFTDASNIMRH  1108
                    P ++VPPE+RIK Y+YG +++P S+A+  A+K    +G+K+LGF D S     
Sbjct  297   TSFAPDHPDEEVPPERRIKAYKYGSEMIPFSTADQAALKLLTTRGLKVLGFVDKSQWKHG  356

Query  1109  YYMKDANVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSD  1288
               M   +    D    KA  A+ AL+ AM    + A+ R V R       +  L PNV +
Sbjct  357   LGMTGTDAVFGDFTKPKAQEAIHALSTAMHAEGKFALARFV-RVANAAPKVVALFPNVQE  415

Query  1289  KGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDSQE  1468
                    L+   LPF ED+R ++F S ++ P ++ P   Q  AAD LV+ML   P+ +  
Sbjct  416   PR--LHCLWMQQLPFEEDLRPYEFSSLASNP-TIQPTATQLAAADTLVEMLS-RPASTSH  471

Query  1469  ALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRR  1648
             A       NP LQR Y  +  ++    A + PL   + R    D  L       +  F +
Sbjct  472   AF------NPALQRLYDTIAHRAMDPTAPLAPLPPHVERHLREDRTLFEPALAAIHAFDK  525

Query  1649  CFELKDNPKMKKSRKRLIREKPTGSDEE--------------------GERASTKVKSEK  1768
              F+LK+  K K  +K+      +  D +                                
Sbjct  526   AFQLKEAAKAKDHKKKSFWSDVSIGDTKPADVPVADGGGGDDNDDGELDLDDLLGEDVTA  585

Query  1769  IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNG  1948
             +G++NP+ DFE +++     +    A+  M+ +I  L      G  + K L+CL   R  
Sbjct  586   VGSMNPISDFEALLATNQLAK-AQLAVMGMEEQILGLFRQDARG-YHAKGLDCLRYFRRR  643

Query  1949  CIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSFM  2128
                      FN  L  + A     +     + L  H + L++  + P  D    EA SF+
Sbjct  644   SPEIHRTTLFNAFLHRVKAEFGPSN-GPVWQLLVEHHVTLLSTRDDPSCDTSIREAESFL  702



>gb|EMP26688.1| X-ray repair cross-complementing protein 5 [Chelonia mydas]
Length=843

 Score =   197 bits (500),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 190/722 (26%), Positives = 320/722 (44%), Gaps = 105/722 (15%)
 Frame = +2

Query  155   IDVGPSMHCVLP-------EIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelg  313
             +DVG +M    P       + +K+ ++ V++++     DEV V+LFGT  T N L     
Sbjct  1     MDVGFAMSNSAPGEESPFEQAKKMMTMFVQRQVFAESKDEVSVVLFGTDGTENTLASGDQ  60

Query  314   gYEHVTVLRSIKVVDDDLLQALEQ-LPRGSVDGDFLDAVIVGMDMMIKKYGITNKGKKRL  490
              Y+++TV R + + D DLL+ ++  +  GS   DFLDA++V MD++ K+       K+ +
Sbjct  61    -YQNITVQRHLMLPDFDLLEDIQNAIQPGSEQADFLDALVVCMDLLQKETIGKKYEKRHI  119

Query  491   CLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDLDAEKGIIDENDFL  670
              + T+   P         EDQ+  I A +K  G+   S+   +   +D E G  D  D  
Sbjct  120   EVFTDLSSPF-------SEDQLEIIIANLKKTGI---SLQFFLPFPVDDEDGSGDTGDDR  169

Query  671   LSVFSKETSSKAAYVESATSLMGAIRTRNIA--------PVTLYRGDFE-----------  793
              S   + +  +    E     +  +R    A         +  +R   E           
Sbjct  170   HSDMCRNSFPRKGLTEQQKEGICMVRKLMFALEEEGGLDEIYTFRESLERLSMFKKIERR  229

Query  794   ---------LSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQ  946
                      + + L I++  YK  +EE+        D         K ++     Y +  
Sbjct  230   PMAWPCQLTIGSNLSIRIVAYKSLTEEKVKKSWTLVD----AKTLKKEDVQKETVYCLDD  285

Query  947   DPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKD  1123
             D   +V  +  ++G+ YG  +VP S  + E +K+K E K   +LGF+ +S I RH+YM +
Sbjct  286   DDETEVQKDDLVQGFCYGSDIVPFSKVDEEQMKYKTEAKCFSVLGFSRSSQIQRHHYMGN  345

Query  1124  A--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGN  1297
                 VF A  + + A+ A+SAL  A+ +++ VAIVR  +                 D+ +
Sbjct  346   QVLKVFAAKDDEAAAV-ALSALIHALDELDVVAIVRYAY-----------------DRRS  387

Query  1298  VPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSD-----S  1462
              P  L +  LP+ ED+R++ F S  N      P E Q  A D+L+  + LA  D     +
Sbjct  388   NPQCLIYVQLPYMEDLRQYMFSSLKN-NKKYTPTEDQLSAVDSLIDSMSLAYEDEDGETT  446

Query  1463  QEALLPEFTPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEF  1642
             ++   P   PNP  QR Y  L+ K+ H D  +PP+++ L  + +   E+  + +  +++ 
Sbjct  447   EDLFKPSKIPNPQFQRLYQCLQHKAFHPDKPLPPIEQHLLEMLEVPQEVREKCQAPLEKI  506

Query  1643  RRCFELKDNPKMKK----------------SRKRLIREKPTGSDEEGERASTKVKSEKIG  1774
             +  F LKD  K K+                S KR   E   GS      A   V +  +G
Sbjct  507   KALFPLKDAGKKKEQKTAQDVFKDNNEDGPSAKRAKAENEEGSFSIANLAEGSVTT--VG  564

Query  1775  NINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEG---DTYQKALECLVALRN  1945
             +INP ++F  ++ ++      N   +E+  ++   +E  LE      Y K++ C+   R 
Sbjct  565   SINPAENFCVLVRQK------NANFKEVSQQLINRIEQFLETKGLQYYMKSINCIRVFRE  618

Query  1946  GCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEARSF  2125
               I   E + FND L+ L    ++K L  F + L   GI+LI+K EA  S V   EA+ F
Sbjct  619   EAIKLAEVQCFNDFLQALKKKVEDKTLADFWEILIQDGISLISKDEAEGSSVTHEEAKKF  678

Query  2126  MT  2131
             + 
Sbjct  679   LA  680



>ref|XP_005969263.1| PREDICTED: X-ray repair cross-complementing protein 5 [Pantholops 
hodgsonii]
Length=733

 Score =   196 bits (497),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 192/736 (26%), Positives = 334/736 (45%), Gaps = 97/736 (13%)
 Frame = +2

Query  122   MAR--NREGLILVIDVGPSMHCVLPEIE-------KVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR  N+  ++L +DVG +M    P  E       KV ++ V++++     DEV ++LFG
Sbjct  1     MARSWNKAAVVLCMDVGLAMSNSFPGEESPFELAKKVITMFVQRQVFAENKDEVALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  E   Y+++TV R +   D DLL+ +E ++  GS   DFLDA+IV MD+ I
Sbjct  61    TDGTENALAGEDQ-YQNITVHRHLMRPDFDLLEDIESKIQPGSQQADFLDALIVCMDL-I  118

Query  452   KKYGITNKGKKR-LCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMD---------  601
             +K  +  K +KR + + T+   P          DQ+  I   +K  GM +          
Sbjct  119   QKETLGKKFEKRHIEVFTDLSSPFS-------RDQLDIIIDNLKKSGMSLQFFLPFPIVK  171

Query  602   ----------SVIVRMKQDLDAEKGIIDENDFLLSVFSKETSSKA---------AYVESA  724
                       S+++         KG+ ++    + +  K   S           ++ ES 
Sbjct  172   KGGTGDRGDGSLLLDHHGPSFPPKGVTEQQKEGIQMVKKVMMSLEGEDGLEEIYSFSESL  231

Query  725   TSLMGAIRT-RNIAPVTLYRGDFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKF  901
               L    +T R+  P   +     + + L IK+  YK  ++E+        D        
Sbjct  232   RQLCVFKKTERHSMP---WSCQLTIGSNLSIKIVAYKSITQEKVKKSWTVVD----ARTL  284

Query  902   AKHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLG  1078
              K +I     Y +  D   +V  E  I+G+RYG  ++P S  + E +K++ E K   +LG
Sbjct  285   KKEDIQKETVYCLNDDDETEVSKEDTIQGFRYGSDIIPFSKVDEEQMKYRSEGKCFSVLG  344

Query  1079  FTDASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGN  1252
             F  +S +   Y+M +    VF A  + + A+ A+S+L  A+ +++ VA+VR  + Q + N
Sbjct  345   FCRSSQVHMKYFMGNQVLKVFAAKDDEAAAV-ALSSLIHALDELDMVAVVRYAYDQ-RAN  402

Query  1253  VTIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLV  1432
               +GV  P + D     + L +  LPF ED+R++ F S  N      P E Q  A D L+
Sbjct  403   PQVGVAFPLIKD---TYECLVYIQLPFMEDLRQYMFSSLKN-NRKCTPTEAQLSAVDALI  458

Query  1433  KMLDLAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDP  1597
               + L   D +E  + +       PNP  QR +  L  ++ H    +PP+ + +  + DP
Sbjct  459   DSMSLVQKDEEEGTIEDLFPTSKIPNPQFQRLFQCLLHRALHPHEPLPPIQQQILSMLDP  518

Query  1598  DPELLSQNKTVVDEFRRCFEL----------------KDNPKMKKSRKRLIREKPTGSDE  1729
               E+ ++ +  V + +  F L                +DN +   + KRL  E+      
Sbjct  519   PTEVTAKCQVPVSKIKTLFPLTEVIKKKNQVTGQDLFQDNHEEGPTCKRLKTEEEEAHFS  578

Query  1730  EGERASTKVKSEKIGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT-  1906
                 A   V    +G++NP ++F  ++ ++ +      + +E  +++   +E  L+ +  
Sbjct  579   VSSLAEGTVTC--VGSVNPAENFRVLVRQKKA------SFEEASHQLINHIEQFLDTNET  630

Query  1907  --YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITKT  2080
               + K+++C+ A R   I   E ++FN+ L+ L    + K L  F + +   G+ LITK 
Sbjct  631   LYFMKSMDCIKAFREEAIQFSEEQRFNNFLKALQEKVEIKRLNHFWEIVVHDGVTLITKD  690

Query  2081  EAPDSDVLESEARSFM  2128
             EAP S V   EA+ F+
Sbjct  691   EAPGSSVTTEEAKKFL  706



>ref|XP_010123040.1| PREDICTED: X-ray repair cross-complementing protein 5, partial 
[Chlamydotis macqueenii]
Length=683

 Score =   195 bits (495),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 196/701 (28%), Positives = 324/701 (46%), Gaps = 92/701 (13%)
 Frame = +2

Query  191   EIEKVCSVLVEKKLIYSKYDEVGVILFgttetanelteelggYEHVTVLRSIKVVDDDLL  370
             + +KV +  V++++     DEV V+LFGT  T N+L      Y+++TV RS+ + D DLL
Sbjct  14    QAKKVMTKFVQRQVFAESKDEVAVVLFGTDGTRNDLANGDQ-YQNITVHRSLMLPDFDLL  72

Query  371   QALEQLPR-GSVDGDFLDAVIVGMDMMIKKYGITNKGKKRLCLITNAMCPIKDPYEGTKE  547
             + ++ + + GS   DFLDA+IV MD++ K+       K+ + L T+   P+        E
Sbjct  73    EDIQDVIKPGSEQADFLDAIIVCMDLLQKETIGKKYEKRHIELFTDLSSPVS-------E  125

Query  548   DQVSTIAAQMKAHGMRMD------------------SVIVRMKQD-------LDAEKGII  652
             DQ+  I A +K  G+ +                   SV   M ++        + +K  I
Sbjct  126   DQLEIIIANLKKTGISLQFFLPFPVDVGDGSGDTSASVRSHMHRNPFPRKSLTEQQKEGI  185

Query  653   DENDFLLSVFSKETSSKAAYVESAT----SLMGAIRTRNIA-PVTLYRGDFELSTKLKIK  817
             D    L+    +E   +  Y    +    S+   I  R +A P  L  G     + L I+
Sbjct  186   DVVRKLMHTLDEEGGLEEIYTFRESLERLSMFKKIERRPMAWPCQLTIG-----SNLSIR  240

Query  818   VWVYKKTSEERFPTLKMYSDKAPPTDKFAKHEITSSYEYKVVQDPTKQVPPEQRIKGYRY  997
             +  YK  +EE+    KM++     T    K ++     Y +  D   +V  +  I+G+RY
Sbjct  241   IVAYKSVTEEKVK--KMWTVVDART--LRKDDVQKETVYCLNDDDETEVQKDDTIQGFRY  296

Query  998   GPQVVPISSAEWEAVKFKPE-KGVKLLGFTDASNIMRHYYMKDA--NVFIA-DPENSKAI  1165
             G  +VP S  + E +K+K E K   +LGF+ +S I RHYYM +    VF A D EN  A 
Sbjct  297   GSDIVPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHYYMGNQVLKVFAAKDDEN--AA  354

Query  1166  LAVSALARAMKDMNRVAIVRCVWRQGQGNVTIGVLTPNVSDKGNVPDSLYFNALPFAEDV  1345
             +A SAL  A+ ++  VAIVR  + + + N  IGV  P + D     + L +  LP+ ED+
Sbjct  355   VAFSALVHALDELKVVAIVRYAYDR-RSNPQIGVAFPYIKD---AYECLIYVQLPYMEDL  410

Query  1346  REFQFPSFSNLPSSMLPNEQQQEAADNLVKMLDLAPSDS-----QEALLPEFTPNPVLQR  1510
             R++ F S  N     +P E Q  A D+L+  ++L   D      ++   P   PNP  QR
Sbjct  411   RQYIFSSLKN-NKKCIPTEDQLSAVDSLIDSMNLIYEDDDGETFEDLFKPSKIPNPHFQR  469

Query  1511  YYHYLEMKSKHHDAAVPPLDEILRRITDPDPELLSQNKTVVDEFRRCFEL----------  1660
              Y  L+ K+ H +  +PP+++ L  + +    +  + +  + + +  F L          
Sbjct  470   LYQCLQHKAFHPNEPLPPIEQHLLEMLEVPRVVKERCQAPLAKVKALFPLKEVGKKKEEK  529

Query  1661  ------KDNPKMKKSRKRLIREKPTGSDEEGERASTKVKS---EKIGNINPVQDFEDMIS  1813
                   KDN      +K      P   DEEG  +  K+       +G++NP +DF  ++ 
Sbjct  530   TAQDIFKDNEDGPNPKK------PKIEDEEGSFSIIKLAEGNVTSVGSVNPAEDFRILVR  583

Query  1814  RRDSPEWVNKAIQEMKNKIFYLVENSLEGDTYQKALECLVALRNGCIVEQEPKQFNDLLR  1993
             ++++        Q++ N+I   +EN      Y K + C+   R   +   + + FND L+
Sbjct  584   QKNAD--FKDVSQQLINRIDQFLENK-SSQYYMKGINCIRVFREEAVKLSKVQCFNDFLQ  640

Query  1994  NLYASCKEKDLRSFCKQLESHGIALITKTEAPDSDVLESEA  2116
              L +  ++K L  F + +    I+LITK EA  S V   EA
Sbjct  641   ALKSKVEDKALSDFWEIMIQDRISLITKNEAEGSLVTSEEA  681



>ref|XP_006186968.1| PREDICTED: X-ray repair cross-complementing protein 5 [Camelus 
ferus]
Length=733

 Score =   196 bits (497),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 190/738 (26%), Positives = 340/738 (46%), Gaps = 99/738 (13%)
 Frame = +2

Query  122   MAR--NREGLILVIDVGPSMHCVLPE-------IEKVCSVLVEKKLIYSKYDEVGVILFg  274
             MAR  N+  ++L +DVG +M    P         +KV ++ V++++     DE+ ++LFG
Sbjct  1     MARSGNKAAVVLCMDVGFAMSNSSPGGGSPFELAKKVMTMFVQRQVFAESKDEIALVLFG  60

Query  275   ttetanelteelggYEHVTVLRSIKVVDDDLLQALE-QLPRGSVDGDFLDAVIVGMDMMI  451
             T  T N L  E   Y+++TV R + + D DLL+ +E ++  GS   DFLDA+IV MD++ 
Sbjct  61    TDNTKNALAGEDQ-YQNITVHRHLMLPDFDLLEDIENKIQPGSQQADFLDALIVCMDLIQ  119

Query  452   KKYGITNKGKKRLCLITNAMCPIKDPYEGTKEDQVSTIAAQMKAHGMRMDSVIVRMKQDL  631
             ++       KK + + T+   P         +DQ+  I   +K  G+   S+   +   +
Sbjct  120   RETIGKKFNKKHIEVFTDLSSPFS-------KDQLDVIIHNLKKSGI---SLQFFLPFPV  169

Query  632   DAEKGIIDENDFLLSV--------FSKETSSKAAYVESATSLMGAIR-----------TR  754
             D E G  D  D  LS+            T  +   ++    +M ++            + 
Sbjct  170   DKEDGTGDRGDGNLSLDHHGPSFPLKGITEQQKEGIQMVKKVMMSLEGEDGLDEIYSFSE  229

Query  755   NIAPVTLYRG----------DFELSTKLKIKVWVYKKTSEERFPTLKMYSDKAPPTDKFA  904
             ++  + +++              + + L IK+  YK   +E+  T K ++     T K  
Sbjct  230   SLRQLCVFKKIERSSVPWHCQLTIGSNLSIKIVAYKSILQEK--TKKSWTVVDARTLK--  285

Query  905   KHEITSSYEYKVVQDPTKQVPPEQRIKGYRYGPQVVPISSAEWEAVKFKPE-KGVKLLGF  1081
             K +I     + +  D   +VP E  I+G+RYG  ++P S  + E +K+K E K   +LGF
Sbjct  286   KEDIRKETVFCLNDDDETEVPKEDTIQGFRYGSDIIPFSKVDQEQMKYKSEGKCFSVLGF  345

Query  1082  TDASNIMRHYYMKDA--NVFIADPENSKAILAVSALARAMKDMNRVAIVRCVWRQGQGNV  1255
               +S + R Y+M +    VF A  + + A+ A+S+L  A+ +++ VA+VR  + + + N 
Sbjct  346   CRSSQVHRKYFMGNQVLKVFAAKDDEAAAV-ALSSLIHALDELDMVAVVRYAYDR-RANP  403

Query  1256  TIGVLTPNVSDKGNVPDSLYFNALPFAEDVREFQFPSFSNLPSSMLPNEQQQEAADNLVK  1435
              +GV  P + D     + L +  LPF ED+R++ F S  N      P E Q  A D L+ 
Sbjct  404   QVGVAFPYIKD---TYECLVYIQLPFMEDLRQYMFSSLQN-KKKCTPTEAQLSAVDALID  459

Query  1436  MLDLAPSDSQEALLPEF-----TPNPVLQRYYHYLEMKSKHHDAAVPPLDEILRRITDPD  1600
              + L   D +E  + +       PNP  QR +  L  ++ H    +PP+ E +  + DP 
Sbjct  460   SMSLVKRDEEEGTIEDLFPTTKIPNPQFQRLFQCLLHRALHPQEPLPPIQEHILNMLDPP  519

Query  1601  PELLSQNKTVVDEFRRCFELKDNPKMKKSRKRLIREKPTGSD-EEGERASTKVKSEK---  1768
              E+ +  +  + + +  F L +  K    RK  +  +    D  E    S K+K+EK   
Sbjct  520   AEVTANCQDPLCKIKALFPLTEVIK----RKDQVTAQDIFQDIREDGPTSKKLKTEKEEA  575

Query  1769  --------------IGNINPVQDFEDMISRRDSPEWVNKAIQEMKNKIFYLVENSLEGDT  1906
                           +G++NP ++F  ++ ++ +      + +E  +++   +E  L+ + 
Sbjct  576   PFSVSSLAEGNVTCVGSVNPAENFRVLVRQKKA------SFEEASHQLINHIEQFLDTNK  629

Query  1907  ---YQKALECLVALRNGCIVEQEPKQFNDLLRNLYASCKEKDLRSFCKQLESHGIALITK  2077
                + K+++C+   R   I   E ++FN  L+ L    + K L  F + +   GI LITK
Sbjct  630   TPYFMKSMDCIKVFREEAIQFSEEQRFNSFLKALREKVEIKQLSHFWEIVVQDGITLITK  689

Query  2078  TEAPDSDVLESEARSFMT  2131
              EA  S V   EA+ F+ 
Sbjct  690   DEASGSSVTAEEAKKFLA  707



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7284512114752