BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21120_g1_i2 len=3214 path=[237:0-247 485:248-2097 2335:2098-2144
2381:2145-2215 192:2216-2241 2477:2242-2597 2833:2598-2621
2857:2622-3020 3269:3021-3213]

Length=3214
                                                                      Score     E

ref|XP_009789067.1|  PREDICTED: U-box domain-containing protein 4...   1135   0.0      
ref|XP_009789059.1|  PREDICTED: U-box domain-containing protein 4...   1129   0.0      
ref|XP_009592895.1|  PREDICTED: U-box domain-containing protein 4...   1128   0.0      
ref|XP_009592894.1|  PREDICTED: U-box domain-containing protein 4...   1121   0.0      
ref|XP_006341792.1|  PREDICTED: U-box domain-containing protein 4...   1118   0.0      
ref|XP_006361218.1|  PREDICTED: U-box domain-containing protein 4...   1108   0.0      
ref|XP_010319902.1|  PREDICTED: U-box domain-containing protein 4...   1106   0.0      
emb|CDP02559.1|  unnamed protein product                               1104   0.0      
ref|XP_010314681.1|  PREDICTED: U-box domain-containing protein 4...   1076   0.0      
ref|XP_009797979.1|  PREDICTED: U-box domain-containing protein 4...   1054   0.0      
ref|XP_006466517.1|  PREDICTED: U-box domain-containing protein 4...   1053   0.0      
ref|XP_009610326.1|  PREDICTED: U-box domain-containing protein 4...   1052   0.0      
ref|XP_011082322.1|  PREDICTED: U-box domain-containing protein 4...   1048   0.0      
gb|KDO79024.1|  hypothetical protein CISIN_1g003348mg                  1048   0.0      
ref|XP_006426022.1|  hypothetical protein CICLE_v10024899mg            1047   0.0      
ref|XP_006466521.1|  PREDICTED: U-box domain-containing protein 4...   1046   0.0      
ref|XP_007047436.1|  RING/U-box superfamily protein with ARM repe...   1040   0.0      
gb|EYU23288.1|  hypothetical protein MIMGU_mgv1a001434mg               1033   0.0      
ref|XP_006380667.1|  hypothetical protein POPTR_0007s10280g            1022   0.0      
ref|XP_011074755.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...   1018   0.0      
ref|XP_011013975.1|  PREDICTED: U-box domain-containing protein 4...   1017   0.0      
ref|XP_011008564.1|  PREDICTED: U-box domain-containing protein 4...   1015   0.0      
ref|XP_008238495.1|  PREDICTED: U-box domain-containing protein 4      1001   0.0      
ref|XP_002283956.2|  PREDICTED: U-box domain-containing protein 4       988   0.0      Vitis vinifera
ref|XP_006380666.1|  hypothetical protein POPTR_0007s10280g             985   0.0      
ref|XP_006380663.1|  hypothetical protein POPTR_0007s10280g             985   0.0      
ref|XP_009336069.1|  PREDICTED: U-box domain-containing protein 4...    981   0.0      
ref|XP_002306495.2|  hypothetical protein POPTR_0005s18820g             980   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009367853.1|  PREDICTED: U-box domain-containing protein 4...    978   0.0      
ref|XP_011025265.1|  PREDICTED: U-box domain-containing protein 4...    977   0.0      
ref|XP_010243920.1|  PREDICTED: U-box domain-containing protein 4       962   0.0      
ref|XP_004287978.1|  PREDICTED: U-box domain-containing protein 4...    962   0.0      
ref|XP_010087281.1|  U-box domain-containing protein 4                  959   0.0      
ref|XP_010028138.1|  PREDICTED: U-box domain-containing protein 4       953   0.0      
gb|KCW54795.1|  hypothetical protein EUGRSUZ_I00736                     943   0.0      
ref|XP_010670739.1|  PREDICTED: U-box domain-containing protein 4       941   0.0      
ref|XP_003551173.1|  PREDICTED: U-box domain-containing protein 4...    934   0.0      
gb|KHN48396.1|  U-box domain-containing protein 4                       933   0.0      
ref|XP_009367873.1|  PREDICTED: U-box domain-containing protein 4...    932   0.0      
ref|XP_002524955.1|  ubiquitin-protein ligase, putative                 925   0.0      Ricinus communis
ref|XP_003538329.1|  PREDICTED: U-box domain-containing protein 4...    924   0.0      
ref|XP_008457779.1|  PREDICTED: U-box domain-containing protein 4...    921   0.0      
gb|KDO79032.1|  hypothetical protein CISIN_1g003348mg                   916   0.0      
gb|KCW54797.1|  hypothetical protein EUGRSUZ_I00736                     914   0.0      
gb|KHN46283.1|  U-box domain-containing protein 4                       912   0.0      
ref|XP_004149702.1|  PREDICTED: U-box domain-containing protein 4...    912   0.0      
ref|XP_010531283.1|  PREDICTED: U-box domain-containing protein 4       910   0.0      
ref|XP_007146857.1|  hypothetical protein PHAVU_006G076000g             903   0.0      
ref|XP_004500342.1|  PREDICTED: U-box domain-containing protein 4...    902   0.0      
gb|KEH34421.1|  ARM repeat RING/U-box protein                           897   0.0      
gb|KDO79033.1|  hypothetical protein CISIN_1g003348mg                   892   0.0      
ref|XP_002880484.1|  armadillo/beta-catenin repeat family protein       891   0.0      
gb|EPS70781.1|  hypothetical protein M569_03979                         889   0.0      
ref|XP_006404783.1|  hypothetical protein EUTSA_v10000047mg             884   0.0      
ref|XP_010472313.1|  PREDICTED: U-box domain-containing protein 4       883   0.0      
ref|XP_006293682.1|  hypothetical protein CARUB_v10022640mg             882   0.0      
ref|XP_010429257.1|  PREDICTED: U-box domain-containing protein 4...    880   0.0      
ref|NP_001189583.1|  protein PLANT U-BOX 4                              880   0.0      
ref|NP_179895.6|  protein PLANT U-BOX 4                                 879   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KEH34422.1|  ARM repeat RING/U-box protein                           878   0.0      
gb|KHG28942.1|  U-box domain-containing 4 -like protein                 877   0.0      
gb|KDP32027.1|  hypothetical protein JCGZ_12488                         862   0.0      
ref|XP_010942967.1|  PREDICTED: U-box domain-containing protein 4...    851   0.0      
ref|XP_006575440.1|  PREDICTED: U-box domain-containing protein 4...    833   0.0      
ref|XP_006575441.1|  PREDICTED: U-box domain-containing protein 4...    832   0.0      
gb|AAB87116.1|  hypothetical protein                                    835   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006845980.1|  hypothetical protein AMTR_s00155p00026110          823   0.0      
ref|XP_009402804.1|  PREDICTED: U-box domain-containing protein 4...    815   0.0      
gb|KHN40971.1|  U-box domain-containing protein 4                       808   0.0      
ref|XP_010942970.1|  PREDICTED: U-box domain-containing protein 4...    811   0.0      
ref|XP_010942968.1|  PREDICTED: U-box domain-containing protein 4...    810   0.0      
ref|XP_009394995.1|  PREDICTED: U-box domain-containing protein 4...    806   0.0      
ref|XP_008808377.1|  PREDICTED: U-box domain-containing protein 4...    804   0.0      
ref|XP_009394994.1|  PREDICTED: U-box domain-containing protein 4...    800   0.0      
ref|XP_008808379.1|  PREDICTED: U-box domain-containing protein 4...    794   0.0      
gb|KHG09481.1|  U-box domain-containing 4 -like protein                 774   0.0      
ref|XP_007142063.1|  hypothetical protein PHAVU_008G249400g             755   0.0      
ref|XP_008802944.1|  PREDICTED: U-box domain-containing protein 4...    758   0.0      
gb|KHG13263.1|  U-box domain-containing 4 -like protein                 737   0.0      
ref|XP_006659047.1|  PREDICTED: U-box domain-containing protein 4...    733   0.0      
ref|NP_001060820.1|  Os08g0110500                                       729   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002444901.1|  hypothetical protein SORBIDRAFT_07g001110          726   0.0      Sorghum bicolor [broomcorn]
ref|XP_008648363.1|  PREDICTED: U-box domain-containing protein 4       724   0.0      
gb|EEC82795.1|  hypothetical protein OsI_27558                          723   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010234999.1|  PREDICTED: U-box domain-containing protein 4...    716   0.0      
ref|XP_003562601.2|  PREDICTED: U-box domain-containing protein 4...    716   0.0      
ref|XP_004972465.1|  PREDICTED: U-box domain-containing protein 4...    713   0.0      
dbj|BAJ92958.1|  predicted protein                                      709   0.0      
ref|XP_008678334.1|  PREDICTED: U-box domain-containing protein 4...    705   0.0      
emb|CDJ26521.1|  unnamed protein product                                701   0.0      
ref|XP_003573506.2|  PREDICTED: U-box domain-containing protein 4...    697   0.0      
gb|AFW61428.1|  putative ARM repeat-containing protein containing...    663   0.0      
ref|XP_008678335.1|  PREDICTED: U-box domain-containing protein 4...    663   0.0      
gb|EMT16948.1|  U-box domain-containing protein 4                       639   0.0      
gb|EMS61710.1|  U-box domain-containing protein 4                       619   0.0      
ref|XP_010246789.1|  PREDICTED: U-box domain-containing protein 3...    560   0.0      
ref|XP_007208336.1|  hypothetical protein PRUPE_ppa002184mg             544   6e-176   
emb|CDX76873.1|  BnaC08g34590D                                          535   9e-172   
ref|XP_009117298.1|  PREDICTED: U-box domain-containing protein 4       531   1e-169   
emb|CBI33734.3|  unnamed protein product                                523   4e-168   
emb|CDY46092.1|  BnaA09g42160D                                          532   2e-167   
ref|XP_010933040.1|  PREDICTED: U-box domain-containing protein 4...    504   7e-159   
gb|AIU34701.1|  Arm1                                                    484   1e-156   
dbj|BAK03073.1|  predicted protein                                      484   2e-156   
dbj|BAJ93866.1|  predicted protein                                      483   2e-156   
emb|CDM85251.1|  unnamed protein product                                473   3e-152   
gb|EMS55038.1|  U-box domain-containing protein 4                       468   2e-150   
ref|XP_002868987.1|  hypothetical protein ARALYDRAFT_912596             456   5e-148   
ref|XP_006645135.1|  PREDICTED: U-box domain-containing protein 4...    466   3e-145   
gb|KHG13616.1|  U-box domain-containing 2 -like protein                 455   1e-142   
ref|NP_001045017.2|  Os01g0884400                                       455   8e-141   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71911.1|  hypothetical protein OsI_04691                          452   8e-139   Oryza sativa Indica Group [Indian rice]
gb|EEE55766.1|  hypothetical protein OsJ_04318                          452   9e-138   Oryza sativa Japonica Group [Japonica rice]
gb|EMT06745.1|  U-box domain-containing protein 4                       439   3e-137   
gb|EMT05611.1|  U-box domain-containing protein 4                       435   1e-134   
ref|XP_008238487.1|  PREDICTED: U-box domain-containing protein 4...    421   2e-134   
ref|XP_007206789.1|  hypothetical protein PRUPE_ppa026658mg             422   1e-133   
gb|KHN08833.1|  U-box domain-containing protein 4                       411   1e-131   
ref|XP_006596458.1|  PREDICTED: U-box domain-containing protein 4...    407   9e-129   
gb|EMS49590.1|  U-box domain-containing protein 4                       431   1e-127   
emb|CBI37127.3|  unnamed protein product                                413   3e-127   
ref|XP_002456752.1|  hypothetical protein SORBIDRAFT_03g041930          419   3e-127   Sorghum bicolor [broomcorn]
ref|XP_010550344.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    416   1e-126   
ref|XP_007201804.1|  hypothetical protein PRUPE_ppa001702mg             416   2e-126   
ref|XP_008235668.1|  PREDICTED: U-box domain-containing protein 3...    415   5e-126   
ref|XP_010652375.1|  PREDICTED: U-box domain-containing protein 3       416   5e-126   
gb|KDO60475.1|  hypothetical protein CISIN_1g004078mg                   414   6e-126   
ref|XP_008235667.1|  PREDICTED: U-box domain-containing protein 3...    415   7e-126   
ref|XP_006443826.1|  hypothetical protein CICLE_v10018951mg             412   5e-125   
gb|KDO60476.1|  hypothetical protein CISIN_1g004078mg                   412   6e-125   
ref|XP_009112370.1|  PREDICTED: U-box domain-containing protein 2...    410   2e-124   
ref|XP_009112371.1|  PREDICTED: U-box domain-containing protein 2...    409   2e-124   
ref|XP_009369474.1|  PREDICTED: U-box domain-containing protein 3...    410   5e-124   
emb|CDX81323.1|  BnaC09g07340D                                          408   5e-124   
ref|XP_010101417.1|  U-box domain-containing protein 3                  410   5e-124   
ref|XP_008382858.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    410   6e-124   
ref|XP_008674728.1|  PREDICTED: U-box domain-containing protein 4...    409   1e-123   
emb|CDY18649.1|  BnaA09g07460D                                          406   2e-123   
ref|XP_007050279.1|  ARM repeat superfamily protein isoform 2           407   2e-123   
ref|XP_009417313.1|  PREDICTED: U-box domain-containing protein 4...    391   4e-123   
ref|XP_007050278.1|  ARM repeat superfamily protein isoform 1           408   4e-123   
ref|XP_009417311.1|  PREDICTED: U-box domain-containing protein 4...    390   5e-123   
ref|XP_004289953.1|  PREDICTED: U-box domain-containing protein 3...    407   5e-123   
ref|XP_004970816.1|  PREDICTED: U-box domain-containing protein 4...    408   6e-123   
ref|XP_006857297.1|  hypothetical protein AMTR_s00067p00049340          407   2e-122   
ref|XP_010935918.1|  PREDICTED: U-box domain-containing protein 3...    405   4e-122   
ref|XP_002866707.1|  armadillo/beta-catenin repeat family protein       402   7e-122   
ref|XP_002306856.1|  armadillo/beta-catenin repeat family protein       401   5e-121   Populus trichocarpa [western balsam poplar]
ref|XP_011004045.1|  PREDICTED: U-box domain-containing protein 3...    401   8e-121   
ref|XP_008451242.1|  PREDICTED: U-box domain-containing protein 3       400   2e-120   
gb|KHG15816.1|  U-box domain-containing 3 -like protein                 399   8e-120   
ref|XP_009336148.1|  PREDICTED: U-box domain-containing protein 3...    399   8e-120   
ref|XP_004148950.1|  PREDICTED: U-box domain-containing protein 3...    398   1e-119   
ref|XP_010262328.1|  PREDICTED: U-box domain-containing protein 3...    398   2e-119   
ref|XP_008440337.1|  PREDICTED: U-box domain-containing protein 4       380   6e-119   
ref|XP_004495092.1|  PREDICTED: U-box domain-containing protein 3...    395   7e-119   
ref|XP_011013568.1|  PREDICTED: U-box domain-containing protein 3...    396   7e-119   
ref|XP_011028811.1|  PREDICTED: U-box domain-containing protein 3...    395   1e-118   
ref|XP_004495091.1|  PREDICTED: U-box domain-containing protein 3...    395   2e-118   
gb|KHG28018.1|  U-box domain-containing 3 -like protein                 395   2e-118   
ref|XP_002302042.1|  armadillo/beta-catenin repeat family protein       394   2e-118   Populus trichocarpa [western balsam poplar]
ref|NP_201535.3|  ARM repeat superfamily protein                        392   3e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004141993.1|  PREDICTED: U-box domain-containing protein 4...    386   7e-118   
gb|KEH42514.1|  armadillo/beta-catenin repeat protein                   388   8e-118   
emb|CDP03751.1|  unnamed protein product                                393   1e-117   
ref|XP_008346169.1|  PREDICTED: U-box domain-containing protein 3...    392   4e-117   
gb|KCW84730.1|  hypothetical protein EUGRSUZ_B01548                     385   6e-117   
ref|XP_004141892.1|  PREDICTED: U-box domain-containing protein 4...    375   7e-117   
gb|KHG16511.1|  U-box domain-containing 3 -like protein                 390   1e-116   
gb|KEH42515.1|  armadillo/beta-catenin repeat protein                   388   2e-116   
ref|XP_006393931.1|  hypothetical protein EUTSA_v10003745mg             387   2e-116   
gb|KEH42516.1|  armadillo/beta-catenin repeat protein                   388   3e-116   
gb|KHN03887.1|  U-box domain-containing protein 3                       388   6e-116   
gb|EYU46447.1|  hypothetical protein MIMGU_mgv1a002302mg                385   1e-115   
ref|XP_010905800.1|  PREDICTED: U-box domain-containing protein 3...    387   2e-115   
ref|XP_010039247.1|  PREDICTED: U-box domain-containing protein 3...    388   2e-115   
ref|XP_010039241.1|  PREDICTED: U-box domain-containing protein 3...    388   2e-115   
ref|XP_010039237.1|  PREDICTED: U-box domain-containing protein 3...    388   2e-115   
gb|KDP26522.1|  hypothetical protein JCGZ_17680                         386   5e-115   
ref|XP_008807731.1|  PREDICTED: U-box domain-containing protein 3       385   1e-114   
ref|XP_007144888.1|  hypothetical protein PHAVU_007G192300g             385   1e-114   
ref|XP_007144889.1|  hypothetical protein PHAVU_007G192300g             385   1e-114   
ref|XP_002532036.1|  ubiquitin-protein ligase, putative                 383   2e-114   Ricinus communis
ref|XP_010679334.1|  PREDICTED: U-box domain-containing protein 3...    383   3e-114   
ref|XP_010679335.1|  PREDICTED: U-box domain-containing protein 3...    383   3e-114   
ref|XP_009401620.1|  PREDICTED: U-box domain-containing protein 3       383   4e-114   
ref|XP_009369475.1|  PREDICTED: U-box domain-containing protein 3...    382   7e-114   
gb|KCW84729.1|  hypothetical protein EUGRSUZ_B01548                     377   1e-113   
ref|XP_008440336.1|  PREDICTED: U-box domain-containing protein 4...    374   1e-113   
ref|XP_006604492.1|  PREDICTED: U-box domain-containing protein 3...    382   1e-113   
ref|XP_009780997.1|  PREDICTED: U-box domain-containing protein 3       382   2e-113   
ref|XP_006576944.1|  PREDICTED: U-box domain-containing protein 3...    382   2e-113   
gb|KHN02500.1|  U-box domain-containing protein 3                       380   4e-113   
ref|XP_009367841.1|  PREDICTED: U-box domain-containing protein 4...    364   8e-113   
ref|XP_009614286.1|  PREDICTED: U-box domain-containing protein 3...    380   8e-113   
ref|XP_009614285.1|  PREDICTED: U-box domain-containing protein 3...    380   1e-112   
ref|XP_010262331.1|  PREDICTED: U-box domain-containing protein 3...    379   2e-112   
gb|KEH23933.1|  armadillo/beta-catenin repeat protein                   378   4e-112   
ref|XP_011080054.1|  PREDICTED: U-box domain-containing protein 3...    377   7e-112   
ref|XP_006604490.1|  PREDICTED: U-box domain-containing protein 3...    377   9e-112   
ref|XP_006604491.1|  PREDICTED: U-box domain-containing protein 3...    377   1e-111   
ref|XP_010484515.1|  PREDICTED: U-box domain-containing protein 2...    375   1e-111   
ref|XP_011080053.1|  PREDICTED: U-box domain-containing protein 3...    377   1e-111   
ref|XP_010464200.1|  PREDICTED: U-box domain-containing protein 2...    374   2e-111   
ref|XP_010464193.1|  PREDICTED: U-box domain-containing protein 2...    374   2e-111   
ref|XP_010444664.1|  PREDICTED: U-box domain-containing protein 2...    374   3e-111   
ref|XP_010444662.1|  PREDICTED: U-box domain-containing protein 2...    374   3e-111   
dbj|BAB09019.1|  unnamed protein product                                372   7e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001778307.1|  predicted protein                                  364   8e-111   
ref|XP_010555859.1|  PREDICTED: U-box domain-containing protein 3       374   9e-111   
ref|XP_009407189.1|  PREDICTED: U-box domain-containing protein 3...    371   1e-110   
ref|XP_010326171.1|  PREDICTED: U-box domain-containing protein 3       372   6e-110   
ref|XP_006280091.1|  hypothetical protein CARUB_v10025974mg             369   1e-109   
ref|XP_009407188.1|  PREDICTED: U-box domain-containing protein 3...    370   1e-109   
ref|XP_011013573.1|  PREDICTED: U-box domain-containing protein 3...    370   2e-109   
ref|XP_006351668.1|  PREDICTED: U-box domain-containing protein 3...    371   2e-109   
ref|XP_011028816.1|  PREDICTED: U-box domain-containing protein 3...    370   3e-109   
gb|KCW84732.1|  hypothetical protein EUGRSUZ_B01548                     365   2e-107   
gb|KCW84733.1|  hypothetical protein EUGRSUZ_B01548                     365   2e-107   
gb|KCW84731.1|  hypothetical protein EUGRSUZ_B01548                     365   2e-107   
ref|XP_001781593.1|  predicted protein                                  353   2e-105   
emb|CDY02891.1|  BnaC04g25950D                                          358   3e-105   
ref|XP_004493781.1|  PREDICTED: U-box domain-containing protein 3...    358   9e-105   
ref|XP_011083032.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    357   2e-104   
ref|XP_009139209.1|  PREDICTED: U-box domain-containing protein 3...    355   3e-104   
ref|XP_006290759.1|  hypothetical protein CARUB_v10016863mg             351   4e-104   
emb|CDY64696.1|  BnaA04g27690D                                          354   1e-103   
ref|XP_006576943.1|  PREDICTED: U-box domain-containing protein 3...    355   5e-103   
gb|EPS67526.1|  hypothetical protein M569_07248                         350   9e-103   
ref|NP_001078286.1|  U-box domain-containing protein 3                  351   9e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006576940.1|  PREDICTED: U-box domain-containing protein 3...    355   1e-102   
ref|XP_006576941.1|  PREDICTED: U-box domain-containing protein 3...    354   1e-102   
ref|XP_006576942.1|  PREDICTED: U-box domain-containing protein 3...    354   1e-102   
ref|XP_002878000.1|  armadillo/beta-catenin repeat family protein       352   1e-102   
ref|NP_191039.2|  U-box domain-containing protein 3                     350   3e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403536.1|  hypothetical protein EUTSA_v10010139mg             350   5e-102   
gb|KHN10747.1|  U-box domain-containing protein 3                       352   6e-102   
dbj|BAC43212.1|  unknown protein                                        350   6e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403537.1|  hypothetical protein EUTSA_v10010139mg             350   6e-102   
ref|XP_006403535.1|  hypothetical protein EUTSA_v10010139mg             349   1e-101   
ref|XP_010427195.1|  PREDICTED: U-box domain-containing protein 3       349   1e-101   
ref|XP_010504303.1|  PREDICTED: U-box domain-containing protein 3...    348   2e-101   
emb|CDM85478.1|  unnamed protein product                                340   2e-100   
ref|XP_010670749.1|  PREDICTED: U-box domain-containing protein 4...    339   3e-100   
emb|CDX73449.1|  BnaC08g25540D                                          343   4e-100   
ref|XP_010670744.1|  PREDICTED: U-box domain-containing protein 4...    340   6e-100   
ref|XP_010516017.1|  PREDICTED: U-box domain-containing protein 3...    343   1e-99    
emb|CDX78262.1|  BnaA09g34570D                                          342   1e-99    
ref|XP_009116155.1|  PREDICTED: U-box domain-containing protein 3       341   2e-99    
ref|XP_002992508.1|  ubiquitin-protein ligase, PUB2                     335   2e-96    
ref|XP_002990179.1|  ubiquitin-protein ligase, PUB2                     334   4e-96    
emb|CDY12838.1|  BnaC07g15950D                                          330   2e-95    
emb|CDY57440.1|  BnaAnng14540D                                          328   4e-95    
emb|CAB77599.1|  putative protein                                       330   5e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002970194.1|  hypothetical protein SELMODRAFT_61948              317   1e-94    
ref|XP_009103428.1|  PREDICTED: U-box domain-containing protein 2       328   2e-94    
ref|XP_002978359.1|  hypothetical protein SELMODRAFT_51906              313   3e-93    
ref|XP_010679568.1|  PREDICTED: U-box domain-containing protein 4...    305   1e-90    
ref|XP_002989344.1|  hypothetical protein SELMODRAFT_235743             304   6e-90    
ref|XP_002980965.1|  hypothetical protein SELMODRAFT_113592             305   2e-89    
ref|XP_002980963.1|  hypothetical protein SELMODRAFT_420513             298   3e-89    
ref|XP_007018507.1|  ARM repeat superfamily protein                     295   7e-87    
ref|XP_002969740.1|  ubiquitin-protein ligase, PUB4                     307   1e-86    
ref|XP_004252739.1|  PREDICTED: U-box domain-containing protein 4...    295   1e-86    
ref|XP_006342665.1|  PREDICTED: U-box domain-containing protein 4...    294   3e-86    
gb|KHG00011.1|  U-box domain-containing 4 -like protein                 293   7e-86    
ref|XP_006472298.1|  PREDICTED: U-box domain-containing protein 4...    291   2e-85    
ref|XP_006433633.1|  hypothetical protein CICLE_v10001676mg             291   3e-85    
ref|XP_002986139.1|  ubiquitin-protein ligase, PUB13                    299   7e-85    
ref|XP_006356861.1|  PREDICTED: U-box domain-containing protein 4...    290   8e-85    
gb|KDO81505.1|  hypothetical protein CISIN_1g018791mg                   290   1e-84    
ref|XP_002984952.1|  ubiquitin-protein ligase, PUB13                    299   1e-84    
ref|XP_008220327.1|  PREDICTED: U-box domain-containing protein 4       289   2e-84    
ref|XP_004238092.1|  PREDICTED: U-box domain-containing protein 4...    289   2e-84    
ref|XP_007227457.1|  hypothetical protein PRUPE_ppa007890mg             288   2e-84    
gb|KHG16185.1|  U-box domain-containing 4 -like protein                 288   4e-84    
ref|XP_002285318.1|  PREDICTED: U-box domain-containing protein 4       287   5e-84    Vitis vinifera
ref|XP_009603721.1|  PREDICTED: U-box domain-containing protein 4       288   6e-84    
ref|XP_009794113.1|  PREDICTED: U-box domain-containing protein 4...    287   7e-84    
ref|XP_010247350.1|  PREDICTED: U-box domain-containing protein 4...    287   1e-83    
emb|CBI19404.3|  unnamed protein product                                287   2e-83    
ref|XP_002981351.1|  ubiquitin-protein ligase, PUB4                     292   6e-83    
ref|XP_009803619.1|  PREDICTED: U-box domain-containing protein 4...    285   6e-83    
gb|KEH35812.1|  armadillo/beta-catenin repeat protein                   284   9e-83    
gb|KDP41625.1|  hypothetical protein JCGZ_16032                         283   2e-82    
ref|XP_002510099.1|  E3 ubiquitin ligase PUB14, putative                283   2e-82    
ref|XP_009403749.1|  PREDICTED: U-box domain-containing protein 4...    283   2e-82    
ref|XP_007160909.1|  hypothetical protein PHAVU_001G027300g             283   2e-82    
ref|XP_009624199.1|  PREDICTED: U-box domain-containing protein 4...    285   3e-82    
ref|XP_004142891.1|  PREDICTED: U-box domain-containing protein 4...    282   4e-82    
ref|XP_002301150.2|  hypothetical protein POPTR_0002s11960g             280   2e-81    
gb|ADD09563.1|  E3 ubiquitin ligase                                     280   2e-81    
dbj|BAF01345.1|  hypothetical proteins                                  274   2e-81    
ref|XP_008444561.1|  PREDICTED: U-box domain-containing protein 4       280   2e-81    
ref|XP_010688093.1|  PREDICTED: U-box domain-containing protein 4...    280   3e-81    
ref|XP_011074355.1|  PREDICTED: U-box domain-containing protein 4...    280   3e-81    
gb|EYU36380.1|  hypothetical protein MIMGU_mgv1a009210mg                280   3e-81    
ref|XP_003550308.1|  PREDICTED: U-box domain-containing protein 4       280   3e-81    
ref|XP_003589079.1|  U-box domain-containing protein                    278   5e-81    
ref|XP_004501523.1|  PREDICTED: U-box domain-containing protein 4...    280   5e-81    
gb|AES59330.2|  armadillo/beta-catenin-like repeat protein              279   6e-81    
ref|XP_001772291.1|  predicted protein                                  288   6e-81    
ref|XP_010272526.1|  PREDICTED: U-box domain-containing protein 4...    279   8e-81    
ref|XP_010938960.1|  PREDICTED: U-box domain-containing protein 4...    278   9e-81    
ref|XP_011017118.1|  PREDICTED: U-box domain-containing protein 4...    278   9e-81    
ref|XP_009403748.1|  PREDICTED: U-box domain-containing protein 4...    278   1e-80    
emb|CDX91947.1|  BnaC03g32490D                                          278   2e-80    
gb|ACN40705.1|  unknown                                                 283   2e-80    
ref|XP_004498998.1|  PREDICTED: U-box domain-containing protein 4...    277   3e-80    
ref|XP_009134615.1|  PREDICTED: U-box domain-containing protein 4...    277   3e-80    
ref|XP_009421109.1|  PREDICTED: U-box domain-containing protein 4...    277   4e-80    
emb|CDM85485.1|  unnamed protein product                                283   5e-80    
ref|XP_008362755.1|  PREDICTED: U-box domain-containing protein 4...    276   5e-80    
ref|XP_009354088.1|  PREDICTED: U-box domain-containing protein 4...    276   5e-80    
ref|XP_004290967.1|  PREDICTED: U-box domain-containing protein 4...    275   2e-79    
ref|XP_010530486.1|  PREDICTED: U-box domain-containing protein 4...    275   2e-79    
emb|CDP01201.1|  unnamed protein product                                275   3e-79    
gb|KDP30475.1|  hypothetical protein JCGZ_16154                         283   4e-79    
ref|XP_010252683.1|  PREDICTED: U-box domain-containing protein 4...    278   4e-79    
gb|AFK46109.1|  unknown                                                 273   6e-79    
ref|XP_011084290.1|  PREDICTED: U-box domain-containing protein 14      282   7e-79    
ref|XP_010059796.1|  PREDICTED: U-box domain-containing protein 4...    271   3e-78    
ref|XP_006300236.1|  hypothetical protein CARUB_v10016476mg             271   4e-78    
ref|XP_008787190.1|  PREDICTED: U-box domain-containing protein 4...    271   4e-78    
ref|NP_566136.1|  armadillo/beta-catenin-like repeat-containing p...    271   5e-78    
gb|AAL16172.1|AF428404_1  AT3g01400/T13O15_4                            271   6e-78    
ref|XP_003635632.1|  PREDICTED: U-box domain-containing protein 4       274   6e-78    
emb|CDX74298.1|  BnaA03g27490D                                          270   7e-78    
ref|XP_007143751.1|  hypothetical protein PHAVU_007G098700g             279   7e-78    
ref|XP_002968976.1|  hypothetical protein SELMODRAFT_231208             278   9e-78    
ref|XP_010942796.1|  PREDICTED: U-box domain-containing protein 4...    270   1e-77    
ref|XP_006856806.1|  hypothetical protein AMTR_s00055p00145690          273   1e-77    
gb|AAM64910.1|  unknown                                                 269   2e-77    
ref|XP_002990024.1|  hypothetical protein SELMODRAFT_184959             278   2e-77    
ref|XP_010431524.1|  PREDICTED: U-box domain-containing protein 4...    269   2e-77    
gb|KHN00867.1|  U-box domain-containing protein 14                      278   3e-77    
ref|XP_003556245.1|  PREDICTED: U-box domain-containing protein 1...    277   3e-77    
ref|XP_009140638.1|  PREDICTED: U-box domain-containing protein 4...    276   5e-77    
ref|XP_009396044.1|  PREDICTED: U-box domain-containing protein 4...    267   2e-76    
ref|XP_002320032.2|  hypothetical protein POPTR_0014s01670g             266   2e-76    
ref|XP_007136751.1|  hypothetical protein PHAVU_009G071200g             265   2e-76    
ref|XP_003535520.1|  PREDICTED: U-box domain-containing protein 1...    275   3e-76    
ref|XP_009401027.1|  PREDICTED: U-box domain-containing protein 4...    265   5e-76    
ref|XP_010485548.1|  PREDICTED: U-box domain-containing protein 4...    265   5e-76    
ref|XP_008776156.1|  PREDICTED: U-box domain-containing protein 4       265   6e-76    
gb|KFK37604.1|  hypothetical protein AALP_AA3G004800                    265   9e-76    
ref|XP_002298363.1|  armadillo/beta-catenin repeat family protein       274   9e-76    
ref|XP_007154024.1|  hypothetical protein PHAVU_003G084700g             267   9e-76    
ref|XP_011000261.1|  PREDICTED: U-box domain-containing protein 1...    274   1e-75    
ref|XP_010463527.1|  PREDICTED: U-box domain-containing protein 4...    264   1e-75    
ref|XP_006408499.1|  hypothetical protein EUTSA_v10021975mg             263   2e-75    
ref|XP_006833209.1|  hypothetical protein AMTR_s00072p00171260          272   2e-75    
ref|XP_002313440.1|  armadillo/beta-catenin repeat family protein       273   3e-75    
ref|XP_002283992.1|  PREDICTED: U-box domain-containing protein 13      273   3e-75    
ref|XP_010270156.1|  PREDICTED: U-box domain-containing protein 4...    267   4e-75    
gb|KEH43492.1|  armadillo/beta-catenin repeat protein                   266   4e-75    
ref|XP_009396054.1|  PREDICTED: U-box domain-containing protein 4...    265   5e-75    
ref|XP_010091242.1|  U-box domain-containing protein 4                  261   5e-75    
ref|XP_010556451.1|  PREDICTED: U-box domain-containing protein 4...    262   6e-75    
ref|XP_010940632.1|  PREDICTED: U-box domain-containing protein 12      270   9e-75    
ref|XP_009125026.1|  PREDICTED: U-box domain-containing protein 4       261   1e-74    
ref|XP_010999871.1|  PREDICTED: U-box domain-containing protein 4...    261   1e-74    
ref|XP_004307361.1|  PREDICTED: U-box domain-containing protein 1...    270   1e-74    
ref|XP_010556449.1|  PREDICTED: U-box domain-containing protein 4...    261   1e-74    
ref|XP_006841078.1|  hypothetical protein AMTR_s00086p00031680          261   2e-74    
ref|XP_009395597.1|  PREDICTED: U-box domain-containing protein 4...    264   2e-74    
gb|KDP44223.1|  hypothetical protein JCGZ_05690                         270   3e-74    
ref|XP_011024385.1|  PREDICTED: U-box domain-containing protein 1...    268   7e-74    
ref|XP_008393732.1|  PREDICTED: U-box domain-containing protein 4...    259   7e-74    
ref|XP_008364702.1|  PREDICTED: U-box domain-containing protein 14      267   8e-74    
gb|KHN37791.1|  U-box domain-containing protein 14                      268   8e-74    
ref|XP_006607012.1|  PREDICTED: U-box domain-containing protein 4...    256   8e-74    
ref|XP_010936614.1|  PREDICTED: U-box domain-containing protein 4       262   8e-74    
ref|XP_009368915.1|  PREDICTED: U-box domain-containing protein 14      267   9e-74    
ref|XP_008233282.1|  PREDICTED: U-box domain-containing protein 14      267   1e-73    
ref|XP_003550969.1|  PREDICTED: U-box domain-containing protein 1...    259   2e-73    
ref|XP_008440076.1|  PREDICTED: U-box domain-containing protein 4       261   2e-73    
ref|XP_003546191.1|  PREDICTED: U-box domain-containing protein 4...    261   2e-73    
ref|XP_008789545.1|  PREDICTED: U-box domain-containing protein 1...    266   2e-73    
ref|XP_009394383.1|  PREDICTED: U-box domain-containing protein 4...    261   2e-73    
ref|XP_009393836.1|  PREDICTED: U-box domain-containing protein 4...    258   2e-73    
ref|XP_009407746.1|  PREDICTED: U-box domain-containing protein 4...    261   2e-73    
ref|XP_011041060.1|  PREDICTED: U-box domain-containing protein 1...    266   2e-73    
ref|XP_009407762.1|  PREDICTED: U-box domain-containing protein 4...    261   2e-73    
ref|XP_011042684.1|  PREDICTED: U-box domain-containing protein 1...    267   2e-73    
ref|XP_004134799.1|  PREDICTED: U-box domain-containing protein 4...    261   2e-73    
gb|KEH43493.1|  armadillo/beta-catenin repeat protein                   266   2e-73    
gb|KEH30893.1|  armadillo/beta-catenin repeat protein                   262   3e-73    
ref|XP_002534105.1|  Spotted leaf protein, putative                     267   3e-73    
ref|XP_008789544.1|  PREDICTED: U-box domain-containing protein 1...    266   3e-73    
ref|XP_006346779.1|  PREDICTED: U-box domain-containing protein 4...    260   4e-73    
ref|XP_002311996.1|  armadillo/beta-catenin repeat family protein       265   5e-73    
ref|XP_004496239.1|  PREDICTED: U-box domain-containing protein 1...    265   5e-73    
ref|XP_002315320.1|  armadillo/beta-catenin repeat family protein       265   5e-73    
gb|EPS68981.1|  hypothetical protein M569_05787                         265   6e-73    
ref|XP_007009958.1|  U-box domain-containing protein 14                 265   6e-73    
ref|XP_004505870.1|  PREDICTED: U-box domain-containing protein 1...    266   7e-73    
ref|XP_004486322.1|  PREDICTED: U-box domain-containing protein 4...    260   7e-73    
ref|XP_006467322.1|  PREDICTED: U-box domain-containing protein 4...    260   7e-73    
ref|XP_011031687.1|  PREDICTED: U-box domain-containing protein 14      265   7e-73    
ref|XP_010557715.1|  PREDICTED: U-box domain-containing protein 14      264   1e-72    
ref|XP_003594249.1|  U-box domain-containing protein                    259   1e-72    
ref|XP_007016448.1|  Plant U-box 13 isoform 2                           265   1e-72    
ref|XP_010241804.1|  PREDICTED: U-box domain-containing protein 14      264   2e-72    
gb|EYU39871.1|  hypothetical protein MIMGU_mgv1a002720mg                264   2e-72    
ref|XP_007016447.1|  U-box domain-containing protein 13 isoform 1       265   2e-72    
ref|XP_006436479.1|  hypothetical protein CICLE_v10030962mg             256   2e-72    
ref|NP_001060138.1|  Os07g0587500                                       255   2e-72    
dbj|BAJ85388.1|  predicted protein                                      263   2e-72    
ref|XP_010253199.1|  PREDICTED: U-box domain-containing protein 1...    264   2e-72    
gb|KEH30143.1|  armadillo/beta-catenin repeat protein                   264   3e-72    
ref|XP_006424806.1|  hypothetical protein CICLE_v10027966mg             261   3e-72    
dbj|BAD94341.1|  hypothetical protein                                   254   4e-72    
ref|XP_009411052.1|  PREDICTED: U-box domain-containing protein 4...    254   4e-72    
ref|XP_010504312.1|  PREDICTED: U-box domain-containing protein 14      263   4e-72    
ref|XP_010253985.1|  PREDICTED: U-box domain-containing protein 1...    262   5e-72    
ref|XP_002965709.1|  ubiquitin-protein ligase, PUB12                    262   5e-72    
emb|CDY28679.1|  BnaCnng05650D                                          250   5e-72    
ref|XP_006350763.1|  PREDICTED: U-box domain-containing protein 1...    261   5e-72    
emb|CDY32692.1|  BnaA02g07540D                                          254   5e-72    
ref|XP_002270524.1|  PREDICTED: U-box domain-containing protein 14      262   5e-72    
ref|XP_002971622.1|  ubiquitin-protein ligase, PUB12                    262   6e-72    
ref|XP_003534872.1|  PREDICTED: U-box domain-containing protein 4       257   7e-72    
emb|CDY02828.1|  BnaC02g10610D                                          253   8e-72    
ref|XP_010556450.1|  PREDICTED: U-box domain-containing protein 4...    253   8e-72    
ref|XP_009360717.1|  PREDICTED: U-box domain-containing protein 4...    253   8e-72    
ref|XP_003607915.1|  U-box domain-containing protein                    261   9e-72    
gb|KEH30892.1|  armadillo/beta-catenin repeat protein                   262   1e-71    
ref|XP_006424807.1|  hypothetical protein CICLE_v10027966mg             262   1e-71    
ref|XP_004140474.1|  PREDICTED: U-box domain-containing protein 1...    261   1e-71    
ref|XP_004236666.1|  PREDICTED: U-box domain-containing protein 4...    256   2e-71    
ref|XP_003537996.1|  PREDICTED: U-box domain-containing protein 1...    261   2e-71    
ref|XP_009599897.1|  PREDICTED: U-box domain-containing protein 1...    261   2e-71    
gb|KDP38040.1|  hypothetical protein JCGZ_04683                         261   2e-71    
ref|XP_009777581.1|  PREDICTED: U-box domain-containing protein 1...    261   2e-71    
ref|XP_006655674.1|  PREDICTED: U-box domain-containing protein 1...    258   3e-71    
ref|XP_009353692.1|  PREDICTED: U-box domain-containing protein 1...    258   3e-71    
gb|EAY99303.1|  hypothetical protein OsI_21270                          259   3e-71    
ref|XP_010666679.1|  PREDICTED: U-box domain-containing protein 14      260   3e-71    
ref|XP_003539679.1|  PREDICTED: U-box domain-containing protein 1...    261   4e-71    
ref|XP_004161193.1|  PREDICTED: U-box domain-containing protein 1...    261   4e-71    
ref|XP_010094691.1|  U-box domain-containing protein 4                  254   4e-71    
ref|XP_006350762.1|  PREDICTED: U-box domain-containing protein 1...    260   5e-71    
ref|XP_011070638.1|  PREDICTED: U-box domain-containing protein 1...    260   5e-71    
ref|XP_007132072.1|  hypothetical protein PHAVU_011G064700g             260   5e-71    
ref|XP_009594953.1|  PREDICTED: U-box domain-containing protein 14      259   5e-71    
ref|XP_004505257.1|  PREDICTED: U-box domain-containing protein 1...    260   5e-71    
gb|KHG05758.1|  U-box domain-containing 13 -like protein                260   5e-71    
gb|KFK27405.1|  hypothetical protein AALP_AA8G378800                    251   5e-71    
ref|XP_009136774.1|  PREDICTED: U-box domain-containing protein 4...    254   6e-71    
gb|KHN32120.1|  U-box domain-containing protein 13                      260   6e-71    
gb|KDO64708.1|  hypothetical protein CISIN_1g006669mg                   256   7e-71    
ref|XP_004250056.1|  PREDICTED: U-box domain-containing protein 1...    259   7e-71    
ref|XP_007157719.1|  hypothetical protein PHAVU_002G092600g             259   7e-71    
ref|XP_003557288.1|  PREDICTED: U-box domain-containing protein 12      258   8e-71    
ref|XP_006361678.1|  PREDICTED: U-box domain-containing protein 1...    259   8e-71    
emb|CDX90518.1|  BnaA03g42630D                                          254   8e-71    
ref|XP_010106453.1|  U-box domain-containing protein 13                 259   8e-71    
ref|XP_006436478.1|  hypothetical protein CICLE_v10030962mg             257   8e-71    
ref|XP_007147642.1|  hypothetical protein PHAVU_006G142100g             254   9e-71    
ref|XP_007026281.1|  ARM repeat superfamily protein isoform 1           254   9e-71    
ref|XP_004250960.1|  PREDICTED: U-box domain-containing protein 13      259   1e-70    
gb|AGT17414.1|  hypothetical protein SHCRBa_140_J14_R_360               257   1e-70    
gb|KDO48789.1|  hypothetical protein CISIN_1g006877mg                   256   1e-70    
ref|XP_009760654.1|  PREDICTED: U-box domain-containing protein 14      258   1e-70    
ref|XP_004298462.1|  PREDICTED: U-box domain-containing protein 1...    258   1e-70    
ref|XP_004293377.1|  PREDICTED: U-box domain-containing protein 4...    253   1e-70    
emb|CDY38931.1|  BnaA04g13520D                                          258   1e-70    
ref|XP_009145837.1|  PREDICTED: U-box domain-containing protein 4       254   1e-70    
ref|XP_008385130.1|  PREDICTED: U-box domain-containing protein 1...    260   1e-70    
ref|XP_009353694.1|  PREDICTED: U-box domain-containing protein 1...    259   2e-70    
emb|CDY21412.1|  BnaA09g30150D                                          258   2e-70    
emb|CDO99779.1|  unnamed protein product                                258   2e-70    
emb|CDY04746.1|  BnaC05g18430D                                          258   2e-70    
ref|XP_006850733.1|  hypothetical protein AMTR_s00025p00052670          259   2e-70    
ref|XP_010322360.1|  PREDICTED: U-box domain-containing protein 1...    256   2e-70    
ref|XP_009618416.1|  PREDICTED: U-box domain-containing protein 4...    253   2e-70    
emb|CDY09688.1|  BnaC07g33730D                                          253   2e-70    
ref|XP_009115567.1|  PREDICTED: U-box domain-containing protein 11      257   2e-70    
ref|XP_007204993.1|  hypothetical protein PRUPE_ppa003509mg             256   2e-70    
emb|CDP09042.1|  unnamed protein product                                258   2e-70    
ref|XP_008798480.1|  PREDICTED: U-box domain-containing protein 4       253   2e-70    
ref|XP_010935714.1|  PREDICTED: U-box domain-containing protein 1...    257   2e-70    
gb|EPS73780.1|  hypothetical protein M569_00975                         252   2e-70    
ref|XP_008223401.1|  PREDICTED: U-box domain-containing protein 13      258   3e-70    
ref|XP_004294506.1|  PREDICTED: U-box domain-containing protein 1...    258   3e-70    
ref|XP_002460943.1|  hypothetical protein SORBIDRAFT_02g037940          249   3e-70    
ref|XP_006348996.1|  PREDICTED: U-box domain-containing protein 1...    258   3e-70    
ref|XP_009775506.1|  PREDICTED: U-box domain-containing protein 4...    253   3e-70    
ref|XP_010535503.1|  PREDICTED: U-box domain-containing protein 13      258   3e-70    
ref|XP_010685786.1|  PREDICTED: U-box domain-containing protein 13      258   3e-70    
ref|XP_002868130.1|  predicted protein                                  253   3e-70    
ref|XP_010935712.1|  PREDICTED: U-box domain-containing protein 1...    257   3e-70    
gb|KHG15771.1|  U-box domain-containing 14 -like protein                257   3e-70    
emb|CDY25764.1|  BnaA07g10180D                                          256   3e-70    
ref|XP_009357795.1|  PREDICTED: U-box domain-containing protein 1...    257   4e-70    
ref|XP_008454770.1|  PREDICTED: U-box domain-containing protein 1...    258   4e-70    
ref|XP_002528228.1|  ubiquitin-protein ligase, putative                 252   4e-70    
ref|XP_010449782.1|  PREDICTED: U-box domain-containing protein 4...    252   4e-70    
ref|XP_006414341.1|  hypothetical protein EUTSA_v10025098mg             252   4e-70    



>ref|XP_009789067.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Nicotiana sylvestris]
Length=821

 Score =  1135 bits (2935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/833 (75%), Positives = 706/833 (85%), Gaps = 13/833 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+ LLKVLLNNIS FFHLSS E+I+  LV +YY K ED+L +L+PIL  IVD E AS+E
Sbjct  1     MEMSLLKVLLNNISQFFHLSSSESISDVLVQRYYCKNEDLLNILKPILEAIVDVEAASNE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LLQK F+ +   +DELREL++TWQ L SKVYFVLQAESLI K+R  SL+I+ELL +   C
Sbjct  61    LLQKAFARVAQFIDELRELYETWQPLGSKVYFVLQAESLIVKIRTCSLEILELLKTYHQC  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+++LTSLE+ +LKIK +DYEL+S TITKAIK  +EG GASSDS  KIADCL L SN+
Sbjct  121   LPADTTLTSLEHSILKIKYVDYELMSMTITKAIKAQMEGLGASSDSFAKIADCLRLNSNK  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELLIELVALE+LKENAEQAEK+EEVEYIEQIIALV++MHD  + MKQS++CT V IP DF
Sbjct  181   ELLIELVALEQLKENAEQAEKSEEVEYIEQIIALVSNMHDRFVTMKQSQTCTPVPIPPDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIR+WIDLGLTVCPKTRQ L HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIRKWIDLGLTVCPKTRQMLGHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP+KSL++NQP S +AH DSG PRD   F   R N+S+SPDSA  L SP
Sbjct  301   NWCESNNVKLPDPMKSLSLNQPCSLLAHADSGVPRDTQGFPLPRGNHSSSPDSARSLSSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
             RKS ISSS  QRE SSPSHP SSS++SLP +A + L LDVER+S++ SE+R+A+SG+   
Sbjct  361   RKSLISSSINQREGSSPSHPHSSSDDSLPGVASNMLALDVERISIKSSEERMAHSGE---  417

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTAS-  1441
                    +  + NS+ +ADE+S  GHNRTTSAPSTLSNSNFS A + DGNEVSS + A+ 
Sbjct  418   -------IKSTGNSMLAADEHSLVGHNRTTSAPSTLSNSNFSPAISGDGNEVSSRSAAAA  470

Query  1440  TEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETR  1261
             T+AS +V SESR AA L+  RRE EFPS + TR R  +IWRRPSER   RIVSS TVE R
Sbjct  471   TDASGDV-SESRPAAPLSVLRREPEFPSMLETRARNQSIWRRPSERF-PRIVSSATVERR  528

Query  1260  ADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLH  1081
             ADL EV+EQVRKLV+DL S S+D QR ATAELRLLAKHNMDNRIVI++CGAI+LLVNLLH
Sbjct  529   ADLLEVEEQVRKLVQDLNSDSIDVQRDATAELRLLAKHNMDNRIVIASCGAINLLVNLLH  588

Query  1080  SEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSV  901
             SEDM VQENAVTALLNLSINDNNK  IANA AIEPLI+VL+TG+ EAKENSAATLFSLSV
Sbjct  589   SEDMNVQENAVTALLNLSINDNNKCLIANADAIEPLIHVLQTGTAEAKENSAATLFSLSV  648

Query  900   IEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVE  721
             IEDNK+KIGRSGA++ LVDLLGNGTPRGKKDAATALFNLSILHENK RIVQAGAV+ LVE
Sbjct  649   IEDNKMKIGRSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKARIVQAGAVKFLVE  708

Query  720   LMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQL  541
             LMDPAAGMVDKAVAVLSNLATI EGR +IGQEGGI +LVEVVELGSARGKENAAAALLQL
Sbjct  709   LMDPAAGMVDKAVAVLSNLATIHEGRAAIGQEGGIAVLVEVVELGSARGKENAAAALLQL  768

Query  540   CTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             CTNSSR+CNMVLQ GAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  769   CTNSSRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  821



>ref|XP_009789059.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009789061.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009789062.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009789063.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009789064.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009789065.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009789066.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Nicotiana sylvestris]
Length=827

 Score =  1129 bits (2919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/839 (74%), Positives = 706/839 (84%), Gaps = 19/839 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+ LLKVLLNNIS FFHLSS E+I+  LV +YY K ED+L +L+PIL  IVD E AS+E
Sbjct  1     MEMSLLKVLLNNISQFFHLSSSESISDVLVQRYYCKNEDLLNILKPILEAIVDVEAASNE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LLQK F+ +   +DELREL++TWQ L SKVYFVLQAESLI K+R  SL+I+ELL +   C
Sbjct  61    LLQKAFARVAQFIDELRELYETWQPLGSKVYFVLQAESLIVKIRTCSLEILELLKTYHQC  120

Query  2517  LPAESSLTSLE------NCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCL  2356
             LPA+++LTSLE      + +LKIK +DYEL+S TITKAIK  +EG GASSDS  KIADCL
Sbjct  121   LPADTTLTSLEVGSQKQHSILKIKYVDYELMSMTITKAIKAQMEGLGASSDSFAKIADCL  180

Query  2355  SLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSV  2176
              L SN+ELLIELVALE+LKENAEQAEK+EEVEYIEQIIALV++MHD  + MKQS++CT V
Sbjct  181   RLNSNKELLIELVALEQLKENAEQAEKSEEVEYIEQIIALVSNMHDRFVTMKQSQTCTPV  240

Query  2175  QIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYT  1996
              IP DFCCPLSLELMTDPVIVASGQTYER FIR+WIDLGLTVCPKTRQ L HTNLIPNYT
Sbjct  241   PIPPDFCCPLSLELMTDPVIVASGQTYERAFIRKWIDLGLTVCPKTRQMLGHTNLIPNYT  300

Query  1995  VKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSA  1816
             VKALIANWCE NN+KLPDP+KSL++NQP S +AH DSG PRD   F   R N+S+SPDSA
Sbjct  301   VKALIANWCESNNVKLPDPMKSLSLNQPCSLLAHADSGVPRDTQGFPLPRGNHSSSPDSA  360

Query  1815  HGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLAN  1636
               L SPRKS ISSS  QRE SSPSHP SSS++SLP +A + L LDVER+S++ SE+R+A+
Sbjct  361   RSLSSPRKSLISSSINQREGSSPSHPHSSSDDSLPGVASNMLALDVERISIKSSEERMAH  420

Query  1635  SGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS  1456
             SG+          +  + NS+ +ADE+S  GHNRTTSAPSTLSNSNFS A + DGNEVSS
Sbjct  421   SGE----------IKSTGNSMLAADEHSLVGHNRTTSAPSTLSNSNFSPAISGDGNEVSS  470

Query  1455  PTTAS-TEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSS  1279
              + A+ T+AS +V SESR AA L+  RRE EFPS + TR R  +IWRRPSER   RIVSS
Sbjct  471   RSAAAATDASGDV-SESRPAAPLSVLRREPEFPSMLETRARNQSIWRRPSERF-PRIVSS  528

Query  1278  PTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISL  1099
              TVE RADL EV+EQVRKLV+DL S S+D QR ATAELRLLAKHNMDNRIVI++CGAI+L
Sbjct  529   ATVERRADLLEVEEQVRKLVQDLNSDSIDVQRDATAELRLLAKHNMDNRIVIASCGAINL  588

Query  1098  LVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAAT  919
             LVNLLHSEDM VQENAVTALLNLSINDNNK  IANA AIEPLI+VL+TG+ EAKENSAAT
Sbjct  589   LVNLLHSEDMNVQENAVTALLNLSINDNNKCLIANADAIEPLIHVLQTGTAEAKENSAAT  648

Query  918   LFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGA  739
             LFSLSVIEDNK+KIGRSGA++ LVDLLGNGTPRGKKDAATALFNLSILHENK RIVQAGA
Sbjct  649   LFSLSVIEDNKMKIGRSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKARIVQAGA  708

Query  738   VRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAA  559
             V+ LVELMDPAAGMVDKAVAVLSNLATI EGR +IGQEGGI +LVEVVELGSARGKENAA
Sbjct  709   VKFLVELMDPAAGMVDKAVAVLSNLATIHEGRAAIGQEGGIAVLVEVVELGSARGKENAA  768

Query  558   AALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             AALLQLCTNSSR+CNMVLQ GAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  769   AALLQLCTNSSRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  827



>ref|XP_009592895.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Nicotiana tomentosiformis]
Length=821

 Score =  1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/833 (75%), Positives = 705/833 (85%), Gaps = 13/833 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+ LL+VLLNNIS FFHLSS E+I+  LV +YY K ED+LK+L+PIL  IVD E AS E
Sbjct  1     MEMSLLEVLLNNISQFFHLSSSESISDVLVQRYYCKNEDVLKILKPILEAIVDVEAASSE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LLQK F+ L   +DELREL++TWQ L SKVYFVLQAESLI K+R  SL+I+ELL SS  C
Sbjct  61    LLQKAFARLAQFIDELRELYETWQPLGSKVYFVLQAESLIVKIRTCSLEILELLKSSHQC  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+ +LTSLE+ +LKIK +DYEL+S TITKA+K  +EG GASSD   KIADCL L SN+
Sbjct  121   LPADLTLTSLEHSILKIKYVDYELMSMTITKAVKAQMEGLGASSDGFAKIADCLRLNSNK  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELLIE VALE+LKENAEQAEK+EEVEYIEQIIALV++MHD  + MKQS++CT V IP DF
Sbjct  181   ELLIEFVALEQLKENAEQAEKSEEVEYIEQIIALVSNMHDRFVTMKQSQTCTPVPIPPDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIR+WIDLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIRKWIDLGLTVCPKTRQTLGHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP+KSL++NQ  S +AH DSG PRD   F   R N+S+SPDSA  L SP
Sbjct  301   NWCESNNVKLPDPMKSLSLNQSCSLLAHADSGVPRDTLGFPLPRGNHSSSPDSARFLSSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
             RKS ISSS  QRE SSPSHP SSS++SLP +A + L LDVER+S++ SE+R+A+SG+  +
Sbjct  361   RKSLISSSINQREGSSPSHPHSSSDDSLPGVASNMLALDVERISIKSSEERMAHSGE--I  418

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPT-TAS  1441
             NS  H        S+ +ADE+S  GHNRTTSAPSTLSNSNFS A + DGNEVSS +  A+
Sbjct  419   NSTGH--------SMLAADEHSLVGHNRTTSAPSTLSNSNFSPAISGDGNEVSSRSAVAA  470

Query  1440  TEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETR  1261
             T+AS +V SES  AA L+  RRE EFPS + TR R  +IWRRPSER   RIVSS TVE R
Sbjct  471   TDASGDV-SESCPAAPLSVLRREPEFPSMLETRARNQSIWRRPSERF-PRIVSSATVERR  528

Query  1260  ADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLH  1081
             ADL EV+EQVRKLV+DL S S+D +R ATAELRLLAKHNMDNRIVI++CGAI+LLVNLLH
Sbjct  529   ADLLEVEEQVRKLVQDLNSDSIDVKRDATAELRLLAKHNMDNRIVIASCGAINLLVNLLH  588

Query  1080  SEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSV  901
             SEDM+VQENAVTALLNLSINDNNK +IANA AIEPLI+VL+TG+ EAKENSAATLFSLSV
Sbjct  589   SEDMKVQENAVTALLNLSINDNNKCSIANADAIEPLIHVLQTGTAEAKENSAATLFSLSV  648

Query  900   IEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVE  721
             IEDNK+KIGRSGA++ LVDLLGNG PRGKKDAATALFNLSILHENK RIVQAGAV+ LVE
Sbjct  649   IEDNKMKIGRSGAIKPLVDLLGNGAPRGKKDAATALFNLSILHENKARIVQAGAVKFLVE  708

Query  720   LMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQL  541
             LMDPAAGMVDKAVAVLSNLATI EGR +IGQEGGI +LVEVVELGSARGKENAAAALLQL
Sbjct  709   LMDPAAGMVDKAVAVLSNLATIHEGRAAIGQEGGIAVLVEVVELGSARGKENAAAALLQL  768

Query  540   CTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             CTNSSR+CNMVLQ GAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  769   CTNSSRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  821



>ref|XP_009592894.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Nicotiana tomentosiformis]
Length=827

 Score =  1121 bits (2900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/839 (74%), Positives = 705/839 (84%), Gaps = 19/839 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+ LL+VLLNNIS FFHLSS E+I+  LV +YY K ED+LK+L+PIL  IVD E AS E
Sbjct  1     MEMSLLEVLLNNISQFFHLSSSESISDVLVQRYYCKNEDVLKILKPILEAIVDVEAASSE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LLQK F+ L   +DELREL++TWQ L SKVYFVLQAESLI K+R  SL+I+ELL SS  C
Sbjct  61    LLQKAFARLAQFIDELRELYETWQPLGSKVYFVLQAESLIVKIRTCSLEILELLKSSHQC  120

Query  2517  LPAESSLTSLE------NCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCL  2356
             LPA+ +LTSLE      + +LKIK +DYEL+S TITKA+K  +EG GASSD   KIADCL
Sbjct  121   LPADLTLTSLEVGSQKQHSILKIKYVDYELMSMTITKAVKAQMEGLGASSDGFAKIADCL  180

Query  2355  SLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSV  2176
              L SN+ELLIE VALE+LKENAEQAEK+EEVEYIEQIIALV++MHD  + MKQS++CT V
Sbjct  181   RLNSNKELLIEFVALEQLKENAEQAEKSEEVEYIEQIIALVSNMHDRFVTMKQSQTCTPV  240

Query  2175  QIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYT  1996
              IP DFCCPLSLELMTDPVIVASGQTYER FIR+WIDLGLTVCPKTRQTL HTNLIPNYT
Sbjct  241   PIPPDFCCPLSLELMTDPVIVASGQTYERAFIRKWIDLGLTVCPKTRQTLGHTNLIPNYT  300

Query  1995  VKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSA  1816
             VKALIANWCE NN+KLPDP+KSL++NQ  S +AH DSG PRD   F   R N+S+SPDSA
Sbjct  301   VKALIANWCESNNVKLPDPMKSLSLNQSCSLLAHADSGVPRDTLGFPLPRGNHSSSPDSA  360

Query  1815  HGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLAN  1636
               L SPRKS ISSS  QRE SSPSHP SSS++SLP +A + L LDVER+S++ SE+R+A+
Sbjct  361   RFLSSPRKSLISSSINQREGSSPSHPHSSSDDSLPGVASNMLALDVERISIKSSEERMAH  420

Query  1635  SGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS  1456
             SG+  +NS  H        S+ +ADE+S  GHNRTTSAPSTLSNSNFS A + DGNEVSS
Sbjct  421   SGE--INSTGH--------SMLAADEHSLVGHNRTTSAPSTLSNSNFSPAISGDGNEVSS  470

Query  1455  PT-TASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSS  1279
              +  A+T+AS +V SES  AA L+  RRE EFPS + TR R  +IWRRPSER   RIVSS
Sbjct  471   RSAVAATDASGDV-SESCPAAPLSVLRREPEFPSMLETRARNQSIWRRPSERF-PRIVSS  528

Query  1278  PTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISL  1099
              TVE RADL EV+EQVRKLV+DL S S+D +R ATAELRLLAKHNMDNRIVI++CGAI+L
Sbjct  529   ATVERRADLLEVEEQVRKLVQDLNSDSIDVKRDATAELRLLAKHNMDNRIVIASCGAINL  588

Query  1098  LVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAAT  919
             LVNLLHSEDM+VQENAVTALLNLSINDNNK +IANA AIEPLI+VL+TG+ EAKENSAAT
Sbjct  589   LVNLLHSEDMKVQENAVTALLNLSINDNNKCSIANADAIEPLIHVLQTGTAEAKENSAAT  648

Query  918   LFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGA  739
             LFSLSVIEDNK+KIGRSGA++ LVDLLGNG PRGKKDAATALFNLSILHENK RIVQAGA
Sbjct  649   LFSLSVIEDNKMKIGRSGAIKPLVDLLGNGAPRGKKDAATALFNLSILHENKARIVQAGA  708

Query  738   VRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAA  559
             V+ LVELMDPAAGMVDKAVAVLSNLATI EGR +IGQEGGI +LVEVVELGSARGKENAA
Sbjct  709   VKFLVELMDPAAGMVDKAVAVLSNLATIHEGRAAIGQEGGIAVLVEVVELGSARGKENAA  768

Query  558   AALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             AALLQLCTNSSR+CNMVLQ GAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  769   AALLQLCTNSSRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  827



>ref|XP_006341792.1| PREDICTED: U-box domain-containing protein 4-like [Solanum tuberosum]
Length=821

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/833 (73%), Positives = 694/833 (83%), Gaps = 13/833 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLKVLL+ IS FFHLSS E+I   LV +YY K ED+LK+L+PIL  IVD E AS E
Sbjct  1     MEISLLKVLLSKISQFFHLSSSESITDSLVQRYYCKAEDLLKILKPILEAIVDVEAASSE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +LQK F  L   VDELREL +TWQ L S VYFVLQAE LI ++R  SL+I+ELL +S  C
Sbjct  61    MLQKAFVRLAQFVDELRELCETWQTLGSNVYFVLQAEPLIVQIRTCSLEILELLKTSHQC  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP +++LTSLE+C+LKIK +DYEL+S TITK+IK  +EG GA+S S  K+ADCL LKSNQ
Sbjct  121   LPTDTTLTSLEHCILKIKYVDYELMSMTITKSIKAQMEGLGANSGSFAKLADCLRLKSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELLIELVALEKLKENAEQAEK EEVEYIEQIIALV+HMHDC I MKQS++CT V IP DF
Sbjct  181   ELLIELVALEKLKENAEQAEKTEEVEYIEQIIALVSHMHDCFITMKQSQTCTPVPIPPDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER +IR+WIDLGLTVCPKTRQ L HT LIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAYIRKWIDLGLTVCPKTRQMLGHTTLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP KSL++NQPSS +AH DSG PRD   F   R N+S SPDSA  L+SP
Sbjct  301   NWCESNNVKLPDPTKSLSLNQPSSFLAHADSGMPRDTQGFPLPRGNHSLSPDSARSLNSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
             +K  ISSS  QRE SSPSHP SS ++SLP +A + L LDVER+S++ SE+R+A+SG+  +
Sbjct  361   QKRLISSSMTQREGSSPSHPHSSLDDSLPGVASNMLALDVERISIKSSEERMAHSGE--I  418

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEV-SSPTTAS  1441
             NS  H  +        +A+E S  GHNRT+SAPSTLSNSNFS     DGNEV S    A+
Sbjct  419   NSHRHCML--------AANEYSLVGHNRTSSAPSTLSNSNFSPTIPGDGNEVFSRSAAAA  470

Query  1440  TEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETR  1261
             T+AS +V SES+ AA L+  +RE EFPS + TR+R  +IW RPSER   RIVSS TVE R
Sbjct  471   TDASGDV-SESQPAAPLSVLQREPEFPSMLETRVRNQSIWGRPSERF-PRIVSSATVERR  528

Query  1260  ADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLH  1081
             ADL E++EQVRKLV+DL S S+D QR ATAELRLLAKHNMDNR+V++NCG+I+LLVNLLH
Sbjct  529   ADLLELEEQVRKLVQDLSSNSIDVQRDATAELRLLAKHNMDNRVVMANCGSINLLVNLLH  588

Query  1080  SEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSV  901
             SEDM+VQENAVT LLNLSINDNNK +IANA AIEPLI+VL TGS EAKENSAATLFSLSV
Sbjct  589   SEDMKVQENAVTTLLNLSINDNNKCSIANADAIEPLIHVLRTGSGEAKENSAATLFSLSV  648

Query  900   IEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVE  721
             IEDNK+KIGRSGA++ LVDLLGNG+PRGKKDAATALFNLSILHENKGRIVQAGAV+ LVE
Sbjct  649   IEDNKMKIGRSGAIKPLVDLLGNGSPRGKKDAATALFNLSILHENKGRIVQAGAVKFLVE  708

Query  720   LMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQL  541
             LMDPAAGMVDKAVAVLSNLATI EGR +IGQEGGIP+LVEVVELGSARG+ENAAAALLQL
Sbjct  709   LMDPAAGMVDKAVAVLSNLATIHEGRAAIGQEGGIPVLVEVVELGSARGRENAAAALLQL  768

Query  540   CTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             CTNSSR+CNMVLQ GAVPPLVALSQSGTPRAREKAQ LLSYFRNQRHGNAGRG
Sbjct  769   CTNSSRFCNMVLQEGAVPPLVALSQSGTPRAREKAQGLLSYFRNQRHGNAGRG  821



>ref|XP_006361218.1| PREDICTED: U-box domain-containing protein 4-like [Solanum tuberosum]
Length=818

 Score =  1108 bits (2867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/832 (73%), Positives = 701/832 (84%), Gaps = 14/832 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI +LK+LLNNIS F HLSS ++++ ELV +YY K EDILKL++PIL  I D E AS E
Sbjct  1     MEISMLKMLLNNISCFCHLSSSDHMSGELVRRYYCKIEDILKLVKPILDSIADVEEASSE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL K F+GL   VDELRELF+TW+ L SK+YFVLQAE LI K+R  SL+I+ELL SS   
Sbjct  61    LLLKAFAGLAQHVDELRELFETWEPLCSKIYFVLQAEPLIGKIRTCSLEILELLKSSHKS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+ +LT+LE  +LKIK +DYEL+S TITK IK  VEG GASSD+  KIADCLSL SN+
Sbjct  121   LPADVTLTTLELYILKIKYVDYELISMTITKVIKAQVEGLGASSDNFAKIADCLSLNSNE  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELLIELVALEKLKENAEQAEK E+VEYIEQ+I LV+HMHDC + +KQS+SCT+V IP DF
Sbjct  181   ELLIELVALEKLKENAEQAEKTEDVEYIEQMITLVSHMHDCFVTVKQSQSCTTVPIPPDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIRRWIDLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIRRWIDLGLTVCPKTRQTLGHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE+N++KLPDP+ SL++NQPSS + H DSGA RD H+F  +R  +S SPDS   L SP
Sbjct  301   NWCEINDVKLPDPMISLSLNQPSSLITHADSGASRDNHVFPLTRDKHSLSPDSTQSLGSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
             RK+ ISSS  QREESSPSH RSSSE+SLP +AG+ L  DVER+ ++ SEDR+A+SG+ S 
Sbjct  361   RKTLISSSVSQREESSPSHLRSSSEDSLPGVAGNVLAFDVERIIMK-SEDRMAHSGEIS-  418

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTAST  1438
                SH       +S  + +E    GH+RTTSAPSTL+NSNFS     DGN++SS + A+ 
Sbjct  419   ---SHG------HSTLAVEEQLSSGHSRTTSAPSTLANSNFSPVIPGDGNKLSSQSEAAA  469

Query  1437  EASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRA  1258
              AS +V  +S+ AA++   RRE EFPS + TR R  AIWRRPS+R   RI+SSPTVE RA
Sbjct  470   VASGDVVVDSKPAASIP--RREPEFPSTLETRPRNQAIWRRPSDRF-PRIISSPTVERRA  526

Query  1257  DLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHS  1078
             DL+E++EQV+KLVEDLKSTS+D QR ATAELRLLAKHNMDNR+VI+NCG+ISLLVNLL+S
Sbjct  527   DLSELEEQVKKLVEDLKSTSIDMQRTATAELRLLAKHNMDNRMVIANCGSISLLVNLLYS  586

Query  1077  EDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVI  898
             EDM+VQE+AVTALLNLSINDNNK AIANA AIEPLI+VL+TGS EAKENSAATLFSLSV+
Sbjct  587   EDMKVQEDAVTALLNLSINDNNKCAIANADAIEPLIHVLQTGSDEAKENSAATLFSLSVM  646

Query  897   EDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVEL  718
             EDNK+KIGRSGA++ LVDLLGNGTPRGKKDAATALFNLSILHENK RI+QAGAV++LV+L
Sbjct  647   EDNKMKIGRSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKARIIQAGAVKYLVDL  706

Query  717   MDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLC  538
             MDPA GMVDKAVAVLSNLATI EGR  IGQEGGIP+LVEVVELGSARGKENAAAALLQLC
Sbjct  707   MDPATGMVDKAVAVLSNLATIPEGRAGIGQEGGIPLLVEVVELGSARGKENAAAALLQLC  766

Query  537   TNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             TNS+R+CN+VLQ GAVPPLVALSQSGTPRAREKAQALLS+FRNQRHGNAGRG
Sbjct  767   TNSNRFCNIVLQEGAVPPLVALSQSGTPRAREKAQALLSFFRNQRHGNAGRG  818



>ref|XP_010319902.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum]
 ref|XP_010319930.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum]
Length=818

 Score =  1106 bits (2860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/832 (73%), Positives = 695/832 (84%), Gaps = 14/832 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI +LK+LLNNIS F HLSS ++++ ELV +YY K EDILKL++PIL  IVD E AS E
Sbjct  1     MEISMLKMLLNNISCFCHLSSSDHMSGELVRRYYCKIEDILKLVKPILDSIVDVEEASSE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL K F+GL   VDELRELF+TW+ L SK+YFVLQAE LI K+R  SL+++ELL SS   
Sbjct  61    LLLKAFAGLAQHVDELRELFETWEPLCSKIYFVLQAEPLIGKIRTCSLEVLELLKSSHKS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+ +LT+LE  +LKIK +DYEL+  TITK IK  VEG GAS D+  KIADCLSL SN+
Sbjct  121   LPADVTLTTLELYILKIKYVDYELILMTITKVIKAQVEGLGASPDNFAKIADCLSLNSNE  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELLIELVALEKLKENAEQAEK E+VEYIEQ+I LV+HMHDC + +KQS+SCT+V IP DF
Sbjct  181   ELLIELVALEKLKENAEQAEKTEDVEYIEQMITLVSHMHDCFVTVKQSQSCTTVSIPPDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIRRWIDLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIRRWIDLGLTVCPKTRQTLGHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE+N++KLPDP+ SL++NQPSS + H DSGA RD H+F  +R  +S SPDS   L SP
Sbjct  301   NWCEINDVKLPDPMISLSLNQPSSLITHADSGASRDNHVFPLTRDKHSLSPDSTQSLGSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
             RK+ I SS  QREESSPSH RSSSE+SLP +AG+    DVER+ ++ SEDR+A+SG+ S 
Sbjct  361   RKTLILSSVNQREESSPSHLRSSSEDSLPGVAGNIHAFDVERIIMK-SEDRMAHSGEIS-  418

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTAST  1438
                SH       +S  + DE    GHNRTTSAPSTL+NSNFS     DGN++SS   A+ 
Sbjct  419   ---SHG------HSTLAVDEQLSSGHNRTTSAPSTLANSNFSPVIPSDGNKLSSQPEAAA  469

Query  1437  EASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRA  1258
              AS +V  +S+ AA++   RRE EFPS + TR R  AIWRRPSER   RI+SSPTVE RA
Sbjct  470   VASGDVVVDSKPAASIP--RREPEFPSTLETRPRNQAIWRRPSERF-PRIISSPTVEKRA  526

Query  1257  DLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHS  1078
             DL+E++EQV+KLVEDLKSTS+D QR ATAELRLLAKHNMDNR+VI+NCGAISLLVNLLHS
Sbjct  527   DLSELEEQVKKLVEDLKSTSIDMQRTATAELRLLAKHNMDNRMVIANCGAISLLVNLLHS  586

Query  1077  EDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVI  898
             EDM+VQE+AVTALLNLSINDNNK AIANA AIEPLI+VL+TGS EAKENSAATLFSLSV+
Sbjct  587   EDMKVQEDAVTALLNLSINDNNKCAIANADAIEPLIHVLQTGSDEAKENSAATLFSLSVM  646

Query  897   EDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVEL  718
             EDNKIKIGRSGA++ LVDLLGNGTPRGKKDAATALFNLSILHENK RI+QAGAV++LV+L
Sbjct  647   EDNKIKIGRSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKARIIQAGAVKYLVDL  706

Query  717   MDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLC  538
             MDPA GMVDKAVAVLSNLATI +GR  IGQEGGIP+LVEVVELGSARGKENAAAALLQLC
Sbjct  707   MDPATGMVDKAVAVLSNLATIPDGRAGIGQEGGIPLLVEVVELGSARGKENAAAALLQLC  766

Query  537   TNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             TNS+R+CN VLQ GAVPPLVALSQSGTPRAREKAQALLS+FRNQRHGN GRG
Sbjct  767   TNSNRFCNTVLQEGAVPPLVALSQSGTPRAREKAQALLSFFRNQRHGNTGRG  818



>emb|CDP02559.1| unnamed protein product [Coffea canephora]
Length=821

 Score =  1104 bits (2855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/833 (72%), Positives = 687/833 (82%), Gaps = 13/833 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLKVL+N+ISSFFHLS+ EN+N + V KYYQK E+ILKL++P+L  I+DAE+ SDE
Sbjct  1     MEIKLLKVLVNSISSFFHLSARENLNLQPVQKYYQKIEEILKLVKPVLDAIIDAEVTSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              LQK F+GLG++V++LRELF+ WQ L SK+YFVLQ ESLIAKV+   L+I ELL S D  
Sbjct  61    KLQKAFTGLGNAVEDLRELFENWQPLMSKIYFVLQVESLIAKVKTSGLEIFELLKSFDGF  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP+E S+ SLE C+ K+K +  E  +A IT+AIK+ VE SGASSDSL KIADCL LKSNQ
Sbjct  121   LPSELSVASLELCIQKLKHLGSEQTTAIITEAIKDQVEASGASSDSLAKIADCLRLKSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELLIE VALEKLKENAEQAEKN E EY++Q+IALVTHMHDCL++MKQS+SC+ V IPADF
Sbjct  181   ELLIEAVALEKLKENAEQAEKNGEAEYLDQMIALVTHMHDCLVLMKQSQSCSPVSIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIR+WIDLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIRKWIDLGLTVCPKTRQTLAHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP+KS+++NQP+  +AH +SG P+D H+  HSR+N S SPDS   L SP
Sbjct  301   NWCETNNVKLPDPLKSMSLNQPALLLAHTESGVPKDSHVQPHSRSNRSASPDSTRSLGSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
               S ISSS IQ+E S PSHP SSSE+SLP +AG+  GLD+E +    SEDRL NSGDRS 
Sbjct  361   IGSLISSSVIQQEGSPPSHPHSSSEDSLPGVAGNGHGLDIENVPRRSSEDRLVNSGDRS-  419

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPT-TAS  1441
                    +P S ++ + ADE S QGHNRT SA ST SNS        DGNE  S   T  
Sbjct  420   ---GQLYLPPSRDNSAGADEQSSQGHNRTQSASSTHSNSM-----PGDGNEAPSQGLTYG  471

Query  1440  TEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETR  1261
             ++ S EV S +   A+L   +RE EF S + TR R   IWRRPS+  V RIVSSP VETR
Sbjct  472   SDVSGEVTS-APQPASLITPQREPEFASRLETRSRSQTIWRRPSQNFVPRIVSSPAVETR  530

Query  1260  ADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLH  1081
             ADL+ V+ QVR LVEDL+ TS+D QR ATAELRLLA+HNMDNRIVI+NCGAISLLVNLLH
Sbjct  531   ADLSGVEAQVRTLVEDLRGTSLDVQRNATAELRLLARHNMDNRIVIANCGAISLLVNLLH  590

Query  1080  SEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSV  901
             S D ++QENAVTALLNLSINDNNK+AIANA AIEPLI+VL+TGSPEA+ENSAATLFSLSV
Sbjct  591   STDTKLQENAVTALLNLSINDNNKAAIANADAIEPLIHVLQTGSPEARENSAATLFSLSV  650

Query  900   IEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVE  721
             IE+NK++IGRSGA+Q LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQAGAV++LVE
Sbjct  651   IEENKVRIGRSGAIQPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVQAGAVKYLVE  710

Query  720   LMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQL  541
             LMDPAAGMVDKAVAVLSNLATI EGR +IGQEGGIP+LVEVVELGSARGKENAAAALLQL
Sbjct  711   LMDPAAGMVDKAVAVLSNLATIPEGRTAIGQEGGIPVLVEVVELGSARGKENAAAALLQL  770

Query  540   CTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             CT+S+R+CNMVLQ GAVPPLVALSQSGTPRAREKAQALLSYFR QR  NAGRG
Sbjct  771   CTSSNRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRTQR--NAGRG  821



>ref|XP_010314681.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum]
 ref|XP_010314682.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum]
Length=819

 Score =  1076 bits (2783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/832 (72%), Positives = 677/832 (81%), Gaps = 13/832 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLKVLL++IS FFHLSS ENI   LV +YY K ED+LK+L+PIL  IVD E AS E
Sbjct  1     MEISLLKVLLSSISQFFHLSSSENITDILVQRYYCKAEDLLKILKPILEAIVDVEAASSE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +LQK F+GL  SVDELREL +TWQ L S VYFVLQ E LI K R  SL+ +ELL +S  C
Sbjct  61    MLQKAFAGLAQSVDELRELCETWQPLGSNVYFVLQVEPLIVKTRTCSLEFLELLKTSHEC  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+++LTSLE+C+LKIK +DYEL+S TITK+IK  +EG GA+SDS  K+ADCL LKSNQ
Sbjct  121   LPADTTLTSLEHCILKIKYVDYELISMTITKSIKAQMEGLGANSDSFAKLADCLRLKSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELLIELVALEKLKENAEQAEK EEVEYIEQIIALV+HMHDC I MKQS++C  V IP DF
Sbjct  181   ELLIELVALEKLKENAEQAEKTEEVEYIEQIIALVSHMHDCFITMKQSQTCRPVTIPPDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVA+GQTYER FIR WIDLGLTVCPKTRQ L HT LIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVATGQTYERAFIREWIDLGLTVCPKTRQMLGHTTLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP KSL++NQ SS +AH  SG PRD       R N+S+S   +    S 
Sbjct  301   NWCESNNVKLPDPTKSLSLNQASSLLAHAYSGMPRDTQGIPLLRGNHSSS-PDSSRSLSS  359

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              +   SSS  QRE  SPSHP SS ++SLP +A + L LDV R+S++ SE+R+A+SG+  +
Sbjct  360   PRKICSSSMTQREGLSPSHPHSSLDDSLPRVASNMLALDVVRISIKTSEERMAHSGE--I  417

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTAST  1438
             NS  H  +        +A+++S  GHNRTTSAPSTLSNSNFS     DGNEV S + A+ 
Sbjct  418   NSHGHCML--------AANKHSLVGHNRTTSAPSTLSNSNFSPTIPGDGNEVFSMSAAAA  469

Query  1437  EASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRA  1258
               + +V SES+ AA L+  + E EFPS   TR+R  +IW RPSER   RIVSS TVE RA
Sbjct  470   TDACDV-SESQPAAPLSVLQGEPEFPSMPETRVRNQSIWLRPSERF-PRIVSSATVERRA  527

Query  1257  DLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHS  1078
             DL E++EQVRKLV+DL S S+D QR ATAELRLLAKHNMDNRIV++NCG+I+LLVNLLHS
Sbjct  528   DLLELEEQVRKLVQDLSSNSIDVQRDATAELRLLAKHNMDNRIVMANCGSINLLVNLLHS  587

Query  1077  EDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVI  898
             EDM VQENAVT LLNLSINDNNK  IANA AIEPLI+VL TGS EAKENSAATLFSLSVI
Sbjct  588   EDMNVQENAVTTLLNLSINDNNKCLIANADAIEPLIHVLHTGSGEAKENSAATLFSLSVI  647

Query  897   EDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVEL  718
             EDNK+KIGRSGA++ LVDLLGNG+PRGKKDAATALFNLSILHENKGRIVQAGAV+ LVEL
Sbjct  648   EDNKMKIGRSGAIKPLVDLLGNGSPRGKKDAATALFNLSILHENKGRIVQAGAVKFLVEL  707

Query  717   MDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLC  538
             MDPAAGMVDKAVAVLSNLATI EGR +IGQEGGIP+LVEVVELGSARG+ENAAAALLQLC
Sbjct  708   MDPAAGMVDKAVAVLSNLATIHEGRAAIGQEGGIPLLVEVVELGSARGRENAAAALLQLC  767

Query  537   TNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             TNSSR+CNMVLQ GAVPPLVALSQSGT RAREKAQ LLSYFRNQRHGNAGRG
Sbjct  768   TNSSRFCNMVLQEGAVPPLVALSQSGTARAREKAQGLLSYFRNQRHGNAGRG  819



>ref|XP_009797979.1| PREDICTED: U-box domain-containing protein 4-like [Nicotiana 
sylvestris]
 ref|XP_009797980.1| PREDICTED: U-box domain-containing protein 4-like [Nicotiana 
sylvestris]
 gb|AAO61490.1| arm repeat-containing protein [Nicotiana tabacum]
Length=790

 Score =  1054 bits (2725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/832 (72%), Positives = 674/832 (81%), Gaps = 42/832 (5%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLKVLLNNIS F HLSS ++I+ ELV +YY K EDILKL++PIL  IVD E AS E
Sbjct  1     MEISLLKVLLNNISCFSHLSSSDHISGELVRRYYCKIEDILKLVKPILDAIVDVEAASGE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL K F+GL   VDELRELF+T + L SKVYFVLQAE LI K+R+ SL+I+ELL SS   
Sbjct  61    LLLKAFAGLAQCVDELRELFETLEPLCSKVYFVLQAEPLIGKIRSCSLEILELLKSSHKS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+ +LT+LE  +LKIK +DYE++S TITK IK  VEG G SSDS  KIADCLSL SNQ
Sbjct  121   LPADVTLTTLELYILKIKYVDYEMISVTITKVIKAQVEGLGTSSDSFAKIADCLSLNSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELLIELVALEKLKENAEQAEK+E VEYIEQ+I LV+HMHDC +  KQS+SCT+V IP DF
Sbjct  181   ELLIELVALEKLKENAEQAEKSEVVEYIEQMITLVSHMHDCFVTTKQSQSCTAVPIPPDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIRRWIDLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIRRWIDLGLTVCPKTRQTLGHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE+NN+KLPDP+KSL++NQPS                          SPDS     SP
Sbjct  301   NWCEINNVKLPDPMKSLSLNQPS-------------------------LSPDSTQSSGSP  335

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
             RKS ISS+  QREESSPSHPRSSSEESLP + G+ L  DVERM ++ SEDR+A+SG+ S 
Sbjct  336   RKSLISSTVSQREESSPSHPRSSSEESLPGVGGNILAFDVERMRIK-SEDRMAHSGEIS-  393

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTAST  1438
                SH       +S   AD+    GHNRTTSAPSTLSNSNFS     DGN++S  ++   
Sbjct  394   ---SHG------HSTLVADDQFPLGHNRTTSAPSTLSNSNFSPVIPGDGNKLSEDSSV--  442

Query  1437  EASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRA  1258
              AS +V  +S+ AA++    +E EFP     R R   IWRRP+ER   RIVSS TVE RA
Sbjct  443   -ASGDVGLDSKPAASVLP--KEPEFPYTPEMRPRNQLIWRRPTERF-PRIVSSATVERRA  498

Query  1257  DLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHS  1078
             DL+EV+EQV+KL+E+LKSTS+D QR ATAELRLLAKHNMDNR+VI+NCGAIS LVNLLHS
Sbjct  499   DLSEVEEQVKKLIEELKSTSLDMQRNATAELRLLAKHNMDNRMVIANCGAISSLVNLLHS  558

Query  1077  EDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVI  898
             +DM+VQE+AVTALLNLSINDNNK AIANA AIEPLI+VL+TGS EAKENSAATLFSLSV+
Sbjct  559   KDMKVQEDAVTALLNLSINDNNKCAIANADAIEPLIHVLQTGSAEAKENSAATLFSLSVM  618

Query  897   EDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVEL  718
             E+NK+KIGRSGA++ LVDLLGNGTPRGKKDAATALFNLSILHENK RI+QAGAV++LVEL
Sbjct  619   EENKMKIGRSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKSRIIQAGAVKYLVEL  678

Query  717   MDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLC  538
             MDPA GMVDKAVAVLSNLATI EGR  IGQEGGIP+LVEVVELGSARGKENAAAALLQLC
Sbjct  679   MDPATGMVDKAVAVLSNLATIPEGRAEIGQEGGIPLLVEVVELGSARGKENAAAALLQLC  738

Query  537   TNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             TNSSR+CNMVLQ GAVPPLVALSQSGTPRAREKAQ LLSYFRNQRHGNAGRG
Sbjct  739   TNSSRFCNMVLQEGAVPPLVALSQSGTPRAREKAQQLLSYFRNQRHGNAGRG  790



>ref|XP_006466517.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Citrus sinensis]
 ref|XP_006466518.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Citrus sinensis]
 ref|XP_006466519.1| PREDICTED: U-box domain-containing protein 4-like isoform X3 
[Citrus sinensis]
 ref|XP_006466520.1| PREDICTED: U-box domain-containing protein 4-like isoform X4 
[Citrus sinensis]
Length=834

 Score =  1053 bits (2724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/838 (67%), Positives = 660/838 (79%), Gaps = 12/838 (1%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             GGMEI LLKVLL  ISSF HLSS ++I  ++V KYYQ+ E+ILKLL+PIL  IVD+++AS
Sbjct  5     GGMEISLLKVLLKKISSFLHLSSFDSIKLDIVKKYYQRAEEILKLLKPILDAIVDSDVAS  64

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             DE+L K F   G S+DEL+EL + WQ L S+VYFVLQ ESL++K+R   L I+  L SS 
Sbjct  65    DEVLYKAFEEFGQSIDELKELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSL  124

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
                P E S TSLE C  KIK M+YE  S+ I +AI++ V+G   SS+ L K+A+ LSL+S
Sbjct  125   QYFPGELSSTSLELCSQKIKHMEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAESLSLRS  184

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQE+LIE VALEKLKENAEQAEK  E E+++Q+I+LVT MHD L+M+KQS+ C+ V IP+
Sbjct  185   NQEILIEAVALEKLKENAEQAEKAGEAEFMDQMISLVTRMHDRLVMIKQSQICSPVPIPS  244

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELMTDPVIVASGQTYER FI++WIDLGL VCPKTRQTL HT LIPNYTVKAL
Sbjct  245   DFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKAL  304

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLD  1804
             IANWCE+NN+KLPDP K+ ++NQPS    H DS APRD HIF H+R N    P+S    +
Sbjct  305   IANWCELNNVKLPDPTKTASLNQPSPLFVHADSNAPRDSHIFPHTRGNQQIMPESTRSTN  364

Query  1803  sprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDR  1624
             SP K+ +S +  +   S      +S       IAG+  GLD+ R+SL  SEDR +NS +R
Sbjct  365   SPAKNLVSLNNTREGSSPLHPHSTSETSYSG-IAGNGPGLDIARISLTSSEDRFSNSEER  423

Query  1623  SMNSVSHFSMPLSMNSVSSADENSHQG---HNRTTSAPSTLSNSNFSRANAHDGNEVSSP  1453
             SM  V   SM  S+    +  + S Q    HNRT SA S LSN N S+ +A++ +EVS+ 
Sbjct  424   SMELVGQPSMSKSIKEFPATIDTSEQSSHIHNRTASASSVLSNLNLSQGDANETSEVSNH  483

Query  1452  TTASTEASMEVASESRHAATLAASRRESEFPSPV-GTRLRPPAIWRRPSERLVSRIVSSP  1276
             + AS E  +E    S+ A T+   RRE EFPS V  TR R   IWRRPSER V RIVS+ 
Sbjct  484   SDASGEGKLE----SQPATTM---RREPEFPSRVMETRSRSQVIWRRPSERFVPRIVSTS  536

Query  1275  TVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLL  1096
               ETRADL+ ++ QVRKLVEDLKSTS+D QR ATAELRLLAKHNMDNR+VI+NCGAI++L
Sbjct  537   GAETRADLSGIETQVRKLVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINIL  596

Query  1095  VNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATL  916
             V++LHS + ++QENAVTALLNLSINDNNKSAIANA AIEPLI+VL+TGSPEA+EN+AATL
Sbjct  597   VDMLHSSETKIQENAVTALLNLSINDNNKSAIANANAIEPLIHVLQTGSPEARENAAATL  656

Query  915   FSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAV  736
             FSLSVIEDNKIKIGRSGA+  LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQAGAV
Sbjct  657   FSLSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAV  716

Query  735   RHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAA  556
             +HLV+LMDPAAGMVDKAVAVL+NLATI +GR++IGQE GIP+LVEVVELGSARGKENAAA
Sbjct  717   KHLVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAA  776

Query  555   ALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             ALLQLCTNSSR+C+MVLQ GAVPPLVALSQSGTPRA+EKAQALLSYFRNQRHGNAGRG
Sbjct  777   ALLQLCTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGRG  834



>ref|XP_009610326.1| PREDICTED: U-box domain-containing protein 4-like [Nicotiana 
tomentosiformis]
 ref|XP_009610327.1| PREDICTED: U-box domain-containing protein 4-like [Nicotiana 
tomentosiformis]
Length=790

 Score =  1052 bits (2720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 601/832 (72%), Positives = 672/832 (81%), Gaps = 42/832 (5%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLKVLLNNI+ F HLSS ++I+ ELV KYY K EDILKL++PIL  IVD E AS E
Sbjct  1     MEISLLKVLLNNITCFSHLSSSDHISGELVRKYYCKIEDILKLVKPILDAIVDVEAASGE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL K F+GL   VDELRELF+TW+ L SKVYFVLQAE LI K+R+ SL+I+ELL SS   
Sbjct  61    LLLKAFAGLAQCVDELRELFETWEPLCSKVYFVLQAEPLIGKIRSCSLEILELLKSSHKS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+ +LT+LE  +LKIK +DYE++S TITK IK  VEG G SSDS  K+ADCLSL SNQ
Sbjct  121   LPADVTLTTLELYILKIKYVDYEMISMTITKVIKAQVEGLGTSSDSFAKVADCLSLNSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
              LLIELVALEKLKENAEQAEK+EEVEYIEQ+I LV+H+HDC +  KQS+SCT+V IP DF
Sbjct  181   GLLIELVALEKLKENAEQAEKSEEVEYIEQMITLVSHVHDCFVTTKQSQSCTAVPIPPDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIRRWIDLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIRRWIDLGLTVCPKTRQTLGHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE+NN+KLPDPIKSL++N PS                          SPDS   L SP
Sbjct  301   NWCEINNVKLPDPIKSLSLNHPS-------------------------LSPDSTQSLGSP  335

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
             RKS ISSS  QREESSPS PRSSSEESLP + G+ L  DVER+ ++ SEDR+A+SG+ S 
Sbjct  336   RKSLISSSVNQREESSPSDPRSSSEESLPGVHGNVLAFDVERIHIK-SEDRMAHSGEIS-  393

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTAST  1438
                SH       +S   ADE    GHNRTTSAPSTLSNSNFS     DGN+VS  T    
Sbjct  394   ---SHG------HSTLVADEQFPLGHNRTTSAPSTLSNSNFSPVIPGDGNKVSEDTAV--  442

Query  1437  EASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRA  1258
              AS +V  +S+ AA++    +E EFPS    R R   IWRRP+ER   RIVSS TVE RA
Sbjct  443   -ASGDVGLDSKPAASVLP--KEPEFPSTPEMRPRNQLIWRRPTERF-PRIVSSATVERRA  498

Query  1257  DLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHS  1078
             DL+EV+EQV+KL+E+LKSTS+D QR ATAELRLLAKHNMDNR+VI+NCGAIS LVNLLHS
Sbjct  499   DLSEVEEQVKKLIEELKSTSLDMQRNATAELRLLAKHNMDNRMVIANCGAISSLVNLLHS  558

Query  1077  EDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVI  898
              DM+VQE+AVTALLNLSINDNNK AIANA AIEPLI+VL+TGS EAKENSAATLFSLSV+
Sbjct  559   NDMKVQEDAVTALLNLSINDNNKCAIANADAIEPLIHVLQTGSAEAKENSAATLFSLSVM  618

Query  897   EDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVEL  718
             E+NK+KIGRSGA++ LVDLLGNGTPRGKKDAATALFNLSILHENK RI+QAGAV++LVEL
Sbjct  619   EENKMKIGRSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKSRIIQAGAVKYLVEL  678

Query  717   MDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLC  538
             MDPA GMVDKAVAVLSNLATI EGR  IGQEGGIP+LVEVVELGSARGKENAAAALLQLC
Sbjct  679   MDPAIGMVDKAVAVLSNLATIPEGRAEIGQEGGIPLLVEVVELGSARGKENAAAALLQLC  738

Query  537   TNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             TNSSR+CNMVLQ GAVPPLVALS SGTPRAREKAQ LLSYFRNQRHGNAGRG
Sbjct  739   TNSSRFCNMVLQEGAVPPLVALSLSGTPRAREKAQQLLSYFRNQRHGNAGRG  790



>ref|XP_011082322.1| PREDICTED: U-box domain-containing protein 4-like [Sesamum indicum]
Length=822

 Score =  1048 bits (2711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/833 (69%), Positives = 662/833 (79%), Gaps = 12/833 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LLN+I+SF  LSS E I SE + KYYQK E IL+LL+PIL  IV AEIASDE
Sbjct  1     MEISLLKSLLNSITSFLQLSSFEGIKSEPLQKYYQKIEQILRLLKPILDAIVGAEIASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +LQ+ F+GL  SV ELRE+ +TWQ L SK+Y VLQ ESL++K R    +I+ELL SSD  
Sbjct  61    MLQRGFAGLLQSVVELREICETWQPLMSKIYLVLQVESLVSKTRTHGFEILELLKSSDHS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPAE S  SLE+CV KIK ++ E +S  I KAIK+H EG GA+ DS +++AD L+LKSNQ
Sbjct  121   LPAELSAASLEHCVQKIKRVESEQMSVIIGKAIKDHAEGCGATLDSFSEVADSLALKSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELLIE VAL+KLKENAEQA+K  EVEYI+Q+I LVTHMHD L+MMKQS++C  V IPADF
Sbjct  181   ELLIEAVALDKLKENAEQADKIAEVEYIDQMITLVTHMHDLLVMMKQSDTCNPVPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELM DPVIVASGQTYER FIR+W+DLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMADPVIVASGQTYERAFIRKWLDLGLTVCPKTRQTLAHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP  S+N+NQPSS +++  S   R        R NNS +PD        
Sbjct  301   NWCESNNVKLPDPTISINLNQPSSLLSNAGSVGVR--------RVNNSDAPDRPLA---S  349

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
             + +S   S   + +   SHPRS SE+SL + A +  G D ER+SL  S D   +SG+RS+
Sbjct  350   QVNSSIPSIAIQRDRISSHPRSLSEDSLTDAAVNGTGFDAERVSLGSSGDMSDHSGERSL  409

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTA-S  1441
             NS   F M  S N  + ADE S Q HNRT SA STLSNSN S+  A DG+EV+S  +A  
Sbjct  410   NSGGTFLMSPSRNGGAGADEMSSQVHNRTNSASSTLSNSNISQGTAADGSEVASHASAYG  469

Query  1440  TEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETR  1261
             +EAS E+A+E   AA L+A +RE +F S + TR R  AIWRRPSERL+ RIVSS TVE R
Sbjct  470   SEASGELAAEREPAANLSAPQREPDFLSRLETRSRGQAIWRRPSERLIPRIVSSSTVEMR  529

Query  1260  ADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLH  1081
             ADL EV+ QV++LVEDLKS S+D QR ATAE+RLLAKHN DNRI I+NCGAISLLVNLL 
Sbjct  530   ADLLEVEIQVKRLVEDLKSGSLDSQRNATAEIRLLAKHNSDNRIAIANCGAISLLVNLLR  589

Query  1080  SEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSV  901
             S+D+ VQENAVTALLNLSINDNNKSAIANA AIEPLI+VLETGSPEAKENSAATLFSLSV
Sbjct  590   SKDLTVQENAVTALLNLSINDNNKSAIANANAIEPLIHVLETGSPEAKENSAATLFSLSV  649

Query  900   IEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVE  721
             IED KIKIGRSGA++ LVDLLGNGTPRGK+DA+TALFNLSI HENK RIVQAGAV++LVE
Sbjct  650   IEDLKIKIGRSGAIKPLVDLLGNGTPRGKRDASTALFNLSIHHENKPRIVQAGAVKYLVE  709

Query  720   LMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQL  541
             LMDPA GMVDKAVAV+SNLATIQEGR +IGQEGGIP LVEVVELGSARGKENAAAALL L
Sbjct  710   LMDPAFGMVDKAVAVISNLATIQEGRAAIGQEGGIPFLVEVVELGSARGKENAAAALLHL  769

Query  540   CTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             C NS+R+C+MVLQ GA+PPL ALSQ+GTPRAREKAQ LLS+FRNQRHGNA RG
Sbjct  770   CVNSNRFCHMVLQEGAIPPLAALSQTGTPRAREKAQQLLSFFRNQRHGNAARG  822



>gb|KDO79024.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79025.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79026.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79027.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79028.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79029.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79030.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79031.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
Length=828

 Score =  1048 bits (2710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/836 (67%), Positives = 658/836 (79%), Gaps = 12/836 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLKVLL  ISSF HLSS ++I  ++V KYYQ+ EDILKLL+PIL  IVD+++ASDE
Sbjct  1     MEISLLKVLLKKISSFLHLSSFDSIKLDIVKKYYQRAEDILKLLKPILDAIVDSDLASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F   G S+DELREL + WQ L S+VYFVLQ ESL++K+R   L I+  L SS   
Sbjct  61    VLYKAFEEFGQSIDELRELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQY  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P E S TSLE C  KIK M+YE  S+ I +AI++ V+G   SS+ L K+A+ LSL+SNQ
Sbjct  121   FPGELSSTSLELCSQKIKHMEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAESLSLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQAEK  E E+++Q+I+LVT MHD L+M+KQS+ C+ V IP+DF
Sbjct  181   EILIEAVALEKLKENAEQAEKAGEAEFMDQMISLVTRMHDRLVMIKQSQICSPVPIPSDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI++WIDLGL VCPKTRQTL HT LIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE+NN+KLPDP K+ ++NQPS    H DS APRD HIF H+R N    P+S    +SP
Sbjct  301   NWCELNNVKLPDPTKTASLNQPSPLFVHADSNAPRDSHIFPHTRGNQQIMPESTRSTNSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K+ +S +  +   S      +S       IAG+  GLD+ R+SL  SEDR +NS +RSM
Sbjct  361   AKNLVSLNNTREGSSPLHPHSTSETSYSG-IAGNGPGLDIARISLTSSEDRFSNSEERSM  419

Query  1617  NSVSHFSMPLSMNSVSSADENSHQG---HNRTTSAPSTLSNSNFSRANAHDGNEVSSPTT  1447
               V   SM  S+    +  + S Q    HNRT SA S LSN N S+ +A++ +E+S+ + 
Sbjct  420   ELVGQPSMSKSIKEFPATIDTSEQSSHIHNRTASASSVLSNLNLSQGDANETSELSNHSD  479

Query  1446  ASTEASMEVASESRHAATLAASRRESEFPSPV-GTRLRPPAIWRRPSERLVSRIVSSPTV  1270
             AS E  +E    S+ A T+   RRE EFPS V  TR R   IWRRPSER V RIVS+   
Sbjct  480   ASGEGKLE----SQPATTM---RREPEFPSRVMETRSRSQVIWRRPSERFVPRIVSTSGA  532

Query  1269  ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVN  1090
             ETRADL+ ++ QVRKLVEDLKSTS+D QR ATAELRLLAKHNMDNR+VI+NCGAI++LV+
Sbjct  533   ETRADLSGIETQVRKLVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVD  592

Query  1089  LLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFS  910
             +LHS + ++QENAVTALLNLSINDNNKSAIANA AIEPLI+VL+TGSPEA+EN+AATLFS
Sbjct  593   MLHSSETKIQENAVTALLNLSINDNNKSAIANANAIEPLIHVLQTGSPEARENAAATLFS  652

Query  909   LSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRH  730
             LSVIEDNKIKIGRSGA+  LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQAGAV+H
Sbjct  653   LSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKH  712

Query  729   LVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAAL  550
             LV+LMDPAAGMVDKAVAVL+NLATI +GR++IGQE GIP+LVEVVELGSARGKENAAAAL
Sbjct  713   LVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAAL  772

Query  549   LQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             LQLCTNSSR+C+MVLQ GAVPPLVALSQSGTPRA+EKAQALLSYFRNQRHGNAGRG
Sbjct  773   LQLCTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGRG  828



>ref|XP_006426022.1| hypothetical protein CICLE_v10024899mg [Citrus clementina]
 ref|XP_006426023.1| hypothetical protein CICLE_v10024899mg [Citrus clementina]
 ref|XP_006426024.1| hypothetical protein CICLE_v10024899mg [Citrus clementina]
 gb|ESR39262.1| hypothetical protein CICLE_v10024899mg [Citrus clementina]
 gb|ESR39263.1| hypothetical protein CICLE_v10024899mg [Citrus clementina]
 gb|ESR39264.1| hypothetical protein CICLE_v10024899mg [Citrus clementina]
Length=828

 Score =  1047 bits (2708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/836 (67%), Positives = 661/836 (79%), Gaps = 12/836 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLKVLL  ISSF HLSS ++I  ++V KYYQ+ EDILKLL+PIL  IVD+++ASDE
Sbjct  1     MEISLLKVLLKKISSFLHLSSFDSIKLDIVKKYYQRAEDILKLLKPILDAIVDSDLASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F   G S+DELREL + WQ L S+VYFVLQ ESL++K+R   L I+  L SS   
Sbjct  61    VLYKAFEEFGQSIDELRELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQY  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S TSLE C  KIK M+YE  S+ I +AI++ V+G   SS+ L K+A+ LSL+SNQ
Sbjct  121   LPGELSSTSLELCSQKIKHMEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAESLSLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQAEK  E E+++Q+I+LVT MHD L+M+KQS+ C+ V IP+DF
Sbjct  181   EILIEAVALEKLKENAEQAEKAGEAEFMDQMISLVTRMHDRLVMIKQSQICSPVPIPSDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI++WIDLGL VCPKTRQTL HT LIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE+NN+KLPDP K++++NQPS    H DS APRD HIF H+R +    P+S    +SP
Sbjct  301   NWCELNNVKLPDPTKTVSLNQPSPLFVHADSNAPRDSHIFPHTRGSQQIMPESTRSTNSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K+ +SS+  +   S      +S       IAG+  GLD  R+SL  SEDR +NS +RSM
Sbjct  361   AKNLVSSNNTREGGSPLHPHSTSETSYSG-IAGNGPGLDTARISLTSSEDRFSNSEERSM  419

Query  1617  NSVSHFSMPLSMNSVSSADENSHQG---HNRTTSAPSTLSNSNFSRANAHDGNEVSSPTT  1447
               +   SM  S+    +  + S Q    HNRT SA S LSN N S+ +A++ +E+S+ + 
Sbjct  420   ELIGQPSMSKSIKEFPATIDTSEQSSHIHNRTASASSVLSNLNLSQGDANETSELSNHSD  479

Query  1446  ASTEASMEVASESRHAATLAASRRESEFPSPV-GTRLRPPAIWRRPSERLVSRIVSSPTV  1270
             AS E  +E    S+ A T+   RRE EFPS V  TR R   IWRRPSER V RIVS+   
Sbjct  480   ASGEGKLE----SQPATTM---RREPEFPSRVMETRSRSQVIWRRPSERFVPRIVSTSGA  532

Query  1269  ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVN  1090
             ETRADL+ ++ QVRKLVEDLKSTS+D QR ATAELRLLAKHNMDNR+VI+NCGAI++LV+
Sbjct  533   ETRADLSGIETQVRKLVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVD  592

Query  1089  LLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFS  910
             LLHS ++++QENAVTALLNLSINDNNKSAIANA AIEPLI+VL+TGSPEA+EN+AATLFS
Sbjct  593   LLHSSEIKIQENAVTALLNLSINDNNKSAIANANAIEPLIHVLQTGSPEARENAAATLFS  652

Query  909   LSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRH  730
             LSVIEDNKIKIGRSGA+  LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQAGAV+H
Sbjct  653   LSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKH  712

Query  729   LVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAAL  550
             LV+LMDPAAGMVDKAVAVL+NLATI +GR++IGQE GIP+LVEVVELGSARGKENAAAAL
Sbjct  713   LVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAAL  772

Query  549   LQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             LQLCTNSSR+C+MVLQ GAVPPLVALSQSGTPRA+EKAQALLSYFRNQRHGNAGRG
Sbjct  773   LQLCTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGRG  828



>ref|XP_006466521.1| PREDICTED: U-box domain-containing protein 4-like isoform X5 
[Citrus sinensis]
 ref|XP_006466522.1| PREDICTED: U-box domain-containing protein 4-like isoform X6 
[Citrus sinensis]
Length=828

 Score =  1046 bits (2705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/836 (67%), Positives = 658/836 (79%), Gaps = 12/836 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLKVLL  ISSF HLSS ++I  ++V KYYQ+ E+ILKLL+PIL  IVD+++ASDE
Sbjct  1     MEISLLKVLLKKISSFLHLSSFDSIKLDIVKKYYQRAEEILKLLKPILDAIVDSDVASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F   G S+DEL+EL + WQ L S+VYFVLQ ESL++K+R   L I+  L SS   
Sbjct  61    VLYKAFEEFGQSIDELKELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQY  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P E S TSLE C  KIK M+YE  S+ I +AI++ V+G   SS+ L K+A+ LSL+SNQ
Sbjct  121   FPGELSSTSLELCSQKIKHMEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAESLSLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQAEK  E E+++Q+I+LVT MHD L+M+KQS+ C+ V IP+DF
Sbjct  181   EILIEAVALEKLKENAEQAEKAGEAEFMDQMISLVTRMHDRLVMIKQSQICSPVPIPSDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI++WIDLGL VCPKTRQTL HT LIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE+NN+KLPDP K+ ++NQPS    H DS APRD HIF H+R N    P+S    +SP
Sbjct  301   NWCELNNVKLPDPTKTASLNQPSPLFVHADSNAPRDSHIFPHTRGNQQIMPESTRSTNSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K+ +S +  +   S      +S       IAG+  GLD+ R+SL  SEDR +NS +RSM
Sbjct  361   AKNLVSLNNTREGSSPLHPHSTSETSYSG-IAGNGPGLDIARISLTSSEDRFSNSEERSM  419

Query  1617  NSVSHFSMPLSMNSVSSADENSHQG---HNRTTSAPSTLSNSNFSRANAHDGNEVSSPTT  1447
               V   SM  S+    +  + S Q    HNRT SA S LSN N S+ +A++ +EVS+ + 
Sbjct  420   ELVGQPSMSKSIKEFPATIDTSEQSSHIHNRTASASSVLSNLNLSQGDANETSEVSNHSD  479

Query  1446  ASTEASMEVASESRHAATLAASRRESEFPSPV-GTRLRPPAIWRRPSERLVSRIVSSPTV  1270
             AS E  +E    S+ A T+   RRE EFPS V  TR R   IWRRPSER V RIVS+   
Sbjct  480   ASGEGKLE----SQPATTM---RREPEFPSRVMETRSRSQVIWRRPSERFVPRIVSTSGA  532

Query  1269  ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVN  1090
             ETRADL+ ++ QVRKLVEDLKSTS+D QR ATAELRLLAKHNMDNR+VI+NCGAI++LV+
Sbjct  533   ETRADLSGIETQVRKLVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVD  592

Query  1089  LLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFS  910
             +LHS + ++QENAVTALLNLSINDNNKSAIANA AIEPLI+VL+TGSPEA+EN+AATLFS
Sbjct  593   MLHSSETKIQENAVTALLNLSINDNNKSAIANANAIEPLIHVLQTGSPEARENAAATLFS  652

Query  909   LSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRH  730
             LSVIEDNKIKIGRSGA+  LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQAGAV+H
Sbjct  653   LSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKH  712

Query  729   LVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAAL  550
             LV+LMDPAAGMVDKAVAVL+NLATI +GR++IGQE GIP+LVEVVELGSARGKENAAAAL
Sbjct  713   LVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAAL  772

Query  549   LQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             LQLCTNSSR+C+MVLQ GAVPPLVALSQSGTPRA+EKAQALLSYFRNQRHGNAGRG
Sbjct  773   LQLCTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGRG  828



>ref|XP_007047436.1| RING/U-box superfamily protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 ref|XP_007047437.1| ATP synthase alpha/beta family protein isoform 1 [Theobroma cacao]
 ref|XP_007047438.1| RING/U-box superfamily protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 ref|XP_007047439.1| RING/U-box superfamily protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 gb|EOX91593.1| RING/U-box superfamily protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 gb|EOX91594.1| ATP synthase alpha/beta family protein isoform 1 [Theobroma cacao]
 gb|EOX91595.1| RING/U-box superfamily protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 gb|EOX91596.1| RING/U-box superfamily protein with ARM repeat domain isoform 
1 [Theobroma cacao]
Length=834

 Score =  1040 bits (2690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/837 (68%), Positives = 670/837 (80%), Gaps = 8/837 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LL+NISSF +LSS ENINSE V KYYQ+ E++LKLL+PIL+ IVD+EI SDE
Sbjct  1     MEISLLKALLSNISSFLNLSSSENINSEPVQKYYQRAEEVLKLLKPILNAIVDSEITSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F GLG SV+ELRE F++WQ L SKVYFVLQ ESLI+ +R  SL I + L SS   
Sbjct  61    VLSKAFEGLGLSVEELREQFESWQPLLSKVYFVLQVESLISNIRNSSLDIFQFLKSSHQQ  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S  SLE+C+ KIK + YE  S+ I +AI++ V+  G SS+ L KIA+ LSL SNQ
Sbjct  121   LPDELSSASLEHCLQKIKHVGYEQTSSVIREAIRDQVDSVGPSSEMLVKIAESLSLSSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQAEK  E E+I+Q+IALVT MHD L+++KQS+SC+ V I ADF
Sbjct  181   EILIEAVALEKLKENAEQAEKTTEAEFIDQMIALVTRMHDRLVLIKQSQSCSPVPIAADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI++WIDLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLTVCPKTRQTLAHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP+KS+++NQPS  + H +SG PRD + F HSR++   SP+S     S 
Sbjct  301   NWCESNNVKLPDPVKSMSLNQPSPLLVHAESGLPRDSNSFPHSRSSQPVSPES-RPTGSS  359

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K+ I SS + +E +SP HP S+SE SLP +AG+   LDV R++L  +EDR +N    + 
Sbjct  360   GKNLIISSGLHQEGTSPLHPCSTSEGSLPGVAGNGECLDVARITLNSAEDR-SNLEQENR  418

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTA--  1444
             +SV   SM  S     SA ++S Q H R+ SA STLSNS+F R    D NE S  +T   
Sbjct  419   DSVGQPSMSPSSIEFHSAGQSS-QNHTRSDSASSTLSNSDFPRGVVGDANETSEGSTQLA  477

Query  1443  --STEASMEVASESRHAATLAASRRESEFPSPV-GTRLRPPAIWRRPSERLVSRIVSSPT  1273
               S++ S EV S+++ AA+ A  +RE EFP  +   R R   IWRRPSER + RIVSSP 
Sbjct  478   AYSSDGSGEVKSDTQPAASSAIPQREPEFPPRLMDARSRSQTIWRRPSERFIPRIVSSPG  537

Query  1272  VETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLV  1093
             +E RADL+ ++ QV+KLVEDLK+TSVD QR AT+ELRLLAKHNMDNR++I+NCGAISLLV
Sbjct  538   IENRADLSGIETQVKKLVEDLKNTSVDTQRDATSELRLLAKHNMDNRVIIANCGAISLLV  597

Query  1092  NLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLF  913
             +LLHS D + QENAVTALLNLSINDNNKSAIANA AI+PLI+VLETGSPEAKENSAATLF
Sbjct  598   DLLHSPDTKTQENAVTALLNLSINDNNKSAIANADAIKPLIHVLETGSPEAKENSAATLF  657

Query  912   SLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVR  733
             SLSVIEDNK+KIGRSGA++ LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQAGAVR
Sbjct  658   SLSVIEDNKVKIGRSGAIRPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVQAGAVR  717

Query  732   HLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAA  553
             HLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQE GIP+LVEVVELGSARGKENAAAA
Sbjct  718   HLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGQENGIPVLVEVVELGSARGKENAAAA  777

Query  552   LLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             LLQLCT + ++C+ VLQ GAVPPLVALSQSGTPRA+EKAQALLSYFR QRHGNAGRG
Sbjct  778   LLQLCTTNGKFCSKVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRTQRHGNAGRG  834



>gb|EYU23288.1| hypothetical protein MIMGU_mgv1a001434mg [Erythranthe guttata]
Length=820

 Score =  1033 bits (2670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/846 (67%), Positives = 655/846 (77%), Gaps = 40/846 (5%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LLN++S FF LSS E + SE V KY+ K E+ILKLL+P L  I+DA+I SDE
Sbjct  1     MEISLLKSLLNSVSCFFQLSSCEGMKSEPVQKYHAKIEEILKLLKPTLDAILDADIVSDE  60

Query  2697  LLQKV-FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             + Q+V F GL  SVDELR++++ WQ L SKVYFVLQ ESL++K++   L+I+ELL S D 
Sbjct  61    MRQRVLFEGLLQSVDELRDIYENWQPLMSKVYFVLQVESLMSKIKTHGLEILELLKSYDQ  120

Query  2520  CLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSN  2341
              +PAE S  SLE  V KIK +  E  S+ IT AIK+HVEGSGASS+SL K+AD L L SN
Sbjct  121   GIPAELSAASLELRVQKIKHVGSESTSSIITDAIKDHVEGSGASSESLAKVADSLGLNSN  180

Query  2340  QELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPAD  2161
             QELLIE VALEKLKENAEQAE   EVEYI+QIIALVTHMHD L+M+KQS++C  V IPAD
Sbjct  181   QELLIEAVALEKLKENAEQAENTGEVEYIDQIIALVTHMHDLLVMLKQSQTCNPVSIPAD  240

Query  2160  FCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALI  1981
             FCCPLSLELMTDPVIVASGQTYER FIR WIDLGLTVCPKTRQTL H+NLIPNYTVKALI
Sbjct  241   FCCPLSLELMTDPVIVASGQTYERVFIRNWIDLGLTVCPKTRQTLAHSNLIPNYTVKALI  300

Query  1980  ANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDs  1801
             A+WC+ NN+KLPDP KS+++NQPSS +A+ + G  R        R NNS +PD + G   
Sbjct  301   ASWCQSNNVKLPDPTKSIHLNQPSSLLANAEPGVVR--------RVNNSGTPDRSLG---  349

Query  1800  prkssisssaiqreesspshprssseeslpEIAGDDLG--------LDVERMSLEGSEDR  1645
                      +     S       +S      ++ D L         LD ER+S   S+DR
Sbjct  350   ---------SAGSVPSIAVKRDRTSPSPPHSLSEDSLAEATVNGHVLDAERVSPRSSDDR  400

Query  1644  LANSGDRSMNSVSHFSMPLSMNSVS----SADENSHQGHNRTTSAPSTLSNSNFSRANAH  1477
               +SG+RS+N        L++NS S    +  ++S QGHNRT SA ST+SNSN S+  A 
Sbjct  401   SDHSGERSLNLGG-----LTLNSPSRNGGAGVDDSSQGHNRTNSASSTVSNSNMSQGTAA  455

Query  1476  DGNEVSSPTTAS-TEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERL  1300
             DGNEV+S  +A  ++ S E+A+E R AATL    RE  FPS + TR R  A+WRRPS+R 
Sbjct  456   DGNEVASHASAYVSDTSGELATEPRSAATLNPPTREHSFPSRLETRPRG-AMWRRPSDRF  514

Query  1299  VSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVIS  1120
               R+ S+PTVE +A+L E++ QV+KLVEDLKS+S+D Q  AT+++RLLAKHNM+NRIVI+
Sbjct  515   APRLASTPTVEMKAELLEIETQVKKLVEDLKSSSLDAQIKATSDIRLLAKHNMENRIVIA  574

Query  1119  NCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEA  940
             NCGAI++LVNLL S DM VQENAVTALLNLSINDNNKSAIANA AIEPLI+VLETGSPEA
Sbjct  575   NCGAINVLVNLLRSTDMTVQENAVTALLNLSINDNNKSAIANADAIEPLIHVLETGSPEA  634

Query  939   KENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKG  760
             KENSAATLFSLSVIE+NKIKIGRSGA+Q LVDLLGNGTPRGKKDAATALFNLSI HENK 
Sbjct  635   KENSAATLFSLSVIEENKIKIGRSGAIQPLVDLLGNGTPRGKKDAATALFNLSINHENKT  694

Query  759   RIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSA  580
             RIVQAGAV+HLVELMDPA GMVDKAVAVLSNLATI EGR +IGQE GIP+LVEVVELGS 
Sbjct  695   RIVQAGAVKHLVELMDPAFGMVDKAVAVLSNLATIHEGRAAIGQERGIPVLVEVVELGSG  754

Query  579   RGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRH  400
             RGKENAAAALLQLCTNSSR+CNMVLQ GAVPPLVALSQSGTPRAREKAQ LL YFRNQRH
Sbjct  755   RGKENAAAALLQLCTNSSRFCNMVLQEGAVPPLVALSQSGTPRAREKAQQLLGYFRNQRH  814

Query  399   GNAGRG  382
             GNAGRG
Sbjct  815   GNAGRG  820



>ref|XP_006380667.1| hypothetical protein POPTR_0007s10280g [Populus trichocarpa]
 gb|ERP58464.1| hypothetical protein POPTR_0007s10280g [Populus trichocarpa]
Length=840

 Score =  1022 bits (2642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/840 (68%), Positives = 666/840 (79%), Gaps = 8/840 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LL+VLL  IS+F HLS  +NI+S+ V KYYQK E+ILKLL+PI   IVD+E+ASDE
Sbjct  1     MEISLLEVLLKTISTFLHLSKDDNISSDPVQKYYQKAEEILKLLKPIFDAIVDSEVASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F  LG SVDELRE+F++WQ LSSKVYFVLQ ESL  K+R   L   +LL SS   
Sbjct  61    VLNKDFLELGRSVDELREIFESWQPLSSKVYFVLQIESLTLKIRNLGLDSFQLLKSSHQQ  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S +SLENC+ KIK   YE  S+ I +AI    EG G SS+ L KIAD L L+SNQ
Sbjct  121   LPDELSSSSLENCIQKIKHSVYEQTSSIIKEAISGQEEGVGPSSEILVKIADSLCLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEK+KENAEQAEK  E E+I+Q+IALVTH+H+ L+++KQS+S + V IPADF
Sbjct  181   EILIEAVALEKIKENAEQAEKTAEAEFIDQMIALVTHIHERLVLIKQSQSSSPVPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WI+LGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKNWIELGLTVCPKTRQTLAHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDPIKS++ NQPS  + HV+S A RD H+  H R N   SP+S     SP
Sbjct  301   NWCESNNVKLPDPIKSMSFNQPSPLLVHVESIASRDSHVLPHLRENQPLSPESNRSAGSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              +S ISSS I RE SSP HPRS+SE SL    G+  GLD+ R+SL  SE+R  +S +R +
Sbjct  361   GRSMISSSGIHREGSSPLHPRSTSEGSLSGAVGNGQGLDIARISLMSSEERSGSSEERYL  420

Query  1617  NSVSHFSMPLSMNSVSSA---DENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSP--  1453
             +SV H S   S N VS+A   D    Q HNR+ SA S L+++ F +  + D NE +    
Sbjct  421   DSVCHRSASPSRNEVSTAVRADGLQSQNHNRSASASSALTHAAFPQGASGDANESTEFSN  480

Query  1452  --TTASTEASMEVASESRHAATLAASRRESEFPSP-VGTRLRPPAIWRRPSERLVSRIVS  1282
               T+ S++ S EV  E + ++TL    RE EFPS  V TR R    WRRPS+RLV RIVS
Sbjct  481   HFTSYSSDTSGEVKPEPQASSTLNTPHREPEFPSFLVDTRSRSQTAWRRPSDRLVPRIVS  540

Query  1281  SPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAIS  1102
             SP +ETRADLA ++ +VRKLVEDL+STS+D QR ATA+LRLLAKHNMDNRIVI+NCG+I 
Sbjct  541   SPAIETRADLAGIEMEVRKLVEDLRSTSIDIQRDATAKLRLLAKHNMDNRIVIANCGSIG  600

Query  1101  LLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAA  922
             LLVNLL S D ++QENAVTALLNLSINDNNK+AIANA AIEPLI+VLETGSPEAKENSAA
Sbjct  601   LLVNLLCSTDKKIQENAVTALLNLSINDNNKTAIANADAIEPLIHVLETGSPEAKENSAA  660

Query  921   TLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAG  742
             TLFSLSVIEDNK++IGRSGAV  LVDLLGNGTPRGKKDAATALFNLSI HENK RIV+AG
Sbjct  661   TLFSLSVIEDNKVRIGRSGAVGPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVEAG  720

Query  741   AVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENA  562
             AV+HLV+LMDPAAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGS RGKENA
Sbjct  721   AVKHLVDLMDPAAGMVDKAVAVLANLATIPEGRNAIGQEGGIPVLVEVVELGSVRGKENA  780

Query  561   AAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             AAALLQLCTNSSR+C+MVLQ GAVPPLVALSQSGTPRA+EKAQ+LLSYFRNQRHGNAGR 
Sbjct  781   AAALLQLCTNSSRFCHMVLQEGAVPPLVALSQSGTPRAKEKAQSLLSYFRNQRHGNAGRA  840



>ref|XP_011074755.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
4-like [Sesamum indicum]
Length=821

 Score =  1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/834 (68%), Positives = 652/834 (78%), Gaps = 15/834 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI  LK LLN+I+  F LSS ++I  E V +YYQK E+++KLL+PI   IVDAEIASDE
Sbjct  1     MEISALKSLLNSITRIFLLSSCDSIKCEPVQRYYQKIEEMMKLLKPIFDAIVDAEIASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LLQ  F+GL  SVDE RE+ ++WQ L+SKVYFVLQ ESL+  +R   LK +E+L +S  C
Sbjct  61    LLQIEFAGLCKSVDESREILESWQPLTSKVYFVLQIESLMVNIRTHGLKSLEILKASSHC  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPAE +  SLE+CV K+K M  E  S  I KAIK+H+E SGASS+SL K+AD LSLKSNQ
Sbjct  121   LPAELNAESLEHCVQKLKHMGSEQTSLIIMKAIKDHLEDSGASSESLGKVADRLSLKSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELLIE VALEKLKENAEQAEK  EVEYI+Q+IALVTHMHD L+MMKQS+SC    IPADF
Sbjct  181   ELLIEAVALEKLKENAEQAEKAGEVEYIDQMIALVTHMHDLLVMMKQSQSCNP-PIPADF  239

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIR+WIDLGL VCPKTRQTL HTNLIPN+TVKALIA
Sbjct  240   CCPLSLELMTDPVIVASGQTYERAFIRKWIDLGLIVCPKTRQTLAHTNLIPNFTVKALIA  299

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP K+ N++QPSS +A+ +S   R        RAN+S +PD + G    
Sbjct  300   NWCESNNVKLPDPTKTTNLHQPSSLLANAESVRGR--------RANSSGTPDRSLGSPMK  351

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
                S +++       +     S    +   I G    LD++R+S   S DR  +SG+RS 
Sbjct  352   SSISSNATQRLGTSPTHPRSYSEDSLTEAAINGT--MLDMDRVSPRSSGDRSDHSGERSS  409

Query  1617  NSVSHFSMPLSMN-SVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTA-  1444
              S     M  S N + ++ADE   +GHNRT S  S LSNSN S+  A DGNE +SP  A 
Sbjct  410   RSGGLLLMSPSRNFAGAAADERLSEGHNRTXS--SPLSNSNLSQETAADGNEGASPADAY  467

Query  1443  STEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVET  1264
             +++AS E+ +E +      A+RRE +FPS + TR R  A WRRPSER   R+VSSPTVE 
Sbjct  468   ASDASGELPAEPQRPTNPNAARREHDFPSRLETRPRGQAFWRRPSERFGPRVVSSPTVEM  527

Query  1263  RADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLL  1084
             RA+L EV+ QV+KL+EDLKS+S+D QR ATAE+RLLAKHNMDNRI+I+NCGAISL VNLL
Sbjct  528   RAELLEVEAQVKKLIEDLKSSSIDVQRNATAEIRLLAKHNMDNRIIIANCGAISLFVNLL  587

Query  1083  HSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLS  904
              S D  VQENAVTALLNLSINDNNKSAIANA AIEPLIYVLETGSPEAKENSAATLFSLS
Sbjct  588   RSTDSIVQENAVTALLNLSINDNNKSAIANADAIEPLIYVLETGSPEAKENSAATLFSLS  647

Query  903   VIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLV  724
             V+++NKIKIGRSGA++ LVDLLG+GTPRGKKDAATALFNLSI HENK RIVQAGAV++LV
Sbjct  648   VMDENKIKIGRSGAIKPLVDLLGHGTPRGKKDAATALFNLSINHENKARIVQAGAVKYLV  707

Query  723   ELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQ  544
             ELMDPA GMVDKAVAVLSNLATI EGR +IGQEGGIP+LVEVVELGS RGKENAAAALLQ
Sbjct  708   ELMDPAFGMVDKAVAVLSNLATIHEGRTAIGQEGGIPVLVEVVELGSGRGKENAAAALLQ  767

Query  543   LCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             LCTNS+R+CNMVLQ GAVPPLVALSQSGTPRAREKAQ LL YFRNQRHGNAGRG
Sbjct  768   LCTNSNRFCNMVLQEGAVPPLVALSQSGTPRAREKAQQLLGYFRNQRHGNAGRG  821



>ref|XP_011013975.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011013976.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011013978.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011013979.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011013980.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
Length=840

 Score =  1017 bits (2629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/840 (68%), Positives = 663/840 (79%), Gaps = 8/840 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LL+VLL  IS+F HLS  +NI+S+ V KYYQK E+ILKLL+P+   IVD+E+ASDE
Sbjct  1     MEISLLEVLLKTISTFLHLSKDDNISSDPVQKYYQKAEEILKLLKPVFDAIVDSEVASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F  LG SVDELRE+F++WQ LSSKVY VLQ ESL  K+R   L   +LL SS   
Sbjct  61    VLNKDFLELGRSVDELREIFESWQPLSSKVYSVLQIESLTLKIRNLGLDSFQLLKSSHQQ  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S +SLEN + KIK   YE  S+ I +AI +  EG G SS+ L KIAD L L+SNQ
Sbjct  121   LPDELSSSSLENRMQKIKHSVYEQTSSIIKEAISDQEEGVGPSSEILVKIADSLCLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQAEK  E E+I+QIIALVT +H+CL+++KQS++ + V IPADF
Sbjct  181   EILIEAVALEKLKENAEQAEKTAEAEFIDQIIALVTRIHECLVLIKQSQTSSPVPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WI+LGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKNWIELGLTVCPKTRQTLAHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDPIKS++ NQPS  + HV+S A RD H+  H R N   SP+S     SP
Sbjct  301   NWCESNNVKLPDPIKSMSFNQPSPLLVHVESIASRDSHVLPHLRENQPLSPESNRSAGSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              +S ISSS I RE SSP HP S+SE SL    G+  GLD+ R+SL  SE+R  NS +R +
Sbjct  361   GRSMISSSGIHREGSSPLHPCSTSEGSLSGAVGNGQGLDIARISLMSSEERSGNSEERYL  420

Query  1617  NSVSHFSMPLSMNSVSSA---DENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSP--  1453
             NSV H S   S N VS+A   D    Q HNR+ SA S L+++ F +  + D NE +    
Sbjct  421   NSVCHHSASPSRNEVSTAVRADGLLSQNHNRSASASSALAHAAFPQGASGDANESTEFSN  480

Query  1452  --TTASTEASMEVASESRHAATLAASRRESEFPSP-VGTRLRPPAIWRRPSERLVSRIVS  1282
               T+ S++ S EV  E + ++TL    RE EFPS  V TR R    WRRPS+RLV RIVS
Sbjct  481   HFTSYSSDTSGEVKPEPQASSTLNTPHREPEFPSFLVDTRSRSQTAWRRPSDRLVPRIVS  540

Query  1281  SPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAIS  1102
             SP +ET ADLA ++ +VRKLVEDL+STS+D QR  TA+LRLLAKHNMDNRIVI+NCGAIS
Sbjct  541   SPAIETNADLAGIEMEVRKLVEDLRSTSIDIQRDTTAKLRLLAKHNMDNRIVIANCGAIS  600

Query  1101  LLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAA  922
             LLVNLL S D ++QENAVTALLNLSINDNNK+AIANA AIEPLI+VL+TGSPEAKENSAA
Sbjct  601   LLVNLLCSTDKKIQENAVTALLNLSINDNNKTAIANADAIEPLIHVLKTGSPEAKENSAA  660

Query  921   TLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAG  742
             TLFSLSVIEDNK++IGRSGA+  LVDLLGNGTPRGKKDAATALFNLSI HENK RIV+AG
Sbjct  661   TLFSLSVIEDNKVRIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVEAG  720

Query  741   AVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENA  562
             AV+HLV+LMDPAAGMVDKAVAVL+NLATI EGR +IGQE GIP+LVEVVELGSARGKENA
Sbjct  721   AVKHLVDLMDPAAGMVDKAVAVLANLATIPEGRNAIGQESGIPVLVEVVELGSARGKENA  780

Query  561   AAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             AAALLQLCTNSSR+C+MVLQ GAVPPLVALSQSGTPRA+EKAQ+LLSYFRNQRHGNAGR 
Sbjct  781   AAALLQLCTNSSRFCHMVLQEGAVPPLVALSQSGTPRAKEKAQSLLSYFRNQRHGNAGRA  840



>ref|XP_011008564.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011008565.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011008566.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011008567.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011008568.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
Length=840

 Score =  1015 bits (2624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/840 (68%), Positives = 663/840 (79%), Gaps = 8/840 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LL+VLL  IS+F HLS  +NI+S+ V KYYQK E+ILKLL+P+   IVD+E+ASDE
Sbjct  1     MEISLLEVLLKTISTFLHLSKDDNISSDPVQKYYQKAEEILKLLKPVFDAIVDSEVASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F  LG SVDELRE+F++WQ LSSKVY VLQ ESL  K+R   L   +LL SS   
Sbjct  61    VLNKDFLELGRSVDELREIFESWQPLSSKVYSVLQIESLTLKIRNLGLDSFQLLKSSHQQ  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S +SLEN + KIK   YE  S+ I +AI +  EG G SS+ L KIAD L L+SNQ
Sbjct  121   LPDELSSSSLENRMQKIKHSVYEQTSSIIKEAISDQEEGVGPSSEILVKIADSLCLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEK+KENAEQAEK  E E+I+QIIALVT +H+CL+++KQS++ + V IPADF
Sbjct  181   EVLIEAVALEKIKENAEQAEKTAEAEFIDQIIALVTRIHECLVLIKQSQTSSPVPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WI+LGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKNWIELGLTVCPKTRQTLAHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDPIKS++ NQPS  + HV+S A RD H+  H R N   SP+S     SP
Sbjct  301   NWCESNNVKLPDPIKSMSFNQPSPLLVHVESIASRDSHVLPHLRENQPLSPESNRSAGSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              +S ISSS I RE SSP HP S+SE SL    G+  GLD+ R+SL  SE+R  NS +R +
Sbjct  361   GRSMISSSGIHREGSSPLHPCSTSEGSLSGAVGNGQGLDIARISLMSSEERSGNSEERYL  420

Query  1617  NSVSHFSMPLSMNSVSSA---DENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSP--  1453
             NSV H S   S N VS+A   D    Q HNR+ SA S L+++ F +  + D NE +    
Sbjct  421   NSVCHHSASPSRNEVSTAVRADGLLSQNHNRSASASSALAHAAFPQGASGDANESTEFSN  480

Query  1452  --TTASTEASMEVASESRHAATLAASRRESEFPSP-VGTRLRPPAIWRRPSERLVSRIVS  1282
               T+ S++ S EV  E + ++TL    RE EFPS  V TR R    WRRPS+RLV RIVS
Sbjct  481   HFTSYSSDTSGEVKPEPQASSTLNTPHREPEFPSFLVDTRSRSQTAWRRPSDRLVPRIVS  540

Query  1281  SPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAIS  1102
             SP +ET ADLA ++ +VRKLVEDL+STS+D QR  TA+LRLLAKHNMDNRIVI+NCGAIS
Sbjct  541   SPAIETNADLAGIEMEVRKLVEDLRSTSIDIQRDTTAKLRLLAKHNMDNRIVIANCGAIS  600

Query  1101  LLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAA  922
             LLVNLL S D ++QENAVTALLNLSINDNNK+AIANA AIEPLI+VL+TGSPEAKENSAA
Sbjct  601   LLVNLLCSTDKKIQENAVTALLNLSINDNNKTAIANADAIEPLIHVLKTGSPEAKENSAA  660

Query  921   TLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAG  742
             TLFSLSVIEDNK++IGRSGA+  LVDLLGNGTPRGKKDAATALFNLSI HENK RIV+AG
Sbjct  661   TLFSLSVIEDNKVRIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVEAG  720

Query  741   AVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENA  562
             AV+HLV+LMDPAAGMVDKAVAVL+NLATI EGR +IGQE GIP+LVEVVELGSARGKENA
Sbjct  721   AVKHLVDLMDPAAGMVDKAVAVLANLATIPEGRNAIGQESGIPVLVEVVELGSARGKENA  780

Query  561   AAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             AAALLQLCTN+SR+C+MVLQ GAVPPLVALSQSGTPRA+EKAQ+LLSYFRNQRHGNAGR 
Sbjct  781   AAALLQLCTNNSRFCHMVLQEGAVPPLVALSQSGTPRAKEKAQSLLSYFRNQRHGNAGRA  840



>ref|XP_008238495.1| PREDICTED: U-box domain-containing protein 4 [Prunus mume]
Length=844

 Score =  1001 bits (2588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/841 (66%), Positives = 659/841 (78%), Gaps = 8/841 (1%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G MEI L K LLNNISSFFHLSS +NIN + V KYY++ E+ILKLL+ +L  ++D+EIAS
Sbjct  5     GVMEISLFKALLNNISSFFHLSSNDNINLDPVLKYYKRAEEILKLLKTVLDAVIDSEIAS  64

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
              E+L K F  LGH +DELRE  + WQ L SKV  VLQ ESLI+K+    L I +LL +S 
Sbjct  65    YEVLNKPFEELGHYIDELREQIEDWQPLLSKVNLVLQVESLISKIWTSGLDIFQLLKTSQ  124

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
               LP E    SLE+C+ K+K++  E +S  I  ++ + VEG G SS+ L KIA+ LSL+S
Sbjct  125   QHLPDELGSASLEHCIQKLKNVVDEQMSTVIKDSVSDQVEGVGPSSEILVKIAEGLSLRS  184

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQE+LIE VALEKLKENAEQ+EK EE EYIEQ+I+LVT MH+ L+ +KQS+SC+ V IPA
Sbjct  185   NQEILIEAVALEKLKENAEQSEKIEEAEYIEQLISLVTRMHERLVTIKQSQSCSPVPIPA  244

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELMTDPVIVASGQTYER FI+ WIDLGLTVCPKTRQTL HTNLIPNYTVKAL
Sbjct  245   DFCCPLSLELMTDPVIVASGQTYERTFIKNWIDLGLTVCPKTRQTLAHTNLIPNYTVKAL  304

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLD  1804
             IANWCE NN+KLPDP KS+ +N+ +  +   + GAP+D   F HSR N   SP+SA  + 
Sbjct  305   IANWCESNNVKLPDPSKSMGLNKATQLLGQAEHGAPKDSPPFPHSRGNQPMSPESARSMG  364

Query  1803  sprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDR  1624
             SP K+  SS  + RE SSP HPRS+SE SL  + G+   LD+ R++L  SEDR AN  +R
Sbjct  365   SPTKNLFSSGPLHRERSSPLHPRSTSEGSLSGVVGNGQVLDIARITLANSEDRSANLEER  424

Query  1623  SMNSVSHFSMPLSMNSVSSA--DENSHQGHNRTTSAPSTLSNSNFSRA---NAHDGNEVS  1459
             S +  S  SM  S++   ++   E S Q HNRT SA S LSN+N ++    NA+   +V 
Sbjct  425   STDLGSQHSMSPSLDEFPNSIEAEQSSQSHNRTASASSILSNANGTQGTPVNANGALQVP  484

Query  1458  SPTTA-STEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPA-IWRRPSERLVSRIV  1285
             S  +  S++AS E+ SE +  A LA  +RE+E P+ +   +RP + +WRRPS  LV RIV
Sbjct  485   SNLSGYSSDASGELKSEPQAVAALATQQRETELPTRMA-EVRPRSQMWRRPSGSLVPRIV  543

Query  1284  SSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAI  1105
             SSP VETR DL+ ++ QVR LVEDLKSTS+D QR AT ++RLLAKHNMDNRIVI+NCGAI
Sbjct  544   SSPAVETRPDLSALEAQVRSLVEDLKSTSLDTQREATLQIRLLAKHNMDNRIVIANCGAI  603

Query  1104  SLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSA  925
             SLLV+LLHS D  +QENAVTALLNLSINDNNK+AIA A AIEPLI+VLETGS EAKENSA
Sbjct  604   SLLVDLLHSTDTRIQENAVTALLNLSINDNNKTAIATANAIEPLIHVLETGSAEAKENSA  663

Query  924   ATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA  745
             ATLFSLSVIEDNK++IGRSGA++ LVDLLGNGTPRG+KDAATALFNLSI HENKGRIVQA
Sbjct  664   ATLFSLSVIEDNKVRIGRSGAIEPLVDLLGNGTPRGRKDAATALFNLSIFHENKGRIVQA  723

Query  744   GAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKEN  565
             GAVR+LVELMDPAAGMVDKAVAVL+NL+TI EGR +IGQEGGIP+LVEVVELGSARGKEN
Sbjct  724   GAVRYLVELMDPAAGMVDKAVAVLANLSTIPEGRTAIGQEGGIPVLVEVVELGSARGKEN  783

Query  564   AAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             AAAALLQLCTNS+RYC+MVLQ GAVPPLV LSQSGT RA+EKAQ LLSYFRN RHGNAGR
Sbjct  784   AAAALLQLCTNSNRYCSMVLQEGAVPPLVVLSQSGTSRAKEKAQTLLSYFRNHRHGNAGR  843

Query  384   G  382
             G
Sbjct  844   G  844



>ref|XP_002283956.2| PREDICTED: U-box domain-containing protein 4 [Vitis vinifera]
 ref|XP_010652751.1| PREDICTED: U-box domain-containing protein 4 [Vitis vinifera]
 ref|XP_010652752.1| PREDICTED: U-box domain-containing protein 4 [Vitis vinifera]
Length=809

 Score =   988 bits (2554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/833 (68%), Positives = 641/833 (77%), Gaps = 25/833 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LLN ISSFF LSS +NI+SE V KYYQK E+ILKLL+PILS I+D+EIASDE
Sbjct  1     MEISLLKRLLNKISSFFLLSSHDNIDSEPVRKYYQKIEEILKLLKPILSTIIDSEIASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL K F  LG SVD+L+ELF+    L SKVYFVLQ E  I+K+R   L+I + L SS  C
Sbjct  61    LLNKAFEELGRSVDDLQELFENCHPLMSKVYFVLQIELSISKIRTSGLEIFQQLKSSHQC  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S  SLE C+ K+K M YE  S  + +AI+N V+G+G+SS+SL K+ADCLSL+SNQ
Sbjct  121   LPDELSSASLETCIQKVKHMGYEQTSTILQEAIRNQVQGAGSSSESLMKLADCLSLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELLIE VALEKLKENAEQAEK EE EYI+Q+I L T MHD  I+ KQS+SC  + IPADF
Sbjct  181   ELLIEAVALEKLKENAEQAEKTEEAEYIDQMITLATQMHDRFIITKQSQSCNPIPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIR+W+DLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIRKWLDLGLTVCPKTRQTLAHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP+KSLN+NQ S  +AH + GAPRD H   HSRA+   SP+S     SP
Sbjct  301   NWCESNNVKLPDPVKSLNLNQSSPLLAHAEPGAPRDAHNVPHSRASQPMSPESTRFTGSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
               + +SS  I RE +SPSHPRS SE SL  +AG+  G D+E               DRSM
Sbjct  361   GNNLVSSGGIHREGTSPSHPRSRSEGSLSGVAGNGHGSDIE---------------DRSM  405

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTAST  1438
             +SV   S  L     SS    +     RT SA +   N     AN+ +G   +     S+
Sbjct  406   DSVGQPST-LPSRKESSNSTGADANLCRTASASTLPCN-----ANSSEGTLGADIGVYSS  459

Query  1437  EASMEVASESRHAAT-LAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETR  1261
             + S E+  E + AA  L   +RE +FP  + TR R  A+WRRPSER V RIVSSPT ETR
Sbjct  460   DVSGEMTPEPQAAAANLTTPQREPDFPLRLETRARSQAMWRRPSERFVPRIVSSPTTETR  519

Query  1260  ADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLH  1081
             ADL+ V+ QV++LVEDLKS SV+ QR AT+ELRLLAKHNMDNRIVI+NCGAISLLVNLL 
Sbjct  520   ADLSGVEAQVQRLVEDLKSESVETQREATSELRLLAKHNMDNRIVIANCGAISLLVNLLR  579

Query  1080  SEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSV  901
             SED + QENAVTALLNLSINDNNK+AIANA AIEPLI+VL+TGSPEAKENSAATLFSLSV
Sbjct  580   SEDAKAQENAVTALLNLSINDNNKTAIANAQAIEPLIHVLQTGSPEAKENSAATLFSLSV  639

Query  900   IEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVE  721
             IEDNK  IGRSGA+  LV+LLGNGTPRGKKDAATALFNLSI HENK RIVQAGAVRHLVE
Sbjct  640   IEDNKAAIGRSGAIAPLVELLGNGTPRGKKDAATALFNLSIFHENKTRIVQAGAVRHLVE  699

Query  720   LMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQL  541
             LMDPAAGMVDKAVAVL+NLATI EGR +I Q GGIP+LVEVVELGSARGKENAAAALLQL
Sbjct  700   LMDPAAGMVDKAVAVLANLATITEGRHAIDQAGGIPVLVEVVELGSARGKENAAAALLQL  759

Query  540   CTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             C+NSSR C  VLQ GAVPPLVALSQSGTPRA+EKAQALL+ FR+ RH  AGRG
Sbjct  760   CSNSSRSCIKVLQEGAVPPLVALSQSGTPRAKEKAQALLNCFRS-RH--AGRG  809



>ref|XP_006380666.1| hypothetical protein POPTR_0007s10280g [Populus trichocarpa]
 gb|ERP58463.1| hypothetical protein POPTR_0007s10280g [Populus trichocarpa]
Length=826

 Score =   985 bits (2546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/823 (68%), Positives = 649/823 (79%), Gaps = 8/823 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LL+VLL  IS+F HLS  +NI+S+ V KYYQK E+ILKLL+PI   IVD+E+ASDE
Sbjct  1     MEISLLEVLLKTISTFLHLSKDDNISSDPVQKYYQKAEEILKLLKPIFDAIVDSEVASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F  LG SVDELRE+F++WQ LSSKVYFVLQ ESL  K+R   L   +LL SS   
Sbjct  61    VLNKDFLELGRSVDELREIFESWQPLSSKVYFVLQIESLTLKIRNLGLDSFQLLKSSHQQ  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S +SLENC+ KIK   YE  S+ I +AI    EG G SS+ L KIAD L L+SNQ
Sbjct  121   LPDELSSSSLENCIQKIKHSVYEQTSSIIKEAISGQEEGVGPSSEILVKIADSLCLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEK+KENAEQAEK  E E+I+Q+IALVTH+H+ L+++KQS+S + V IPADF
Sbjct  181   EILIEAVALEKIKENAEQAEKTAEAEFIDQMIALVTHIHERLVLIKQSQSSSPVPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WI+LGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKNWIELGLTVCPKTRQTLAHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDPIKS++ NQPS  + HV+S A RD H+  H R N   SP+S     SP
Sbjct  301   NWCESNNVKLPDPIKSMSFNQPSPLLVHVESIASRDSHVLPHLRENQPLSPESNRSAGSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              +S ISSS I RE SSP HPRS+SE SL    G+  GLD+ R+SL  SE+R  +S +R +
Sbjct  361   GRSMISSSGIHREGSSPLHPRSTSEGSLSGAVGNGQGLDIARISLMSSEERSGSSEERYL  420

Query  1617  NSVSHFSMPLSMNSVSSA---DENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSP--  1453
             +SV H S   S N VS+A   D    Q HNR+ SA S L+++ F +  + D NE +    
Sbjct  421   DSVCHRSASPSRNEVSTAVRADGLQSQNHNRSASASSALTHAAFPQGASGDANESTEFSN  480

Query  1452  --TTASTEASMEVASESRHAATLAASRRESEFPSP-VGTRLRPPAIWRRPSERLVSRIVS  1282
               T+ S++ S EV  E + ++TL    RE EFPS  V TR R    WRRPS+RLV RIVS
Sbjct  481   HFTSYSSDTSGEVKPEPQASSTLNTPHREPEFPSFLVDTRSRSQTAWRRPSDRLVPRIVS  540

Query  1281  SPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAIS  1102
             SP +ETRADLA ++ +VRKLVEDL+STS+D QR ATA+LRLLAKHNMDNRIVI+NCG+I 
Sbjct  541   SPAIETRADLAGIEMEVRKLVEDLRSTSIDIQRDATAKLRLLAKHNMDNRIVIANCGSIG  600

Query  1101  LLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAA  922
             LLVNLL S D ++QENAVTALLNLSINDNNK+AIANA AIEPLI+VLETGSPEAKENSAA
Sbjct  601   LLVNLLCSTDKKIQENAVTALLNLSINDNNKTAIANADAIEPLIHVLETGSPEAKENSAA  660

Query  921   TLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAG  742
             TLFSLSVIEDNK++IGRSGAV  LVDLLGNGTPRGKKDAATALFNLSI HENK RIV+AG
Sbjct  661   TLFSLSVIEDNKVRIGRSGAVGPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVEAG  720

Query  741   AVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENA  562
             AV+HLV+LMDPAAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGS RGKENA
Sbjct  721   AVKHLVDLMDPAAGMVDKAVAVLANLATIPEGRNAIGQEGGIPVLVEVVELGSVRGKENA  780

Query  561   AAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQ  433
             AAALLQLCTNSSR+C+MVLQ GAVPPLVALSQSGTPRA+EK Q
Sbjct  781   AAALLQLCTNSSRFCHMVLQEGAVPPLVALSQSGTPRAKEKVQ  823



>ref|XP_006380663.1| hypothetical protein POPTR_0007s10280g [Populus trichocarpa]
 ref|XP_006380664.1| hypothetical protein POPTR_0007s10280g [Populus trichocarpa]
 ref|XP_006380665.1| hypothetical protein POPTR_0007s10280g [Populus trichocarpa]
 gb|ERP58460.1| hypothetical protein POPTR_0007s10280g [Populus trichocarpa]
 gb|ERP58461.1| hypothetical protein POPTR_0007s10280g [Populus trichocarpa]
 gb|ERP58462.1| hypothetical protein POPTR_0007s10280g [Populus trichocarpa]
Length=824

 Score =   985 bits (2546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/824 (68%), Positives = 649/824 (79%), Gaps = 8/824 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LL+VLL  IS+F HLS  +NI+S+ V KYYQK E+ILKLL+PI   IVD+E+ASDE
Sbjct  1     MEISLLEVLLKTISTFLHLSKDDNISSDPVQKYYQKAEEILKLLKPIFDAIVDSEVASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F  LG SVDELRE+F++WQ LSSKVYFVLQ ESL  K+R   L   +LL SS   
Sbjct  61    VLNKDFLELGRSVDELREIFESWQPLSSKVYFVLQIESLTLKIRNLGLDSFQLLKSSHQQ  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S +SLENC+ KIK   YE  S+ I +AI    EG G SS+ L KIAD L L+SNQ
Sbjct  121   LPDELSSSSLENCIQKIKHSVYEQTSSIIKEAISGQEEGVGPSSEILVKIADSLCLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEK+KENAEQAEK  E E+I+Q+IALVTH+H+ L+++KQS+S + V IPADF
Sbjct  181   EILIEAVALEKIKENAEQAEKTAEAEFIDQMIALVTHIHERLVLIKQSQSSSPVPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WI+LGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKNWIELGLTVCPKTRQTLAHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDPIKS++ NQPS  + HV+S A RD H+  H R N   SP+S     SP
Sbjct  301   NWCESNNVKLPDPIKSMSFNQPSPLLVHVESIASRDSHVLPHLRENQPLSPESNRSAGSP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              +S ISSS I RE SSP HPRS+SE SL    G+  GLD+ R+SL  SE+R  +S +R +
Sbjct  361   GRSMISSSGIHREGSSPLHPRSTSEGSLSGAVGNGQGLDIARISLMSSEERSGSSEERYL  420

Query  1617  NSVSHFSMPLSMNSVSSA---DENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSP--  1453
             +SV H S   S N VS+A   D    Q HNR+ SA S L+++ F +  + D NE +    
Sbjct  421   DSVCHRSASPSRNEVSTAVRADGLQSQNHNRSASASSALTHAAFPQGASGDANESTEFSN  480

Query  1452  --TTASTEASMEVASESRHAATLAASRRESEFPSP-VGTRLRPPAIWRRPSERLVSRIVS  1282
               T+ S++ S EV  E + ++TL    RE EFPS  V TR R    WRRPS+RLV RIVS
Sbjct  481   HFTSYSSDTSGEVKPEPQASSTLNTPHREPEFPSFLVDTRSRSQTAWRRPSDRLVPRIVS  540

Query  1281  SPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAIS  1102
             SP +ETRADLA ++ +VRKLVEDL+STS+D QR ATA+LRLLAKHNMDNRIVI+NCG+I 
Sbjct  541   SPAIETRADLAGIEMEVRKLVEDLRSTSIDIQRDATAKLRLLAKHNMDNRIVIANCGSIG  600

Query  1101  LLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAA  922
             LLVNLL S D ++QENAVTALLNLSINDNNK+AIANA AIEPLI+VLETGSPEAKENSAA
Sbjct  601   LLVNLLCSTDKKIQENAVTALLNLSINDNNKTAIANADAIEPLIHVLETGSPEAKENSAA  660

Query  921   TLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAG  742
             TLFSLSVIEDNK++IGRSGAV  LVDLLGNGTPRGKKDAATALFNLSI HENK RIV+AG
Sbjct  661   TLFSLSVIEDNKVRIGRSGAVGPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVEAG  720

Query  741   AVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENA  562
             AV+HLV+LMDPAAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGS RGKENA
Sbjct  721   AVKHLVDLMDPAAGMVDKAVAVLANLATIPEGRNAIGQEGGIPVLVEVVELGSVRGKENA  780

Query  561   AAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQA  430
             AAALLQLCTNSSR+C+MVLQ GAVPPLVALSQSGTPRA+EK Q 
Sbjct  781   AAALLQLCTNSSRFCHMVLQEGAVPPLVALSQSGTPRAKEKVQG  824



>ref|XP_009336069.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri]
 ref|XP_009336070.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri]
 ref|XP_009336071.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri]
 ref|XP_009336073.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri]
 ref|XP_009336083.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri]
 ref|XP_009336084.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri]
 ref|XP_009336085.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri]
 ref|XP_009336086.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri]
Length=836

 Score =   981 bits (2536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/838 (65%), Positives = 640/838 (76%), Gaps = 8/838 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI L K LLNNISSFFHLSS  NIN + V KYY+  E+ILKLL+ +L  I D+EIAS E
Sbjct  1     MEISLFKALLNNISSFFHLSSHNNINFDPVLKYYKSAEEILKLLKTVLDAIADSEIASYE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F  LG  VDELRE  + WQ LSSKV  VLQ ESLI+K+ A  L I +LL +S   
Sbjct  61    ILDKPFEELGQYVDELREQIEDWQPLSSKVNLVLQVESLISKIWASGLDIFQLLKTSPQH  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E    SLE C+ K++ M YE +S  I  AI + VEG G SS+ L KIA+ LSLKSNQ
Sbjct  121   LPDEMGSASLEQCIQKLEHMGYEQMSTVIKDAISDQVEGVGPSSEILVKIAEGLSLKSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQ+EK EE EYIEQ+I+LVT MH+ LI +KQ+ SC+ V IPADF
Sbjct  181   EILIEAVALEKLKENAEQSEKIEEAEYIEQMISLVTRMHERLITIKQARSCSPVPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WI LGLTVCPKTRQTL H+NLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERTFIKNWIGLGLTVCPKTRQTLAHSNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP+KS+ +N+ +  + H +   P+D  IFSHS  N S SP+S      P
Sbjct  301   NWCESNNVKLPDPVKSVGLNKSAHLLGHAEPDTPKDSPIFSHSSVNQSMSPESTRSTGLP  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K+  SS  + RE  SP HPRS+SE SLP I G+   LD+ER+SL  SEDR AN  +RS 
Sbjct  361   SKNMFSSGPLHRERISPLHPRSTSEGSLPGIVGNGQALDIERISLANSEDRSANLEERST  420

Query  1617  NSVSHFSMPLSMNSVSSA--DENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTT-  1447
             +  S  SM  S + + ++  DE   Q HNRT SA S L N+N +   + + N V   +T 
Sbjct  421   DLDSQHSMSPSRDELPNSIEDEQPSQSHNRTASASSVLVNANGTLGTSVNANGVLQVSTN  480

Query  1446  ---ASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSP  1276
                 S++AS E+ S+++  A LA  +RE+E P+ +        +WRRPS     RIVSSP
Sbjct  481   LSGYSSDASGELKSQAQTVAPLAPQQRETESPTRMAESRPRNQMWRRPSS--FPRIVSSP  538

Query  1275  TVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLL  1096
              +ETR DL+E++ QVR LV+DLKSTS+D QR AT +LRLLAKHNMDNRIVI+NCGAI LL
Sbjct  539   PIETRPDLSELEAQVRNLVDDLKSTSLDTQREATFQLRLLAKHNMDNRIVIANCGAIGLL  598

Query  1095  VNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATL  916
             V+LL S D  VQENAVTALLNLSINDNNK+AIA A AIEPLI+VLETGS EAKENSAATL
Sbjct  599   VDLLRSTDTRVQENAVTALLNLSINDNNKTAIATANAIEPLIHVLETGSAEAKENSAATL  658

Query  915   FSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAV  736
             FSLSVIEDNK++IGRSGA+  LVDLLGNG+PRG+KDAATALFNLSI HENK RIVQAGAV
Sbjct  659   FSLSVIEDNKVRIGRSGAIGPLVDLLGNGSPRGRKDAATALFNLSIFHENKDRIVQAGAV  718

Query  735   RHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAA  556
             ++LVELMDPAAGMVDKAVAVL+NL+TI EGR +IGQEGGIP+LVEVVELGSARGKENAAA
Sbjct  719   KYLVELMDPAAGMVDKAVAVLANLSTIPEGRTAIGQEGGIPVLVEVVELGSARGKENAAA  778

Query  555   ALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             ALLQLCTNS+R+C  VLQ GAVPPLV LSQSGTPRA+EKAQ LLSYFRN R GNAGRG
Sbjct  779   ALLQLCTNSNRFCGQVLQEGAVPPLVVLSQSGTPRAKEKAQTLLSYFRNHRQGNAGRG  836



>ref|XP_002306495.2| hypothetical protein POPTR_0005s18820g [Populus trichocarpa]
 gb|EEE93491.2| hypothetical protein POPTR_0005s18820g [Populus trichocarpa]
Length=840

 Score =   980 bits (2533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/841 (67%), Positives = 658/841 (78%), Gaps = 10/841 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LL+VLL NIS+F H+S  + I+S+ V KYYQK E+ILKLL+PIL  IV++E+ SD 
Sbjct  1     MEISLLEVLLKNISAFLHISKDDKISSDPVQKYYQKAEEILKLLKPILDTIVNSEVPSDA  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F  LG SVDEL+E+F+ WQ LSSKV+FVLQ ESL +K+ +  L   +LL +S   
Sbjct  61    VLNKDFQELGQSVDELKEIFENWQPLSSKVHFVLQIESLTSKICSLGLNSFQLLKASHQQ  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S +SLENC+ KIK   Y   S+ I +AI +  EG G SS+ L KI+D L L+SNQ
Sbjct  121   LPDELSSSSLENCIQKIKLSGYVQTSSIIKEAISDQEEGVGPSSEILVKISDSLCLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQAEK  E E+I+QII LVT MH+ L+++KQS++ + V IPADF
Sbjct  181   EILIEAVALEKLKENAEQAEKTAEAEFIDQIITLVTRMHERLVLIKQSQTYSPVPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WI+LGLTVCPKT+QTL HTNLI NYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKNWIELGLTVCPKTQQTLAHTNLITNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDPIKS++ NQPS  + H +S   R+ H+ SH R +   S +S     SP
Sbjct  301   NWCESNNVKLPDPIKSMSFNQPSPLLVHAESITSRE-HVLSHPRGSQPISSESNQATGSP  359

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMS-LEGSEDRLANSGDRS  1621
              ++ ISSS IQRE SSP H  S+SE SL  I G+  GLD+ R+S L  SE+R +NS +R+
Sbjct  360   GQNMISSSGIQREGSSPLHSHSTSESSLSVIVGNGQGLDIARISSLTSSEERSSNSEERN  419

Query  1620  MNSVSHFSMPLSMNSVSSA---DENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSP-  1453
             ++SV H S   S   VS+A   D    Q HNR+ SA S L ++ F +  + D NE S   
Sbjct  420   LDSVHHCSASPSRKEVSTAVRADGLLSQNHNRSASASSALGHAAFPQGASGDANESSEFS  479

Query  1452  ---TTASTEASMEVASESRHAATLAASRRESEFPSP-VGTRLRPPAIWRRPSERLVSRIV  1285
                T+ S++ S EV  E + ++ L    RE EFPS  V TR R   IWRRPS+RLV RIV
Sbjct  480   NHLTSYSSDISGEVKPEPQASSALHTPHREPEFPSRLVDTRSRSQTIWRRPSDRLVPRIV  539

Query  1284  SSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAI  1105
             SS  +ETRADLA ++ +VR LVEDLKST VD QR ATA+LRLLAKHNMDNRIVI+N GAI
Sbjct  540   SSSAIETRADLAGIETEVRNLVEDLKSTLVDTQRDATAKLRLLAKHNMDNRIVIANFGAI  599

Query  1104  SLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSA  925
             SLLVNLL S D+++QENAVTALLNLSINDNNK+AI NA AIEPLI+VLETGSPEAKENSA
Sbjct  600   SLLVNLLRSTDIKIQENAVTALLNLSINDNNKTAIGNADAIEPLIHVLETGSPEAKENSA  659

Query  924   ATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA  745
             ATLFSLSVIEDNK++IGRSGA+  LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQA
Sbjct  660   ATLFSLSVIEDNKVRIGRSGAIVPLVDLLGNGTPRGKKDAATALFNLSIFHENKDRIVQA  719

Query  744   GAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKEN  565
             GAV+HLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGSARGKEN
Sbjct  720   GAVKHLVELMDPAAGMVDKAVAVLANLATIPEGRNAIGQEGGIPVLVEVVELGSARGKEN  779

Query  564   AAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             AAAALLQLCTNSSR+C+MVLQ GAVPPLVALSQSGTPRA+EKAQALLS+FRNQRHGNAGR
Sbjct  780   AAAALLQLCTNSSRFCHMVLQEGAVPPLVALSQSGTPRAKEKAQALLSFFRNQRHGNAGR  839

Query  384   G  382
              
Sbjct  840   A  840



>ref|XP_009367853.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009367860.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009367866.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Pyrus x bretschneideri]
Length=831

 Score =   978 bits (2529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/839 (66%), Positives = 648/839 (77%), Gaps = 15/839 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI L K LLNNISSFFHLSS +NIN + V KY ++ E+ILKLL+ +L  I D+EIAS E
Sbjct  1     MEISLFKALLNNISSFFHLSSHDNINFDPVLKYCKRAEEILKLLKTVLDAIADSEIASYE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL K F  LG  VDELRE  + WQ L SKV  VLQ ESLI+K+    L I +LL +S   
Sbjct  61    LLNKPFEELGQYVDELREQIEDWQPLFSKVKLVLQVESLISKIWTSGLDIFQLLKTSPQH  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E    SLE+C+ K K M YE +S  I  AI + VEG G SS+ L KIA+ LSL+SNQ
Sbjct  121   LPDELGSASLEHCIQKFKHMGYEQMSTVIKDAINDQVEGVGPSSEILVKIAEGLSLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQ+EK EE EYIE +I+LVT MH+ LIM+KQSESC+ V IPADF
Sbjct  181   EILIEAVALEKLKENAEQSEKIEEAEYIEHLISLVTCMHERLIMIKQSESCSPVPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WI LGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERIFIKNWIGLGLTVCPKTRQTLAHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP K+ ++      +   + GAP+D  IF HSR + S SP+S     SP
Sbjct  301   NWCESNNVKLPDPAKAAHL------LGQAEPGAPKDSSIFPHSRVSQSMSPESTRSTGSP  354

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K+  SS  + +E SSP HPRS+SE SLP I G    LD+ER+SL  SEDR AN  +RS 
Sbjct  355   SKNLFSSGPLYQERSSPLHPRSTSEGSLPGIVGTRQDLDIERISLANSEDRSANLEERST  414

Query  1617  NSVSHFSMPLSMNSVSS--ADENSHQGHNRTTSAPSTLSNSNFSRANAHDGN---EVSSP  1453
             +  S  SM  S + + +    E S Q HNRT SA S LSN+N S+    +GN   +VS+ 
Sbjct  415   DLDSQHSMSPSRDELPNFIEVEQSSQNHNRTASASSVLSNANCSQGTPVNGNGALQVSTS  474

Query  1452  TTA-STEASMEVASESRHAATLAASRRESEFPSPVGTRLRPP-AIWRRPSERLVSRIVSS  1279
              +  S++AS E+ SE +  ATLA  +R++E P+ +    RP   +WRRPS  L+ RIVSS
Sbjct  475   LSGYSSDASGELKSEPQAVATLAPQQRQTESPTRI-VEARPRNQMWRRPSS-LIPRIVSS  532

Query  1278  PTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISL  1099
             P +ETR DL+E++ QVR LVEDLKSTS+D QR AT +LRLLAKHNMDNRIVI++CGAI L
Sbjct  533   PPIETRPDLSELEAQVRNLVEDLKSTSLDTQREATFQLRLLAKHNMDNRIVIASCGAIGL  592

Query  1098  LVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAAT  919
             LV+LL S D  VQENAVTALLNLSINDNNK+AIA A AIEPLI+VLETGS EAKENSAAT
Sbjct  593   LVDLLRSADTRVQENAVTALLNLSINDNNKTAIATANAIEPLIHVLETGSAEAKENSAAT  652

Query  918   LFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGA  739
             LFSLSVIEDNK++IGRSGA++ LVDLLGNG+PRG+KDAATALFNLSI HENKGRIVQAGA
Sbjct  653   LFSLSVIEDNKVRIGRSGAIRPLVDLLGNGSPRGRKDAATALFNLSIFHENKGRIVQAGA  712

Query  738   VRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAA  559
             V++LVELMDPAAGMVDKAVAVL+NL+TI +GR +IGQEGGIP+LVEVVELGSARGKENAA
Sbjct  713   VKYLVELMDPAAGMVDKAVAVLANLSTIPDGRTAIGQEGGIPVLVEVVELGSARGKENAA  772

Query  558   AALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             AALLQLCTNS+RYC+ VLQ GAVPPLV LSQSGTPRA+EKAQ LLSYFRN R GNAGRG
Sbjct  773   AALLQLCTNSNRYCSQVLQEGAVPPLVVLSQSGTPRAKEKAQTLLSYFRNHRQGNAGRG  831



>ref|XP_011025265.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011025266.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011025267.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011025268.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
Length=840

 Score =   977 bits (2525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/841 (67%), Positives = 653/841 (78%), Gaps = 10/841 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LL+VLL NIS F H+S    I+S+ V KYYQK E+ILKLL+PIL  IV++E+ASDE
Sbjct  1     MEISLLEVLLKNISGFLHISKDNKISSDPVQKYYQKAEEILKLLKPILDTIVNSEVASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F  LG SVDELRE+F+ WQ LSSKV+FVLQ ESL +K+ +  L   +LL +S   
Sbjct  61    VLNKDFQELGQSVDELREIFENWQPLSSKVHFVLQIESLTSKICSLGLNSFQLLKASHQQ  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S +SLENC+ KIK   Y   S+ I +AI +  EG G SS+ L KIAD L L+SNQ
Sbjct  121   LPNELSSSSLENCIQKIKLSGYVKTSSIIKEAISDREEGVGPSSEILVKIADSLCLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQAEK  E E+I+QII LVT MH+ L+++KQS++ + V IPADF
Sbjct  181   EILIEAVALEKLKENAEQAEKTAEAEFIDQIITLVTRMHERLVLIKQSQTYSPVPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WI+LGLTVCPKT+Q L HTNLI NYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKNWIELGLTVCPKTQQALAHTNLITNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDPIKS++ NQPS  + H +S   R+ H+ SH R +   S +S     SP
Sbjct  301   NWCESNNVKLPDPIKSMSFNQPSQLLGHAESITSRE-HVLSHPRGSQPISSESNQATGSP  359

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMS-LEGSEDRLANSGDRS  1621
              ++ I SS IQRE SSP H  S+SE SL  I G+  GLD+ R+S L  SE+R +NS +R+
Sbjct  360   GQNMIPSSGIQREGSSPLHSDSTSESSLSVIVGNGQGLDIARISSLMSSEERSSNSEERN  419

Query  1620  MNSVSHFSMPLSMNSVSSA---DENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSP-  1453
             +NSV H S   S   VS+A   D    Q HNR+ SA S L ++   +  + D NE S   
Sbjct  420   LNSVHHCSASPSRKEVSTAVRADGLLSQNHNRSASASSALGHAALPQGASGDANESSEFS  479

Query  1452  ---TTASTEASMEVASESRHAATLAASRRESEFPSP-VGTRLRPPAIWRRPSERLVSRIV  1285
                T+ S++ S EV  E + ++ L    RE EFPS  V TR R   IWRRPS+RLV RIV
Sbjct  480   NHLTSYSSDISGEVKPEPQASSALHTPHREPEFPSRLVDTRSRSQTIWRRPSDRLVPRIV  539

Query  1284  SSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAI  1105
             SS  +ETR DLA ++ +VR LVEDLKST VD QR ATA+LRLLAKHNMDNRIVI+N GAI
Sbjct  540   SSSAIETRTDLAGIETEVRNLVEDLKSTLVDTQRDATAKLRLLAKHNMDNRIVIANFGAI  599

Query  1104  SLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSA  925
             SLLVNLL S D+++QENAVTALLNLSINDNNK+AI NA AIEPLI+VL TGSPEAKENSA
Sbjct  600   SLLVNLLRSTDIKIQENAVTALLNLSINDNNKTAIGNADAIEPLIHVLVTGSPEAKENSA  659

Query  924   ATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA  745
             ATLFSLSVIEDNK++IGRSGA+  LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQA
Sbjct  660   ATLFSLSVIEDNKVRIGRSGAIVPLVDLLGNGTPRGKKDAATALFNLSIFHENKDRIVQA  719

Query  744   GAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKEN  565
             GAV+HLVELMDPAAGMVDKAVAVL+NLAT+ EGR +IGQEGGIP+LVEVVELGSARGKEN
Sbjct  720   GAVKHLVELMDPAAGMVDKAVAVLANLATVPEGRNAIGQEGGIPVLVEVVELGSARGKEN  779

Query  564   AAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             AAAALLQLCTNSSR+C+MVLQ GAVPPLVALSQSGTPRA+EKAQALLSYFRNQRHGNAGR
Sbjct  780   AAAALLQLCTNSSRFCHMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGR  839

Query  384   G  382
              
Sbjct  840   A  840



>ref|XP_010243920.1| PREDICTED: U-box domain-containing protein 4 [Nelumbo nucifera]
Length=839

 Score =   962 bits (2486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/842 (64%), Positives = 658/842 (78%), Gaps = 13/842 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI  LK LLNNIS   HLSS  N++SE V KYYQK ++ILKLL+ IL GIVD++ ASDE
Sbjct  1     MEISYLKALLNNISRLGHLSS-NNVDSEPVKKYYQKLDEILKLLRSILDGIVDSDKASDE  59

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F  L   VDE REL ++W  + SKVYFVLQ ES++ +++A +L++ ++L S    
Sbjct  60    ILNKTFEELDGFVDEARELIESWHPMMSKVYFVLQIESILERIQASALEVFQILKSLHQN  119

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             L A+ S  SLE+C+ K++ + YE +S  I +AI++ V+ S  SS+ L K+AD LSL SNQ
Sbjct  120   LFADLSSASLEHCIQKLRCIGYEQMSTIIKEAIRDQVDNSMPSSEKLVKLADSLSLTSNQ  179

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL+E VALEK+K NAEQAEK+EEV YI+ +IALVT+MHD L+ + QS++   V IP DF
Sbjct  180   ELLMEAVALEKVKVNAEQAEKDEEVAYIDHMIALVTNMHDRLVKIMQSQNTNGVTIPPDF  239

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+RW+DLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  240   CCPLSLELMTDPVIVASGQTYERAFIKRWLDLGLTVCPKTRQTLAHTNLIPNYTVKALIA  299

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHS----RANNSTSPDSAHG  1810
             NWCE NN+KLPDP KS++++QPS+ +AH DS + RD +   +S    R+N+  SP+SA  
Sbjct  300   NWCESNNVKLPDPAKSMSLSQPSALLAHADSSS-RDTYSLPYSGTPTRSNHPKSPESARA  358

Query  1809  LDsprkssisssaiqreesspshprssseeslpEIAGDD-LGLDVERMSLEGSEDRLANS  1633
               SP K+  SS+    E +SPSHP+S+SE +L    G +  GLD+ RMSL GS+DR  NS
Sbjct  359   TCSPHKNFFSSNGTHLERTSPSHPQSASESALTSGGGSNGFGLDIGRMSLIGSDDRGINS  418

Query  1632  GDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVS--  1459
              +R++ SV   S+        SA +   +GHNR+ S  ST+S+++ ++    D NE+S  
Sbjct  419   EERNLGSVGQSSISSRKEPEDSAVDEKLKGHNRSPSVSSTVSSTDCAQGTIADANEISRV  478

Query  1458  --SPTTASTEASMEVASESRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLVSRI  1288
                 T  S++AS EV+SE   A       RE EFPS +  TR R   IWRR S+R + RI
Sbjct  479   SSDMTHYSSDASGEVSSEPP-APAALVPPREPEFPSRIAETRSRSQTIWRRQSDRFIPRI  537

Query  1287  VSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGA  1108
             VSSP + TRADL  V+ +V++LVEDL++TS+D QR AT ELRLLAKHNMDNRI+I+ CGA
Sbjct  538   VSSPAIGTRADLLGVETEVKRLVEDLRNTSIDVQRAATTELRLLAKHNMDNRIIIAECGA  597

Query  1107  ISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENS  928
             ISLLV LLHS D + QENAVTALLNLSINDNNK++IANA AI+PLI+VLETGSPEAKENS
Sbjct  598   ISLLVGLLHSADRKTQENAVTALLNLSINDNNKTSIANADAIDPLIHVLETGSPEAKENS  657

Query  927   AATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQ  748
             AATLFSLSVIE+NK+KIGRSGA++ LV+LLGNGTPRGKKDAATALFNLSI HENK RIVQ
Sbjct  658   AATLFSLSVIEENKVKIGRSGAIRPLVELLGNGTPRGKKDAATALFNLSIYHENKARIVQ  717

Query  747   AGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKE  568
             AGAVR+LVELMDPAAGMVDKAVAVL+NLATIQEGR++IGQE GIP+LVEVVELGSARGKE
Sbjct  718   AGAVRYLVELMDPAAGMVDKAVAVLANLATIQEGRVAIGQERGIPVLVEVVELGSARGKE  777

Query  567   NAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAG  388
             NAAAALLQLCTNS ++C++VLQ GAVPPLVALSQSGTPRA+EKAQALLSYFRNQRHGNAG
Sbjct  778   NAAAALLQLCTNSHKFCSLVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAG  837

Query  387   RG  382
             RG
Sbjct  838   RG  839



>ref|XP_004287978.1| PREDICTED: U-box domain-containing protein 4-like [Fragaria vesca 
subsp. vesca]
Length=839

 Score =   962 bits (2486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/841 (66%), Positives = 645/841 (77%), Gaps = 13/841 (2%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             GGMEI +LK LLN+ISSFFH SS ENIN + V KYYQK E+ILKLL+ +L  IVD+EIAS
Sbjct  5     GGMEISMLKALLNSISSFFHFSSHENINVDPVQKYYQKAEEILKLLKTVLDAIVDSEIAS  64

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
              E+L K F  LGH ++ELRE F+ WQ LSSKV  VLQ ESLI+K+   SL + +LL +S+
Sbjct  65    YEVLNKPFEELGHYLEELREQFEDWQPLSSKVNLVLQVESLISKIPTCSLDVFQLLKTSE  124

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
               LP E    SLE C+ K+K M YE  S  I  AI   VEG G SS+ L KIA+ LSL+S
Sbjct  125   QHLPDELGSASLELCIQKVKHMSYEKTSTVIKDAISVLVEGVGPSSEILVKIAEGLSLRS  184

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQE+LIE VALEKLKENAEQ+EK EE EYIE +IALVT MH+ LI +KQSESC++V IPA
Sbjct  185   NQEILIEAVALEKLKENAEQSEKIEEAEYIEHMIALVTRMHERLITIKQSESCSAVPIPA  244

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELMTDPVIVASGQTYER FI+ WI+LGLTVCPKTRQTL HTNLIPNYTVKAL
Sbjct  245   DFCCPLSLELMTDPVIVASGQTYERTFIKNWINLGLTVCPKTRQTLAHTNLIPNYTVKAL  304

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLD  1804
             IANWCE NN+KLPDP KS+++N+P+  + H + G P+D  I   SR N S SPDS   + 
Sbjct  305   IANWCESNNVKLPDPTKSMDLNKPTHLLGHAEPGVPKDSPIHPRSRVNPSMSPDSTRSMG  364

Query  1803  sprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDR  1624
             SP K+ ISS  + R   SP HPRS+SE SL  +AG+   LDV R+S   SEDR A   DR
Sbjct  365   SPTKNFISSGGVHRGGRSPFHPRSASEGSLSGVAGNGQVLDVARISSTSSEDRSAIIDDR  424

Query  1623  SMNSVSHFSMPLSMNSVSSADENSH--QGHNRTTSAPSTLSNSNFSRANAHDGN---EVS  1459
             + + VS  S   S +      E +   Q HNR+ SA S LSN+N  R    D N   + S
Sbjct  425   TTDLVSQQSTSPSRSEFPITTEANQLSQSHNRSASASSILSNTNGPRETTLDANGSLQTS  484

Query  1458  SPTTA-STEASMEVASESRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLVSRIV  1285
                +  S++AS E  SE + AAT    +RE E P+ +   R R P +WRRPS  L+ R+V
Sbjct  485   GNLSGYSSDASGEFKSE-QQAAT--PQQREPELPTRMPEARPRNP-MWRRPSGSLIPRMV  540

Query  1284  SSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAI  1105
             S P  ETR DL+ ++ QVR LVEDLKST++D QR AT ELR+LAKHNMDNRIVI+NCGAI
Sbjct  541   SHPPTETRPDLSGLEAQVRTLVEDLKSTTLDTQRDATYELRMLAKHNMDNRIVIANCGAI  600

Query  1104  SLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSA  925
             SLLV LL S D  VQEN+VTALLNLSINDNNK+AIA A AIEPLIYVLETGS EAKENSA
Sbjct  601   SLLVELLRSTDSRVQENSVTALLNLSINDNNKTAIATADAIEPLIYVLETGSAEAKENSA  660

Query  924   ATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA  745
             ATLFSLSVIEDNK++IGRSGA++ LVDLLGNGTPRG+KDAATALFNLSI HENK RIVQA
Sbjct  661   ATLFSLSVIEDNKVRIGRSGAIRPLVDLLGNGTPRGRKDAATALFNLSIFHENKARIVQA  720

Query  744   GAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKEN  565
             GAV++LVELMDPAAGMVDKAVAVL+NL+TI EGR +IGQEGGIP+LVEVVELGSARGKEN
Sbjct  721   GAVKYLVELMDPAAGMVDKAVAVLANLSTIPEGRTAIGQEGGIPVLVEVVELGSARGKEN  780

Query  564   AAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             AAAALLQLCTNS++YC+MVLQ GAVPPLV LSQSGTPRA+EKAQ LLSYFRN  H NAGR
Sbjct  781   AAAALLQLCTNSNKYCSMVLQEGAVPPLVVLSQSGTPRAKEKAQTLLSYFRN--HRNAGR  838

Query  384   G  382
             G
Sbjct  839   G  839



>ref|XP_010087281.1| U-box domain-containing protein 4 [Morus notabilis]
 gb|EXB28728.1| U-box domain-containing protein 4 [Morus notabilis]
Length=900

 Score =   959 bits (2480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/834 (65%), Positives = 645/834 (77%), Gaps = 20/834 (2%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G MEI LLKVLL+NISSFFHLSS  NINSE   KYYQ+ E+ILKLL+ IL   +D+E AS
Sbjct  21    GVMEISLLKVLLDNISSFFHLSSCVNINSEPFLKYYQRAEEILKLLKTILDAFIDSEAAS  80

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
              E+L+K F  LG  +D+LRE F  W  LSSKVYF LQ ESL++K+R+ SL I +LL SS 
Sbjct  81    SEVLKKSFEELGCFIDDLREQFVNWHPLSSKVYFALQIESLLSKIRSSSLDIFQLLKSSH  140

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
               LP E    SLE+C+ KIK + +E +S  + +AIK  VEG G SS+ L KIA+ LSL+S
Sbjct  141   QVLPDELDSVSLEHCIQKIKHLGFEQMSNVLKEAIKYQVEGGGPSSEILVKIAENLSLRS  200

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQ++LIE VAL K+KENAEQ+EK +E E+++Q+IALVT MH+ LIM+KQS++C+ V IP 
Sbjct  201   NQDILIEAVALGKVKENAEQSEKTDEAEFMDQMIALVTRMHERLIMIKQSQNCSPVPIPP  260

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELMTDPVIVASGQTYER FI+ WIDLGLTVCPKTRQTL HTNLI NYTVKAL
Sbjct  261   DFCCPLSLELMTDPVIVASGQTYERAFIKNWIDLGLTVCPKTRQTLAHTNLITNYTVKAL  320

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLD  1804
             I NWCE NN+KLPDP ++  +NQPS  + + DSG  RD  +F  SR N   SP+S   + 
Sbjct  321   IVNWCESNNVKLPDPARTTGLNQPSHLLGNADSGTTRDTPVFPQSRGNQPMSPESTRPIG  380

Query  1803  sprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDR  1624
             SP     +S    RE SSP HPRS+SE SL  +AG+  GLD+ R+SL  SEDR  NS ++
Sbjct  381   SPTTIFTASGGFDREGSSPLHPRSTSEGSLSGVAGNGQGLDIARVSLTSSEDRSTNSEEK  440

Query  1623  SMNSVSHFSMPLSMNSVSSADE--NSHQGHNRTTSAPSTLSNSNFSRANAHDGNEV----  1462
             S +SV   S   S   +S+ +    S Q H+RT SA ST+S++NF +    D NE     
Sbjct  441   SPDSVGQPSTSPSRKELSNVNGVGESSQRHSRTVSASSTISSANFPQETPGDANEALHDS  500

Query  1461  SSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVS  1282
             ++ T  S++AS +V             +RE +  + V  R R   IWRRPSER   RIVS
Sbjct  501   ANLTGYSSDASGDV-------------KREPQAVAQVPARSRSHTIWRRPSERFAPRIVS  547

Query  1281  SPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAIS  1102
              P VE RADLA+V+ QVRKLVE+L+S+S+D QR ATAELRLLA++NMDNRIVI+NCGAI+
Sbjct  548   -PVVEMRADLADVEAQVRKLVEELQSSSIDTQRDATAELRLLARNNMDNRIVIANCGAIN  606

Query  1101  LLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAA  922
             LLVNLL SED ++QENAVTALLNLSINDNNK+AIANA AIEPLI+VL+TGS EAKENSAA
Sbjct  607   LLVNLLRSEDAKIQENAVTALLNLSINDNNKAAIANANAIEPLIHVLQTGSAEAKENSAA  666

Query  921   TLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAG  742
             TLFSLSVIE+NK+ IGRSGA++ LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQAG
Sbjct  667   TLFSLSVIENNKVAIGRSGAIRPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVQAG  726

Query  741   AVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENA  562
             AV++LVELMDPAAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGSARGKENA
Sbjct  727   AVKYLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGQEGGIPVLVEVVELGSARGKENA  786

Query  561   AAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRH  400
             AAALLQLCTNS R+CNMVLQ GAVPPLVALSQSGTPRA+EKAQALL+YFRN RH
Sbjct  787   AAALLQLCTNSGRFCNMVLQEGAVPPLVALSQSGTPRAKEKAQALLTYFRNHRH  840



>ref|XP_010028138.1| PREDICTED: U-box domain-containing protein 4 [Eucalyptus grandis]
 ref|XP_010028139.1| PREDICTED: U-box domain-containing protein 4 [Eucalyptus grandis]
 ref|XP_010028140.1| PREDICTED: U-box domain-containing protein 4 [Eucalyptus grandis]
 ref|XP_010028141.1| PREDICTED: U-box domain-containing protein 4 [Eucalyptus grandis]
 gb|KCW54796.1| hypothetical protein EUGRSUZ_I00736 [Eucalyptus grandis]
Length=831

 Score =   953 bits (2464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/836 (63%), Positives = 645/836 (77%), Gaps = 9/836 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LL+NIS +FHLSS ++IN E   KYY+K E+ILKL++PIL  IV +E+AS+E
Sbjct  1     MEISLLKALLSNISLYFHLSSSDSINLEPAQKYYKKAEEILKLVKPILDVIVGSEVASNE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K F  +  SV+ LRELF +WQ L SKV F+L+ E LI+K+R+      +LL S+D  
Sbjct  61    SLNKAFGEIHQSVEALRELFDSWQPLLSKVDFILRVEVLISKIRSAGFDTFQLLKSADRN  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S  SLE+CV KIK ++++   + I KAI++  EG G SS  L KIA+  SLKSNQ
Sbjct  121   LPDELSSVSLEHCVQKIKHIEFDQACSVIRKAIEDQAEGVGPSSTDLLKIAEIFSLKSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQ+E   +V+Y +Q+I ++T MHD L+++KQSE  + + IPADF
Sbjct  181   EILIEAVALEKLKENAEQSENTSDVDYFDQLITIITRMHDRLVLIKQSEIPSPIPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIR+W+DLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIRKWLDLGLTVCPKTRQTLGHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP+KS++ NQP   ++H +SGA R+ HI    R N   SP+S   + SP
Sbjct  301   NWCESNNVKLPDPMKSVSSNQPLPLLSHAESGAIREPHI----RGNPPVSPESVRHIGSP  356

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K+ ++SS + ++ +SPSHP+S S+  L  +AG   GLD+ R+SL  SE+   N  + + 
Sbjct  357   VKNFVASSGVPQDLNSPSHPQSRSDALLSTVAGGGRGLDIGRISLGASEESSVNFEEGAS  416

Query  1617  NSVSHFSMPLSMNSVSS---ADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTT  1447
             +S    S   + +  S+   ADE     H RT SA S  S ++  R ++ D N  ++ T 
Sbjct  417   DSSLQVSTSPNRSEFSNGIGADER-MLNHKRTVSASSAHSGASRPRGSSGDANGSTNMTG  475

Query  1446  ASTEASMEVASESRHAATLAASRRESEFPSP-VGTRLRPPAIWRRPSERLVSRIVSSPTV  1270
              S++AS E+  E +  A +  + RE EFP   V TR R   IWRR  +R   RIVSSP V
Sbjct  476   YSSDASGEMKPELQSPANVTTTPREPEFPPRIVETRSRSQTIWRRQPDRFGPRIVSSPAV  535

Query  1269  ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVN  1090
             E RADL+E++ +VRKLV+ LKS S + Q  ATAELRLLAKHNMDNRIVI+NCGAI+LLV 
Sbjct  536   EARADLSEIETKVRKLVDALKSDSAETQGEATAELRLLAKHNMDNRIVIANCGAINLLVG  595

Query  1089  LLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFS  910
             LL S D ++QE+AVTALLNLSINDNNK AIANA AI+PLI+VL+TG+PEAKENSAATLFS
Sbjct  596   LLRSPDTKIQEDAVTALLNLSINDNNKIAIANADAIDPLIHVLQTGTPEAKENSAATLFS  655

Query  909   LSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRH  730
             LSVIEDNK+KIGRSGA++ LVDLLGNGTPRGKKDAATALFNLSI HENKGRIVQAGAV++
Sbjct  656   LSVIEDNKVKIGRSGAIEPLVDLLGNGTPRGKKDAATALFNLSIFHENKGRIVQAGAVKY  715

Query  729   LVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAAL  550
             LVELMDPAAGMVDKAVAVL+NLATIQEGR +IGQEGGIP+LVEVVELGSARGKENAAAAL
Sbjct  716   LVELMDPAAGMVDKAVAVLANLATIQEGRNAIGQEGGIPVLVEVVELGSARGKENAAAAL  775

Query  549   LQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             LQLCTNS+R+C+ VLQ GAVPPLVALSQSGTPRA+EKAQ LL+YFRNQRHGNAGRG
Sbjct  776   LQLCTNSNRHCSKVLQEGAVPPLVALSQSGTPRAKEKAQGLLTYFRNQRHGNAGRG  831



>gb|KCW54795.1| hypothetical protein EUGRSUZ_I00736 [Eucalyptus grandis]
Length=827

 Score =   943 bits (2437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/836 (63%), Positives = 642/836 (77%), Gaps = 13/836 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LL+NIS +FHLSS ++IN E   KYY+K E+ILKL++PIL  IV +E+AS+E
Sbjct  1     MEISLLKALLSNISLYFHLSSSDSINLEPAQKYYKKAEEILKLVKPILDVIVGSEVASNE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K F  +  SV+ LRELF +WQ L SKV F+L+ E LI+K+R+      +LL S+D  
Sbjct  61    SLNKAFGEIHQSVEALRELFDSWQPLLSKVDFILRVEVLISKIRSAGFDTFQLLKSADRN  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S  SLE    KIK ++++   + I KAI++  EG G SS  L KIA+  SLKSNQ
Sbjct  121   LPDELSSVSLE----KIKHIEFDQACSVIRKAIEDQAEGVGPSSTDLLKIAEIFSLKSNQ  176

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQ+E   +V+Y +Q+I ++T MHD L+++KQSE  + + IPADF
Sbjct  177   EILIEAVALEKLKENAEQSENTSDVDYFDQLITIITRMHDRLVLIKQSEIPSPIPIPADF  236

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIR+W+DLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  237   CCPLSLELMTDPVIVASGQTYERAFIRKWLDLGLTVCPKTRQTLGHTNLIPNYTVKALIA  296

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP+KS++ NQP   ++H +SGA R+ HI    R N   SP+S   + SP
Sbjct  297   NWCESNNVKLPDPMKSVSSNQPLPLLSHAESGAIREPHI----RGNPPVSPESVRHIGSP  352

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K+ ++SS + ++ +SPSHP+S S+  L  +AG   GLD+ R+SL  SE+   N  + + 
Sbjct  353   VKNFVASSGVPQDLNSPSHPQSRSDALLSTVAGGGRGLDIGRISLGASEESSVNFEEGAS  412

Query  1617  NSVSHFSMPLSMNSVSS---ADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTT  1447
             +S    S   + +  S+   ADE     H RT SA S  S ++  R ++ D N  ++ T 
Sbjct  413   DSSLQVSTSPNRSEFSNGIGADER-MLNHKRTVSASSAHSGASRPRGSSGDANGSTNMTG  471

Query  1446  ASTEASMEVASESRHAATLAASRRESEFPSP-VGTRLRPPAIWRRPSERLVSRIVSSPTV  1270
              S++AS E+  E +  A +  + RE EFP   V TR R   IWRR  +R   RIVSSP V
Sbjct  472   YSSDASGEMKPELQSPANVTTTPREPEFPPRIVETRSRSQTIWRRQPDRFGPRIVSSPAV  531

Query  1269  ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVN  1090
             E RADL+E++ +VRKLV+ LKS S + Q  ATAELRLLAKHNMDNRIVI+NCGAI+LLV 
Sbjct  532   EARADLSEIETKVRKLVDALKSDSAETQGEATAELRLLAKHNMDNRIVIANCGAINLLVG  591

Query  1089  LLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFS  910
             LL S D ++QE+AVTALLNLSINDNNK AIANA AI+PLI+VL+TG+PEAKENSAATLFS
Sbjct  592   LLRSPDTKIQEDAVTALLNLSINDNNKIAIANADAIDPLIHVLQTGTPEAKENSAATLFS  651

Query  909   LSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRH  730
             LSVIEDNK+KIGRSGA++ LVDLLGNGTPRGKKDAATALFNLSI HENKGRIVQAGAV++
Sbjct  652   LSVIEDNKVKIGRSGAIEPLVDLLGNGTPRGKKDAATALFNLSIFHENKGRIVQAGAVKY  711

Query  729   LVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAAL  550
             LVELMDPAAGMVDKAVAVL+NLATIQEGR +IGQEGGIP+LVEVVELGSARGKENAAAAL
Sbjct  712   LVELMDPAAGMVDKAVAVLANLATIQEGRNAIGQEGGIPVLVEVVELGSARGKENAAAAL  771

Query  549   LQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             LQLCTNS+R+C+ VLQ GAVPPLVALSQSGTPRA+EKAQ LL+YFRNQRHGNAGRG
Sbjct  772   LQLCTNSNRHCSKVLQEGAVPPLVALSQSGTPRAKEKAQGLLTYFRNQRHGNAGRG  827



>ref|XP_010670739.1| PREDICTED: U-box domain-containing protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=836

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/840 (62%), Positives = 638/840 (76%), Gaps = 12/840 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+ L + LL+NISSF  LSS E  +SE V K  QK E+ILKLL+PIL  I+D E+ASDE
Sbjct  1     MEVSLWRALLHNISSFLCLSSREGFDSEPVRKSCQKMEEILKLLKPILDAIMDTEVASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +  K    LG S+DE R+LF++W LL+S+V  VLQAE L A++R   L++  +L  S   
Sbjct  61    VFSKALDELGESIDESRDLFESWHLLASRVDLVLQAELLTARMRNCVLELFWVLKDSCQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPAE S +SLE+C+ K+K++ Y+  SA I+ A+K+  +G G S + L KIADCL L+SNQ
Sbjct  121   LPAELSSSSLEHCIQKVKNIGYDTTSAIISDALKDQADGHGPSPERLIKIADCLGLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQAEKN EV+Y EQ+I+LVT MHD L+ +KQS+SCT V +PADF
Sbjct  181   EILIEAVALEKLKENAEQAEKNAEVDYFEQLISLVTRMHDRLVTLKQSQSCTPVPLPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIV+SGQTYER FIR+W+DLGLTVCPKTRQ+L HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVSSGQTYERAFIRKWLDLGLTVCPKTRQSLLHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDS--AHGLD  1804
             NWCE+  +KLPDP+KS+N +Q  + ++  DSG+ RD HI S SR N   SP+   +   D
Sbjct  301   NWCEIYKVKLPDPMKSINEDQQLALLSQSDSGSLRDPHIRSLSRGNQPASPEPIRSAAFD  360

Query  1803  sprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDR  1624
                    S    +    SP HPRSSS+ S+      + GLD+ R SLE   DRL+NS  +
Sbjct  361   GKNSGYSSDLHREGASPSPLHPRSSSDSSMFRTVEKEHGLDIGRASLE---DRLSNSERK  417

Query  1623  SMNS-VSHFSMPLS---MNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVS-  1459
             S++S   H   P      N+VSS ++ S +    ++   + +S  N ++  + D N++S 
Sbjct  418   SVDSNGQHLVSPARREYANAVSSHEQPSERDDGMSSDG-NRVSEMNLAQRLSGDANQISQ  476

Query  1458  SPTTASTEASMEVASESRHAATLAASRRESEFPS-PVGTRLRPPAIWRRPSERLVSRIVS  1282
             S    S +AS E++ E   AA  + S RE + PS  +G+R R   IWRRPS+RL+ R++S
Sbjct  477   SSGVDSRDASGELSEEQHVAAPESTSHREPDLPSRQMGSRSRSQNIWRRPSDRLMPRMIS  536

Query  1281  SPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAIS  1102
             SPT ETR DL+E + +V+KLVEDLKS S++ QR AT +LRLLAKHNMDNRIVI+NCGAI 
Sbjct  537   SPTTETRPDLSETEAEVKKLVEDLKSDSIETQREATCQLRLLAKHNMDNRIVIANCGAIK  596

Query  1101  LLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAA  922
             LLV+LL S D++ QENAVTALLNLSINDNNK AI NA AIEPLIYVL+TG+PEA+ENSAA
Sbjct  597   LLVDLLQSTDLKTQENAVTALLNLSINDNNKMAIGNADAIEPLIYVLQTGTPEARENSAA  656

Query  921   TLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAG  742
             TLFSLSVIE+NK KIGRSGA+  LVDLLGNGTPRGKKDAATALFNLSI H+NK RIVQAG
Sbjct  657   TLFSLSVIEENKSKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHDNKARIVQAG  716

Query  741   AVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENA  562
             AVRHLVELMDPAAGMVDKAVAVL+NLATI EGR +IG   GIP+LVEVVELGSARGKENA
Sbjct  717   AVRHLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGSARGIPVLVEVVELGSARGKENA  776

Query  561   AAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             AAALLQLCT SSR+CNMVLQ GAVPPLV+LSQSGTPRAREKAQ+LLSYFR+QRH N+  G
Sbjct  777   AAALLQLCTFSSRFCNMVLQEGAVPPLVSLSQSGTPRAREKAQSLLSYFRSQRHTNSRGG  836



>ref|XP_003551173.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max]
Length=841

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/840 (62%), Positives = 633/840 (75%), Gaps = 6/840 (1%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G MEI LLK+++N +SSF HLS   N+NSE V KYYQK E+I KLL+PI+  IV+ E+AS
Sbjct  2     GVMEISLLKMIVNGMSSFLHLSFSGNMNSEPVSKYYQKAEEIHKLLKPIIDAIVNPELAS  61

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             DE+L K+   +G +V+EL+E  + W LLSSKVYFV+Q E LI+++R   L I + L  S 
Sbjct  62    DEVLNKILEEIGFAVNELKEHVENWHLLSSKVYFVMQVEPLISRIRTSGLNIFQQLKDSQ  121

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
              CLP E S   L+ C  K+K + +E +S  I +AI  H+E  G SS+ LTKIAD L L+S
Sbjct  122   HCLPDELSSEYLQLCSQKLKLLGHEEISPVIKEAITEHLENVGPSSELLTKIADSLGLRS  181

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQE+LIE VALE+LKENAEQ EK  E E+I+Q+IA+VT MH+ L+M+KQ++S + V IPA
Sbjct  182   NQEVLIEAVALERLKENAEQTEKTAEAEFIDQMIAVVTRMHERLVMLKQAQSSSPVSIPA  241

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELMTDPVIVASGQTYER FI+ WIDLGLTVCPKTRQTL HT+LIPNYTVKAL
Sbjct  242   DFCCPLSLELMTDPVIVASGQTYERAFIKNWIDLGLTVCPKTRQTLVHTHLIPNYTVKAL  301

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLD  1804
             IANWCE NN++L DP KS N+NQ S    +++SG  R+  +F+HSR+N  +SP+SA    
Sbjct  302   IANWCESNNVQLVDPTKSTNLNQASVLHGYMESGTTRESPVFAHSRSNQPSSPESARSCS  361

Query  1803  sprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDR  1624
                 ++  +S   + E +      S+ E       +   +D+ R+S EG +DR A+S + 
Sbjct  362   FSSPANNLTSGGTQREGTSPLHPRSTSEGSFRGMVNGQYMDLARISPEGLDDRSASSDES  421

Query  1623  SMNSVSHFSM-PLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGN---EVSS  1456
             S++S SH SM P    S S+      Q H R  S  S LSN+NF +    D N   ++S+
Sbjct  422   SVDSASHPSMSPSRRESSSAFSSEQSQTHIRAVSDSSALSNANFPQETQDDDNNAPQLST  481

Query  1455  PTTASTEASMEV--ASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVS  1282
                 S EAS E+   +E+     + +  RE EFP  + TR R  AIWRRPSER V RIVS
Sbjct  482   SAGHSREASGELNPGTETGGTTAVPSVHREPEFPLRLETRSRSQAIWRRPSERHVPRIVS  541

Query  1281  SPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAIS  1102
             SP VETRADL+ ++ QVR LVE L+S+ VD QR ATAELRLLAKHNMDNRI I+NCGAI+
Sbjct  542   SPVVETRADLSAIETQVRNLVEGLRSSDVDTQREATAELRLLAKHNMDNRIAIANCGAIN  601

Query  1101  LLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAA  922
             LLV+LL S D  +QENAVTALLNLSINDNNK+AIANAGAIEPLI+VLETGSPEAKENSAA
Sbjct  602   LLVDLLQSTDTTIQENAVTALLNLSINDNNKTAIANAGAIEPLIHVLETGSPEAKENSAA  661

Query  921   TLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAG  742
             TLFSLSVIE+NKI IGRSGA+  LV+LLG+GTPRGK+DAATALFNLSI HENK RIVQAG
Sbjct  662   TLFSLSVIEENKIFIGRSGAIGPLVELLGSGTPRGKRDAATALFNLSIFHENKNRIVQAG  721

Query  741   AVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENA  562
             AVRHLV+LMDPAAGMVDKAVAVL+NLATI EGR +IG EGGIP+LVEVVELGSARGKENA
Sbjct  722   AVRHLVDLMDPAAGMVDKAVAVLANLATIPEGRNAIGDEGGIPVLVEVVELGSARGKENA  781

Query  561   AAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             AAALL LC +S ++ + VLQ GAVPPLVALSQSGTPRA+EKAQALL+ F++QRHG++GRG
Sbjct  782   AAALLHLCLHSPKFSSKVLQQGAVPPLVALSQSGTPRAKEKAQALLNQFKSQRHGSSGRG  841



>gb|KHN48396.1| U-box domain-containing protein 4 [Glycine soja]
Length=838

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/838 (62%), Positives = 632/838 (75%), Gaps = 6/838 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK+++N +SSF HLS   N+NSE V KYYQK E+I KLL+PI+  IV+ E+ASDE
Sbjct  1     MEISLLKMIVNGMSSFLHLSFSGNMNSEPVSKYYQKAEEIHKLLKPIIDAIVNPELASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K+   +G +V+EL+E  + W LLSSKVYFV+Q E LI+++R   L I + L  S  C
Sbjct  61    VLNKILEEIGFAVNELKEHVENWHLLSSKVYFVMQVEPLISRIRTSGLNIFQQLKDSQHC  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S   L+ C  K+K + +E +S  I +AI  H+E  G SS+ LTKIAD L L+SNQ
Sbjct  121   LPDELSSEYLQLCSQKLKLLGHEEISPVIKEAITEHLENVGPSSELLTKIADSLGLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALE+LKENAEQ EK  E E+I+Q+IA+VT MH+ L+M+KQ++S + V IPADF
Sbjct  181   EVLIEAVALERLKENAEQTEKTAEAEFIDQMIAVVTRMHERLVMLKQAQSSSPVSIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WIDLGLTVCPKTRQTL HT+LIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKNWIDLGLTVCPKTRQTLVHTHLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN++L DP KS N+NQ S    +++SG  R+  +F+HSR+N  +SP+SA      
Sbjct  301   NWCESNNVQLVDPTKSTNLNQASVLHGYMESGTTRESPVFAHSRSNQPSSPESARSRSFS  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
               ++  +S   + E +      S+ E       +   +D+ R+S EG +DR A+S + S+
Sbjct  361   SPANNLTSGGTQREGTSPLHPRSTSEGSFRGMVNGQYMDLARISPEGLDDRSASSDESSV  420

Query  1617  NSVSHFSM-PLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGN---EVSSPT  1450
             +S SH SM P    S S+      Q H R  S  S LSN+NF +    D N   ++S+  
Sbjct  421   DSASHPSMSPSRRESSSAFSSEQSQTHIRAVSDSSALSNANFPQETQDDDNNAPQLSTSA  480

Query  1449  TASTEASMEV--ASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSP  1276
               S EAS E+   +E+     + +  RE EFP  + TR R  AIWRRPSER V RIVSSP
Sbjct  481   GHSREASGELNPGTETGGTTAVPSVHREPEFPLRLETRSRSQAIWRRPSERHVPRIVSSP  540

Query  1275  TVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLL  1096
              VETRADL+ ++ QVR LVE LKS+ VD QR ATAELRLLAKHNMDNRI I+NCGAI++L
Sbjct  541   VVETRADLSAIETQVRNLVEGLKSSDVDTQREATAELRLLAKHNMDNRIAIANCGAINVL  600

Query  1095  VNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATL  916
             V+LL S D  +QENAVTALLNLSINDNNK+AIANAGAIEPLI+VLETGSPEAKENSAATL
Sbjct  601   VDLLQSTDTTIQENAVTALLNLSINDNNKTAIANAGAIEPLIHVLETGSPEAKENSAATL  660

Query  915   FSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAV  736
             FSLSVIE+NKI IGRSGA+  LV+LLG+GTPRGK+DAATALFNLSI HENK RIVQAGAV
Sbjct  661   FSLSVIEENKIFIGRSGAIGPLVELLGSGTPRGKRDAATALFNLSIFHENKNRIVQAGAV  720

Query  735   RHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAA  556
             RHLV+LMDPAAGMVDKAVAVL+NLATI EGR +IG EGGIP+LVEVVELGSARGKENAAA
Sbjct  721   RHLVDLMDPAAGMVDKAVAVLANLATIPEGRNAIGDEGGIPVLVEVVELGSARGKENAAA  780

Query  555   ALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             ALL LC +S ++ + VLQ GAVPPLVALSQSGTPRA+EKAQALL+ F++QRHG++GRG
Sbjct  781   ALLHLCLHSPKFSSKVLQQGAVPPLVALSQSGTPRAKEKAQALLNQFKSQRHGSSGRG  838



>ref|XP_009367873.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Pyrus x bretschneideri]
Length=792

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/839 (64%), Positives = 625/839 (74%), Gaps = 54/839 (6%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI L K LLNNISSFFHLSS +NIN + V KY ++ E+ILKLL+ +L  I D+EIAS E
Sbjct  1     MEISLFKALLNNISSFFHLSSHDNINFDPVLKYCKRAEEILKLLKTVLDAIADSEIASYE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL K F  LG  VDELRE  + WQ L SKV                              
Sbjct  61    LLNKPFEELGQYVDELREQIEDWQPLFSKVKL----------------------------  92

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
                        +C+ K K M YE +S  I  AI + VEG G SS+ L KIA+ LSL+SNQ
Sbjct  93    -----------HCIQKFKHMGYEQMSTVIKDAINDQVEGVGPSSEILVKIAEGLSLRSNQ  141

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQ+EK EE EYIE +I+LVT MH+ LIM+KQSESC+ V IPADF
Sbjct  142   EILIEAVALEKLKENAEQSEKIEEAEYIEHLISLVTCMHERLIMIKQSESCSPVPIPADF  201

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WI LGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  202   CCPLSLELMTDPVIVASGQTYERIFIKNWIGLGLTVCPKTRQTLAHTNLIPNYTVKALIA  261

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP K+ ++      +   + GAP+D  IF HSR + S SP+S     SP
Sbjct  262   NWCESNNVKLPDPAKAAHL------LGQAEPGAPKDSSIFPHSRVSQSMSPESTRSTGSP  315

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K+  SS  + +E SSP HPRS+SE SLP I G    LD+ER+SL  SEDR AN  +RS 
Sbjct  316   SKNLFSSGPLYQERSSPLHPRSTSEGSLPGIVGTRQDLDIERISLANSEDRSANLEERST  375

Query  1617  NSVSHFSMPLSMNSVSS--ADENSHQGHNRTTSAPSTLSNSNFSRANAHDGN---EVSSP  1453
             +  S  SM  S + + +    E S Q HNRT SA S LSN+N S+    +GN   +VS+ 
Sbjct  376   DLDSQHSMSPSRDELPNFIEVEQSSQNHNRTASASSVLSNANCSQGTPVNGNGALQVSTS  435

Query  1452  TTA-STEASMEVASESRHAATLAASRRESEFPSPVGTRLRPP-AIWRRPSERLVSRIVSS  1279
              +  S++AS E+ SE +  ATLA  +R++E P+ +    RP   +WRRPS  L+ RIVSS
Sbjct  436   LSGYSSDASGELKSEPQAVATLAPQQRQTESPTRI-VEARPRNQMWRRPSS-LIPRIVSS  493

Query  1278  PTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISL  1099
             P +ETR DL+E++ QVR LVEDLKSTS+D QR AT +LRLLAKHNMDNRIVI++CGAI L
Sbjct  494   PPIETRPDLSELEAQVRNLVEDLKSTSLDTQREATFQLRLLAKHNMDNRIVIASCGAIGL  553

Query  1098  LVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAAT  919
             LV+LL S D  VQENAVTALLNLSINDNNK+AIA A AIEPLI+VLETGS EAKENSAAT
Sbjct  554   LVDLLRSADTRVQENAVTALLNLSINDNNKTAIATANAIEPLIHVLETGSAEAKENSAAT  613

Query  918   LFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGA  739
             LFSLSVIEDNK++IGRSGA++ LVDLLGNG+PRG+KDAATALFNLSI HENKGRIVQAGA
Sbjct  614   LFSLSVIEDNKVRIGRSGAIRPLVDLLGNGSPRGRKDAATALFNLSIFHENKGRIVQAGA  673

Query  738   VRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAA  559
             V++LVELMDPAAGMVDKAVAVL+NL+TI +GR +IGQEGGIP+LVEVVELGSARGKENAA
Sbjct  674   VKYLVELMDPAAGMVDKAVAVLANLSTIPDGRTAIGQEGGIPVLVEVVELGSARGKENAA  733

Query  558   AALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             AALLQLCTNS+RYC+ VLQ GAVPPLV LSQSGTPRA+EKAQ LLSYFRN R GNAGRG
Sbjct  734   AALLQLCTNSNRYCSQVLQEGAVPPLVVLSQSGTPRAKEKAQTLLSYFRNHRQGNAGRG  792



>ref|XP_002524955.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF37452.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=799

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/842 (63%), Positives = 613/842 (73%), Gaps = 77/842 (9%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LL+NISSF HLSS++NI S+LV K YQK E+ILKLL+PIL  IVD+EIASDE
Sbjct  25    MEISLLKALLSNISSFLHLSSIDNICSDLVQKCYQKAEEILKLLKPILDAIVDSEIASDE  84

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F  LG SVDELRELF+ WQ LSSKV+FVLQ ESLI+K+R   L I +LL SS   
Sbjct  85    VLTKAFDELGQSVDELRELFENWQPLSSKVFFVLQIESLISKIRTLGLDIFQLLKSSHEH  144

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E                                                 LS  S +
Sbjct  145   LPDE-------------------------------------------------LSTSSLE  155

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQAEK  E E  +Q+I+L             S++C+ V IPADF
Sbjct  156   EILIEAVALEKLKENAEQAEKPREAELFDQMISL-------------SQTCSHVPIPADF  202

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIV SGQTYER FI+ WI+LGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  203   CCPLSLELMTDPVIVGSGQTYERAFIKNWIELGLTVCPKTRQTLAHTNLIPNYTVKALIA  262

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP+KS++ NQPS+ + H +SG PR  H F +SR N   SP+S    DSP
Sbjct  263   NWCESNNVKLPDPVKSVSFNQPSALLIHAESGTPRGSHGF-YSRGNQPMSPESTRSTDSP  321

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              ++ ISSS  +   S      +S       I G++ GLD+ R+SL  SE+R  N   R+ 
Sbjct  322   DRNWISSSVHRESTSPCHPRSTSDSSLSG-IVGNEQGLDMARISLASSEERSVNLEGRNR  380

Query  1617  NSVSHFSMPLSMNSVSSA---DENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSP--  1453
             +S    S+  S N VS+A    E   Q H+R  SA S   N++FS+    D N+ S    
Sbjct  381   DSGVRHSVSPSRNEVSNAVRVGEPIAQSHSRNASASSI--NASFSQGAQVDTNDSSEVLN  438

Query  1452  --TTASTEASMEVASESRHAATLAASR--RESEF-PSPVGTRLRPPAIWRRPSERLVSRI  1288
               T+ S++ S EV +E++ +  L + R  RE EF P  + TR R   IWRRPS+RL+ RI
Sbjct  439   HLTSYSSDNSGEVKAETQASTALNSPRPHREPEFAPRFIETRSRSQTIWRRPSDRLIPRI  498

Query  1287  VSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGA  1108
             VSSP +ETRADL+ V+ QVR LVEDLKS S+D QR ATAELRLLAKHNMDNRIVI+NCGA
Sbjct  499   VSSPAIETRADLSGVETQVRNLVEDLKSDSIDVQRAATAELRLLAKHNMDNRIVIANCGA  558

Query  1107  ISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENS  928
             I++LVNLL S D ++QENAVTALLNLSINDNNK+AIANA AI PLI+VLETGSPEAKENS
Sbjct  559   INILVNLLRSADAKIQENAVTALLNLSINDNNKTAIANADAIGPLIHVLETGSPEAKENS  618

Query  927   AATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQ  748
             AATLFSLSVIEDNK++IGRSGAV  LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQ
Sbjct  619   AATLFSLSVIEDNKVRIGRSGAVGPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVQ  678

Query  747   AGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKE  568
             AGAV+HLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGSARGKE
Sbjct  679   AGAVKHLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGQEGGIPVLVEVVELGSARGKE  738

Query  567   NAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAG  388
             NAAAALLQLCTNS+R+CN VLQ GAVPPLVALSQSGTPRA+EKAQALLS+FRNQRHGNA 
Sbjct  739   NAAAALLQLCTNSNRFCNTVLQEGAVPPLVALSQSGTPRAKEKAQALLSFFRNQRHGNA-  797

Query  387   RG  382
             RG
Sbjct  798   RG  799



>ref|XP_003538329.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max]
Length=838

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/838 (62%), Positives = 627/838 (75%), Gaps = 6/838 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK+++N ISSF HLS   N+NS  V KYYQK E+ILKLL+PI+  IV +E+ASDE
Sbjct  1     MEISLLKMIVNGISSFLHLSFSGNMNSAPVPKYYQKAEEILKLLKPIIDAIVYSELASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K+   +  +V+EL+E  + W LLSSKVYFV+Q E LI+++R   L I   L  S  C
Sbjct  61    VLNKILEEIDLAVNELKEHVENWHLLSSKVYFVMQVEPLISRIRTSGLNIFLQLKDSQHC  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S   L++C  K+K + +E  S  I +AI  H+E  G SS+ L+KIAD L L+SNQ
Sbjct  121   LPDELSSEHLQHCSQKLKLLGHEETSPVIQEAITEHLENVGPSSELLSKIADSLGLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALE+LKENAEQ EK  E E I+Q+IA+VTHMH+ L+M+KQ++S + V IPADF
Sbjct  181   EVLIEAVALERLKENAEQTEKTAEAELIDQMIAVVTHMHERLVMLKQAQSISPVPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WIDLGLTVC KTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKNWIDLGLTVCAKTRQTLVHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN++L DP KS N+NQ      +++SG  R+  +F HSR+N  +SP+SA      
Sbjct  301   NWCESNNVQLVDPTKSTNLNQACVLHGYMESGTTRESPVFVHSRSNQPSSPESAGSRSFS  360

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
               ++  +S   + E +      S+ E       +   +D+ R+S EG +DR A+S + S+
Sbjct  361   SPANNLTSGGTQREGTSPLHPRSTSEGSLSGMVNGQYMDLARISPEGLDDRSASSDESSV  420

Query  1617  NSVSHFSM-PLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGN---EVSSPT  1450
             +S SH SM P    S S+      Q H R  S  S LSN+NF +    D N   ++S+  
Sbjct  421   DSASHPSMSPSRRESSSAFSSEQSQTHIRAVSDSSALSNANFPQETEDDNNNAPQLSTSA  480

Query  1449  TASTEASMEV--ASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSP  1276
               S EAS E+    E+    ++A+  RE EFP  + TR R  AIWRRPSER V RIVSSP
Sbjct  481   GHSREASGELNPGPETAGTTSVASVHREPEFPLRLETRSRSQAIWRRPSERHVPRIVSSP  540

Query  1275  TVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLL  1096
              VETRADL+ ++ QVR LVE LKS+ VD QR ATAELRLLAKHNMDNRI I+NCGAI++L
Sbjct  541   VVETRADLSAIETQVRNLVEGLKSSDVDTQREATAELRLLAKHNMDNRIAIANCGAINVL  600

Query  1095  VNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATL  916
             V+LL S D  +QENAVTALLNLSINDNNK+AIANAGAIEPLI+VL+TGSPEAKENSAATL
Sbjct  601   VDLLQSTDTTIQENAVTALLNLSINDNNKTAIANAGAIEPLIHVLKTGSPEAKENSAATL  660

Query  915   FSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAV  736
             FSLSVIE+NKI IGRSGA+  LV+LLG+GTPRGKKDAATALFNLSI HENK  IVQAGAV
Sbjct  661   FSLSVIEENKIFIGRSGAIGPLVELLGSGTPRGKKDAATALFNLSIFHENKNWIVQAGAV  720

Query  735   RHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAA  556
             RHLV+LMDPAAGMVDKAVAVL+NLATI EGR +IG EGGIP+LVEVVELGSARGKENAAA
Sbjct  721   RHLVDLMDPAAGMVDKAVAVLANLATIPEGRNAIGDEGGIPVLVEVVELGSARGKENAAA  780

Query  555   ALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             ALL LC +S++Y   VLQ GAVPPLVALSQSGTPRA+EKAQALL+ FR+QRHG+AGRG
Sbjct  781   ALLHLCLHSTKYLGKVLQQGAVPPLVALSQSGTPRAKEKAQALLNQFRSQRHGSAGRG  838



>ref|XP_008457779.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis melo]
Length=841

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/846 (62%), Positives = 624/846 (74%), Gaps = 19/846 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M + LLKVLL +ISSF  LSS + IN +   KYY K E  LKLL+PIL  +VD++IASDE
Sbjct  1     MGVSLLKVLLRHISSFLQLSSSDYINLQPTLKYYHKIEGALKLLRPILDAVVDSDIASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L + F  L HSVDELR LF+ WQ LSSKVYFVLQ+E+LI+K+  FSL I +LL SS+  
Sbjct  61    ELTQAFEELDHSVDELRVLFENWQPLSSKVYFVLQSETLISKIGKFSLDIFQLLQSSNEN  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S  SLE+CV KIK++  E +S+ I  AI+N V+G   SSD L K+AD LSL+SNQ
Sbjct  121   LPEELSSKSLEHCVQKIKNIGKEEISSVIKDAIRNQVDGIAPSSDVLVKLADSLSLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
              +LIE VALEKLKE+AEQAE   E E I+Q+IALVT MH+ LIM+KQS+S + V IP DF
Sbjct  181   AILIEAVALEKLKESAEQAENTGEAEDIDQMIALVTRMHERLIMIKQSQSTSPVSIPPDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WID GL VCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERVFIKNWIDQGLNVCPKTRQTLVHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIH---IFSHSRANNSTSPDSAHGL  1807
             NWC+ NN+KL DP KS+N+NQ S  +  V S  P D H   +F HS      SP S    
Sbjct  301   NWCDTNNVKLSDPSKSVNLNQLSPLL--VGSFEP-DTHREPLFPHSPGYQPMSPQSTRSA  357

Query  1806  DsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGD  1627
              S +  +      +   SS      S +    + AGD+ G++V R+ L  SE+++    +
Sbjct  358   GSGKNLNSLGGTHRDGSSSLLSHSLSEDSLSND-AGDERGIEVSRLLLSSSEEQMTKLEE  416

Query  1626  RSMNSVSHFSMPLSMNSVSSA---DENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS  1456
                + V+  S   S  +V +    DE SH GHNR++S  S +SN+N SR  + + NE + 
Sbjct  417   NGCDPVAKPSTSPSGTNVPNTCGEDEPSH-GHNRSSSTSSGVSNANHSRGTSGEANEATH  475

Query  1455  PTTASTEASMEVASESRH------AATLAASRRESEFPSPVGTRLRPPA--IWRRPSERL  1300
              +T  T    + A ES+       A++      E E P  +    RP    +W RPSER 
Sbjct  476   LSTNLTGYGSDAAGESKSEPLAVAASSTNYREPEREHPPRLADHPRPRGNTMWLRPSERF  535

Query  1299  VSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVIS  1120
              SRI++S   ETR DL+ ++ QV+K+VE+LKS+S+D  R ATAELRLLAKHNMDNRIVI+
Sbjct  536   ASRIITSSANETRPDLSAIEAQVQKVVEELKSSSLDTLRGATAELRLLAKHNMDNRIVIA  595

Query  1119  NCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEA  940
              CGAI  LV LL SED ++QENAVTALLNLSINDNNKSAIA A AIEPLI+VL+TGSPEA
Sbjct  596   QCGAIDYLVGLLLSEDSKIQENAVTALLNLSINDNNKSAIAQANAIEPLIHVLKTGSPEA  655

Query  939   KENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKG  760
             KENSAATLFSLSVIE+NK+KIGRSGA+  LV+LLGNGTPRGKKDAATALFNLSI HENK 
Sbjct  656   KENSAATLFSLSVIEENKVKIGRSGAIGPLVELLGNGTPRGKKDAATALFNLSIFHENKA  715

Query  759   RIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSA  580
             RIVQAGAVRHLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGSA
Sbjct  716   RIVQAGAVRHLVELMDPAAGMVDKAVAVLANLATIPEGRSAIGQEGGIPVLVEVVELGSA  775

Query  579   RGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRH  400
             RGKENAAAALLQLCT S+R+C+MVLQ GAVPPLVALSQSGT RA+EKAQALLS+FR+QRH
Sbjct  776   RGKENAAAALLQLCTTSNRHCSMVLQEGAVPPLVALSQSGTARAKEKAQALLSHFRSQRH  835

Query  399   GNAGRG  382
             GN+GRG
Sbjct  836   GNSGRG  841



>gb|KDO79032.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
Length=729

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/737 (67%), Positives = 581/737 (79%), Gaps = 12/737 (2%)
 Frame = -2

Query  2580  IAKVRAFSLKIVELLVSSDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEG  2401
             ++K+R   L I+  L SS    P E S TSLE C  KIK M+YE  S+ I +AI++ V+G
Sbjct  1     MSKIRTSGLDIMLQLKSSLQYFPGELSSTSLELCSQKIKHMEYEQTSSLIKEAIRDQVDG  60

Query  2400  SGASSDSLTKIADCLSLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMH  2221
                SS+ L K+A+ LSL+SNQE+LIE VALEKLKENAEQAEK  E E+++Q+I+LVT MH
Sbjct  61    VAPSSEILVKVAESLSLRSNQEILIEAVALEKLKENAEQAEKAGEAEFMDQMISLVTRMH  120

Query  2220  DCLIMMKQSESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPK  2041
             D L+M+KQS+ C+ V IP+DFCCPLSLELMTDPVIVASGQTYER FI++WIDLGL VCPK
Sbjct  121   DRLVMIKQSQICSPVPIPSDFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPK  180

Query  2040  TRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHI  1861
             TRQTL HT LIPNYTVKALIANWCE+NN+KLPDP K+ ++NQPS    H DS APRD HI
Sbjct  181   TRQTLAHTTLIPNYTVKALIANWCELNNVKLPDPTKTASLNQPSPLFVHADSNAPRDSHI  240

Query  1860  FSHSRANNSTSPDSAHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLD  1681
             F H+R N    P+S    +SP K+ +S +  +   S      +S       IAG+  GLD
Sbjct  241   FPHTRGNQQIMPESTRSTNSPAKNLVSLNNTREGSSPLHPHSTSETSYSG-IAGNGPGLD  299

Query  1680  VERMSLEGSEDRLANSGDRSMNSVSHFSMPLSMNSVSSADENSHQG---HNRTTSAPSTL  1510
             + R+SL  SEDR +NS +RSM  V   SM  S+    +  + S Q    HNRT SA S L
Sbjct  300   IARISLTSSEDRFSNSEERSMELVGQPSMSKSIKEFPATIDTSEQSSHIHNRTASASSVL  359

Query  1509  SNSNFSRANAHDGNEVSSPTTASTEASMEVASESRHAATLAASRRESEFPSPV-GTRLRP  1333
             SN N S+ +A++ +E+S+ + AS E  +E    S+ A T+   RRE EFPS V  TR R 
Sbjct  360   SNLNLSQGDANETSELSNHSDASGEGKLE----SQPATTM---RREPEFPSRVMETRSRS  412

Query  1332  PAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLA  1153
               IWRRPSER V RIVS+   ETRADL+ ++ QVRKLVEDLKSTS+D QR ATAELRLLA
Sbjct  413   QVIWRRPSERFVPRIVSTSGAETRADLSGIETQVRKLVEDLKSTSLDTQREATAELRLLA  472

Query  1152  KHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPL  973
             KHNMDNR+VI+NCGAI++LV++LHS + ++QENAVTALLNLSINDNNKSAIANA AIEPL
Sbjct  473   KHNMDNRMVIANCGAINILVDMLHSSETKIQENAVTALLNLSINDNNKSAIANANAIEPL  532

Query  972   IYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATAL  793
             I+VL+TGSPEA+EN+AATLFSLSVIEDNKIKIGRSGA+  LVDLLGNGTPRGKKDAATAL
Sbjct  533   IHVLQTGSPEARENAAATLFSLSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATAL  592

Query  792   FNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIP  613
             FNLSI HENK RIVQAGAV+HLV+LMDPAAGMVDKAVAVL+NLATI +GR++IGQE GIP
Sbjct  593   FNLSIYHENKARIVQAGAVKHLVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIP  652

Query  612   ILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQ  433
             +LVEVVELGSARGKENAAAALLQLCTNSSR+C+MVLQ GAVPPLVALSQSGTPRA+EKAQ
Sbjct  653   VLVEVVELGSARGKENAAAALLQLCTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQ  712

Query  432   ALLSYFRNQRHGNAGRG  382
             ALLSYFRNQRHGNAGRG
Sbjct  713   ALLSYFRNQRHGNAGRG  729



>gb|KCW54797.1| hypothetical protein EUGRSUZ_I00736 [Eucalyptus grandis]
Length=816

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/817 (63%), Positives = 627/817 (77%), Gaps = 9/817 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LL+NIS +FHLSS ++IN E   KYY+K E+ILKL++PIL  IV +E+AS+E
Sbjct  1     MEISLLKALLSNISLYFHLSSSDSINLEPAQKYYKKAEEILKLVKPILDVIVGSEVASNE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K F  +  SV+ LRELF +WQ L SKV F+L+ E LI+K+R+      +LL S+D  
Sbjct  61    SLNKAFGEIHQSVEALRELFDSWQPLLSKVDFILRVEVLISKIRSAGFDTFQLLKSADRN  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S  SLE+CV KIK ++++   + I KAI++  EG G SS  L KIA+  SLKSNQ
Sbjct  121   LPDELSSVSLEHCVQKIKHIEFDQACSVIRKAIEDQAEGVGPSSTDLLKIAEIFSLKSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQ+E   +V+Y +Q+I ++T MHD L+++KQSE  + + IPADF
Sbjct  181   EILIEAVALEKLKENAEQSENTSDVDYFDQLITIITRMHDRLVLIKQSEIPSPIPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIR+W+DLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIRKWLDLGLTVCPKTRQTLGHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP+KS++ NQP   ++H +SGA R+ HI    R N   SP+S   + SP
Sbjct  301   NWCESNNVKLPDPMKSVSSNQPLPLLSHAESGAIREPHI----RGNPPVSPESVRHIGSP  356

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K+ ++SS + ++ +SPSHP+S S+  L  +AG   GLD+ R+SL  SE+   N  + + 
Sbjct  357   VKNFVASSGVPQDLNSPSHPQSRSDALLSTVAGGGRGLDIGRISLGASEESSVNFEEGAS  416

Query  1617  NSVSHFSMPLSMNSVSS---ADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTT  1447
             +S    S   + +  S+   ADE     H RT SA S  S ++  R ++ D N  ++ T 
Sbjct  417   DSSLQVSTSPNRSEFSNGIGADER-MLNHKRTVSASSAHSGASRPRGSSGDANGSTNMTG  475

Query  1446  ASTEASMEVASESRHAATLAASRRESEFPSP-VGTRLRPPAIWRRPSERLVSRIVSSPTV  1270
              S++AS E+  E +  A +  + RE EFP   V TR R   IWRR  +R   RIVSSP V
Sbjct  476   YSSDASGEMKPELQSPANVTTTPREPEFPPRIVETRSRSQTIWRRQPDRFGPRIVSSPAV  535

Query  1269  ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVN  1090
             E RADL+E++ +VRKLV+ LKS S + Q  ATAELRLLAKHNMDNRIVI+NCGAI+LLV 
Sbjct  536   EARADLSEIETKVRKLVDALKSDSAETQGEATAELRLLAKHNMDNRIVIANCGAINLLVG  595

Query  1089  LLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFS  910
             LL S D ++QE+AVTALLNLSINDNNK AIANA AI+PLI+VL+TG+PEAKENSAATLFS
Sbjct  596   LLRSPDTKIQEDAVTALLNLSINDNNKIAIANADAIDPLIHVLQTGTPEAKENSAATLFS  655

Query  909   LSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRH  730
             LSVIEDNK+KIGRSGA++ LVDLLGNGTPRGKKDAATALFNLSI HENKGRIVQAGAV++
Sbjct  656   LSVIEDNKVKIGRSGAIEPLVDLLGNGTPRGKKDAATALFNLSIFHENKGRIVQAGAVKY  715

Query  729   LVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAAL  550
             LVELMDPAAGMVDKAVAVL+NLATIQEGR +IGQEGGIP+LVEVVELGSARGKENAAAAL
Sbjct  716   LVELMDPAAGMVDKAVAVLANLATIQEGRNAIGQEGGIPVLVEVVELGSARGKENAAAAL  775

Query  549   LQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREK  439
             LQLCTNS+R+C+ VLQ GAVPPLVALSQSGTPRA+EK
Sbjct  776   LQLCTNSNRHCSKVLQEGAVPPLVALSQSGTPRAKEK  812


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 79/165 (48%), Gaps = 12/165 (7%)
 Frame = -2

Query  861  VQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA--GAVRHLVELM-DPAAGMVD  691
            V+ LVD L + +   + +A TA   L   H    RIV A  GA+  LV L+  P   + +
Sbjct  548  VRKLVDALKSDSAETQGEA-TAELRLLAKHNMDNRIVIANCGAINLLVGLLRSPDTKIQE  606

Query  690  KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             AV  L NL+     +++I     I  L+ V++ G+   KEN+AA L  L          
Sbjct  607  DAVTALLNLSINDNNKIAIANADAIDPLIHVLQTGTPEAKENSAATLFSLSVIEDNKVK-  665

Query  510  VLQHGAVPPLVALSQSGTPRAREKAQAL---LSYFRNQRHGNAGR  385
            + + GA+ PLV L  +GTPR ++ A      LS F    H N GR
Sbjct  666  IGRSGAIEPLVDLLGNGTPRGKKDAATALFNLSIF----HENKGR  706



>gb|KHN46283.1| U-box domain-containing protein 4 [Glycine soja]
Length=831

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/831 (62%), Positives = 621/831 (75%), Gaps = 6/831 (1%)
 Frame = -2

Query  2856  VLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFS  2677
             +++N ISSF HLS   N+NS  V KYYQK E+ILKLL+PI+  IV +E+ASDE+L K+  
Sbjct  1     MIVNGISSFLHLSFSGNMNSAPVPKYYQKAEEILKLLKPIIDAIVYSELASDEVLNKILE  60

Query  2676  GLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSL  2497
              +  +V+EL+E  + W LLSSKVYFV+Q E LI+++R   L I   L  S  CLP E S 
Sbjct  61    EIDLAVNELKEHVENWHLLSSKVYFVMQVEPLISRIRTSGLNIFLQLKDSQHCLPDELSS  120

Query  2496  TSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELV  2317
               L++C  K+K + +E  S  I +AI  H+E  G SS+ L+KIAD L L+SNQE+LIE V
Sbjct  121   EHLQHCSQKLKLLGHEETSPVIQEAITEHLENVGPSSELLSKIADSLGLRSNQEVLIEAV  180

Query  2316  aleklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLE  2137
             ALE+LKENAEQ EK  E E I+Q+IA+VTHMH+ L+M+KQ++S + V IPADFCCPLSLE
Sbjct  181   ALERLKENAEQTEKTAEAELIDQMIAVVTHMHERLVMLKQAQSISPVPIPADFCCPLSLE  240

Query  2136  LMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNN  1957
             LMTDPVIVASGQTYER FI+ WIDLGLTVC KTRQTL HTNLIPNYTVKALIANWCE NN
Sbjct  241   LMTDPVIVASGQTYERAFIKNWIDLGLTVCAKTRQTLVHTNLIPNYTVKALIANWCESNN  300

Query  1956  IKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsprkssiss  1777
             ++L DP KS N+NQ      +++SG  R+  +F HSR+N  +SP+SA        ++  +
Sbjct  301   VQLVDPTKSTNLNQACVLHGYMESGTTRESPVFVHSRSNQPSSPESAGSRSFSSPANNLT  360

Query  1776  saiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSMNSVSHFS  1597
             S   + E +      S+ E       +   +D+ R+S EG +DR A+S + S++S SH S
Sbjct  361   SGGTQREGTSPLHPRSTSEGSFRGMVNGQYMDLARISPEGLDDRSASSDESSVDSASHPS  420

Query  1596  M-PLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGN---EVSSPTTASTEAS  1429
             M P    S S+      Q H R  S  S LSN+NF +    D N   ++S+    S EAS
Sbjct  421   MSPSRRESSSAFSSEQSQTHIRAVSDSSALSNANFPQETEDDNNNAPQLSTSAGHSREAS  480

Query  1428  MEV--ASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRAD  1255
              E+    E+    ++A+  RE EFP  + TR R  AIWRRPSER V RIVSSP VETRAD
Sbjct  481   GELNPGPETAGTTSVASVHREPEFPLRLETRSRSQAIWRRPSERHVPRIVSSPVVETRAD  540

Query  1254  LAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSE  1075
             L+ ++ QVR LVE LKS+ VD QR ATAELRLLAKHNMDNRI I+NCGAI++LV+LL S 
Sbjct  541   LSAIETQVRNLVEGLKSSDVDTQREATAELRLLAKHNMDNRIAIANCGAINVLVDLLQST  600

Query  1074  DMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIE  895
             D  +QENAVTALLNLSINDNNK+AIANAGAIEPLI+VLETGSPEAKENSAATLFSLSVIE
Sbjct  601   DTTIQENAVTALLNLSINDNNKTAIANAGAIEPLIHVLETGSPEAKENSAATLFSLSVIE  660

Query  894   DNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELM  715
             +NKI IGRSGA+  LV+LLG+GTPRGKKDAATALFNLSI HENK  IVQAGAVRHLV+LM
Sbjct  661   ENKIFIGRSGAIGPLVELLGSGTPRGKKDAATALFNLSIFHENKNWIVQAGAVRHLVDLM  720

Query  714   DPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCT  535
             DPAAGMVDKAVAVL+NLATI EGR +IG EGGIP+LVEVVELGSARGKENAAAALL LC 
Sbjct  721   DPAAGMVDKAVAVLANLATIPEGRNAIGDEGGIPVLVEVVELGSARGKENAAAALLHLCL  780

Query  534   NSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             +S+++   VLQ GAVPPLVALSQSGTPRA+EKAQALL+ FR+QRHG+AGRG
Sbjct  781   HSTKFLGKVLQQGAVPPLVALSQSGTPRAKEKAQALLNQFRSQRHGSAGRG  831



>ref|XP_004149702.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus]
 ref|XP_004169445.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus]
 gb|KGN61966.1| hypothetical protein Csa_2G277080 [Cucumis sativus]
Length=841

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/845 (62%), Positives = 626/845 (74%), Gaps = 17/845 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M + LLKVLL +ISSF  LSS + IN +   KYY K E  LKLL+PIL  +VD++IASDE
Sbjct  1     MGVSLLKVLLRHISSFLQLSSSDYINLQPTLKYYHKIEGALKLLRPILDAVVDSDIASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L + F  L HSVDELR LF+ WQ LSSKVYFVLQ+E+LI+K+  FSL I +LL SS+  
Sbjct  61    ELTQAFEELDHSVDELRVLFENWQPLSSKVYFVLQSETLISKIGKFSLDIFQLLQSSNEN  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S  SLE+CV KIK++  E +S+ I  AI+N V+G   SSD L K+AD LSL+SNQ
Sbjct  121   LPEELSSKSLEHCVQKIKNIGKEEISSVIKDAIRNQVDGIAPSSDVLVKLADSLSLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
              +LIE VALEKLKE+AEQAE   E E I+Q+I LVT MH+ LIM+KQS+S + V IP DF
Sbjct  181   AILIEAVALEKLKESAEQAENTGEAEDIDQMIGLVTRMHERLIMIKQSQSSSPVSIPPDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WID GL VCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERVFIKNWIDQGLNVCPKTRQTLVHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIH---IFSHSRANNSTSPDSAHGL  1807
             NWC+ NN+KL DP KS+N+NQ S  +  V S  P D H   +F HS      SP S    
Sbjct  301   NWCDTNNVKLSDPSKSVNLNQISPLL--VGSFEP-DTHREPLFPHSPGYQPMSPQSTRSA  357

Query  1806  DsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGD  1627
              S + S+      +   SS      S +    + AGD+  ++V+R+ L  SED++A   +
Sbjct  358   GSGKNSNSLGGTHRDGSSSLLPHSLSEDSLSND-AGDEGAIEVDRLLLSSSEDQMAKLEE  416

Query  1626  RSMNSVSHFSMPLSMNSV--SSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSP  1453
                + V+  SM  S  +V  S  ++     HNR++S  S +SN+N SR  + + NE +  
Sbjct  417   NGCDPVAKPSMSPSRTNVLNSCGEDEPSHSHNRSSSTSSGVSNANHSRGTSGEANEATHL  476

Query  1452  TTAST----EASMEVASESRHAATLAASRRESE--FPSPVGTRLRPPA--IWRRPSERLV  1297
             +T  T    +A+ E  SE   AAT   + RE E   P  +    RP    +W RPSER  
Sbjct  477   STNLTGYGSDAAGESKSEPLAAATPTTNHREPEREHPPRLADHPRPRGNTMWLRPSERFA  536

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             SRI++S   ETR DL+ ++ QV+K+VE+LKS+S+D  R ATAELRLLAKHNMDNRIVI+ 
Sbjct  537   SRIITSSANETRPDLSAIEAQVQKVVEELKSSSLDTLRGATAELRLLAKHNMDNRIVIAQ  596

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI  LV LL SED ++QENAVTALLNLSINDNNKSAIA A AIEPLI+VL+TGSPEAK
Sbjct  597   CGAIDYLVGLLLSEDSKIQENAVTALLNLSINDNNKSAIAQANAIEPLIHVLKTGSPEAK  656

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAATLFSLSVIE+NK+KIGRSGA+  LV+LLGNGTPRGKKDAATALFNLSI HENK R
Sbjct  657   ENSAATLFSLSVIEENKVKIGRSGAIGPLVELLGNGTPRGKKDAATALFNLSIFHENKAR  716

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAVRHLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGSAR
Sbjct  717   IVQAGAVRHLVELMDPAAGMVDKAVAVLANLATIPEGRSAIGQEGGIPVLVEVVELGSAR  776

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAAAALLQLCT S+R+C+MVLQ GAVPPLVALSQSGT RA+EKAQALLS+FR+QRHG
Sbjct  777   GKENAAAALLQLCTTSNRHCSMVLQEGAVPPLVALSQSGTARAKEKAQALLSHFRSQRHG  836

Query  396   NAGRG  382
             N+GRG
Sbjct  837   NSGRG  841



>ref|XP_010531283.1| PREDICTED: U-box domain-containing protein 4 [Tarenaya hassleriana]
 ref|XP_010531284.1| PREDICTED: U-box domain-containing protein 4 [Tarenaya hassleriana]
 ref|XP_010531285.1| PREDICTED: U-box domain-containing protein 4 [Tarenaya hassleriana]
 ref|XP_010531286.1| PREDICTED: U-box domain-containing protein 4 [Tarenaya hassleriana]
Length=839

 Score =   910 bits (2351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/841 (61%), Positives = 636/841 (76%), Gaps = 11/841 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI +L+VLL +ISSF +LSS  +I  + + KYY++ ED+L++L+P++  +V+++I  ++
Sbjct  1     MEISVLRVLLGSISSFLNLSSSRHIGLDPLGKYYKRVEDLLRVLKPVIDVVVNSDIDLED  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K F  L   VD+ RELF++WQ  SSKVYFVLQ ES + K+R   +   +LL +S   
Sbjct  61    KLVKEFEELARDVDQSRELFRSWQPFSSKVYFVLQIESFMLKMRDSIVDTFQLLKTSQNH  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E +   LE C+ KIK + YE +S+ I  A+++  +G G S + L KI +   L+SNQ
Sbjct  121   LPDELNPGLLERCLEKIKHLSYEEISSVIDGALRDQRDGVGPSPEILVKIGEETGLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE V+LEK KE AEQ EKN EVE+++Q+I++V  MH+ L+++KQ+++ +S+ I ADF
Sbjct  181   EILIEAVSLEKQKEIAEQTEKNGEVEFLDQLISVVNRMHERLLLIKQTQTSSSIPILADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLE+MTDPVIV+SGQTYER FI++WIDLGLTVCPKTRQTL HT LIPNYTVKALI 
Sbjct  241   FCPLSLEVMTDPVIVSSGQTYERAFIKKWIDLGLTVCPKTRQTLNHTTLIPNYTVKALIV  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN++LPDP KS ++N+ S  ++  +S    D ++F+   +N     D + G  +P
Sbjct  301   NWCETNNVRLPDPTKSTSLNELSPLLSCTNSIPNMDANVFARIGSNQPNDLDPSAG--AP  358

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K+S S+S ++RE +SPSH  SS + SLP + G+  GLD+ RMSL   EDR  NS +   
Sbjct  359   GKNSFSTSVVEREGASPSHLPSSLDASLPGLTGNGHGLDIGRMSLNDFEDRSNNSREMKT  418

Query  1617  NSVSHFSMPLSMNSVSSADENSH--QGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTA  1444
             ++   FS+  +      A EN    + H R+ SA ST+SN  F R  + DGNE S  +  
Sbjct  419   DAPGRFSVSSTRRGSVDAAENGQVSEHHYRSASASSTVSNEEFPRVLSADGNENSEESAH  478

Query  1443  STEASMEVASESRH-----AATLAASRRES-EF-PSPVGTRLRPPAIWRRPSERLVSRIV  1285
             +T  + + + E R      AA+ A  RR+S EF P  +  R R  + WRRPSERL SRIV
Sbjct  479   ATPYTSDASGEMRREPLTAAASSATPRRDSSEFSPKLMDRRTRGQSFWRRPSERLGSRIV  538

Query  1284  SSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAI  1105
             S+P+ ETR DL+EV+ QV+KLVE+LKS SVD QR AT E+RLLAKHNMDNRIVI+NCGAI
Sbjct  539   SAPSNETRRDLSEVETQVKKLVEELKSGSVDTQRKATGEIRLLAKHNMDNRIVIANCGAI  598

Query  1104  SLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSA  925
             SLLV+LL+S D E QE+AVTALLNLSINDNNK AIA+AGAIEPLI+VL+TGS EAKENSA
Sbjct  599   SLLVDLLYSSDSETQEHAVTALLNLSINDNNKRAIADAGAIEPLIHVLQTGSSEAKENSA  658

Query  924   ATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA  745
             ATLFSLSVIE+NKIKIGRSGA+  LVDLLG GTPRGKKDAATALFNLSI HENK RIVQA
Sbjct  659   ATLFSLSVIEENKIKIGRSGAIGPLVDLLGTGTPRGKKDAATALFNLSIHHENKARIVQA  718

Query  744   GAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKEN  565
             GAVRHL++LMDPA GMVDKAVAV++NLATI EGR  IGQEGGIP+LVEVVELGSARGKEN
Sbjct  719   GAVRHLIDLMDPAGGMVDKAVAVMANLATIPEGRNGIGQEGGIPLLVEVVELGSARGKEN  778

Query  564   AAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             AAAALLQLCTNS R+CNMVLQ GA+PPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR
Sbjct  779   AAAALLQLCTNSGRFCNMVLQEGAIPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  838

Query  384   G  382
             G
Sbjct  839   G  839



>ref|XP_007146857.1| hypothetical protein PHAVU_006G076000g [Phaseolus vulgaris]
 gb|ESW18851.1| hypothetical protein PHAVU_006G076000g [Phaseolus vulgaris]
Length=838

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/841 (61%), Positives = 628/841 (75%), Gaps = 12/841 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK+++N ISSF HLS   N++SE V KYYQK E+ILKLL+PI+  IV++E+ASDE
Sbjct  1     MEISLLKMIVNGISSFLHLSISGNMSSEPVSKYYQKAEEILKLLKPIIDEIVNSELASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K+   +G +V+EL+E  + W LLSSKVYFV+Q E LI+++R   L I + L  S   
Sbjct  61    VLSKILEEIGLAVNELKEHVENWHLLSSKVYFVMQVEPLISRIRTSGLNIFQQLKVSQHS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S   L+ C  K+K + +E  S+ I +AI   +E +G S D LT IAD L L SNQ
Sbjct  121   LPDELSSEDLQQCSHKLKLLGHEESSSVIKEAIV-QLEYAGPSPDVLTIIADRLGLMSNQ  179

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ++LIE VALE+LKENAEQ+EK EE EYI+Q+IA++THMH+ LIM+KQ++S + V IPADF
Sbjct  180   DVLIEAVALERLKENAEQSEKTEEAEYIDQMIAVITHMHERLIMLKQAQSSSPVPIPADF  239

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WIDLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  240   CCPLSLELMTDPVIVASGQTYERAFIKNWIDLGLTVCPKTRQTLAHTNLIPNYTVKALIA  299

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN++L DP KS N+N PS    +++SG  R+  +F+H R+N  +SP+SA    S 
Sbjct  300   NWCESNNVRLVDPTKSTNLNPPSVLHGYMESGTTRESPVFAHPRSNQPSSPESARS-RSF  358

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLG--LDVERMSLEGSEDRLANSGDR  1624
                  + ++   +    S P      S   ++G   G  +D+ R+S  G +DR A+S + 
Sbjct  359   SSPGNNITSGGIQLEETSSPLHPRSTSEGSLSGIINGQYMDLARISPAGLDDRSASSDES  418

Query  1623  SMNSVSHFSM-PLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTT  1447
             +++S S  S+ P    S S+      Q H R  S  S LS +NF +    D N     +T
Sbjct  419   TVDSASQPSLSPSRRESSSAFGSEQSQTHIRAVSDSSALSTANFPQETQDDDNNAPHLST  478

Query  1446  A---STEASMEVASESRHAAT--LAASRRESEFPSPV-GTRLRPPAIWRRPSERLVSRIV  1285
             +   S +AS E+ +    A T  + ++ RE+E P  +  TR R  AIWRRPSERLV RI 
Sbjct  479   SPGHSRDASGELNTGPETAGTTVMLSTHREAESPVRLFETRPRSQAIWRRPSERLVPRI-  537

Query  1284  SSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAI  1105
             +SP +ET+ DL+ ++ QVR LVE L+S+ +D Q+ ATAELRLLAKHNMDNRI I+NCGAI
Sbjct  538   ASPAIETKGDLSGIEAQVRNLVEGLRSSDLDAQKEATAELRLLAKHNMDNRIAIANCGAI  597

Query  1104  SLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSA  925
             +LLV+LL S D  +QENAVTALLNLSINDNNK+ IA+AGAIEPLI+VLE GSPEAKENSA
Sbjct  598   NLLVDLLRSADTAIQENAVTALLNLSINDNNKTEIASAGAIEPLIHVLEHGSPEAKENSA  657

Query  924   ATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA  745
             ATLFSLSVIE+NKI IGRSGA++ LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQA
Sbjct  658   ATLFSLSVIEENKISIGRSGAIRPLVDLLGNGTPRGKKDAATALFNLSIFHENKNRIVQA  717

Query  744   GAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKEN  565
             GAVRHLVELMDPAAGMVDKAVAVL+NLATI EGR +IG+EGGIP+LVEVVELGSARGKEN
Sbjct  718   GAVRHLVELMDPAAGMVDKAVAVLANLATILEGRNAIGEEGGIPVLVEVVELGSARGKEN  777

Query  564   AAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             AAAALL LC +S R+   VLQ GAVPPLVALSQSGTPRA+EKAQALL+ FRNQRHGNAGR
Sbjct  778   AAAALLHLCLHSDRFLGKVLQQGAVPPLVALSQSGTPRAKEKAQALLNQFRNQRHGNAGR  837

Query  384   G  382
             G
Sbjct  838   G  838



>ref|XP_004500342.1| PREDICTED: U-box domain-containing protein 4-like [Cicer arietinum]
Length=839

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/840 (60%), Positives = 623/840 (74%), Gaps = 9/840 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK+L++ ISSF HLS   N+NSE V KYYQ  ++ILKLL+PI+     +E+ASDE
Sbjct  1     MEISLLKMLIDRISSFLHLSFSGNMNSEPVSKYYQTAKEILKLLKPIIDAFTTSELASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K+F  LGH++DEL+E  + W LLSSKVYF++Q E LI+K++   LK+++ L ++  C
Sbjct  61    VLSKIFEELGHAIDELKEHAENWHLLSSKVYFIMQVEPLISKIQTSGLKVLQQLKATKQC  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
                E S   LE+CV K+K +  E  S+ I +AI   ++G+G S+++L KIAD L L+SN+
Sbjct  121   PHDELSSEHLEHCVQKLKLLGLEETSSVIKEAIMEQLDGAGPSTETLEKIADSLGLRSNE  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQ+E   E EYI+QIIA+VT +H+ L+M+KQS+S + V +PADF
Sbjct  181   EVLIEAVALEKLKENAEQSENTAEAEYIDQIIAVVTRLHERLVMLKQSQSGSPVLVPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WIDLGLTVCPKT QTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIKNWIDLGLTVCPKTHQTLAHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE+NN+KL DP KS N+NQ S    +++S   R+  +F HSR+N  +SP+SA    S 
Sbjct  301   NWCELNNVKLVDPTKSTNLNQASILHGYMESSTTRESPVFPHSRSNLPSSPESARS-RSF  359

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLG--LDVERMSLEGSEDRLANSGDR  1624
                  + ++    +   + P      S   ++G   G  +D  + S    +DR A+S + 
Sbjct  360   SSPGNNITSSGGIQREGTSPLHPRSTSEGSLSGVVNGQYMDAAKTSPSVLDDRSASSDES  419

Query  1623  SMNSVSHFSM-PLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGN--EVSSP  1453
             S++S+   SM P    S S+      Q H R  S     S+ NF      D N  ++S+ 
Sbjct  420   SVDSIGQPSMSPSRRESSSAFSPEQSQNHVRAVSDSGAFSDVNFQETQGDDSNASQLSTS  479

Query  1452  TTASTEASMEV--ASESRHAATLAASRRESEF-PSPVGTRLRPPAIWRRPSERLVSRIVS  1282
                S + S E+   S++   A + + +RE EF P  +  R R  AIWRRPSERLV RI+S
Sbjct  480   PGYSRDTSGELNPGSDAAGPAPVLSIQREPEFLPRLMENRSRSQAIWRRPSERLVPRIIS  539

Query  1281  SPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAIS  1102
             S  +E+R DL+ ++ QVR LVE L+S+ VD QR ATAE+RLLAKHNMDNRI I+NCGAI+
Sbjct  540   SSAIESRVDLSAIETQVRGLVEGLRSSDVDTQREATAEIRLLAKHNMDNRIAIANCGAIN  599

Query  1101  LLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAA  922
             +LV+LL S D  +QENAVTALLNLSINDNNK+AIANAGAIEPLI+VLETGSPEAKENSAA
Sbjct  600   ILVDLLKSTDTTIQENAVTALLNLSINDNNKTAIANAGAIEPLIHVLETGSPEAKENSAA  659

Query  921   TLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAG  742
             TLFSLSVIE+NK+ IGRSGA+  LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQAG
Sbjct  660   TLFSLSVIEENKVNIGRSGAISPLVDLLGNGTPRGKKDAATALFNLSIFHENKNRIVQAG  719

Query  741   AVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENA  562
             AV+HLVELMDPAAGMVDKAVAVL+NLATI EGR++IGQEG    LVEVVELGS RGKENA
Sbjct  720   AVKHLVELMDPAAGMVDKAVAVLANLATIPEGRIAIGQEGXXXXLVEVVELGSVRGKENA  779

Query  561   AAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             AAALL LC +S+R+ +MVLQ GAVPPLVAL+QSGTPRA+EKAQALL+ FR+QRHGN+GRG
Sbjct  780   AAALLHLCLHSNRFLSMVLQQGAVPPLVALAQSGTPRAKEKAQALLNQFRSQRHGNSGRG  839



>gb|KEH34421.1| ARM repeat RING/U-box protein [Medicago truncatula]
Length=836

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/837 (62%), Positives = 632/837 (76%), Gaps = 9/837 (1%)
 Frame = -2

Query  2868  LLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQ  2689
             ++LK+L+++ISSF H S   N+NSE V KYYQKTE ILKLL+PI+    ++E  SDE+L 
Sbjct  1     MMLKMLVDSISSFLHSSFSGNMNSETVSKYYQKTEVILKLLKPIIDTFANSEPTSDEVLS  60

Query  2688  KVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPA  2509
               F  LGH+VDE++E  + W LLSSKVYFV+Q + LI+++   SLK+++ L +S      
Sbjct  61    MTFEELGHAVDEVKEYVENWHLLSSKVYFVMQVDPLISRIWTSSLKVLQQLKASKQFPND  120

Query  2508  ESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELL  2329
             E +   LE+CV K+K +  E  S+ I +AI   ++ +G SS+ L KIAD L LKSN+E+L
Sbjct  121   EVNSEHLEHCVQKLKLLGLEETSSVIKEAIMEQLDDAGPSSEVLEKIADSLGLKSNEEVL  180

Query  2328  IELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCP  2149
             IE VALEKLKENAEQ EK  E EYI+Q+IA+VT MH+ L+++KQS+S + V +P DFCCP
Sbjct  181   IEAVALEKLKENAEQTEKTAEAEYIDQMIAVVTRMHERLVLLKQSQSNSPVPVPPDFCCP  240

Query  2148  LSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWC  1969
             LSLELMTDPVIVASGQTYER FI+ WIDLGLTVCPKT QTL HTNLIPNYTVKALIANWC
Sbjct  241   LSLELMTDPVIVASGQTYERAFIKNWIDLGLTVCPKTHQTLAHTNLIPNYTVKALIANWC  300

Query  1968  EMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHG--LDspr  1795
             E NN+KL DPIKS  +NQ S    +++SG  R+  +F HSR+N  +SP+SA     +SP 
Sbjct  301   ESNNVKLVDPIKSTTLNQASILHGYMESGTTRESPVFPHSRSNLPSSPESARSRSFNSPG  360

Query  1794  kssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSMN  1615
              +  SS  IQRE +SP HPRS SE SL  I      +D  R S  G +DR A+S + S++
Sbjct  361   NNIPSSGGIQREGTSPLHPRSISEGSLSGIVNGQY-MDAARTSPTGIDDRSASSDESSID  419

Query  1614  SVSHFSMPLSMNSVSSADENS-HQGHNRTTSAPSTLSNSNFSRANAHDGN--EVSSPTTA  1444
             S+   S+  S    S A  +   Q H R  S     S++NF      D N  ++S+    
Sbjct  420   SMGQPSISPSRRESSGAFSSELSQNHVRAVSDSGAFSDANFQETQGDDSNASQLSTSPGY  479

Query  1443  STEASMEV--ASESRHAATLAASRRESEFPSP-VGTRLRPPAIWRRPSERLVSRIVSSPT  1273
             S + S E+   S++  +A + + +RE EFP   +  R R  AIWRRPSERLV RI+SS  
Sbjct  480   SRDTSGELNPVSDASGSAPMPSMQREPEFPPRLMEARSRSQAIWRRPSERLVPRIISSSA  539

Query  1272  VETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLV  1093
             +E R DL+ ++ QVR LVE L+S  +D QR AT+E+RLLAKHNMDNRI I+NCGAI++LV
Sbjct  540   IEPRVDLSGIEAQVRSLVEGLRSIDLDIQREATSEIRLLAKHNMDNRIAIANCGAINILV  599

Query  1092  NLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLF  913
             +LL S D  VQENAVTALLNLSINDNNK+AIANAGAIEPLI+VLE GSPEAKENSAATLF
Sbjct  600   DLLQSADSRVQENAVTALLNLSINDNNKTAIANAGAIEPLIHVLEHGSPEAKENSAATLF  659

Query  912   SLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVR  733
             SLSVIE+NK+ IGRSGA++ LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQAGAV+
Sbjct  660   SLSVIEENKVNIGRSGAIRPLVDLLGNGTPRGKKDAATALFNLSIFHENKNRIVQAGAVK  719

Query  732   HLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAA  553
             HLVELMDPAAGMVDKAVAVL+NLATI EGR++IGQEGGIP+LVEVVELGSARGKENAAAA
Sbjct  720   HLVELMDPAAGMVDKAVAVLANLATIPEGRIAIGQEGGIPVLVEVVELGSARGKENAAAA  779

Query  552   LLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             LL LC +S+R+ +MVLQHGAVPPLVALSQSGTPRA+EKAQALL+ FR+QRHGN+GRG
Sbjct  780   LLHLCLHSNRFLSMVLQHGAVPPLVALSQSGTPRAKEKAQALLNQFRSQRHGNSGRG  836



>gb|KDO79033.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
Length=689

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/697 (68%), Positives = 559/697 (80%), Gaps = 12/697 (2%)
 Frame = -2

Query  2460  MDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELValeklkenaeqa  2281
             M+YE  S+ I +AI++ V+G   SS+ L K+A+ LSL+SNQE+LIE VALEKLKENAEQA
Sbjct  1     MEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAESLSLRSNQEILIEAVALEKLKENAEQA  60

Query  2280  ekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLELMTDPVIVASGQ  2101
             EK  E E+++Q+I+LVT MHD L+M+KQS+ C+ V IP+DFCCPLSLELMTDPVIVASGQ
Sbjct  61    EKAGEAEFMDQMISLVTRMHDRLVMIKQSQICSPVPIPSDFCCPLSLELMTDPVIVASGQ  120

Query  2100  TYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDPIKSLNV  1921
             TYER FI++WIDLGL VCPKTRQTL HT LIPNYTVKALIANWCE+NN+KLPDP K+ ++
Sbjct  121   TYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIANWCELNNVKLPDPTKTASL  180

Query  1920  NQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsprkssisssaiqreesspsh  1741
             NQPS    H DS APRD HIF H+R N    P+S    +SP K+ +S +  +   S    
Sbjct  181   NQPSPLFVHADSNAPRDSHIFPHTRGNQQIMPESTRSTNSPAKNLVSLNNTREGSSPLHP  240

Query  1740  prssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSMNSVSHFSMPLSMNSVSSAD  1561
               +S       IAG+  GLD+ R+SL  SEDR +NS +RSM  V   SM  S+    +  
Sbjct  241   HSTSETSYSG-IAGNGPGLDIARISLTSSEDRFSNSEERSMELVGQPSMSKSIKEFPATI  299

Query  1560  ENSHQG---HNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVASESRHAATL  1390
             + S Q    HNRT SA S LSN N S+ +A++ +E+S+ + AS E  +E    S+ A T+
Sbjct  300   DTSEQSSHIHNRTASASSVLSNLNLSQGDANETSELSNHSDASGEGKLE----SQPATTM  355

Query  1389  AASRRESEFPSPV-GTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVED  1213
                RRE EFPS V  TR R   IWRRPSER V RIVS+   ETRADL+ ++ QVRKLVED
Sbjct  356   ---RREPEFPSRVMETRSRSQVIWRRPSERFVPRIVSTSGAETRADLSGIETQVRKLVED  412

Query  1212  LKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLN  1033
             LKSTS+D QR ATAELRLLAKHNMDNR+VI+NCGAI++LV++LHS + ++QENAVTALLN
Sbjct  413   LKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVDMLHSSETKIQENAVTALLN  472

Query  1032  LSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQS  853
             LSINDNNKSAIANA AIEPLI+VL+TGSPEA+EN+AATLFSLSVIEDNKIKIGRSGA+  
Sbjct  473   LSINDNNKSAIANANAIEPLIHVLQTGSPEARENAAATLFSLSVIEDNKIKIGRSGAIGP  532

Query  852   LVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVL  673
             LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQAGAV+HLV+LMDPAAGMVDKAVAVL
Sbjct  533   LVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMVDKAVAVL  592

Query  672   SNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGA  493
             +NLATI +GR++IGQE GIP+LVEVVELGSARGKENAAAALLQLCTNSSR+C+MVLQ GA
Sbjct  593   ANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFCSMVLQEGA  652

Query  492   VPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VPPLVALSQSGTPRA+EKAQALLSYFRNQRHGNAGRG
Sbjct  653   VPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGRG  689



>ref|XP_002880484.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH56743.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=829

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/834 (61%), Positives = 623/834 (75%), Gaps = 7/834 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEIL  KVL+ +ISSF +LSS ++I+ +   KYY++ E++LK+L+PI   +V++++  DE
Sbjct  1     MEIL--KVLIGSISSFLNLSSSKHIDLDPFEKYYKRVEELLKVLKPIADVVVNSDLVLDE  58

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K F  L   VD+  +LF++WQ  SSKVYFVLQ ESLI K+R   +   + L+SS   
Sbjct  59    KLGKAFEELTQDVDQSIDLFRSWQAFSSKVYFVLQIESLIPKMRDTIVDTFKFLMSSKNH  118

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S  SLE C+ KIK + YE +S+ I  A+++  +G G S + L KI +   L+SNQ
Sbjct  119   LPDELSPASLEQCLEKIKHLSYEEISSVIDGALRDQRDGVGPSPEILVKIGENTGLRSNQ  178

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALE+ KE AEQ+E N EVE+++Q+I +V  MH+ L+++KQ+++ +SV I ADF
Sbjct  179   EILIEAVALERQKEMAEQSENNAEVEFLDQLIVIVNRMHERLLLIKQTQT-SSVAILADF  237

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLE+MTDPVIV+SGQTYE+ FI+RWIDLGL VCPKTRQTLTHT LIPNYTVKALIA
Sbjct  238   FCPLSLEVMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKALIA  297

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE N++KLPDP KS ++N+ S  ++  DS       + +H  +N S   D++      
Sbjct  298   NWCETNDVKLPDPNKSTSLNELSPLLSCTDSIPSTGADVSAHKVSNKSHDWDASSS--ET  355

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K S SS A  RE +SPS P S+   S P ++G+  GLD  R SL   EDR  +S +   
Sbjct  356   GKPSFSSRATGREGASPSRPASALGASSPGVSGNGYGLDARRGSLNDFEDRSNDSREMKT  415

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS-PTTAS  1441
             ++    S+  +        + S   H+R+ SA ST+SN  F RA+A++ +E S+  T  S
Sbjct  416   DAPGRSSVSSTTRGSVENGQTSENHHHRSPSATSTVSNEEFPRADANENSEESAHATPYS  475

Query  1440  TEASMEVASESRHAATLAASRRE-SEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVET  1264
             ++AS E+ S    A T AA+RR+ S+F      R      WRRPSERL SRIVS+P+ ET
Sbjct  476   SDASGEIRSGPLAATTSAATRRDLSDFSPKFMDRRSRGQFWRRPSERLGSRIVSAPSNET  535

Query  1263  RADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLL  1084
             R DL+EV+ QV+KLVE+LKS+S+D QR ATAELRLLAKHNMDNRIVI N GAI LLV LL
Sbjct  536   RRDLSEVETQVKKLVEELKSSSLDTQRQATAELRLLAKHNMDNRIVIGNSGAIVLLVELL  595

Query  1083  HSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLS  904
             +S D   QENAVTALLNLSINDNNK+AIA+AGAIEPLIYVLE GS EAKENSAATLFSLS
Sbjct  596   YSSDSATQENAVTALLNLSINDNNKTAIADAGAIEPLIYVLENGSSEAKENSAATLFSLS  655

Query  903   VIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLV  724
             VIE+NKIKIG+SGA+  LVDLLGNGTPRGKKDAATALFNLSI  ENK  IVQ+GAVR+L+
Sbjct  656   VIEENKIKIGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKATIVQSGAVRYLI  715

Query  723   ELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQ  544
             +LMDPAAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGSARGKENAAAALLQ
Sbjct  716   DLMDPAAGMVDKAVAVLANLATIPEGRNAIGQEGGIPLLVEVVELGSARGKENAAAALLQ  775

Query  543   LCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             L TNS R+CNMVLQ GAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  776   LSTNSGRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  829



>gb|EPS70781.1| hypothetical protein M569_03979, partial [Genlisea aurea]
Length=800

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/836 (62%), Positives = 609/836 (73%), Gaps = 41/836 (5%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LLN+I+    LSS ENI SELV  Y    E+ILK+L+PI   I++ EIASDE
Sbjct  1     MEISLLKSLLNSITRLLQLSSCENIKSELVQNYCHNVEEILKVLKPIFEVIINTEIASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              LQK F+GL  S+DELRE+    Q L SKVYF ++   L +K++  SL+I++LL S D  
Sbjct  61    TLQKEFAGLHQSIDELREVLVNCQPLMSKVYFAIRVGPLSSKIQNHSLQILDLLKSYDQF  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP+E S  SLE CV KIK     + S+ I KA+K+  +GS  SS+ L  IA  LSLKSNQ
Sbjct  121   LPSELSAASLEYCVQKIKPSGTHI-SSVIIKALKDQKQGSEVSSEILETIAGRLSLKSNQ  179

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELLIE VALEKLKENAEQAE N EVE I+Q+I LVTHMHD L+M KQS+    + IPADF
Sbjct  180   ELLIEAVALEKLKENAEQAENNAEVECIDQMIGLVTHMHDLLVMRKQSQDNNHIPIPADF  239

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIRRWIDLGLTVCPKTRQTL HT LIPNYTVKALIA
Sbjct  240   CCPLSLELMTDPVIVASGQTYERAFIRRWIDLGLTVCPKTRQTLVHTTLIPNYTVKALIA  299

Query  1977  NWCEMNNIKLPDPIKSLN-VNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDs  1801
             +WCE NN+KLPDP KS N +N  S     V+     D+ +FS       T+P +A     
Sbjct  300   HWCESNNVKLPDPTKSTNFLNAESVGARKVNGAGDSDLALFS-------TTPVAA-----  347

Query  1800  prkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRS  1621
                   +SS   +   SPSH  +SS +S   I G+ L  ++  + L  +++RL  S + +
Sbjct  348   ------TSSGAPQRSLSPSHNNNSSSQSSAGINGNIL--EIGSLYLRSTDERLNQSAEGN  399

Query  1620  MNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTAS  1441
               SV      LS            QGH RT SA ST  +SN S   A DGNE +S   A 
Sbjct  400   NESVGDDERRLS------------QGHIRTNSASST--HSNVSHGTAADGNEGTSNLDAV  445

Query  1440  --TEASMEVAS-ESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTV  1270
               ++AS E+AS E++   T +   R++ FPS +  R R  AIWRRPS+R   R++SSPTV
Sbjct  446   YLSDASGELASQEAQPPVTPSTPTRDASFPSRLDPR-RGQAIWRRPSDRFSPRVISSPTV  504

Query  1269  ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVN  1090
             E   +   V+ QVRKLVEDL + SVD+QR AT E+RLLAKHNMDNRI+I+NCGAI LLVN
Sbjct  505   EMTPEHLLVESQVRKLVEDLTNGSVDEQRTATGEIRLLAKHNMDNRIIIANCGAIRLLVN  564

Query  1089  LLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFS  910
             LL S D+ +QENAVTALLNLSIND NKSAIANA AIEPLIYVLETGSPEAKENSAATLFS
Sbjct  565   LLRSSDLMIQENAVTALLNLSINDINKSAIANADAIEPLIYVLETGSPEAKENSAATLFS  624

Query  909   LSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRH  730
             LSV ++NK KIGRSGA++ LV+LLG G+ RGKKDAATALFNLSI H+NKGRIVQAGAV++
Sbjct  625   LSVFDENKTKIGRSGAIKPLVELLGTGSLRGKKDAATALFNLSISHDNKGRIVQAGAVKY  684

Query  729   LVELMDPAAGMVDKAVAVLSNLATIQEGRMSI-GQEGGIPILVEVVELGSARGKENAAAA  553
             LVELMDPA GMVDKAVAVLSNLATI EGRM+I GQ GGIP LVEVVELGS RGKENAAAA
Sbjct  685   LVELMDPAFGMVDKAVAVLSNLATIPEGRMAIGGQGGGIPSLVEVVELGSGRGKENAAAA  744

Query  552   LLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             LLQLC NS R+CNMVLQ GA+PPLVAL+QSGTPRAREKAQ LLSYFRNQRHGN GR
Sbjct  745   LLQLCMNSGRFCNMVLQEGAIPPLVALTQSGTPRAREKAQQLLSYFRNQRHGNGGR  800



>ref|XP_006404783.1| hypothetical protein EUTSA_v10000047mg [Eutrema salsugineum]
 gb|ESQ46236.1| hypothetical protein EUTSA_v10000047mg [Eutrema salsugineum]
Length=826

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/835 (60%), Positives = 620/835 (74%), Gaps = 15/835 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI +LK+L++ ISSF +LSS  +I+ +   KYY++ E++L++L+P+   ++ +++  +E
Sbjct  4     MEISVLKMLVDGISSFLNLSSSRHIDLDPFEKYYKRVEELLRVLKPVADAVISSDLVLEE  63

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K F  L   VD+ R+LF++W   SSKVYFVLQ ESLI K+R   +   + L SS   
Sbjct  64    KLGKAFEELAQDVDQSRDLFRSWHAFSSKVYFVLQIESLIPKMRDTIVDTFQFLKSSKND  123

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S  SLE C+ K+K + YE +S+ I  A+++  +G G S + L KI +   L+SNQ
Sbjct  124   LPLELSPASLEKCLEKVKHLSYEEISSVIDGALRDQRDGVGPSQEILVKIGENTGLRSNQ  183

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALE+ KE AEQ+E N EVE+++Q+I +V  MH+ L++++Q+++ +SV I ADF
Sbjct  184   EILIEAVALERQKEIAEQSENNSEVEFLDQLIVIVNRMHERLLLIRQTQT-SSVAILADF  242

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLE+MTDPVIV+SGQTYE+ FI+RWIDLGL VCPKTRQTLTHT LIPNYTVKALIA
Sbjct  243   FCPLSLEVMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKALIA  302

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE N++KLPDP KS ++N+ S  ++  DS       + +H  +N S   D++ G    
Sbjct  303   NWCETNDVKLPDPNKSTSLNELSPLLSCTDSIPSTAAGVSTHRVSNKSNDWDASTG----  358

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
                     +  RE +SPS P S  + SLP ++G+  GLD  R+SL  SEDR  +S  R M
Sbjct  359   ---ETGKPSFSREGASPSRPASGLDTSLPGVSGNGFGLDARRISLNDSEDRSNDS--REM  413

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS-PTTAS  1441
              +    S   +  SV +  + S   H+R+ SA ST+SN    RA A++ +E S+  T  S
Sbjct  414   KTDVSVS-STTQGSVENG-QTSENHHHRSPSAASTVSNEESPRAEANENSEESAHATPYS  471

Query  1440  TEASMEVASESRHAATLAASRRE-SEF-PSPVGTRLRPPAIWRRPSERLVSRIVSSPTVE  1267
             ++AS E+ S    A T AA+RR+ S+F P  +  R      WRRPSERL SRIVS+P+ E
Sbjct  472   SDASGEIRSGPLAATTPAATRRDLSDFSPRFMDRRNNRGQFWRRPSERLGSRIVSAPSNE  531

Query  1266  TRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNL  1087
             TR DL EV+ QV KLVE+LKS+S+D QR ATAELRLLAKHNMDNRIVI N GAI LLV L
Sbjct  532   TRRDLTEVENQVTKLVEELKSSSLDIQRQATAELRLLAKHNMDNRIVIGNSGAIVLLVEL  591

Query  1086  LHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSL  907
             LHS D   QENAVTALLNLSINDNNK AIA+AGAIEPLI+VLE GS EAKENSAATLFSL
Sbjct  592   LHSTDSATQENAVTALLNLSINDNNKKAIADAGAIEPLIHVLENGSSEAKENSAATLFSL  651

Query  906   SVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHL  727
             SVIE+NKIKIG+SGA+  LVDLLGNGTPRGKKDAATALFNLSI  ENKG IVQ+GAVR+L
Sbjct  652   SVIEENKIKIGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKGTIVQSGAVRYL  711

Query  726   VELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALL  547
             ++LMDPAAGMVDKAVAVL+NLATI EGR +IGQEGGI +LVEVVELGSARGKENAAAALL
Sbjct  712   IDLMDPAAGMVDKAVAVLANLATIPEGRNAIGQEGGIALLVEVVELGSARGKENAAAALL  771

Query  546   QLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             QL TNS R+CNMVLQ GAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  772   QLSTNSGRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  826



>ref|XP_010472313.1| PREDICTED: U-box domain-containing protein 4 [Camelina sativa]
Length=837

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/836 (59%), Positives = 624/836 (75%), Gaps = 6/836 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAE--IAS  2704
             ME+ +LK LL +ISSF +LSS ++I+ +   KYY++ E++L++L+PI   +V+++  +  
Sbjct  4     MEVSVLKALLGSISSFLNLSSSKHIDLDPFDKYYKRVEELLRVLEPIADAVVNSDDVVFD  63

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             ++ L K F  L   VD+  +LF++WQ  SSKVYFVLQ ESLI K+R   +   + L+SS 
Sbjct  64    EKKLVKAFEELTQDVDQSIDLFRSWQAFSSKVYFVLQIESLIPKMRETIVDAFQFLMSSK  123

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
               LP E S  SLE C+ +IK ++YE +S+ I  A+++  +G G S + L KI +   L+S
Sbjct  124   NHLPDELSPASLEQCLEEIKHLNYEEISSVIDGALRDQRDGVGPSPEILVKIGENTGLRS  183

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQE+LIE VALE+ KE AEQ+E N EVE+++Q+I +V  MH+ L+++KQ+++ +SV I A
Sbjct  184   NQEILIEAVALERQKEMAEQSENNAEVEFLDQLIVIVNRMHERLLLIKQTQT-SSVAILA  242

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DF CPLSLE+MTDPVIV+SGQTYE+ FI+RWIDLGL VCPKTRQTLTHT LIPNYTVKAL
Sbjct  243   DFFCPLSLEVMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKAL  302

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLD  1804
             IANWCE N++KLPDP KS ++N+ S  ++  DS    +  +++H  +N S   D++   +
Sbjct  303   IANWCETNDVKLPDPNKSTSLNELSPLLSCTDSIPSTNPDVYAHKVSNKSHDWDASSS-E  361

Query  1803  sprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDR  1624
               + S  S +  +   SSPS P S+   S P ++G+  GLD  R SL   EDR  +S + 
Sbjct  362   IGKPSFSSRAIERESASSPSRPASALGASSPGLSGNGYGLDARRGSLNDIEDRSNDSREL  421

Query  1623  SMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS-PTT  1447
               ++    S+  +        + S   HNR+ SA ST+SN +F RA+A++ +E S+  T 
Sbjct  422   KTDAPGRSSVSSTTRGSVENGQTSENHHNRSPSAASTVSNEDFPRADANENSEESAHATP  481

Query  1446  ASTEASMEVASESRHAATLAASRRE-SEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTV  1270
              S++AS E+ S    A T AA RR+ S+F      R      WRRPSERL SRIVS+P+ 
Sbjct  482   YSSDASGEIRSGPLGATTSAAPRRDFSDFSPKFMDRRNRGQFWRRPSERLGSRIVSAPSN  541

Query  1269  ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVN  1090
             ETR +L EV+ QV+KLVE+LKSTS+D QR ATAELRLLAKHNMDNRIVI N GAI LLV 
Sbjct  542   ETRRELLEVETQVKKLVEELKSTSLDIQRQATAELRLLAKHNMDNRIVIGNSGAIILLVE  601

Query  1089  LLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFS  910
             LL+S D   QENAVTALLNLSINDNNKSAIA+AGAIEPLI+VL+ GS EAKENSAATLFS
Sbjct  602   LLYSNDSATQENAVTALLNLSINDNNKSAIADAGAIEPLIHVLQNGSSEAKENSAATLFS  661

Query  909   LSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRH  730
             LSVIE+NKIKIG+SGA+  LVDLLGNGTPRGKKDAATALFNLSI  ENK  IVQ+GAVR+
Sbjct  662   LSVIEENKIKIGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKATIVQSGAVRY  721

Query  729   LVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAAL  550
             L++LMDPAAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGSARGKENAAAAL
Sbjct  722   LIDLMDPAAGMVDKAVAVLANLATIPEGRNAIGQEGGIPLLVEVVELGSARGKENAAAAL  781

Query  549   LQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             LQL TNS R+CNMVLQ GAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  782   LQLSTNSGRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  837



>ref|XP_006293682.1| hypothetical protein CARUB_v10022640mg [Capsella rubella]
 gb|EOA26580.1| hypothetical protein CARUB_v10022640mg [Capsella rubella]
Length=835

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/834 (60%), Positives = 621/834 (74%), Gaps = 5/834 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME  ++K LL +ISSF +LSS ++I+ +   KYY+  E++L++L+PI   +V++ +  DE
Sbjct  5     MEESVIKALLGSISSFLNLSSSKHIDLDPFEKYYKSVEELLRVLEPIADAVVNSHLVLDE  64

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K F  L   VD+  +LF+ WQ  SSKVYFVLQ ESLI K+R   +   + L+SS   
Sbjct  65    KLGKSFEELTQDVDQSSDLFRGWQAFSSKVYFVLQIESLIPKMRDTIVDAFQFLMSSKDD  124

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E +  SLE C+ KI+ ++YE +S+ I  A+++  +G G S + L KI +   L+SNQ
Sbjct  125   LPDELNQASLEQCLEKIQHLNYEEISSVIDGALRDQRDGVGPSPEILVKIGENTGLRSNQ  184

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALE+ KE AEQ+E N EVE+++Q+I +V  MH+ L+++KQ+++ +SV I ADF
Sbjct  185   EILIEAVALERQKEMAEQSENNAEVEFLDQLIVIVNRMHERLLLIKQTQT-SSVAILADF  243

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLE+MTDPVIV+SGQTYE+ FI+RWIDLGL VCPKTRQTLTHT LIPNYTVKALIA
Sbjct  244   FCPLSLEVMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKALIA  303

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE N++KLPDP KS ++N+ S  ++  DS    +  +++H  +N S   D++      
Sbjct  304   NWCETNDVKLPDPNKSTSLNELSPLLSCTDSIPSTNADVYAHKVSNKSHDWDASSS--EI  361

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K S SS  I+RE +SPS P S+   S P ++G+  GLD  R SL   EDR  +S +   
Sbjct  362   GKPSFSSRGIERESASPSRPASALGASSPGVSGNGYGLDGRRGSLNDFEDRSNDSRELKT  421

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS-PTTAS  1441
             ++    S+  +        + S   HNR+ SA ST+SN +F RA+A++ +E S+  T  S
Sbjct  422   DAPGRSSVSSTTRGSVENGQTSENHHNRSPSATSTVSNEDFPRADANENSEESAHATPYS  481

Query  1440  TEASMEVASESRHAATLAASRRE-SEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVET  1264
             ++AS E+ S    A T AA RR+ S+F      R      WRRPSERL SRIVS+P+ ET
Sbjct  482   SDASGEIRSGPLGATTSAAPRRDFSDFSPKFMDRRNRGQFWRRPSERLGSRIVSAPSNET  541

Query  1263  RADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLL  1084
             R +L EV+ QV+KLVE+LKSTS+D QR ATAELRLLAKHNMDNRIVI N GAI LLV LL
Sbjct  542   RRELLEVEAQVKKLVEELKSTSLDIQRQATAELRLLAKHNMDNRIVIGNSGAIVLLVELL  601

Query  1083  HSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLS  904
             +S D   QENAVTALLNLSINDNNKSAIA+AGAIEPLI+VL+ GS EAKENSAATLFSLS
Sbjct  602   YSTDSATQENAVTALLNLSINDNNKSAIADAGAIEPLIHVLQHGSSEAKENSAATLFSLS  661

Query  903   VIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLV  724
             VIE+NKIKIG+SGA+  LVDLLGNGTPRGKKDAATALFNLSI  ENK  IVQ+GAVR+L+
Sbjct  662   VIEENKIKIGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKATIVQSGAVRYLI  721

Query  723   ELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQ  544
             +LMDPAAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGSARGKEN AAALLQ
Sbjct  722   DLMDPAAGMVDKAVAVLANLATIPEGRNAIGQEGGIPLLVEVVELGSARGKENGAAALLQ  781

Query  543   LCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             L TNS R+CNMVLQ GAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  782   LSTNSGRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  835



>ref|XP_010429257.1| PREDICTED: U-box domain-containing protein 4-like [Camelina sativa]
Length=837

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/836 (59%), Positives = 622/836 (74%), Gaps = 6/836 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAE--IAS  2704
             ME+ +LK L  +ISSF +LSS ++I+ +   KYY++ E++L++L+PI   +V+++  +  
Sbjct  4     MEVSVLKALRGSISSFLNLSSSKHIDLDPFDKYYKRVEELLRVLEPIAEAVVNSDDLVFD  63

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             ++ L K F  L   VD+  +LF++WQ  SSKVYFVLQ ESLI K+R   +   + L+SS 
Sbjct  64    EKKLVKAFEELTQDVDQSIDLFRSWQAFSSKVYFVLQIESLIPKMRETIVDTFQFLMSSK  123

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
               LP E S  SLE C+ +IK ++YE +S+ I  A+++  +G G S + L KI +   L+S
Sbjct  124   NHLPDELSPASLEQCLEEIKHLNYEEISSVIDGALRDQRDGVGPSPEILVKIGENTGLRS  183

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQE+LIE VALE+ KE AEQ+E N EVE+++Q+I +V  MH+ L+++KQ+++ +SV I A
Sbjct  184   NQEILIEAVALERQKEMAEQSENNAEVEFLDQLIVIVNRMHERLLLIKQTQT-SSVAILA  242

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DF CPLSLE+MTDPVIV+SGQTYE+ FI+RWIDLGL VCPKTRQTLTHT LIPNYTVKAL
Sbjct  243   DFFCPLSLEVMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKAL  302

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLD  1804
             IANWCE N++KLPDP KS ++N+ S  ++  DS    +  +++H  +N S   D++   +
Sbjct  303   IANWCETNDVKLPDPNKSTSLNELSPLLSCTDSIPSTNPDVYAHKVSNKSHDWDASSS-E  361

Query  1803  sprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDR  1624
               + S  S +  +   SSPS P S+   S P ++G+  GLD  R SL   EDR  +S + 
Sbjct  362   IGKPSFSSRAIERESASSPSRPASALGASSPSVSGNGYGLDARRGSLNDFEDRSNDSREL  421

Query  1623  SMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS-PTT  1447
               ++    S+  +        + S   HNR+ SA ST+SN +F RA+ ++ +E S+  T 
Sbjct  422   KTDAPGRSSVSSTTRGSVENGQTSENHHNRSPSAASTVSNEDFPRADVNENSEESAHATP  481

Query  1446  ASTEASMEVASESRHAATLAASRRE-SEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTV  1270
              S++AS E+ S    A T AA RR+ S+F      R      WRRPSERL SRIVS+P+ 
Sbjct  482   YSSDASGEIRSGPLGATTSAAPRRDFSDFSPKFMDRRNRGQFWRRPSERLGSRIVSAPSN  541

Query  1269  ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVN  1090
             ETR +L EV+ QV+KLVE+LKSTS+D QR ATAELRLLAKHNMDNRIVI N GAI LLV 
Sbjct  542   ETRRELLEVETQVKKLVEELKSTSLDIQRQATAELRLLAKHNMDNRIVIGNSGAIILLVE  601

Query  1089  LLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFS  910
             LL+S D   QENAVTALLNLSINDNNKSAIA+AGAIEPLI+VL+ GS EAKENSAATLFS
Sbjct  602   LLYSNDSATQENAVTALLNLSINDNNKSAIADAGAIEPLIHVLQNGSSEAKENSAATLFS  661

Query  909   LSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRH  730
             LSVIE+NKIKIG+SGA+  LVDLLGNGTPRGKKDAATALFNLSI  ENK  IVQ+GAVR+
Sbjct  662   LSVIEENKIKIGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKATIVQSGAVRY  721

Query  729   LVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAAL  550
             L++LMDPAAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGSARGKENAAAAL
Sbjct  722   LIDLMDPAAGMVDKAVAVLANLATIPEGRNAIGQEGGIPLLVEVVELGSARGKENAAAAL  781

Query  549   LQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             LQL TNS R+CNMVLQ GAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  782   LQLSTNSGRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  837



>ref|NP_001189583.1| protein PLANT U-BOX 4 [Arabidopsis thaliana]
 sp|O22193.3|PUB4_ARATH RecName: Full=U-box domain-containing protein 4; AltName: Full=Plant 
U-box protein 4 [Arabidopsis thaliana]
 gb|AEC07418.1| RING/U-box domain and ARM repeat-containing protein [Arabidopsis 
thaliana]
Length=826

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/829 (60%), Positives = 617/829 (74%), Gaps = 5/829 (1%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             ++VLL +ISSF +LSS ++I+ +   KYY++ E++L++L+PI   +V ++   DE L K 
Sbjct  1     MEVLLRSISSFLNLSSSKHIDLDPFEKYYKRVEELLRVLKPIADVVVTSDFVFDEKLGKA  60

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
             F  L   VD+  +LF++WQ  SSKVYFVLQ ESL+ K+R   +   + L+SS   LP E 
Sbjct  61    FEELTQDVDQSIDLFRSWQAFSSKVYFVLQIESLLPKMRDTIVDTFQFLMSSKNHLPDEL  120

Query  2502  SLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIE  2323
             S  SLE C+ KIK + YE +S+ I  A+++  +G G S + L KI +   L+SNQE+LIE
Sbjct  121   SPASLEQCLEKIKHLSYEEISSVIDGALRDQRDGVGPSPEILVKIGENTGLRSNQEILIE  180

Query  2322  LValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLS  2143
              VALE+ KE AEQ+E N EVE+++Q+I +V  MH+ L+++KQ+++ +SV I ADF CPLS
Sbjct  181   AVALERQKEMAEQSENNAEVEFLDQLIVIVNRMHERLLLIKQTQT-SSVAILADFFCPLS  239

Query  2142  LELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEM  1963
             LE+MTDPVIV+SGQTYE+ FI+RWIDLGL VCPKTRQTLTHT LIPNYTVKALIANWCE 
Sbjct  240   LEVMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKALIANWCET  299

Query  1962  NNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsprkssi  1783
             N++KLPDP KS ++N+ S  ++  DS       + +   +N S   D++       K S 
Sbjct  300   NDVKLPDPNKSTSLNELSPLLSCTDSIPSTGADVSARKVSNKSHDWDASSS--ETGKPSF  357

Query  1782  sssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSMNSVSH  1603
             SS A +RE +SPS P S+   S P I+G+  GLD  R SL   EDR  +S +   ++   
Sbjct  358   SSRATEREGASPSRPASALGASSPGISGNGYGLDARRGSLNDFEDRSNDSRELRTDAPGR  417

Query  1602  FSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS-PTTASTEASM  1426
              S+  +        + S   H+R+ SA ST+SN  F RA+A++ +E S+  T  S++AS 
Sbjct  418   SSVSSTTRGSVENGQTSENHHHRSPSATSTVSNEEFPRADANENSEESAHATPYSSDASG  477

Query  1425  EVASESRHAATLAASRRE-SEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLA  1249
             E+ S    A T AA+RR+ S+F      R      WRRPSERL SRIVS+P+ ETR DL+
Sbjct  478   EIRSGPLAATTSAATRRDLSDFSPKFMDRRTRGQFWRRPSERLGSRIVSAPSNETRRDLS  537

Query  1248  EVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDM  1069
             EV+ QV+KLVE+LKS+S+D QR ATAELRLLAKHNMDNRIVI N GAI LLV LL+S D 
Sbjct  538   EVETQVKKLVEELKSSSLDTQRQATAELRLLAKHNMDNRIVIGNSGAIVLLVELLYSTDS  597

Query  1068  EVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDN  889
               QENAVTALLNLSINDNNK AIA+AGAIEPLI+VLE GS EAKENSAATLFSLSVIE+N
Sbjct  598   ATQENAVTALLNLSINDNNKKAIADAGAIEPLIHVLENGSSEAKENSAATLFSLSVIEEN  657

Query  888   KIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDP  709
             KIKIG+SGA+  LVDLLGNGTPRGKKDAATALFNLSI  ENK  IVQ+GAVR+L++LMDP
Sbjct  658   KIKIGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKAMIVQSGAVRYLIDLMDP  717

Query  708   AAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNS  529
             AAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGSARGKENAAAALLQL TNS
Sbjct  718   AAGMVDKAVAVLANLATIPEGRNAIGQEGGIPLLVEVVELGSARGKENAAAALLQLSTNS  777

Query  528   SRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              R+CNMVLQ GAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  778   GRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  826



>ref|NP_179895.6| protein PLANT U-BOX 4 [Arabidopsis thaliana]
 gb|AEC07417.1| RING/U-box domain and ARM repeat-containing protein [Arabidopsis 
thaliana]
Length=829

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/829 (60%), Positives = 617/829 (74%), Gaps = 5/829 (1%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             ++VLL +ISSF +LSS ++I+ +   KYY++ E++L++L+PI   +V ++   DE L K 
Sbjct  4     MEVLLRSISSFLNLSSSKHIDLDPFEKYYKRVEELLRVLKPIADVVVTSDFVFDEKLGKA  63

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
             F  L   VD+  +LF++WQ  SSKVYFVLQ ESL+ K+R   +   + L+SS   LP E 
Sbjct  64    FEELTQDVDQSIDLFRSWQAFSSKVYFVLQIESLLPKMRDTIVDTFQFLMSSKNHLPDEL  123

Query  2502  SLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIE  2323
             S  SLE C+ KIK + YE +S+ I  A+++  +G G S + L KI +   L+SNQE+LIE
Sbjct  124   SPASLEQCLEKIKHLSYEEISSVIDGALRDQRDGVGPSPEILVKIGENTGLRSNQEILIE  183

Query  2322  LValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLS  2143
              VALE+ KE AEQ+E N EVE+++Q+I +V  MH+ L+++KQ+++ +SV I ADF CPLS
Sbjct  184   AVALERQKEMAEQSENNAEVEFLDQLIVIVNRMHERLLLIKQTQT-SSVAILADFFCPLS  242

Query  2142  LELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEM  1963
             LE+MTDPVIV+SGQTYE+ FI+RWIDLGL VCPKTRQTLTHT LIPNYTVKALIANWCE 
Sbjct  243   LEVMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKALIANWCET  302

Query  1962  NNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsprkssi  1783
             N++KLPDP KS ++N+ S  ++  DS       + +   +N S   D++       K S 
Sbjct  303   NDVKLPDPNKSTSLNELSPLLSCTDSIPSTGADVSARKVSNKSHDWDASSS--ETGKPSF  360

Query  1782  sssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSMNSVSH  1603
             SS A +RE +SPS P S+   S P I+G+  GLD  R SL   EDR  +S +   ++   
Sbjct  361   SSRATEREGASPSRPASALGASSPGISGNGYGLDARRGSLNDFEDRSNDSRELRTDAPGR  420

Query  1602  FSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS-PTTASTEASM  1426
              S+  +        + S   H+R+ SA ST+SN  F RA+A++ +E S+  T  S++AS 
Sbjct  421   SSVSSTTRGSVENGQTSENHHHRSPSATSTVSNEEFPRADANENSEESAHATPYSSDASG  480

Query  1425  EVASESRHAATLAASRRE-SEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLA  1249
             E+ S    A T AA+RR+ S+F      R      WRRPSERL SRIVS+P+ ETR DL+
Sbjct  481   EIRSGPLAATTSAATRRDLSDFSPKFMDRRTRGQFWRRPSERLGSRIVSAPSNETRRDLS  540

Query  1248  EVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDM  1069
             EV+ QV+KLVE+LKS+S+D QR ATAELRLLAKHNMDNRIVI N GAI LLV LL+S D 
Sbjct  541   EVETQVKKLVEELKSSSLDTQRQATAELRLLAKHNMDNRIVIGNSGAIVLLVELLYSTDS  600

Query  1068  EVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDN  889
               QENAVTALLNLSINDNNK AIA+AGAIEPLI+VLE GS EAKENSAATLFSLSVIE+N
Sbjct  601   ATQENAVTALLNLSINDNNKKAIADAGAIEPLIHVLENGSSEAKENSAATLFSLSVIEEN  660

Query  888   KIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDP  709
             KIKIG+SGA+  LVDLLGNGTPRGKKDAATALFNLSI  ENK  IVQ+GAVR+L++LMDP
Sbjct  661   KIKIGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKAMIVQSGAVRYLIDLMDP  720

Query  708   AAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNS  529
             AAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGSARGKENAAAALLQL TNS
Sbjct  721   AAGMVDKAVAVLANLATIPEGRNAIGQEGGIPLLVEVVELGSARGKENAAAALLQLSTNS  780

Query  528   SRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              R+CNMVLQ GAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  781   GRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  829



>gb|KEH34422.1| ARM repeat RING/U-box protein [Medicago truncatula]
Length=815

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/816 (62%), Positives = 616/816 (75%), Gaps = 9/816 (1%)
 Frame = -2

Query  2805  INSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSGLGHSVDELRELFQTWQ  2626
             +NSE V KYYQKTE ILKLL+PI+    ++E  SDE+L   F  LGH+VDE++E  + W 
Sbjct  1     MNSETVSKYYQKTEVILKLLKPIIDTFANSEPTSDEVLSMTFEELGHAVDEVKEYVENWH  60

Query  2625  LLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLTSLENCVLKIKSMDYEL  2446
             LLSSKVYFV+Q + LI+++   SLK+++ L +S      E +   LE+CV K+K +  E 
Sbjct  61    LLSSKVYFVMQVDPLISRIWTSSLKVLQQLKASKQFPNDEVNSEHLEHCVQKLKLLGLEE  120

Query  2445  LSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELValeklkenaeqaeknee  2266
              S+ I +AI   ++ +G SS+ L KIAD L LKSN+E+LIE VALEKLKENAEQ EK  E
Sbjct  121   TSSVIKEAIMEQLDDAGPSSEVLEKIADSLGLKSNEEVLIEAVALEKLKENAEQTEKTAE  180

Query  2265  vEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERN  2086
              EYI+Q+IA+VT MH+ L+++KQS+S + V +P DFCCPLSLELMTDPVIVASGQTYER 
Sbjct  181   AEYIDQMIAVVTRMHERLVLLKQSQSNSPVPVPPDFCCPLSLELMTDPVIVASGQTYERA  240

Query  2085  FIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDPIKSLNVNQPSS  1906
             FI+ WIDLGLTVCPKT QTL HTNLIPNYTVKALIANWCE NN+KL DPIKS  +NQ S 
Sbjct  241   FIKNWIDLGLTVCPKTHQTLAHTNLIPNYTVKALIANWCESNNVKLVDPIKSTTLNQASI  300

Query  1905  HVAHVDSGAPRDIHIFSHSRANNSTSPDSAHG--LDsprkssisssaiqreesspshprs  1732
                +++SG  R+  +F HSR+N  +SP+SA     +SP  +  SS  IQRE +SP HPRS
Sbjct  301   LHGYMESGTTRESPVFPHSRSNLPSSPESARSRSFNSPGNNIPSSGGIQREGTSPLHPRS  360

Query  1731  sseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSMNSVSHFSMPLSMNSVSSADENS  1552
              SE SL  I      +D  R S  G +DR A+S + S++S+   S+  S    S A  + 
Sbjct  361   ISEGSLSGIVNGQY-MDAARTSPTGIDDRSASSDESSIDSMGQPSISPSRRESSGAFSSE  419

Query  1551  -HQGHNRTTSAPSTLSNSNFSRANAHDGN--EVSSPTTASTEASMEV--ASESRHAATLA  1387
               Q H R  S     S++NF      D N  ++S+    S + S E+   S++  +A + 
Sbjct  420   LSQNHVRAVSDSGAFSDANFQETQGDDSNASQLSTSPGYSRDTSGELNPVSDASGSAPMP  479

Query  1386  ASRRESEFPSP-VGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDL  1210
             + +RE EFP   +  R R  AIWRRPSERLV RI+SS  +E R DL+ ++ QVR LVE L
Sbjct  480   SMQREPEFPPRLMEARSRSQAIWRRPSERLVPRIISSSAIEPRVDLSGIEAQVRSLVEGL  539

Query  1209  KSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNL  1030
             +S  +D QR AT+E+RLLAKHNMDNRI I+NCGAI++LV+LL S D  VQENAVTALLNL
Sbjct  540   RSIDLDIQREATSEIRLLAKHNMDNRIAIANCGAINILVDLLQSADSRVQENAVTALLNL  599

Query  1029  SINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSL  850
             SINDNNK+AIANAGAIEPLI+VLE GSPEAKENSAATLFSLSVIE+NK+ IGRSGA++ L
Sbjct  600   SINDNNKTAIANAGAIEPLIHVLEHGSPEAKENSAATLFSLSVIEENKVNIGRSGAIRPL  659

Query  849   VDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLS  670
             VDLLGNGTPRGKKDAATALFNLSI HENK RIVQAGAV+HLVELMDPAAGMVDKAVAVL+
Sbjct  660   VDLLGNGTPRGKKDAATALFNLSIFHENKNRIVQAGAVKHLVELMDPAAGMVDKAVAVLA  719

Query  669   NLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAV  490
             NLATI EGR++IGQEGGIP+LVEVVELGSARGKENAAAALL LC +S+R+ +MVLQHGAV
Sbjct  720   NLATIPEGRIAIGQEGGIPVLVEVVELGSARGKENAAAALLHLCLHSNRFLSMVLQHGAV  779

Query  489   PPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             PPLVALSQSGTPRA+EKAQALL+ FR+QRHGN+GRG
Sbjct  780   PPLVALSQSGTPRAKEKAQALLNQFRSQRHGNSGRG  815



>gb|KHG28942.1| U-box domain-containing 4 -like protein [Gossypium arboreum]
Length=777

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/748 (66%), Positives = 579/748 (77%), Gaps = 12/748 (2%)
 Frame = -2

Query  2610  VYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLTSLENCVLKIKSMDYELLSATI  2431
             V  VLQ ESLI+K+R FSL + + L SS   LP E +  SLE+C+ KIK + YE  S+ I
Sbjct  37    VSQVLQVESLISKIRNFSLDVFQFLKSSHQHLPDELNSASLEHCLQKIKLVAYEQASSVI  96

Query  2430  TKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELValeklkenaeqaekneevEYIE  2251
              +AI++ V+  G S D + KIA+ LSL+SNQE+LIE VALEKLKENAEQAEK  + E+I+
Sbjct  97    REAIRDQVDSVGPSLDIIVKIAENLSLRSNQEILIEAVALEKLKENAEQAEKTADAEFID  156

Query  2250  QIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRW  2071
             QIIALV  MHD L++MKQSE+C+ V IPADFCCPLSLELMTDPVIVASGQTYER FI+ W
Sbjct  157   QIIALVNRMHDRLVLMKQSETCSPVPIPADFCCPLSLELMTDPVIVASGQTYERAFIKNW  216

Query  2070  IDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHV  1891
             I LG TVCPKTRQTL HT LIPNYTVKALIANWCE NN+KLP+P KS+N++Q    + H 
Sbjct  217   ISLGFTVCPKTRQTLAHTTLIPNYTVKALIANWCESNNVKLPNPTKSINLDQSHPLLVHA  276

Query  1890  DSGAPRDIHIFSHSRANNSTSPDSAHGLDsprkssisssaiqreesspshprssseeslp  1711
             +SG PRD + F   R +   SP+S        K+ ++SS +  + +SP HPRS+SE SLP
Sbjct  277   ESGLPRDSNSFPPPRISQPLSPES-RSRGQAGKNLVTSSGLHHKGTSPLHPRSTSESSLP  335

Query  1710  EIAGDDLGLDVERMSLEGSEDRLANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRT  1531
              IAG+  GLDV R+SL+  EDR +    R  +SV    +  S N   S+     Q H R+
Sbjct  336   AIAGNGGGLDVARISLKSVEDR-SKLERRYSDSVGEPPVSPSNNIGQSS-----QNHTRS  389

Query  1530  TSAPSTLSNSNFSRANAHDGNEVSSPTT----ASTEASMEVASESRHAATLAASRRESEF  1363
              SA S L N +       D NE S  +T     +++AS EV S+++   + A  +RE +F
Sbjct  390   VSASSALPNPDSPLGAVGDANETSDGSTHLAAYNSDASGEVKSDAQPTVSPAIPQREPQF  449

Query  1362  PSP-VGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQ  1186
             P   + TR R   IWRRPSER + RIVSSP VE RADL+ ++ QV+KLVEDLK TSVD Q
Sbjct  450   PPRLMDTRSRSQTIWRRPSERFIPRIVSSPGVENRADLSGIEAQVKKLVEDLKCTSVDTQ  509

Query  1185  RIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKS  1006
             R ATA+LRLLAKHNMDNRI+I+NCGAI LLV+LLHS D + QENAVTALLNLSINDNNK+
Sbjct  510   REATAQLRLLAKHNMDNRIIIANCGAIVLLVDLLHSPDTKTQENAVTALLNLSINDNNKT  569

Query  1005  AIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGT  826
             AIA+A AIEPLI+VLETGSPEAKENSAATLFSLSVIEDNK+KIGRSGA++ LVDLLGNGT
Sbjct  570   AIADADAIEPLIHVLETGSPEAKENSAATLFSLSVIEDNKVKIGRSGAIKPLVDLLGNGT  629

Query  825   PRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEG  646
             PRGKKDAATALFNLSI HENK RIVQAGAVRHLV+LMDPAAGMVDKAVAVL+NLATI EG
Sbjct  630   PRGKKDAATALFNLSIFHENKARIVQAGAVRHLVDLMDPAAGMVDKAVAVLANLATIPEG  689

Query  645   RMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQ  466
             R +IGQEGGIP+LVEVVELGSARGKENAAAALLQLCT S R+CNMVLQ GAVPPLVALSQ
Sbjct  690   RNAIGQEGGIPVLVEVVELGSARGKENAAAALLQLCTTSGRFCNMVLQEGAVPPLVALSQ  749

Query  465   SGTPRAREKAQALLSYFRNQRHGNAGRG  382
             +GTPR +EKAQALLSYFRNQRHG+AGRG
Sbjct  750   TGTPRGKEKAQALLSYFRNQRHGSAGRG  777



>gb|KDP32027.1| hypothetical protein JCGZ_12488 [Jatropha curcas]
Length=696

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/701 (70%), Positives = 562/701 (80%), Gaps = 13/701 (2%)
 Frame = -2

Query  2460  MDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELValeklkenaeqa  2281
             M YE  S+ + +AI++  E  G SS+ L KIA+ LSL+SNQE+LIE VALEKLKENAEQA
Sbjct  1     MGYEQTSSVVREAIRDQAESVGPSSEILVKIAESLSLRSNQEILIEAVALEKLKENAEQA  60

Query  2280  ekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLELMTDPVIVASGQ  2101
             E   E E  +Q+I+LVTHMHD L++MKQS++ + V IPADFCCPLSLELMTDPVIVASGQ
Sbjct  61    ENPREAELFDQMISLVTHMHDRLVLMKQSQTSSPVPIPADFCCPLSLELMTDPVIVASGQ  120

Query  2100  TYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDPIKSLNV  1921
             TYER FI+ WI+LGLTVCPKTRQTLTHTNLIPNYTVKALIANWCE NN+KLPDP KS++ 
Sbjct  121   TYERAFIKNWIELGLTVCPKTRQTLTHTNLIPNYTVKALIANWCESNNVKLPDPAKSVSF  180

Query  1920  NQPSSHVAHVDSGAPRDIHI-FSHSRANNSTSPDSAHGLDsprkssisssaiqreessps  1744
             NQPS  + H +SG PRD+H+ F HSR N   SP+S     SP ++ ISS AI RE +SP 
Sbjct  181   NQPSPLLVHAESGTPRDLHVVFPHSRGNQPMSPESTRSTGSPGRNWISSGAIHREGASPL  240

Query  1743  hprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSMNSVSHFSMPLSMNSVSS-  1567
             HPRS+SE SL  I G++ GLD+ R+SL  SE+R AN   +S++SV H S+  S   VS+ 
Sbjct  241   HPRSTSEGSLSGIIGNERGLDLMRISLTNSEERSANLEGKSLDSVVHHSLSPSRKEVSNS  300

Query  1566  --ADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPT----TASTEASMEVASESR  1405
               ADE   Q H+R+ SA STL N+NFS+    D NE S  +    + S++ S EV +E +
Sbjct  301   FRADEPIAQSHSRSASASSTLPNANFSQGAQGDNNESSEVSNHLASYSSDNSGEVKAEPQ  360

Query  1404  HAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRK  1225
              +     S RE EFP     R R   IWRRPS+RLV RIVSSP +ETR DL+ V+ QVRK
Sbjct  361   ASTASNTSHREHEFP----PRSRSQTIWRRPSDRLVPRIVSSPAIETRVDLSGVETQVRK  416

Query  1224  LVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVT  1045
             L+EDL S SVD QR AT+ELRLLAKHNMDNRIVI+ CGAISLLVNLL S D  +QENAVT
Sbjct  417   LIEDLNSDSVDIQREATSELRLLAKHNMDNRIVIAQCGAISLLVNLLRSTDSRIQENAVT  476

Query  1044  ALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSG  865
             ALLNLSINDNNK+AIANA AIEPLI+VL TGSPEAKENSAATLFSLSVIEDNK++IGRSG
Sbjct  477   ALLNLSINDNNKTAIANADAIEPLIHVLVTGSPEAKENSAATLFSLSVIEDNKVRIGRSG  536

Query  864   AVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKA  685
             A+  LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQAGAV+HLVELMDPAAGMVDKA
Sbjct  537   AIGPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVQAGAVKHLVELMDPAAGMVDKA  596

Query  684   VAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVL  505
             VAVL+NLATI EGR++IGQEGGIP+LVEVVELGSARGKENAAAALLQLCTNSSR+CN VL
Sbjct  597   VAVLANLATIPEGRVAIGQEGGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFCNNVL  656

Query  504   QHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             Q GAVPPLVALSQSGTPRA+EKAQALL YFRNQRHGNA RG
Sbjct  657   QEGAVPPLVALSQSGTPRAKEKAQALLQYFRNQRHGNA-RG  696



>ref|XP_010942967.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Elaeis guineensis]
 ref|XP_010942971.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Elaeis guineensis]
Length=836

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/845 (58%), Positives = 608/845 (72%), Gaps = 32/845 (4%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G MEI LLK LL++I+ F  LSS  +I SELV +Y+QK ++IL+LL+P+L  +V +EI+S
Sbjct  13    GVMEISLLKTLLSSIARFDLLSSSNSIKSELVQRYFQKIDEILELLKPVLDQVVASEISS  72

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             D  L K+   L   V+E RE   +W  + SKVYFVLQ ES+I  ++ +++++ +LL S  
Sbjct  73    DGKLIKLVEELDGVVNEARERIGSWHPIMSKVYFVLQIESIITNIQKYAIEVCQLLNS--  130

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
               LP+E  +TS    + K + M YE +S  I + I++  E +    + L KI++ LSL S
Sbjct  131   -LLPSEI-VTSTSTSIEKTQHMHYEQISDVIKETIRDQKEKTIPRPEQLNKISNFLSLSS  188

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQELL+E VALEKLK      E   E   I+Q+IALVTHMH+CL+ +KQ  S   V IPA
Sbjct  189   NQELLMEAVALEKLKVKVGHGENQVEQ--IDQMIALVTHMHECLVKIKQVHSINGVPIPA  246

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELM+DPVIVASGQTYER FIR+W+D G  VCPKTRQTL HTNLIPNYTVKAL
Sbjct  247   DFCCPLSLELMSDPVIVASGQTYERAFIRKWLDQGFNVCPKTRQTLGHTNLIPNYTVKAL  306

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHI--FSHS-RANNSTSPDSAH  1813
             IANWCE N+IKLPDPIKS+N+N PSS ++ +DS    D H+    HS RA++  SP+S  
Sbjct  307   IANWCESNDIKLPDPIKSMNMNLPSSFLSPIDSSG-NDCHVPHSGHSPRASHPRSPESNR  365

Query  1812  GL-----DsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSED  1648
              +     DS   + +   +   E+   S   S   ES  +IA    G D     L  S  
Sbjct  366   SMVSSHKDSHSSNGVLKESYLHEKPLSSQHSSIPVESSLQIAN---GCDANVARLSSSMG  422

Query  1647  RL-ANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDG  1471
              +  +SG ++ N           +S +S  +   QGHNR+ SA S +S++++ +    D 
Sbjct  423   EIHVDSGGQTANEAKQ-------DSQASMVDEQLQGHNRSVSASSAVSSNDYLQGTG-DA  474

Query  1470  NEVSSPTTASTEASMEVASE-SRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLV  1297
             N VS  ++  T  S + + E +R     +  +RE EFP  +G  R R   I RRPS   V
Sbjct  475   NVVSRVSSDLTHYSSDASGEVTRETPVSSTPQREPEFPQRLGEARSRSQNISRRPS---V  531

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
              RI++S ++++R DL+ V+ QVRKL+ DLKS SVD QR AT ELRLLAKHNM+NRIVI+N
Sbjct  532   PRIITSSSMDSRPDLSGVETQVRKLIGDLKSDSVDVQRSATEELRLLAKHNMENRIVIAN  591

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAIS LV+LL S D + QENAVTALLNLSINDNNK+AIANAGAI+PLI+VLETG+PEA+
Sbjct  592   CGAISSLVDLLRSTDPKTQENAVTALLNLSINDNNKTAIANAGAIDPLIHVLETGNPEAR  651

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAATLFSLSVIE++K++IGRSGA++ LV+LLGNGTPRGKKDAATALFNLSI HE+KGR
Sbjct  652   ENSAATLFSLSVIEESKVRIGRSGAIKPLVELLGNGTPRGKKDAATALFNLSIFHEHKGR  711

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV+HLVELMDPAAGMVDKAVAVL+NLATI EGR +IG  GGIP+LVEVVELGSAR
Sbjct  712   IVQAGAVKHLVELMDPAAGMVDKAVAVLANLATIPEGRAAIGHSGGIPVLVEVVELGSAR  771

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAAAALLQLCTNS+R+C  VLQ GAVPPLVALSQSGTPRA+EKAQALLSYFRNQRHG
Sbjct  772   GKENAAAALLQLCTNSNRFCTQVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHG  831

Query  396   NAGRG  382
              AGRG
Sbjct  832   KAGRG  836



>ref|XP_006575440.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Glycine max]
Length=813

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/842 (57%), Positives = 593/842 (70%), Gaps = 77/842 (9%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G MEI LLKVL + ISSF HLS  E + SE V KYYQK E +LKLL+PI+   V +++AS
Sbjct  41    GVMEISLLKVLSDAISSFSHLSFSERMKSEPVSKYYQKAEKMLKLLKPIIDTTVFSDLAS  100

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             ++LL K+F  L  +VDELREL   W  LSSK YFV+Q + LI+ ++   L I++ L +S 
Sbjct  101   NKLLSKLFEELSLAVDELRELSLNWHPLSSKFYFVIQVDPLISTIQDLGLSILQQLKASP  160

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
               L        L+N          +  S+TI KAI   +EG G S++ L  IA+ L L+S
Sbjct  161   QSL--------LDNL--------RDEASSTIKKAIMEQLEGVGPSTEVLENIAENLGLRS  204

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQE LIE VAL+KLKENAEQ E   EVE+I+Q+I++V  MH+ L+M+KQ++S   V +PA
Sbjct  205   NQEALIEAVALDKLKENAEQLENAVEVEFIDQMISVVNRMHEHLVMLKQAQSSIPVLVPA  264

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELM DPVIVASGQTYER FI+ WIDLGLTVCPKTRQTL HTNLIPNYTVKAL
Sbjct  265   DFCCPLSLELMMDPVIVASGQTYERAFIKNWIDLGLTVCPKTRQTLVHTNLIPNYTVKAL  324

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRD---IHIFSHSRANNSTSPD-SA  1816
             IANWCE N++KL DP+KS ++NQ S     ++SG  +D   IH    S  ++S++P  S 
Sbjct  325   IANWCESNDVKLVDPMKSKSLNQSSPFHGSMESGLIKDLPEIHQERTSTLHSSSTPSGSL  384

Query  1815  HGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLAN  1636
             +G+                                    ++  +++ER+S  GS+D  A+
Sbjct  385   NGM-----------------------------------VNEQHVNLERISSTGSDDESAS  409

Query  1635  SGDRSMNSVSHFSM-PLSMNSVSSADENSHQGHNRTTSAPST--LSNSNFSRANAHDGNE  1465
             S + S++SV    M P +  S ++      Q   RTTS  +T  LS S+    +A  G  
Sbjct  410   SDEGSVDSVDQSLMSPSTRESSNALSSEQSQTDVRTTSHNNTPLLSTSSVHSQDA-SGEL  468

Query  1464  VSSPTTASTEASMEVASESRHAATLAASRRESEF-PSPVGTRLRPPAIWRRPSERLVSRI  1288
              S P          VA  +RH        RE EF P     R R   +W+R SE LV R+
Sbjct  469   NSGPDA--------VAMPTRH--------REPEFSPQLAVPRSRSQTLWQRSSEWLVPRV  512

Query  1287  VSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGA  1108
             VS+P +ETRADL+  + QVRKL+E LKS SVD +R ATAELRLLAK NMDNRIVISNCGA
Sbjct  513   VSNP-IETRADLSAAETQVRKLLEQLKSDSVDSKREATAELRLLAKENMDNRIVISNCGA  571

Query  1107  ISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENS  928
             ISL+V+LL S D  +QEN+VT LLNLSINDNNK+AIAN+GAIEPLI+VL+TGSPEAKENS
Sbjct  572   ISLIVDLLQSTDTRIQENSVTTLLNLSINDNNKAAIANSGAIEPLIHVLQTGSPEAKENS  631

Query  927   AATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQ  748
             AATLFSLSV E+NKI+IGRSGA++ LVDLLGNGTPRGKKDAATALFNLS+ HENK RIVQ
Sbjct  632   AATLFSLSVTEENKIRIGRSGAIRPLVDLLGNGTPRGKKDAATALFNLSLFHENKDRIVQ  691

Query  747   AGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKE  568
             AGAV++LVELMDPAAGMVDKAVAVL+NLATI EG+ +IGQ+GGIP+LVEV+ELGSARGKE
Sbjct  692   AGAVKNLVELMDPAAGMVDKAVAVLANLATIPEGKTAIGQQGGIPVLVEVIELGSARGKE  751

Query  567   NAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAG  388
             NAAAALL LC+++ RY NMVLQ GAVPPLVALSQSGTPRA+EKA ALL+ FR+QRHG+AG
Sbjct  752   NAAAALLHLCSDNHRYLNMVLQEGAVPPLVALSQSGTPRAKEKALALLNQFRSQRHGSAG  811

Query  387   RG  382
             R 
Sbjct  812   RA  813



>ref|XP_006575441.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Glycine max]
 ref|XP_006575442.1| PREDICTED: U-box domain-containing protein 4-like isoform X3 
[Glycine max]
 ref|XP_006575443.1| PREDICTED: U-box domain-containing protein 4-like isoform X4 
[Glycine max]
Length=771

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/840 (57%), Positives = 592/840 (70%), Gaps = 77/840 (9%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLKVL + ISSF HLS  E + SE V KYYQK E +LKLL+PI+   V +++AS++
Sbjct  1     MEISLLKVLSDAISSFSHLSFSERMKSEPVSKYYQKAEKMLKLLKPIIDTTVFSDLASNK  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL K+F  L  +VDELREL   W  LSSK YFV+Q + LI+ ++   L I++ L +S   
Sbjct  61    LLSKLFEELSLAVDELRELSLNWHPLSSKFYFVIQVDPLISTIQDLGLSILQQLKASPQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             L        L+N          +  S+TI KAI   +EG G S++ L  IA+ L L+SNQ
Sbjct  121   L--------LDNL--------RDEASSTIKKAIMEQLEGVGPSTEVLENIAENLGLRSNQ  164

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E LIE VAL+KLKENAEQ E   EVE+I+Q+I++V  MH+ L+M+KQ++S   V +PADF
Sbjct  165   EALIEAVALDKLKENAEQLENAVEVEFIDQMISVVNRMHEHLVMLKQAQSSIPVLVPADF  224

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELM DPVIVASGQTYER FI+ WIDLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  225   CCPLSLELMMDPVIVASGQTYERAFIKNWIDLGLTVCPKTRQTLVHTNLIPNYTVKALIA  284

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRD---IHIFSHSRANNSTSPD-SAHG  1810
             NWCE N++KL DP+KS ++NQ S     ++SG  +D   IH    S  ++S++P  S +G
Sbjct  285   NWCESNDVKLVDPMKSKSLNQSSPFHGSMESGLIKDLPEIHQERTSTLHSSSTPSGSLNG  344

Query  1809  LDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSG  1630
             +                                    ++  +++ER+S  GS+D  A+S 
Sbjct  345   M-----------------------------------VNEQHVNLERISSTGSDDESASSD  369

Query  1629  DRSMNSVSHFSM-PLSMNSVSSADENSHQGHNRTTSAPST--LSNSNFSRANAHDGNEVS  1459
             + S++SV    M P +  S ++      Q   RTTS  +T  LS S+    +A  G   S
Sbjct  370   EGSVDSVDQSLMSPSTRESSNALSSEQSQTDVRTTSHNNTPLLSTSSVHSQDA-SGELNS  428

Query  1458  SPTTASTEASMEVASESRHAATLAASRRESEF-PSPVGTRLRPPAIWRRPSERLVSRIVS  1282
              P          VA  +RH        RE EF P     R R   +W+R SE LV R+VS
Sbjct  429   GPDA--------VAMPTRH--------REPEFSPQLAVPRSRSQTLWQRSSEWLVPRVVS  472

Query  1281  SPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAIS  1102
             +P +ETRADL+  + QVRKL+E LKS SVD +R ATAELRLLAK NMDNRIVISNCGAIS
Sbjct  473   NP-IETRADLSAAETQVRKLLEQLKSDSVDSKREATAELRLLAKENMDNRIVISNCGAIS  531

Query  1101  LLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAA  922
             L+V+LL S D  +QEN+VT LLNLSINDNNK+AIAN+GAIEPLI+VL+TGSPEAKENSAA
Sbjct  532   LIVDLLQSTDTRIQENSVTTLLNLSINDNNKAAIANSGAIEPLIHVLQTGSPEAKENSAA  591

Query  921   TLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAG  742
             TLFSLSV E+NKI+IGRSGA++ LVDLLGNGTPRGKKDAATALFNLS+ HENK RIVQAG
Sbjct  592   TLFSLSVTEENKIRIGRSGAIRPLVDLLGNGTPRGKKDAATALFNLSLFHENKDRIVQAG  651

Query  741   AVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENA  562
             AV++LVELMDPAAGMVDKAVAVL+NLATI EG+ +IGQ+GGIP+LVEV+ELGSARGKENA
Sbjct  652   AVKNLVELMDPAAGMVDKAVAVLANLATIPEGKTAIGQQGGIPVLVEVIELGSARGKENA  711

Query  561   AAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             AAALL LC+++ RY NMVLQ GAVPPLVALSQSGTPRA+EKA ALL+ FR+QRHG+AGR 
Sbjct  712   AAALLHLCSDNHRYLNMVLQEGAVPPLVALSQSGTPRAKEKALALLNQFRSQRHGSAGRA  771



>gb|AAB87116.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM14930.1| hypothetical protein [Arabidopsis thaliana]
Length=924

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/810 (59%), Positives = 598/810 (74%), Gaps = 5/810 (1%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             ++VLL +ISSF +LSS ++I+ +   KYY++ E++L++L+PI   +V ++   DE L K 
Sbjct  80    MEVLLRSISSFLNLSSSKHIDLDPFEKYYKRVEELLRVLKPIADVVVTSDFVFDEKLGKA  139

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
             F  L   VD+  +LF++WQ  SSKVYFVLQ ESL+ K+R   +   + L+SS   LP E 
Sbjct  140   FEELTQDVDQSIDLFRSWQAFSSKVYFVLQIESLLPKMRDTIVDTFQFLMSSKNHLPDEL  199

Query  2502  SLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIE  2323
             S  SLE C+ KIK + YE +S+ I  A+++  +G G S + L KI +   L+SNQE+LIE
Sbjct  200   SPASLEQCLEKIKHLSYEEISSVIDGALRDQRDGVGPSPEILVKIGENTGLRSNQEILIE  259

Query  2322  LValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLS  2143
              VALE+ KE AEQ+E N EVE+++Q+I +V  MH+ L+++KQ+++ +SV I ADF CPLS
Sbjct  260   AVALERQKEMAEQSENNAEVEFLDQLIVIVNRMHERLLLIKQTQT-SSVAILADFFCPLS  318

Query  2142  LELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEM  1963
             LE+MTDPVIV+SGQTYE+ FI+RWIDLGL VCPKTRQTLTHT LIPNYTVKALIANWCE 
Sbjct  319   LEVMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKALIANWCET  378

Query  1962  NNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsprkssi  1783
             N++KLPDP KS ++N+ S  ++  DS       + +   +N S   D++       K S 
Sbjct  379   NDVKLPDPNKSTSLNELSPLLSCTDSIPSTGADVSARKVSNKSHDWDASSS--ETGKPSF  436

Query  1782  sssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSMNSVSH  1603
             SS A +RE +SPS P S+   S P I+G+  GLD  R SL   EDR  +S +   ++   
Sbjct  437   SSRATEREGASPSRPASALGASSPGISGNGYGLDARRGSLNDFEDRSNDSRELRTDAPGR  496

Query  1602  FSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS-PTTASTEASM  1426
              S+  +        + S   H+R+ SA ST+SN  F RA+A++ +E S+  T  S++AS 
Sbjct  497   SSVSSTTRGSVENGQTSENHHHRSPSATSTVSNEEFPRADANENSEESAHATPYSSDASG  556

Query  1425  EVASESRHAATLAASRRE-SEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLA  1249
             E+ S    A T AA+RR+ S+F      R      WRRPSERL SRIVS+P+ ETR DL+
Sbjct  557   EIRSGPLAATTSAATRRDLSDFSPKFMDRRTRGQFWRRPSERLGSRIVSAPSNETRRDLS  616

Query  1248  EVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDM  1069
             EV+ QV+KLVE+LKS+S+D QR ATAELRLLAKHNMDNRIVI N GAI LLV LL+S D 
Sbjct  617   EVETQVKKLVEELKSSSLDTQRQATAELRLLAKHNMDNRIVIGNSGAIVLLVELLYSTDS  676

Query  1068  EVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDN  889
               QENAVTALLNLSINDNNK AIA+AGAIEPLI+VLE GS EAKENSAATLFSLSVIE+N
Sbjct  677   ATQENAVTALLNLSINDNNKKAIADAGAIEPLIHVLENGSSEAKENSAATLFSLSVIEEN  736

Query  888   KIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDP  709
             KIKIG+SGA+  LVDLLGNGTPRGKKDAATALFNLSI  ENK  IVQ+GAVR+L++LMDP
Sbjct  737   KIKIGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKAMIVQSGAVRYLIDLMDP  796

Query  708   AAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNS  529
             AAGMVDKAVAVL+NLATI EGR +IGQEGGIP+LVEVVELGSARGKENAAAALLQL TNS
Sbjct  797   AAGMVDKAVAVLANLATIPEGRNAIGQEGGIPLLVEVVELGSARGKENAAAALLQLSTNS  856

Query  528   SRYCNMVLQHGAVPPLVALSQSGTPRAREK  439
              R+CNMVLQ GAVPPLVALSQSGTPRAREK
Sbjct  857   GRFCNMVLQEGAVPPLVALSQSGTPRAREK  886


 Score = 60.5 bits (145),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 64/130 (49%), Gaps = 4/130 (3%)
 Frame = -2

Query  804  ATALFNLSILHENKGRIV--QAGAVRHLVELM-DPAAGMVDKAVAVLSNLATIQEGRMSI  634
            ATA   L   H    RIV   +GA+  LVEL+    +   + AV  L NL+     + +I
Sbjct  640  ATAELRLLAKHNMDNRIVIGNSGAIVLLVELLYSTDSATQENAVTALLNLSINDNNKKAI  699

Query  633  GQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTP  454
               G I  L+ V+E GS+  KEN+AA L  L          + Q GA+ PLV L  +GTP
Sbjct  700  ADAGAIEPLIHVLENGSSEAKENSAATLFSLSVIEENKIK-IGQSGAIGPLVDLLGNGTP  758

Query  453  RAREKAQALL  424
            R ++ A   L
Sbjct  759  RGKKDAATAL  768


 Score = 58.2 bits (139),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 61/118 (52%), Gaps = 2/118 (2%)
 Frame = -2

Query  1146  NMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIY  967
             + +N+ +I   GA+  L++L+      V + AV  L NL+     ++AI   G I  L+ 
Sbjct  774   HQENKAMIVQSGAVRYLIDLMDPAAGMV-DKAVAVLANLATIPEGRNAIGQEGGIPLLVE  832

Query  966   VLETGSPEAKENSAATLFSLSVIEDNKIK-IGRSGAVQSLVDLLGNGTPRGKKDAATA  796
             V+E GS   KEN+AA L  LS         + + GAV  LV L  +GTPR ++   TA
Sbjct  833   VVELGSARGKENAAAALLQLSTNSGRFCNMVLQEGAVPPLVALSQSGTPRAREKKPTA  890



>ref|XP_006845980.1| hypothetical protein AMTR_s00155p00026110 [Amborella trichopoda]
 gb|ERN07655.1| hypothetical protein AMTR_s00155p00026110 [Amborella trichopoda]
Length=876

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/852 (56%), Positives = 596/852 (70%), Gaps = 24/852 (3%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G M+   L+ LLN +SSF H+ S  NI  E V + Y K  ++LKLL+P+L  IVDA+I  
Sbjct  30    GVMDKSTLRCLLNIMSSFTHIVSCNNIKLEPVQRDYPKIVEMLKLLRPVLDKIVDAQIEL  89

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             DE L K F  L   V+E REL + WQ L S++Y +LQ E L+ K++  +L+I +LL SS 
Sbjct  90    DEQLTKEFEELDMVVNETRELMEGWQPLMSRIYTILQIEPLVGKIQRNALEICQLLCSS-  148

Query  2523  WCLPAESSLTSL-----ENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADC  2359
                  +S+L SL     +NC+ +++ +  +  S  I +AIK+  E    SS+SL +IAD 
Sbjct  149   ----PQSALLSLDSAFLQNCLQELQCIRSDETSDAIKRAIKDQKENLIPSSESLARIADS  204

Query  2358  LSLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTS  2179
             LSL SNQELL+E VALEK+K   +  +   EVEYI+QIIALV  MH+CL+ +KQS++   
Sbjct  205   LSLTSNQELLMEAVALEKVKLQVDNEKNEREVEYIDQIIALVMCMHECLVKIKQSQAIDR  264

Query  2178  VQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNY  1999
             V +P DFCCPLSLELM+DPVIVASGQTYER FIR+W+D GLTVCPKTRQ+L HTNLIPN+
Sbjct  265   VPVPPDFCCPLSLELMSDPVIVASGQTYERAFIRKWLDQGLTVCPKTRQSLAHTNLIPNF  324

Query  1998  TVKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGA--PRDIHIFSHSRANNSTSP  1825
             TVKALIANWCE NN+K+PDPIKS++ NQ  + +A  D G   P  +   +H  +    SP
Sbjct  325   TVKALIANWCESNNVKMPDPIKSMSSNQSLNLLARSDHGVAEPSTLSQKTHV-SKLPRSP  383

Query  1824  DSAHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLG----LDVERMSLEG  1657
             + A  +   +    S+    +     + P      S+  +   + G     ++ R+SL  
Sbjct  384   ERARTVSPHQSFLSSNGTHPKPSPPYTQPIDGVSLSVLPLESQNSGNMSEKELSRVSLIT  443

Query  1656  SEDRLANSGDRSMNSVSHFSMPLSMN-SVSSADENSHQGHNRTTSAPSTLSNSNFSRANA  1480
              +D+     ++ + S +    P     S  S  E+   GHNR+ S  S  S++++++  A
Sbjct  444   PDDQACILEEQKVGSSAQAETPSGKELSECSQIEDGFPGHNRSASVSSAASSTDYTQGVA  503

Query  1479  H-DGNEVSSP----TTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRR  1315
               + NEVS      T  +++AS EV SE    ++     +      P+  R R   IWRR
Sbjct  504   SGEVNEVSRASSDMTQYASDASGEVTSEPTSTSSTPIRDKSEMLTKPLEGRSRGQNIWRR  563

Query  1314  PSER-LVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMD  1138
             P +R  V RIVS+P++++R DL  V+ +VRKLVEDL+S   + +R A AELRLLAKHNM+
Sbjct  564   PLDRGFVPRIVSTPSMDSRPDLLGVETEVRKLVEDLQSPLDEVKRDAAAELRLLAKHNME  623

Query  1137  NRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLE  958
             NRIVI+NCGAI LLV LLHSED++ QENAVTALLNLSINDNNK+ IAN GAIEPLI+VL 
Sbjct  624   NRIVIANCGAIRLLVGLLHSEDLKTQENAVTALLNLSINDNNKTIIANEGAIEPLIHVLR  683

Query  957   TGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSI  778
             TG+PEA+ENSAATLFSLSVIE+NKIKIGRS A++ LV LLGNGTPRGKKDAATALFNLSI
Sbjct  684   TGNPEARENSAATLFSLSVIEENKIKIGRSDAIKPLVHLLGNGTPRGKKDAATALFNLSI  743

Query  777   LHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEV  598
              HENK RIV AGAV+HLV+LMDPAAGMVDKAVAVL+NLATI EGR +IG EGGI  LVEV
Sbjct  744   FHENKARIVHAGAVKHLVDLMDPAAGMVDKAVAVLANLATIPEGRTAIGAEGGITALVEV  803

Query  597   VELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSY  418
             VELGS+RGKENAAAALLQLCTNS R+C+ VLQ GAVPPLVALSQSGTPRAREKAQ+LLSY
Sbjct  804   VELGSSRGKENAAAALLQLCTNSHRFCSNVLQEGAVPPLVALSQSGTPRAREKAQSLLSY  863

Query  417   FRNQRHGNAGRG  382
             FRNQRHGN GRG
Sbjct  864   FRNQRHGNVGRG  875



>ref|XP_009402804.1| PREDICTED: U-box domain-containing protein 4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402810.1| PREDICTED: U-box domain-containing protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=830

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/845 (56%), Positives = 592/845 (70%), Gaps = 30/845 (4%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEILLLK LL++I+ F H+SS  N+   LV KY Q  + IL+  + +   I  +EI+ DE
Sbjct  1     MEILLLKALLDSITKFGHVSSSSNVKPALVQKYCQIIDQILEHFKSVCDEIATSEISLDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    L    +E REL  +W  + SK+YFVLQ E+++ K+   + +I +L V+S   
Sbjct  61    QLVKGLGELDALANEARELVMSWYPMMSKIYFVLQIETIVMKICTSAFRICQL-VTSLLQ  119

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P +S+      C+ +I+ M+ E +S  I KAI++  E     S+ L  I++ LSL SNQ
Sbjct  120   SPIDSATA---KCIEEIEYMNKEQISVIIEKAIRDQTEKDMPRSEHLDMISNSLSLSSNQ  176

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E+VALEKLK     +E   E+E I+ +IAL+T+MHDCL+ +KQ  S   V IPADF
Sbjct  177   ELLAEVVALEKLKVEVGCSENQAEMENIDHMIALITYMHDCLVKVKQLHSINGVPIPADF  236

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELM+DPVIVASGQTYER FI +W+D G  VCP+TRQTL HTNLIPNYTVKALIA
Sbjct  237   CCPLSLELMSDPVIVASGQTYERAFIWKWLDQGFNVCPRTRQTLGHTNLIPNYTVKALIA  296

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGL---  1807
             NWCE NNIKLPDP+KS ++N  SS +   D+     +   +H+  N+S S +S   L   
Sbjct  297   NWCESNNIKLPDPMKSTSLNLHSSFLKPTDANINDFVTHSAHATRNHSRSSESHARLVTS  356

Query  1806  --DsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSE------  1651
               D    + +  +    E+   S   SSS     +IA      +V R+SLE +E      
Sbjct  357   QSDLHASNGVHQATYLNEKPVSSPHHSSSGSLPVQIANGSEA-NVPRLSLESAEGNNESS  415

Query  1650  --DRLANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAH  1477
                RL +S ++++N     S P S     +A++    GHN T SA   +S+ N  +    
Sbjct  416   MDQRLVSSSNQTVNQPKQDSEPFS-----AAEQ--FPGHNWTDSASLAVSSINHLQG-PE  467

Query  1476  DGNEVSSPTTASTEASMEVASESRHAATLAASRRESEFPSPV-GTRLRPPAIWRRPSERL  1300
             D N VS  ++  T  S +   E    +  + S+RESEFPS +   R R  ++WRRPS   
Sbjct  468   DANLVSRVSSDLTHCSSDAMGEIAQDSASSTSQRESEFPSALEDARFRSQSLWRRPS---  524

Query  1299  VSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVIS  1120
               RI+SS  +++R D++ V+ QVRKL+EDLKS S+D Q  ATAELRLLAKHNM+NRIVI+
Sbjct  525   APRIISSQFMDSRPDISGVEAQVRKLIEDLKSESLDLQITATAELRLLAKHNMENRIVIA  584

Query  1119  NCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEA  940
             NCG ISLLV+LLHS + ++QENAVTALLNLSINDNNK AIANAGA++PLIYVLETG+ EA
Sbjct  585   NCGVISLLVDLLHSTESKIQENAVTALLNLSINDNNKIAIANAGAVDPLIYVLETGNSEA  644

Query  939   KENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKG  760
             KENSAATLFSLSVIE+NK++IGRS A++ LV+LL NGTPRGKKDAATALFNLSI HENK 
Sbjct  645   KENSAATLFSLSVIEENKVRIGRSRAIKPLVELLANGTPRGKKDAATALFNLSIFHENKL  704

Query  759   RIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSA  580
             RIVQAGAVRHLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ GGIP+LVEVVELGSA
Sbjct  705   RIVQAGAVRHLVELMDPAAGMVDKAVAVLANLATIPEGRNAIGQAGGIPVLVEVVELGSA  764

Query  579   RGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRH  400
             RGKENAAAALLQLCTNS R+C++VLQ GAVPPLVALSQSGTPRA+EKAQALLSYFRNQRH
Sbjct  765   RGKENAAAALLQLCTNSGRFCSLVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRH  824

Query  399   GNAGR  385
             G AGR
Sbjct  825   GGAGR  829



>gb|KHN40971.1| U-box domain-containing protein 4 [Glycine soja]
Length=747

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/816 (57%), Positives = 575/816 (70%), Gaps = 77/816 (9%)
 Frame = -2

Query  2805  INSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSGLGHSVDELRELFQTWQ  2626
             + SE V KYYQK E +LKLL+PI+   V +++AS++LL K+F  L  +VDELREL   W 
Sbjct  1     MKSEPVSKYYQKAEKMLKLLKPIIDTTVFSDLASNKLLSKLFEELSLAVDELRELSLNWH  60

Query  2625  LLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLTSLENCVLKIKSMDYEL  2446
              LSSK YFV+Q + LI+ ++   L I++ L +S   L        L+N          + 
Sbjct  61    PLSSKFYFVIQVDPLISTIQDLGLSILQQLKASPQSL--------LDNL--------RDE  104

Query  2445  LSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELValeklkenaeqaeknee  2266
              S+TI KAI   +EG G S++ L  IA+ L L+SNQE LIE VAL+KLKENAEQ E   E
Sbjct  105   ASSTIKKAIMEQLEGVGPSTEVLENIAENLGLRSNQEALIEAVALDKLKENAEQLENAVE  164

Query  2265  vEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERN  2086
             VE+I+Q+I++V  MH+ L+M+KQ++S   V +PADFCCPLSLELM DPVIVASGQTYER 
Sbjct  165   VEFIDQMISVVNRMHEHLVMLKQAQSSIPVLVPADFCCPLSLELMMDPVIVASGQTYERA  224

Query  2085  FIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDPIKSLNVNQPSS  1906
             FI+ WIDLGLTVCPKTRQTL HTNLIPNYTVKALIANWCE N++KL DP+KS ++NQ S 
Sbjct  225   FIKNWIDLGLTVCPKTRQTLVHTNLIPNYTVKALIANWCESNDVKLVDPMKSKSLNQSSP  284

Query  1905  HVAHVDSGAPRD---IHIFSHSRANNSTSPD-SAHGLDsprkssisssaiqreesspshp  1738
                 ++SG  +D   IH    S  ++S++P  S +G+                       
Sbjct  285   FHGSMESGLIKDLPEIHQERTSTLHSSSTPSGSLNGM-----------------------  321

Query  1737  rssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSMNSVSHFSM-PLSMNSVSSAD  1561
                          ++  +++ER+S  GS+D  A+S + S++SV    M P +  S ++  
Sbjct  322   ------------VNEQHVNLERISSTGSDDESASSDEGSVDSVDQSLMSPSTRESSNALS  369

Query  1560  ENSHQGHNRTTSAPST--LSNSNFSRANAHDGNEVSSPTTASTEASMEVASESRHAATLA  1387
                 Q   RTTS  +T  LS S+    +A  G   S P          VA  +RH     
Sbjct  370   SEQSQTDVRTTSHNNTPLLSTSSVHSQDA-SGELNSGPDA--------VAMPTRH-----  415

Query  1386  ASRRESEF-PSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDL  1210
                RE EF P     R R   +W+R SE LV R+VS+P +ETRADL+  + QVRKL+E L
Sbjct  416   ---REPEFSPQLAVPRSRSQTLWQRSSEWLVPRVVSNP-IETRADLSAAETQVRKLLEQL  471

Query  1209  KSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNL  1030
             KS SVD +R ATAELRLLAK NMDNRIVISNCGAISL+V+LL S D  +QEN+VT LLNL
Sbjct  472   KSDSVDSKREATAELRLLAKENMDNRIVISNCGAISLIVDLLQSTDTRIQENSVTTLLNL  531

Query  1029  SINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSL  850
             SINDNNK+AIAN+GAIEPLI+VL+TGSPEAKENSAATLFSLSV E+NKI+IGRSGA++ L
Sbjct  532   SINDNNKAAIANSGAIEPLIHVLQTGSPEAKENSAATLFSLSVTEENKIRIGRSGAIRPL  591

Query  849   VDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLS  670
             VDLLGNGTPRGKKDAATALFNLS+ HENK RIVQAGAV++LVELMDPAAGMVDKAVAVL+
Sbjct  592   VDLLGNGTPRGKKDAATALFNLSLFHENKDRIVQAGAVKNLVELMDPAAGMVDKAVAVLA  651

Query  669   NLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAV  490
             NLATI EG+ +IGQ+GGIP+LVEV+ELGSARGKENAAAALL LC+++ RY NMVLQ GAV
Sbjct  652   NLATIPEGKTAIGQQGGIPVLVEVIELGSARGKENAAAALLHLCSDNHRYLNMVLQEGAV  711

Query  489   PPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             PPLVALSQSGTPRA+EKA ALL+ FR+QRHG+AGR 
Sbjct  712   PPLVALSQSGTPRAKEKALALLNQFRSQRHGSAGRA  747



>ref|XP_010942970.1| PREDICTED: U-box domain-containing protein 4-like isoform X3 
[Elaeis guineensis]
Length=847

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/826 (57%), Positives = 590/826 (71%), Gaps = 32/826 (4%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G MEI LLK LL++I+ F  LSS  +I SELV +Y+QK ++IL+LL+P+L  +V +EI+S
Sbjct  13    GVMEISLLKTLLSSIARFDLLSSSNSIKSELVQRYFQKIDEILELLKPVLDQVVASEISS  72

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             D  L K+   L   V+E RE   +W  + SKVYFVLQ ES+I  ++ +++++ +LL S  
Sbjct  73    DGKLIKLVEELDGVVNEARERIGSWHPIMSKVYFVLQIESIITNIQKYAIEVCQLLNS--  130

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
               LP+E  +TS    + K + M YE +S  I + I++  E +    + L KI++ LSL S
Sbjct  131   -LLPSEI-VTSTSTSIEKTQHMHYEQISDVIKETIRDQKEKTIPRPEQLNKISNFLSLSS  188

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQELL+E VALEKLK      E   E   I+Q+IALVTHMH+CL+ +KQ  S   V IPA
Sbjct  189   NQELLMEAVALEKLKVKVGHGENQVEQ--IDQMIALVTHMHECLVKIKQVHSINGVPIPA  246

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELM+DPVIVASGQTYER FIR+W+D G  VCPKTRQTL HTNLIPNYTVKAL
Sbjct  247   DFCCPLSLELMSDPVIVASGQTYERAFIRKWLDQGFNVCPKTRQTLGHTNLIPNYTVKAL  306

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHI--FSHS-RANNSTSPDSAH  1813
             IANWCE N+IKLPDPIKS+N+N PSS ++ +DS    D H+    HS RA++  SP+S  
Sbjct  307   IANWCESNDIKLPDPIKSMNMNLPSSFLSPIDSSG-NDCHVPHSGHSPRASHPRSPESNR  365

Query  1812  GL-----DsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSED  1648
              +     DS   + +   +   E+   S   S   ES  +IA    G D     L  S  
Sbjct  366   SMVSSHKDSHSSNGVLKESYLHEKPLSSQHSSIPVESSLQIAN---GCDANVARLSSSMG  422

Query  1647  RL-ANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDG  1471
              +  +SG ++ N           +S +S  +   QGHNR+ SA S +S++++ +    D 
Sbjct  423   EIHVDSGGQTANEAKQ-------DSQASMVDEQLQGHNRSVSASSAVSSNDYLQGTG-DA  474

Query  1470  NEVSSPTTASTEASMEVASE-SRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLV  1297
             N VS  ++  T  S + + E +R     +  +RE EFP  +G  R R   I RRPS   V
Sbjct  475   NVVSRVSSDLTHYSSDASGEVTRETPVSSTPQREPEFPQRLGEARSRSQNISRRPS---V  531

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
              RI++S ++++R DL+ V+ QVRKL+ DLKS SVD QR AT ELRLLAKHNM+NRIVI+N
Sbjct  532   PRIITSSSMDSRPDLSGVETQVRKLIGDLKSDSVDVQRSATEELRLLAKHNMENRIVIAN  591

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAIS LV+LL S D + QENAVTALLNLSINDNNK+AIANAGAI+PLI+VLETG+PEA+
Sbjct  592   CGAISSLVDLLRSTDPKTQENAVTALLNLSINDNNKTAIANAGAIDPLIHVLETGNPEAR  651

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAATLFSLSVIE++K++IGRSGA++ LV+LLGNGTPRGKKDAATALFNLSI HE+KGR
Sbjct  652   ENSAATLFSLSVIEESKVRIGRSGAIKPLVELLGNGTPRGKKDAATALFNLSIFHEHKGR  711

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV+HLVELMDPAAGMVDKAVAVL+NLATI EGR +IG  GGIP+LVEVVELGSAR
Sbjct  712   IVQAGAVKHLVELMDPAAGMVDKAVAVLANLATIPEGRAAIGHSGGIPVLVEVVELGSAR  771

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREK  439
             GKENAAAALLQLCTNS+R+C  VLQ GAVPPLVALSQSGTPRA+EK
Sbjct  772   GKENAAAALLQLCTNSNRFCTQVLQEGAVPPLVALSQSGTPRAKEK  817


 Score = 56.6 bits (135),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 71/149 (48%), Gaps = 15/149 (10%)
 Frame = -2

Query  807  AATALFNLSILHENKGRIVQA--GAVRHLVELM---DPAAGMVDKAVAVLSNLATIQEGR  643
            +AT    L   H  + RIV A  GA+  LV+L+   DP     + AV  L NL+     +
Sbjct  570  SATEELRLLAKHNMENRIVIANCGAISSLVDLLRSTDPKTQ--ENAVTALLNLSINDNNK  627

Query  642  MSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQS  463
             +I   G I  L+ V+E G+   +EN+AA L  L          + + GA+ PLV L  +
Sbjct  628  TAIANAGAIDPLIHVLETGNPEARENSAATLFSLSVIEESKVR-IGRSGAIKPLVELLGN  686

Query  462  GTPRAREKAQAL---LSYFRNQRHGNAGR  385
            GTPR ++ A      LS F    H + GR
Sbjct  687  GTPRGKKDAATALFNLSIF----HEHKGR  711



>ref|XP_010942968.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Elaeis guineensis]
 ref|XP_010942969.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Elaeis guineensis]
Length=833

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/824 (57%), Positives = 589/824 (71%), Gaps = 32/824 (4%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LL++I+ F  LSS  +I SELV +Y+QK ++IL+LL+P+L  +V +EI+SD 
Sbjct  1     MEISLLKTLLSSIARFDLLSSSNSIKSELVQRYFQKIDEILELLKPVLDQVVASEISSDG  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K+   L   V+E RE   +W  + SKVYFVLQ ES+I  ++ +++++ +LL S    
Sbjct  61    KLIKLVEELDGVVNEARERIGSWHPIMSKVYFVLQIESIITNIQKYAIEVCQLLNS---L  117

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP+E  +TS    + K + M YE +S  I + I++  E +    + L KI++ LSL SNQ
Sbjct  118   LPSEI-VTSTSTSIEKTQHMHYEQISDVIKETIRDQKEKTIPRPEQLNKISNFLSLSSNQ  176

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL+E VALEKLK      E   E   I+Q+IALVTHMH+CL+ +KQ  S   V IPADF
Sbjct  177   ELLMEAVALEKLKVKVGHGENQVEQ--IDQMIALVTHMHECLVKIKQVHSINGVPIPADF  234

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELM+DPVIVASGQTYER FIR+W+D G  VCPKTRQTL HTNLIPNYTVKALIA
Sbjct  235   CCPLSLELMSDPVIVASGQTYERAFIRKWLDQGFNVCPKTRQTLGHTNLIPNYTVKALIA  294

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHI--FSHS-RANNSTSPDSAHGL  1807
             NWCE N+IKLPDPIKS+N+N PSS ++ +DS    D H+    HS RA++  SP+S   +
Sbjct  295   NWCESNDIKLPDPIKSMNMNLPSSFLSPIDSSG-NDCHVPHSGHSPRASHPRSPESNRSM  353

Query  1806  -----DsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRL  1642
                  DS   + +   +   E+   S   S   ES  +IA    G D     L  S   +
Sbjct  354   VSSHKDSHSSNGVLKESYLHEKPLSSQHSSIPVESSLQIAN---GCDANVARLSSSMGEI  410

Query  1641  -ANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNE  1465
               +SG ++ N           +S +S  +   QGHNR+ SA S +S++++ +    D N 
Sbjct  411   HVDSGGQTANEAKQ-------DSQASMVDEQLQGHNRSVSASSAVSSNDYLQGTG-DANV  462

Query  1464  VSSPTTASTEASMEVASE-SRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLVSR  1291
             VS  ++  T  S + + E +R     +  +RE EFP  +G  R R   I RRPS   V R
Sbjct  463   VSRVSSDLTHYSSDASGEVTRETPVSSTPQREPEFPQRLGEARSRSQNISRRPS---VPR  519

Query  1290  IVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCG  1111
             I++S ++++R DL+ V+ QVRKL+ DLKS SVD QR AT ELRLLAKHNM+NRIVI+NCG
Sbjct  520   IITSSSMDSRPDLSGVETQVRKLIGDLKSDSVDVQRSATEELRLLAKHNMENRIVIANCG  579

Query  1110  AISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKEN  931
             AIS LV+LL S D + QENAVTALLNLSINDNNK+AIANAGAI+PLI+VLETG+PEA+EN
Sbjct  580   AISSLVDLLRSTDPKTQENAVTALLNLSINDNNKTAIANAGAIDPLIHVLETGNPEAREN  639

Query  930   SAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIV  751
             SAATLFSLSVIE++K++IGRSGA++ LV+LLGNGTPRGKKDAATALFNLSI HE+KGRIV
Sbjct  640   SAATLFSLSVIEESKVRIGRSGAIKPLVELLGNGTPRGKKDAATALFNLSIFHEHKGRIV  699

Query  750   QAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGK  571
             QAGAV+HLVELMDPAAGMVDKAVAVL+NLATI EGR +IG  GGIP+LVEVVELGSARGK
Sbjct  700   QAGAVKHLVELMDPAAGMVDKAVAVLANLATIPEGRAAIGHSGGIPVLVEVVELGSARGK  759

Query  570   ENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREK  439
             ENAAAALLQLCTNS+R+C  VLQ GAVPPLVALSQSGTPRA+EK
Sbjct  760   ENAAAALLQLCTNSNRFCTQVLQEGAVPPLVALSQSGTPRAKEK  803


 Score = 56.6 bits (135),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 71/149 (48%), Gaps = 15/149 (10%)
 Frame = -2

Query  807  AATALFNLSILHENKGRIVQA--GAVRHLVELM---DPAAGMVDKAVAVLSNLATIQEGR  643
            +AT    L   H  + RIV A  GA+  LV+L+   DP     + AV  L NL+     +
Sbjct  556  SATEELRLLAKHNMENRIVIANCGAISSLVDLLRSTDPKTQ--ENAVTALLNLSINDNNK  613

Query  642  MSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQS  463
             +I   G I  L+ V+E G+   +EN+AA L  L          + + GA+ PLV L  +
Sbjct  614  TAIANAGAIDPLIHVLETGNPEARENSAATLFSLSVIEESKVR-IGRSGAIKPLVELLGN  672

Query  462  GTPRAREKAQAL---LSYFRNQRHGNAGR  385
            GTPR ++ A      LS F    H + GR
Sbjct  673  GTPRGKKDAATALFNLSIF----HEHKGR  697



>ref|XP_009394995.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=833

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/857 (56%), Positives = 600/857 (70%), Gaps = 51/857 (6%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLKVLL++I+ F  +SS  N+  ELV +Y QK + I++  +P+ + I  ++I  DE
Sbjct  1     MEIFLLKVLLDSIAQFSLVSSNNNVKPELVQRYCQKIDQIIEQFEPVCNEIAASKITLDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L KV   L  +V+E REL  +W  ++SK+YFVLQ E+ + K+ + +L+I +L+ S    
Sbjct  61    QLVKVLKELDSAVNEARELVLSWFPMTSKIYFVLQIETTVTKIYSSTLEICQLVESLLLT  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
               A ++L S+E      + MD E +S  I KAI++  E      + L  I++ LSL SNQ
Sbjct  121   PVASTALKSIEG----FQHMDEEPISVVIEKAIRDQTEKDIPRPEHLDMISNFLSLSSNQ  176

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL+E VALEKLK          E+E I+ IIAL+T+MHDCL+  KQ +S   V IPADF
Sbjct  177   ELLMEAVALEKLKLKIGCNVTQAELENIDHIIALITYMHDCLVKSKQLQSINGVSIPADF  236

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELM+DPVIVASGQTYER FIR+W+D G  VCP+TRQTL HTNLIPNYTVKALIA
Sbjct  237   CCPLSLELMSDPVIVASGQTYERAFIRKWLDQGFNVCPRTRQTLGHTNLIPNYTVKALIA  296

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHS----RANNSTSPD----  1822
             NWCE NNIKLPDP+KS+++N PSS +   D+ A  D+ I SHS    R +   SP+    
Sbjct  297   NWCESNNIKLPDPMKSISLNLPSSFLKPTDASA-TDL-IVSHSGDATRVDRPRSPERYVE  354

Query  1821  ------SAHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSL-  1663
                    AH  +     +   + +  +  SP H  SS    L    G     +  R+SL 
Sbjct  355   VTTSQRDAHSSNGFPHETPHETYLHDKSVSPHHRSSSGSSPLQLANGSQA--NTSRISLV  412

Query  1662  --EGS-----EDRLANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSN  1504
               EG+     E R A+SG +++N    +S P               GHNRT SA   +SN
Sbjct  413   STEGNKESSMEQRHASSGSQTVNQPKQYSEP-----------GQFPGHNRTDSASEAVSN  461

Query  1503  SNF--SRANAHDGNEVSSPTT-ASTEASMEVASESRHAATLAASRRESEFPSP-VGTRLR  1336
             ++      +A+  ++VSS  T  S++ S E+A +++ ++   A +RE +FP   V  R R
Sbjct  462   NDHIEGPGDANMASQVSSDLTHYSSDTSGELAQDAQASS---APQREPDFPPRLVDARAR  518

Query  1335  PPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLL  1156
               +++RRPS   V RI+SS ++++R DL+ V+ QVRKL+EDLKS S D QR AT ELRLL
Sbjct  519   SQSMFRRPS---VPRIISSQSMDSRPDLSGVETQVRKLIEDLKSDSGDMQRTATEELRLL  575

Query  1155  AKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEP  976
             AKH+M+NRIVI+NCGAISLLV LL S D + QE+AVTALLNLS+NDNNK AI NA +I+P
Sbjct  576   AKHSMENRIVIANCGAISLLVGLLRSTDTKTQEHAVTALLNLSLNDNNKIAIGNADSIDP  635

Query  975   LIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATA  796
             LI+VLETG+PEAKENSAATL+SLSVIE+NK++IGRS A+  LV+LL NGTPRGKKDAATA
Sbjct  636   LIHVLETGNPEAKENSAATLYSLSVIEENKVRIGRSRAIGPLVELLANGTPRGKKDAATA  695

Query  795   LFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGI  616
             LFNLSI HENK RIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATI EGR +IGQ GGI
Sbjct  696   LFNLSIFHENKLRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIPEGRTAIGQAGGI  755

Query  615   PILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKA  436
             P+LVEVVELGSARGKENAAAALL LCTNS R+C++VLQ GAVPPLVALSQSGTPRA+EKA
Sbjct  756   PVLVEVVELGSARGKENAAAALLHLCTNSGRFCSLVLQEGAVPPLVALSQSGTPRAKEKA  815

Query  435   QALLSYFRNQRHGNAGR  385
             QALLSYFRNQRHGNAGR
Sbjct  816   QALLSYFRNQRHGNAGR  832



>ref|XP_008808377.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008808378.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Phoenix dactylifera]
Length=826

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/842 (56%), Positives = 592/842 (70%), Gaps = 26/842 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LL++I+ F  LSS  +I SELV +Y+QK ++IL+ L+P+L   V +EI+SD 
Sbjct  1     MEISLLKTLLSSIARFDLLSSSNSIKSELVQRYFQKIDEILECLKPVLDQAVASEISSDG  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K+   L   V+E REL  +W    SKVYFVLQ ES+I  ++ +++++ +LL S    
Sbjct  61    NLIKLLEELDGVVNEARELIGSWHPTMSKVYFVLQIESIITNIQKYAIEVCQLLNSLLPS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             +   S+ TS+E+CV K + M  + +S  I +A+++  E      + L KI++ LSL SNQ
Sbjct  121   VIVTSTSTSIEHCVQKTQHMHNDQISDVIKEALRDQREKITPRPEHLDKISNSLSLSSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL+E VALEKLK      E   E   I+ +IALVTHMH+CL+ +KQ  S   V IPADF
Sbjct  181   ELLMEAVALEKLKVKVGNGENQVE--QIDHMIALVTHMHECLVKIKQVHSINGVLIPADF  238

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELM+DPVIVASGQTYER FIR+W+D G  VCPKT QTL HTNLIPNYTVKALIA
Sbjct  239   CCPLSLELMSDPVIVASGQTYERAFIRKWLDQGFNVCPKTHQTLGHTNLIPNYTVKALIA  298

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHI--FSHS-RANNSTSPDSAHGL  1807
             NWCE N+IKLP P+K +N+N PSS ++ +DS +  D H+    HS R ++  SP+S   +
Sbjct  299   NWCESNDIKLPHPVKLVNMNHPSSFLSPIDSSS-NDCHVPHSGHSPRTSHPRSPESDRCI  357

Query  1806  -----DsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRL  1642
                  DS   + +   +   E+   S   S    +  +IA +    ++ R+S    E R 
Sbjct  358   VSSHKDSHSSNGVLKDSSLHEKPLSSQHSSLPVAAPLQIA-NGCDANIARLSPSLGE-RH  415

Query  1641  ANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEV  1462
              +SG ++ N       P   +  S  DE   QGHNR+ SA S +S++++      D N V
Sbjct  416   VDSGGQTANE------PEQDSQASVVDEQL-QGHNRSVSASSAVSSNDYLPGTG-DANVV  467

Query  1461  SSPTTASTEASMEVASE-SRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLVSRI  1288
             S  ++  T  S + + E +R     +  +RE EFP  +G  R R   I RR S   + RI
Sbjct  468   SQVSSDLTHDSSDTSGEVTRETPVSSTPQREPEFPPRLGEARSRSQTISRRSS---IPRI  524

Query  1287  VSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGA  1108
             ++S ++++R DL+ V+ QVRKL+EDLKS SVD QR AT ELR LAKHNM+NRIVI+ CGA
Sbjct  525   ITSSSMDSRPDLSGVETQVRKLIEDLKSDSVDVQRAATEELRFLAKHNMENRIVIAKCGA  584

Query  1107  ISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENS  928
             IS LV+LL S D + QENAVTALLNLSINDNNK+ IANAGAI+PLI+VLE G+PEA+ENS
Sbjct  585   ISSLVDLLRSTDPKTQENAVTALLNLSINDNNKTIIANAGAIDPLIHVLEAGNPEARENS  644

Query  927   AATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQ  748
             AATLFSLSVIEDNK++IGRSGA+  LV+LLGNGTPRGKKDAATALFNLSI HENK RIVQ
Sbjct  645   AATLFSLSVIEDNKVRIGRSGAIGPLVELLGNGTPRGKKDAATALFNLSIFHENKARIVQ  704

Query  747   AGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKE  568
             AGAV+HLVELMDPAAGMVDKAVAVL+NLATI EGR +IG  GGIP LVEVVELGSARGKE
Sbjct  705   AGAVKHLVELMDPAAGMVDKAVAVLANLATIAEGRGAIGHLGGIPALVEVVELGSARGKE  764

Query  567   NAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAG  388
             NAAAALLQLC NS+R+C  VLQ GAVPPLVALSQSGTPRA+EKAQ LL  FRNQRHG AG
Sbjct  765   NAAAALLQLCINSNRFCTQVLQEGAVPPLVALSQSGTPRAKEKAQNLLGIFRNQRHGKAG  824

Query  387   RG  382
             RG
Sbjct  825   RG  826



>ref|XP_009394994.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=839

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/863 (56%), Positives = 600/863 (70%), Gaps = 57/863 (7%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLKVLL++I+ F  +SS  N+  ELV +Y QK + I++  +P+ + I  ++I  DE
Sbjct  1     MEIFLLKVLLDSIAQFSLVSSNNNVKPELVQRYCQKIDQIIEQFEPVCNEIAASKITLDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFV------LQAESLIAKVRAFSLKIVELL  2536
              L KV   L  +V+E REL  +W  ++SK+YFV      LQ E+ + K+ + +L+I +L+
Sbjct  61    QLVKVLKELDSAVNEARELVLSWFPMTSKIYFVSKIYFVLQIETTVTKIYSSTLEICQLV  120

Query  2535  VSSDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCL  2356
              S      A ++L S+E      + MD E +S  I KAI++  E      + L  I++ L
Sbjct  121   ESLLLTPVASTALKSIEG----FQHMDEEPISVVIEKAIRDQTEKDIPRPEHLDMISNFL  176

Query  2355  SLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSV  2176
             SL SNQELL+E VALEKLK          E+E I+ IIAL+T+MHDCL+  KQ +S   V
Sbjct  177   SLSSNQELLMEAVALEKLKLKIGCNVTQAELENIDHIIALITYMHDCLVKSKQLQSINGV  236

Query  2175  QIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYT  1996
              IPADFCCPLSLELM+DPVIVASGQTYER FIR+W+D G  VCP+TRQTL HTNLIPNYT
Sbjct  237   SIPADFCCPLSLELMSDPVIVASGQTYERAFIRKWLDQGFNVCPRTRQTLGHTNLIPNYT  296

Query  1995  VKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHS----RANNSTS  1828
             VKALIANWCE NNIKLPDP+KS+++N PSS +   D+ A  D+ I SHS    R +   S
Sbjct  297   VKALIANWCESNNIKLPDPMKSISLNLPSSFLKPTDASA-TDL-IVSHSGDATRVDRPRS  354

Query  1827  PD----------SAHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDV  1678
             P+           AH  +     +   + +  +  SP H  SS    L    G     + 
Sbjct  355   PERYVEVTTSQRDAHSSNGFPHETPHETYLHDKSVSPHHRSSSGSSPLQLANGSQA--NT  412

Query  1677  ERMSL---EGS-----EDRLANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSA  1522
              R+SL   EG+     E R A+SG +++N    +S P               GHNRT SA
Sbjct  413   SRISLVSTEGNKESSMEQRHASSGSQTVNQPKQYSEP-----------GQFPGHNRTDSA  461

Query  1521  PSTLSNSNF--SRANAHDGNEVSSPTT-ASTEASMEVASESRHAATLAASRRESEFPSP-  1354
                +SN++      +A+  ++VSS  T  S++ S E+A +++ ++   A +RE +FP   
Sbjct  462   SEAVSNNDHIEGPGDANMASQVSSDLTHYSSDTSGELAQDAQASS---APQREPDFPPRL  518

Query  1353  VGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIAT  1174
             V  R R  +++RRPS   V RI+SS ++++R DL+ V+ QVRKL+EDLKS S D QR AT
Sbjct  519   VDARARSQSMFRRPS---VPRIISSQSMDSRPDLSGVETQVRKLIEDLKSDSGDMQRTAT  575

Query  1173  AELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIAN  994
              ELRLLAKH+M+NRIVI+NCGAISLLV LL S D + QE+AVTALLNLS+NDNNK AI N
Sbjct  576   EELRLLAKHSMENRIVIANCGAISLLVGLLRSTDTKTQEHAVTALLNLSLNDNNKIAIGN  635

Query  993   AGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGK  814
             A +I+PLI+VLETG+PEAKENSAATL+SLSVIE+NK++IGRS A+  LV+LL NGTPRGK
Sbjct  636   ADSIDPLIHVLETGNPEAKENSAATLYSLSVIEENKVRIGRSRAIGPLVELLANGTPRGK  695

Query  813   KDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSI  634
             KDAATALFNLSI HENK RIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATI EGR +I
Sbjct  696   KDAATALFNLSIFHENKLRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIPEGRTAI  755

Query  633   GQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTP  454
             GQ GGIP+LVEVVELGSARGKENAAAALL LCTNS R+C++VLQ GAVPPLVALSQSGTP
Sbjct  756   GQAGGIPVLVEVVELGSARGKENAAAALLHLCTNSGRFCSLVLQEGAVPPLVALSQSGTP  815

Query  453   RAREKAQALLSYFRNQRHGNAGR  385
             RA+EKAQALLSYFRNQRHGNAGR
Sbjct  816   RAKEKAQALLSYFRNQRHGNAGR  838



>ref|XP_008808379.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Phoenix dactylifera]
Length=822

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/842 (56%), Positives = 589/842 (70%), Gaps = 30/842 (4%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LL++I+ F  LSS  +I SELV +Y+QK ++IL+ L+P+L   V +EI+SD 
Sbjct  1     MEISLLKTLLSSIARFDLLSSSNSIKSELVQRYFQKIDEILECLKPVLDQAVASEISSDG  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K+   L   V+E REL  +W    SKVYFVLQ ES+I  ++ +++++ +LL S    
Sbjct  61    NLIKLLEELDGVVNEARELIGSWHPTMSKVYFVLQIESIITNIQKYAIEVCQLLNSLLPS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             +   S+ TS+E    K + M  + +S  I +A+++  E      + L KI++ LSL SNQ
Sbjct  121   VIVTSTSTSIE----KTQHMHNDQISDVIKEALRDQREKITPRPEHLDKISNSLSLSSNQ  176

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL+E VALEKLK      E   E   I+ +IALVTHMH+CL+ +KQ  S   V IPADF
Sbjct  177   ELLMEAVALEKLKVKVGNGENQVE--QIDHMIALVTHMHECLVKIKQVHSINGVLIPADF  234

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELM+DPVIVASGQTYER FIR+W+D G  VCPKT QTL HTNLIPNYTVKALIA
Sbjct  235   CCPLSLELMSDPVIVASGQTYERAFIRKWLDQGFNVCPKTHQTLGHTNLIPNYTVKALIA  294

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHI--FSHS-RANNSTSPDSAHGL  1807
             NWCE N+IKLP P+K +N+N PSS ++ +DS +  D H+    HS R ++  SP+S   +
Sbjct  295   NWCESNDIKLPHPVKLVNMNHPSSFLSPIDSSS-NDCHVPHSGHSPRTSHPRSPESDRCI  353

Query  1806  -----DsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRL  1642
                  DS   + +   +   E+   S   S    +  +IA +    ++ R+S    E R 
Sbjct  354   VSSHKDSHSSNGVLKDSSLHEKPLSSQHSSLPVAAPLQIA-NGCDANIARLSPSLGE-RH  411

Query  1641  ANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEV  1462
              +SG ++ N       P   +  S  DE   QGHNR+ SA S +S++++      D N V
Sbjct  412   VDSGGQTANE------PEQDSQASVVDEQL-QGHNRSVSASSAVSSNDYLPGTG-DANVV  463

Query  1461  SSPTTASTEASMEVASE-SRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLVSRI  1288
             S  ++  T  S + + E +R     +  +RE EFP  +G  R R   I RR S   + RI
Sbjct  464   SQVSSDLTHDSSDTSGEVTRETPVSSTPQREPEFPPRLGEARSRSQTISRRSS---IPRI  520

Query  1287  VSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGA  1108
             ++S ++++R DL+ V+ QVRKL+EDLKS SVD QR AT ELR LAKHNM+NRIVI+ CGA
Sbjct  521   ITSSSMDSRPDLSGVETQVRKLIEDLKSDSVDVQRAATEELRFLAKHNMENRIVIAKCGA  580

Query  1107  ISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENS  928
             IS LV+LL S D + QENAVTALLNLSINDNNK+ IANAGAI+PLI+VLE G+PEA+ENS
Sbjct  581   ISSLVDLLRSTDPKTQENAVTALLNLSINDNNKTIIANAGAIDPLIHVLEAGNPEARENS  640

Query  927   AATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQ  748
             AATLFSLSVIEDNK++IGRSGA+  LV+LLGNGTPRGKKDAATALFNLSI HENK RIVQ
Sbjct  641   AATLFSLSVIEDNKVRIGRSGAIGPLVELLGNGTPRGKKDAATALFNLSIFHENKARIVQ  700

Query  747   AGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKE  568
             AGAV+HLVELMDPAAGMVDKAVAVL+NLATI EGR +IG  GGIP LVEVVELGSARGKE
Sbjct  701   AGAVKHLVELMDPAAGMVDKAVAVLANLATIAEGRGAIGHLGGIPALVEVVELGSARGKE  760

Query  567   NAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAG  388
             NAAAALLQLC NS+R+C  VLQ GAVPPLVALSQSGTPRA+EKAQ LL  FRNQRHG AG
Sbjct  761   NAAAALLQLCINSNRFCTQVLQEGAVPPLVALSQSGTPRAKEKAQNLLGIFRNQRHGKAG  820

Query  387   RG  382
             RG
Sbjct  821   RG  822



>gb|KHG09481.1| U-box domain-containing 4 -like protein [Gossypium arboreum]
Length=735

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/767 (60%), Positives = 554/767 (72%), Gaps = 51/767 (7%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LL+NISSF +LSS E INSE V KYYQ+ E+ILKLL+PIL+ I+D+E+ SDE
Sbjct  1     MEISLLKALLSNISSFLNLSSFEKINSEPVQKYYQRAEEILKLLKPILNSIIDSEVTSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K F GLG S++ELRE   +WQ L SKVYF                            
Sbjct  61    VLIKAFEGLGLSIEELREQCDSWQPLLSKVYF----------------------------  92

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
                        + + KIK + YE  S+ I +AI++ V+  G  S+ L KIA+ LSL+SNQ
Sbjct  93    -----------HRLQKIKHVGYEQTSSVIREAIRDQVDSVGPISEILAKIAENLSLRSNQ  141

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE VALEKLKENAEQAEK  E E+++QII LVT MH+ L+++K S++C+ V IPADF
Sbjct  142   EILIEAVALEKLKENAEQAEKTAEAEFVDQIIGLVTRMHERLVLIKHSQTCSPVPIPADF  201

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI++WI LGL VCPKTRQTL HTNLIPNYTVKALIA
Sbjct  202   CCPLSLELMTDPVIVASGQTYERAFIKKWIGLGLIVCPKTRQTLAHTNLIPNYTVKALIA  261

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGLDsp  1798
             NWCE NN+KLPDP+KS+     S  + H +SG  RD      SR++   SP+S       
Sbjct  262   NWCESNNVKLPDPMKSM-----SPLLLHAESGLSRDSSSVPCSRSSQPISPES-RSTSQT  315

Query  1797  rkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSM  1618
              K+ I+SS + RE +SP HPRS+SE SLP I G+   LDV R+SL  +E+  +N   R  
Sbjct  316   DKNLITSSGLNREGTSPLHPRSTSEGSLPAIDGNGEYLDVARISLSSAEEG-SNLEQRGS  374

Query  1617  NSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNE---VSSPTT  1447
              SV    +  S+N   +  ++S   H R+ SA STLSNS+F +    D NE    S+   
Sbjct  375   ESVGQPPLSPSINEFHNNGQSS-LNHARSDSASSTLSNSDFPQGPGGDANESLEASTHLR  433

Query  1446  ASTEASMEVASESRHAATLAASRRESEF-PSPVGTRLRPPAIWRRPSERLVSRIVSSPTV  1270
             A+++ + EV S+ +  A+ A  +RE+EF P  +  R R   IWRR SER V RI+SSP +
Sbjct  434   ANSDINGEVKSDPQPVASSAIPQREAEFSPRFMDPRSRSQRIWRRQSERFVPRIISSPGI  493

Query  1269  ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVN  1090
             E RADL+  + QV+KLVEDLK TSVD QR ATA+LRLLAKHNMDNRI+I+NCGAIS+LV+
Sbjct  494   ENRADLSGTETQVKKLVEDLKCTSVDTQREATAQLRLLAKHNMDNRIIIANCGAISMLVD  553

Query  1089  LLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFS  910
             LL S D + QENAVTALLNLSINDNNK+AIANA AIEPLI+VLETG+PEAKENSAATLFS
Sbjct  554   LLRSPDTKTQENAVTALLNLSINDNNKTAIANANAIEPLIHVLETGTPEAKENSAATLFS  613

Query  909   LSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRH  730
             LSVIEDNK++IGRSGA+  LVDLLGNGTPRGKKDAATALFNLSI HENK RIVQAGAVRH
Sbjct  614   LSVIEDNKVRIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVQAGAVRH  673

Query  729   LVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVEL  589
             LVELMDPAAGMVDKAVAVL+NLATI EGR SIGQE GIP+LVE   L
Sbjct  674   LVELMDPAAGMVDKAVAVLANLATIPEGRTSIGQEQGIPVLVEAQTL  720



>ref|XP_007142063.1| hypothetical protein PHAVU_008G249400g [Phaseolus vulgaris]
 gb|ESW14057.1| hypothetical protein PHAVU_008G249400g [Phaseolus vulgaris]
Length=769

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/836 (55%), Positives = 559/836 (67%), Gaps = 71/836 (8%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLKVL + ISSF HLS  E +  E V KYYQK E +LKLL+PI+     ++IAS+E
Sbjct  1     MEISLLKVLSDAISSFLHLSFSEKMKLEPVSKYYQKAEKMLKLLKPIIDTTDFSDIASNE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L+K+F  L  +VDELREL   W  LSSK YFV Q + L++ ++A  + I++ L  S  C
Sbjct  61    VLRKLFEELCPAVDELRELILNWHPLSSKFYFVNQVDLLVSTIQALGVSILQQLKDSPQC  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP      +L N             S+TI KAI   +EG G S + L  IAD L L+SNQ
Sbjct  121   LP-----DNLGNET-----------SSTIKKAILEQLEGVGPSLEVLENIADHLGLRSNQ  164

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE V+LEKLKE AEQ E   EVEYI+++I++V  MH+ L+M+KQ++S   V +PADF
Sbjct  165   EVLIEAVSLEKLKEKAEQIENTSEVEYIDKMISVVNRMHEHLVMLKQAQSSIPVPVPADF  224

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI+ WIDLGLT+CPKTRQTL HTNL         I 
Sbjct  225   CCPLSLELMTDPVIVASGQTYERAFIKNWIDLGLTICPKTRQTLVHTNL---------IP  275

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHG-LDs  1801
             N+           +K+L  N   +H          D+ +    +  N   P   HG ++S
Sbjct  276   NYT----------VKALIANWCETH----------DVKLPDPIKYKNLNQPSPFHGSMES  315

Query  1800  prkssisssaiqreesspshprssseeslpEIAGD--DLGLDVERMSLEGSEDRLANSGD  1627
                 +  +          +     S      + G   +   D+ER+S  GS+D  A+S +
Sbjct  316   GLIKNSPAITSGEPHQERTSTLHHSSNPGGSLNGTVHEPYADLERISHTGSDDGSASSHE  375

Query  1626  RSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTT  1447
              S++SV       S N++SS      Q   RTT   +TL               +S+ + 
Sbjct  376   GSVDSVGESLTSPSRNALSSEQS---QADIRTTDINNTL---------------LSTSSV  417

Query  1446  ASTEASMEVASESRHAATLAASRRESEFPSPVGT-RLRPPAIWRRPSERLVSRIVSSPTV  1270
              S +A  E+ +  + A  L    RESEF S +   R R   IW+R SE LV R+VS   +
Sbjct  418   HSRDAFGELNA-GQDAIPLPTRHRESEFSSQLAVPRSRSQTIWQRSSEWLVPRVVS---I  473

Query  1269  ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVN  1090
             ETRA L+  + QV+KLVE LK  S+D +R AT+ELRLLAKHNMDNRIVISNCGAISLLV+
Sbjct  474   ETRAALSAAETQVQKLVEQLKIDSLDAKREATSELRLLAKHNMDNRIVISNCGAISLLVD  533

Query  1089  LLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFS  910
             LL S D  +QEN+VTALLNLSINDNNK+AIANAGAIEPLI+VL+TGS EAKENSAATLFS
Sbjct  534   LLQSTDSMIQENSVTALLNLSINDNNKAAIANAGAIEPLIHVLKTGSSEAKENSAATLFS  593

Query  909   LSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRH  730
             LSV E+NKI+IGRSGA++ LVDLLGNG+PRGKKDAATALFNLSI HENK RIVQAGAV+H
Sbjct  594   LSVTEENKIRIGRSGAIRPLVDLLGNGSPRGKKDAATALFNLSIFHENKDRIVQAGAVKH  653

Query  729   LVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAAL  550
             LVELMDPAAGMVDKAVAVL+NLATI EG+ +IG EGGIP+LVEV+ELGS RGKENAAAAL
Sbjct  654   LVELMDPAAGMVDKAVAVLANLATIPEGKAAIGDEGGIPVLVEVIELGSVRGKENAAAAL  713

Query  549   LQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             L LC+ + RY N VLQ GAVPPLVALSQSGTPRA+EKA ALL+ FR+QRHG  GR 
Sbjct  714   LHLCSYNHRYLNKVLQEGAVPPLVALSQSGTPRAKEKALALLNQFRSQRHGGGGRA  769



>ref|XP_008802944.1| PREDICTED: U-box domain-containing protein 4-like [Phoenix dactylifera]
Length=879

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/844 (55%), Positives = 584/844 (69%), Gaps = 20/844 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LLN+I  F  LSS   I SELV +Y  K ++IL+LL+P+L   V +EI+SD 
Sbjct  44    MEISLLKTLLNSIRCFDLLSSSNTIKSELVQRYCPKIDEILELLKPVLDQAVASEISSDG  103

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L ++   L   V+E REL   W   +SKVYFVLQ ES+I  +  +S+++   L S    
Sbjct  104   NLIQLLKELDGVVNEARELVGCWHPTASKVYFVLQIESIITNIWKYSIEVCRRLNSLLPF  163

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             +   +  TS+E+ V KI+ M YE +S  I +AI++  E      + L KI++ LSL SNQ
Sbjct  164   VKINNMSTSIEHYVQKIQHMHYERISDVIKEAIRDQREKVILGPELLDKISNSLSLSSNQ  223

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL+E  ALEKLK  A + E + EVE I+ +IALVT MH+CL+ +K   S   V IPA+F
Sbjct  224   ELLMEAAALEKLKVKAGRGENHIEVEEIDHMIALVTSMHECLLKIKHMHSINGVPIPANF  283

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELM+DPVIV SG TYER FIR+W+D G  VCPKT QTL +TNLIPNYTVK LIA
Sbjct  284   CCPLSLELMSDPVIVHSGLTYERAFIRKWLDQGFNVCPKTHQTLGNTNLIPNYTVKLLIA  343

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHV-----DSGAPRDIHIFSHSRANNSTSPDSAH  1813
             NWCE N+IKLPDP+KS+ +N   S ++ +     D   P   H     RAN+  SP+S  
Sbjct  344   NWCESNDIKLPDPMKSMKINLSLSSLSPIDSSSNDCNVPYSGH---SPRANHPRSPESNR  400

Query  1812  GL-----DsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSED  1648
              +     DS   +         E+       +    S  +I  +    ++ R+SL  +E 
Sbjct  401   CMVSSHKDSHLSNGDLQGNYLHEKPLSPQHSAPPVASSLQIE-NRCDANIARLSLVTTEG  459

Query  1647  RLANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGN  1468
             + ++SG+R  +S    +     ++ +   +   QGHNR+ SA +++S++++ + +  D N
Sbjct  460   KESSSGERHGDSGGQTANQPKQDAQTPIVDEQLQGHNRSVSACTSVSDNDYPQ-DTRDAN  518

Query  1467  EVSSPTTASTEASMEVASE-SRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLVS  1294
              VS  +   T  S + + E +R     +A +RE EFP+ +G    R   I+R  S   + 
Sbjct  519   VVSQVSDDLTHYSSDASGEVTRETPASSAPQREPEFPTRLGEAHFRSQTIFRWSS---IP  575

Query  1293  RIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNC  1114
             RI+SSPT+++R DL+ V+ +VRKL+EDLK  SVD QR ATAELRLLAK NM+NR+VI+NC
Sbjct  576   RIISSPTMDSRPDLSGVETEVRKLIEDLKIDSVDVQRSATAELRLLAKRNMENRVVIANC  635

Query  1113  GAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKE  934
              AISLLV+LLHS D + QENAVTALLNLS+NDNNK AIANAGAI+PLI+VLETG+ EA+E
Sbjct  636   EAISLLVDLLHSTDPKTQENAVTALLNLSLNDNNKIAIANAGAIDPLIHVLETGNTEARE  695

Query  933   NSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRI  754
             NSAATLFSLSVI +NK+ IGRSGA++ LV+LLGNGTPRGKKDA TALFNLS  HENK RI
Sbjct  696   NSAATLFSLSVIGENKVMIGRSGAIRPLVELLGNGTPRGKKDATTALFNLSTFHENKARI  755

Query  753   VQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARG  574
             VQAGAV HLVELMDPAAGMVDKAVAVL+NLATIQEGR +IG   GI  LVEVVELGSARG
Sbjct  756   VQAGAVNHLVELMDPAAGMVDKAVAVLANLATIQEGRTAIGHSDGILPLVEVVELGSARG  815

Query  573   KENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGN  394
             KENAAAALLQLC NS+R+C  VLQ GAVPPLVALSQSGTPRA+EKA ALLSYFRNQR+GN
Sbjct  816   KENAAAALLQLCQNSNRFCTRVLQQGAVPPLVALSQSGTPRAKEKAHALLSYFRNQRYGN  875

Query  393   AGRG  382
             AGRG
Sbjct  876   AGRG  879



>gb|KHG13263.1| U-box domain-containing 4 -like protein [Gossypium arboreum]
 gb|KHG16671.1| U-box domain-containing 4 -like protein [Gossypium arboreum]
Length=627

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/685 (62%), Positives = 494/685 (72%), Gaps = 80/685 (12%)
 Frame = -2

Query  2373  KIADCLSLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQS  2194
             KI + LSL SNQE+LIE VALEKLKENAEQAEK  EV +I+Q+IALV+HM   L+++KQS
Sbjct  2     KIFESLSLNSNQEILIEAVALEKLKENAEQAEKTAEVVFIDQLIALVSHMRHHLVLIKQS  61

Query  2193  ESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTN  2014
             ++C+ V IPADFCCPLSLELMT+PVIVASGQTYER FI+ WIDLGLTVCPKTRQTL H N
Sbjct  62    QACSPVLIPADFCCPLSLELMTNPVIVASGQTYERAFIKNWIDLGLTVCPKTRQTLAHIN  121

Query  2013  LIPNYTVKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAH----VDSGAPRDIHIFSHSR  1846
             LIPNYTVKALI NWCE NN+KLPDP+KS+N+NQP   + H     +SG  +D + F HSR
Sbjct  122   LIPNYTVKALITNWCESNNVKLPDPMKSMNLNQPHPLLVHESKSAESGLRKDSNSFLHSR  181

Query  1845  ANNSTSPDSAHGLDsprkssisssaiqreesspshprssseeslpEIAGDDL----GLDV  1678
             ++ S SP S                                      +G +L    GL  
Sbjct  182   SSQSMSPKS---------------------------------WSRSQSGKNLITSSGLHW  208

Query  1677  ERMSL-------EGS-----EDRLANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNR  1534
             E  SL       EGS     EDR +N   R   SV    M  S +    A  +S +   R
Sbjct  209   EAASLIHPCSTSEGSLPGITEDR-SNVEQRGCESVGQPPMSPS-HFPGGAVGDSSETSER  266

Query  1533  TTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVASESRHAATLAASRRESEF-PS  1357
             +T    T S+S+ S      G   S P  A++ A+ +               RE  F P 
Sbjct  267   STHV--TASSSDIS------GEMKSDPQPAASAATPQ---------------REPGFSPR  303

Query  1356  PVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIA  1177
              +  R R   +WRRP ERL+ RIVSSP  E RA+L+ ++ +V+KLVEDLKSTSVD QR A
Sbjct  304   LMDARSRSQTMWRRPKERLLPRIVSSPATENRAELSGIETRVKKLVEDLKSTSVDTQREA  363

Query  1176  TAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIA  997
              ++LRLLAKHNMDNRI+I+NCGA+SLLV+LLHS D + QENAVTALLNLSINDNNK+AIA
Sbjct  364   ASQLRLLAKHNMDNRIIIANCGAVSLLVDLLHSPDAKTQENAVTALLNLSINDNNKTAIA  423

Query  996   NAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRG  817
             NA AIEPLI+VL+ GSPEAKENSAATLFSLSVIE+NK++IGRSGA++ LVDLLGNGTPRG
Sbjct  424   NANAIEPLIHVLKRGSPEAKENSAATLFSLSVIENNKVRIGRSGAIRPLVDLLGNGTPRG  483

Query  816   KKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMS  637
             KKDAATALFNLSI HENK +IV+A AVR+LV+LMDPAAGMVDKAVAVL+NLA I EGR +
Sbjct  484   KKDAATALFNLSIFHENKAQIVEADAVRYLVDLMDPAAGMVDKAVAVLANLAKIPEGRTA  543

Query  636   IGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGT  457
             IGQEGGIP+LVEVVELGSARGKE  AAALLQLCTNSSR+C MVLQ GAVPPLVALSQSGT
Sbjct  544   IGQEGGIPVLVEVVELGSARGKE-YAAALLQLCTNSSRFCIMVLQEGAVPPLVALSQSGT  602

Query  456   PRAREKAQALLSYFRNQRHGNAGRG  382
             PRA+EKAQALLSYFR+QRHGNA RG
Sbjct  603   PRAKEKAQALLSYFRSQRHGNARRG  627



>ref|XP_006659047.1| PREDICTED: U-box domain-containing protein 4-like [Oryza brachyantha]
Length=826

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/840 (52%), Positives = 579/840 (69%), Gaps = 24/840 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENIN-SELVHKYYQKTEDILKLLQPILSGIVDAEIASD  2701
             ME   L+ LLN+I     L+S  + +  + + KY Q   DI  ++ P++  + ++    +
Sbjct  1     MENFSLRTLLNSILRITVLTSDGSTSRPKPIQKYCQNVCDISSIVSPLIEDLCES---PE  57

Query  2700  ELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             + L +V   LG +V+E   L   W   +SK+YF+ Q ES+I+ ++  SL++ +L   ++ 
Sbjct  58    DQLNEVLRELGTAVNEASGLIGNWHQTTSKIYFIWQIESVISDIQGCSLQLCQL---ANS  114

Query  2520  CLPAESSLTSLE-NCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
              LP   SLT     C+ K++ ++YE +   + +A     E   AS +SL++++  LSL +
Sbjct  115   LLP---SLTGRACTCIEKLQDINYEHMLDLVKEASMELAETDTASPESLSRLSSTLSLST  171

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             N EL +E V+LE L+  A ++E  EE++  E++I LV +MHD L+   Q  +   V IPA
Sbjct  172   NLELYMEAVSLESLRARAMRSENREELDLAEKMIPLVNYMHDRLLRETQLLNINGVPIPA  231

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELM+DPVIVASGQTYER +I+ W+D G T+CPKTRQ L H+NLIPNYTVKAL
Sbjct  232   DFCCPLSLELMSDPVIVASGQTYERVYIKLWLDEGFTICPKTRQRLGHSNLIPNYTVKAL  291

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVD--SGAPRDIHIFSHSRANNSTSPDS---  1819
             IANWCE +NI+LPDP+KSL +N PS+  A  D  +     +H    ++ N   SP++   
Sbjct  292   IANWCESHNIRLPDPMKSLKLNFPSAASALQDLSTTGSSPLHPTVVAKGNIPGSPEADLY  351

Query  1818  AHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLA  1639
                L+                 + +   +S+++S     G     D+ R+SL GSE R  
Sbjct  352   MRSLNRASPPHSVVHQNSHAHVNRAGHEASAKQSSENANGS--VADISRLSLAGSETREP  409

Query  1638  NSGDRSMNSVSHFSMPLSMNSVSSAD-ENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEV  1462
             +   R+  S+   S   +  +  +++ +   Q H  ++S   +L NS   + +A   N  
Sbjct  410   SLEGRNAGSIGQTSEQSAEEAFQASNLDRDSQDHVGSSSVNGSLPNSG--QLDAECDNGP  467

Query  1461  SSPTTASTEASMEVASESRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLVSRIV  1285
             S  T  S++AS+EV      A+++   +RE   PS +   R R   + R+ SER   RI+
Sbjct  468   SGRTNYSSDASLEVTDGGPSASSVP--QREHLIPSRLADVRSRGQFVRRQSSERGFPRII  525

Query  1284  SSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAI  1105
             SS +++TR+DL+ ++ QVRKLV+DL+S SVD QR AT+E+RLLAKHNM+NRIVI+NCGAI
Sbjct  526   SSSSMDTRSDLSAIESQVRKLVDDLRSDSVDVQRSATSEIRLLAKHNMENRIVIANCGAI  585

Query  1104  SLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSA  925
             +LLV LLHS D ++QE+AVTALLNLSINDNNK AIANA A++PLI+VLETG+PEAKENSA
Sbjct  586   NLLVGLLHSPDAKIQEHAVTALLNLSINDNNKIAIANADAVDPLIHVLETGNPEAKENSA  645

Query  924   ATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA  745
             ATLFSLSVIE+NK++IGRSGA++ LVDLLGNGTPRGKKDAATALFNLSILHENK RIVQA
Sbjct  646   ATLFSLSVIEENKVRIGRSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKARIVQA  705

Query  744   GAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKEN  565
              AVR+LVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSARGKEN
Sbjct  706   DAVRYLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPALVEVVELGSARGKEN  765

Query  564   AAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             AAAALLQLCTNSSR+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR+QRHGN+ R
Sbjct  766   AAAALLQLCTNSSRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRSQRHGNSAR  825



>ref|NP_001060820.1| Os08g0110500 [Oryza sativa Japonica Group]
 dbj|BAD09539.1| putative arm repeat-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF22734.1| Os08g0110500 [Oryza sativa Japonica Group]
 gb|EEE67919.1| hypothetical protein OsJ_25785 [Oryza sativa Japonica Group]
Length=824

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/840 (52%), Positives = 571/840 (68%), Gaps = 26/840 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSS-LENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASD  2701
             ME    + LLN+I     L+S       + + KY Q   DI  ++ P++  + ++    +
Sbjct  1     MENFSPRTLLNSILRITVLTSDGSTARPKPIQKYCQNVCDISSIVSPLIEDLCES---PE  57

Query  2700  ELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             E L +V   LG +++    L   WQ  +SK+YF+ Q ES+I+ ++  SL++ +L+ S   
Sbjct  58    EQLNEVLRELGTAINRASGLIGNWQQTTSKIYFIWQIESVISDIQGCSLQLCQLVNS---  114

Query  2520  CLPAESSLTSLE-NCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
              LP   SLT     C+ K++ ++YE +   + ++    VE    S ++L++++  LSL +
Sbjct  115   LLP---SLTGRACTCIEKLQDINYENMFDLVKESSLELVETDTTSPENLSRLSSSLSLST  171

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             N E  +E V+LE L+  A ++E  EE++  +++I LV +MHD L+   Q  S   V IPA
Sbjct  172   NLEFYMEAVSLENLRARAMRSENREEMDLADKMIPLVNYMHDHLLRETQLLSINGVPIPA  231

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELM+DPVIVASGQTYER +I+ W+D G T+CPKTRQ L H+NLIPNYTVKAL
Sbjct  232   DFCCPLSLELMSDPVIVASGQTYERVYIKLWLDEGFTICPKTRQRLGHSNLIPNYTVKAL  291

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSG--APRDIHIFSHSRANNSTSPDS---  1819
             IANWCE +NI+LPDP+KSL +N P +  A  DS       +H    ++ N   SP++   
Sbjct  292   IANWCESHNIRLPDPMKSLKLNFPLAASALQDSSTTGSSPLHPTVAAKGNIPGSPEADLY  351

Query  1818  AHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLA  1639
                L+                 + +   +S ++S     G     DV R+SL GSE R +
Sbjct  352   MRSLNRASPPHSVVHQNSHAHVNRAGHEASIKQSSENANGS--ASDVSRLSLAGSETRES  409

Query  1638  NSGDRSMNSVSHFSMPLSMNSV--SSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNE  1465
             +  +R+  S+   S      +   S+ D +SH  H  ++S   +L NS   + +A   N 
Sbjct  410   SLEERNAGSIGQTSEQSIEEAFQASNLDRDSHD-HVGSSSVNGSLPNS--GQLDAECDNG  466

Query  1464  VSSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIV  1285
              S  T  S++AS EV   +   +  +A +RE   PS +          RRPSER   RI+
Sbjct  467   PSERTNYSSDASGEV---TDGPSASSAPQREHLIPSRLADVRSRGQFVRRPSERGFPRII  523

Query  1284  SSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAI  1105
             SS +++TR+DL+ ++ QVRKLV+DL+S SVD QR AT+++RLLAKHNM+NRI+I+NCGAI
Sbjct  524   SSSSMDTRSDLSAIENQVRKLVDDLRSDSVDVQRSATSDIRLLAKHNMENRIIIANCGAI  583

Query  1104  SLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSA  925
             +LLV LLHS D + QE+AVTALLNLSINDNNK AIANA A++PLI+VLETG+PEAKENSA
Sbjct  584   NLLVGLLHSPDSKTQEHAVTALLNLSINDNNKIAIANADAVDPLIHVLETGNPEAKENSA  643

Query  924   ATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA  745
             ATLFSLSVIE+NK++IGRSGA++ LVDLLGNGTPRGKKDAATALFNLSILHENK RIVQA
Sbjct  644   ATLFSLSVIEENKVRIGRSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKARIVQA  703

Query  744   GAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKEN  565
              AV++LVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSARGKEN
Sbjct  704   DAVKYLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPALVEVVELGSARGKEN  763

Query  564   AAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             AAAALLQLCTNSSR+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR+QRHGN+ R
Sbjct  764   AAAALLQLCTNSSRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRSQRHGNSAR  823



>ref|XP_002444901.1| hypothetical protein SORBIDRAFT_07g001110 [Sorghum bicolor]
 gb|EES14396.1| hypothetical protein SORBIDRAFT_07g001110 [Sorghum bicolor]
Length=823

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/844 (52%), Positives = 571/844 (68%), Gaps = 35/844 (4%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSS-LENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASD  2701
             M+ L    LLN+IS    L+S +  +  + + KY +   D+  ++ P++  +  +    +
Sbjct  1     MDNLSPSTLLNSISCLGALTSDVSTVRPKPIQKYCKNVYDVSSIVNPLVEDLCKS---PE  57

Query  2700  ELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             E L +V   L  +V+E   L   W   +SK+YF  Q ES+I+ ++  SL++ +L+ S   
Sbjct  58    EQLNEVLKDLDTAVNEASGLIGNWHQTTSKIYFGWQIESVISDIQGCSLQLCQLVNS---  114

Query  2520  CLPAESSLTSLE-NCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
              LP   SLT     C+ K++ ++YE +   I +      E +   S++L K++  LSL +
Sbjct  115   LLP---SLTGRACTCIEKLQDINYERMFDLIKEVAVELAETNAVGSENLLKLSSLLSLST  171

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             N EL +E V+LE L+  A ++E  EE+E  EQ+I LV +MHD L+  KQ  S   V IPA
Sbjct  172   NMELYMESVSLENLRTRALRSENREELELAEQMIPLVNYMHDHLLREKQQLSINGVPIPA  231

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELM+DPVIVASGQTYER +I+ W+D G T+CPKTRQ L H+NLIPNYTVKAL
Sbjct  232   DFCCPLSLELMSDPVIVASGQTYERVYIKLWLDEGFTICPKTRQRLGHSNLIPNYTVKAL  291

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDS----GAPRDIHIFSHSRANNSTSPDSA  1816
             IANWCE ++I+LPDP+KSL +N PS+  +  DS    G+P  +H    SRAN   SP++ 
Sbjct  292   IANWCESHDIRLPDPMKSLKLNFPSAASSLQDSSAAGGSP--LHPSVVSRANIPGSPEAD  349

Query  1815  HGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLAN  1636
               L +   +S   S   +         S + E+    A D     V R+SL  SE R ++
Sbjct  350   VYLRNLNGASPPHSLANQNSHVHEVSTSQTSENANGSAPD-----VSRLSLASSEARESS  404

Query  1635  SGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDG---NE  1465
                R    +      +S +S   A ++S+   +   +  S+  N +   +   DG   N 
Sbjct  405   LEGRRGGLIGQ----MSEHSTEEAFQSSNLDRDLQDNLASSSLNGSLPNSGQLDGECDNG  460

Query  1464  V----SSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLV  1297
             V    S  T  S++AS EV          +  +RE   P  +G R +   I R+PS+R  
Sbjct  461   VTRVPSDRTNYSSDASGEVTDGGGAPVASSVPQREHLIPPRLGPRGQ--FIRRQPSDRGF  518

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
              RI+SS T++ R+DL+ ++ QVRKL++DL+S S+D QR A ++LR LAKHNM+NRIVI+N
Sbjct  519   PRIISSSTMDARSDLSAIENQVRKLIDDLRSDSIDVQRSAASDLRSLAKHNMENRIVIAN  578

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGA++LLV+LLHS D + QE+AVTALLNLSINDNNK AIANA A++PLI+VLETG+PEAK
Sbjct  579   CGAVNLLVSLLHSPDAKTQEHAVTALLNLSINDNNKIAIANADAVDPLIHVLETGNPEAK  638

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAATLFSLSVIE+NK++IGRSGA++ LVDLLGNGTPRGKKDAATALFNLSILHENK R
Sbjct  639   ENSAATLFSLSVIEENKVRIGRSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKAR  698

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQA AVRHLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSAR
Sbjct  699   IVQADAVRHLVELMDPAAGMVDKAVAVLANLATIPEGRNAIGQARGIPALVEVVELGSAR  758

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAAAALLQLCTNS+R+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR+QRHG
Sbjct  759   GKENAAAALLQLCTNSNRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRSQRHG  818

Query  396   NAGR  385
             N+ R
Sbjct  819   NSAR  822



>ref|XP_008648363.1| PREDICTED: U-box domain-containing protein 4 [Zea mays]
 ref|XP_008648364.1| PREDICTED: U-box domain-containing protein 4 [Zea mays]
 ref|XP_008648365.1| PREDICTED: U-box domain-containing protein 4 [Zea mays]
 gb|AFW74276.1| putative ARM repeat-containing protein containing family protein 
isoform 1 [Zea mays]
 gb|AFW74277.1| putative ARM repeat-containing protein containing family protein 
isoform 2 [Zea mays]
 gb|AFW74278.1| putative ARM repeat-containing protein containing family protein 
isoform 3 [Zea mays]
Length=828

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/845 (52%), Positives = 571/845 (68%), Gaps = 32/845 (4%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSS-LENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASD  2701
             M+ L    LLN+I+    L+S +  +  + V KY +   DI  ++ P+L  +  +    +
Sbjct  1     MDNLSPSTLLNSITCLGALTSDVSTVRPKPVQKYCKNVYDISSIVNPLLEDLCKS---PE  57

Query  2700  ELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             E L +V   L  +V+E   L   W   + K+ F  Q ES+I+ ++  SL++ +L+ S   
Sbjct  58    EQLNEVLRDLDTAVNEASGLIGNWHQTTGKICFGWQIESVISDIQGCSLQLCQLVHS---  114

Query  2520  CLPAESSLTSLE-NCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
              LP   SLT+    C+ K++ ++YE L   + +      E    SS++L K++  LSL +
Sbjct  115   LLP---SLTARACTCIEKLQDINYEHLFDLVKEVAMELAETGAVSSENLLKLSSLLSLST  171

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             N EL +E V+LE L+  A ++E  EE+E  EQ+I LV +MHD L+  KQ  S   V IP 
Sbjct  172   NMELYMEAVSLENLRTRALRSENREELELAEQMIPLVNYMHDHLLREKQQLSINGVPIPP  231

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELM+DPVIVASGQTYER +I+ W+D G T+CPKTRQ L H+NLIPNYTVKAL
Sbjct  232   DFCCPLSLELMSDPVIVASGQTYERVYIKLWLDEGFTICPKTRQRLGHSNLIPNYTVKAL  291

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVD----SGAPRDIHIFSHSRANNSTSPDS-  1819
             IANWCE ++I+LPDPIKSL +N PS+  +  D     G+P  +H    SR+N   SP++ 
Sbjct  292   IANWCESHDIRLPDPIKSLKLNFPSAASSLQDLSAAGGSP--LHPTLVSRSNIPGSPEAD  349

Query  1818  AHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLA  1639
              H  +    SS  S A Q      + P      S      +    DV R+SL GSE R +
Sbjct  350   VHLRNLNGASSPRSLANQNSHVHANRPGHEVSTSQTSENANGSAPDVSRLSLAGSETRES  409

Query  1638  NSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDG---N  1468
             +   +   S+      +S +S   A ++S+   N   +  S+  N +   +   DG   N
Sbjct  410   SMEAKRAGSIGQ----MSEHSTDEAFQSSNLDRNLQDNLASSSLNGSLPNSGQLDGECDN  465

Query  1467  EV----SSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERL  1300
              V    S  T  S++AS EV          +  +RE   P+ +GTR     I R+PS+R 
Sbjct  466   GVTRVPSDRTNYSSDASGEVTDGGAAPVASSVPQREHLIPARLGTR---QFIRRQPSDRG  522

Query  1299  VSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVIS  1120
               RI+SS T++TR+DL+ ++ QVRKL++DLKS S+D QR A ++LR LAKHNM+NRIVI+
Sbjct  523   FPRIISSSTMDTRSDLSAIENQVRKLIDDLKSDSIDVQRSAASDLRSLAKHNMENRIVIA  582

Query  1119  NCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEA  940
             NCGA+++LV LLHS D + QE+AVTALLNLSINDNNK AIANA A++PLI+VLETG+PEA
Sbjct  583   NCGAVNVLVGLLHSPDAKTQEHAVTALLNLSINDNNKIAIANADAVDPLIHVLETGNPEA  642

Query  939   KENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKG  760
             KENSAATLFSLSV+E+NK++IGRSGA++ LVDLLGNGTPRGKKDAATALFNLSILHENK 
Sbjct  643   KENSAATLFSLSVVEENKVRIGRSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKA  702

Query  759   RIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSA  580
             RIVQA AV+HLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSA
Sbjct  703   RIVQADAVQHLVELMDPAAGMVDKAVAVLANLATIPEGRNAIGQARGIPALVEVVELGSA  762

Query  579   RGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRH  400
             RGKENAAAALLQLCTNS+R+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR+QRH
Sbjct  763   RGKENAAAALLQLCTNSNRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRSQRH  822

Query  399   GNAGR  385
             GN+ R
Sbjct  823   GNSAR  827



>gb|EEC82795.1| hypothetical protein OsI_27558 [Oryza sativa Indica Group]
Length=839

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/842 (52%), Positives = 573/842 (68%), Gaps = 26/842 (3%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSS-LENINSELVHKYYQKTEDILKLLQPILSGIVDAEIA  2707
             G ME    + LLN+I     L+S       + + KY Q   DI  ++ P++  + ++   
Sbjct  14    GLMENFSPRTLLNSILRITVLTSDGSTARPKPIQKYCQNVCDISSIVSPLIEDLCES---  70

Query  2706  SDELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSS  2527
              +E L +V   LG +++    L   WQ  +SK+YF+ Q ES+I+ ++  SL++ +L+ S 
Sbjct  71    PEEQLNEVLRELGTAINRASGLIGNWQQTTSKIYFIWQIESVISDIQGCSLQLCQLVNS-  129

Query  2526  DWCLPAESSLTSLE-NCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSL  2350
                LP   SLT     C+ K++ ++YE +   + ++    VE    S ++L++++  LSL
Sbjct  130   --LLP---SLTGRACTCIEKLQDINYENMFDLVKESSLELVETDTTSPENLSRLSSSLSL  184

Query  2349  KSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQI  2170
              +N EL +E V+LE L+  A ++E  EE++  +++I LV +MHD L+   Q  S   V I
Sbjct  185   STNLELYMEAVSLENLRARAMRSENREEMDLADKMIPLVNYMHDHLLRETQLLSINGVPI  244

Query  2169  PADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVK  1990
             PADFCCPLSLELM+DPVIVASGQTYER +I+ W+D G T+CPKTRQ L H+NLIPNYTVK
Sbjct  245   PADFCCPLSLELMSDPVIVASGQTYERVYIKLWLDEGFTICPKTRQRLGHSNLIPNYTVK  304

Query  1989  ALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSG--APRDIHIFSHSRANNSTSPDS-  1819
             ALIANWCE +NI+LPDP+KSL +N P +  A  DS       +H    ++ N   SP++ 
Sbjct  305   ALIANWCESHNIRLPDPMKSLKLNFPLAASALQDSSTTGSSPLHPTVAAKGNIPGSPEAD  364

Query  1818  --AHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDR  1645
                  L+                 + +   +S ++S     G     DV R+SL GSE R
Sbjct  365   LYMRSLNRASPPHSVVHQNSHAHVNHAGHEASIKQSSENANGS--ASDVSRLSLAGSETR  422

Query  1644  LANSGDRSMNSVSHFSMPLSMNSV--SSADENSHQGHNRTTSAPSTLSNSNFSRANAHDG  1471
              ++  +R+  S+   S      +   S+ D +SH  H  ++S   +L NS   + +A   
Sbjct  423   ESSLEERNAGSIGQTSEQSIEEAFQASNLDRDSHD-HVGSSSVNGSLPNS--GQLDAECD  479

Query  1470  NEVSSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSR  1291
             N  S  T  S++AS EV   +   +  +A +RE   PS +          RRPSER   R
Sbjct  480   NGPSERTNYSSDASGEV---TDGPSASSAPQREHLIPSRLADVRSRGQFVRRPSERGFPR  536

Query  1290  IVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCG  1111
             I+SS +++TR+DL+ ++ QVRKLV+DL+S SVD QR AT+++RLLAKHNM+NRI+I+NCG
Sbjct  537   IISSSSMDTRSDLSAIENQVRKLVDDLRSDSVDVQRSATSDIRLLAKHNMENRIIIANCG  596

Query  1110  AISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKEN  931
             AI+LLV LLHS D + QE+AVTALLNLSINDNNK AIANA A++PLI+VLETG+PEAKEN
Sbjct  597   AINLLVGLLHSPDSKTQEHAVTALLNLSINDNNKIAIANADAVDPLIHVLETGNPEAKEN  656

Query  930   SAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIV  751
             SAATLFSLSVIE+NK++IGRSGA++ LVDLLGNGTPRGKKDAATALFNLSILHENK RIV
Sbjct  657   SAATLFSLSVIEENKVRIGRSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKARIV  716

Query  750   QAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGK  571
             QA AV++LVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSARGK
Sbjct  717   QADAVKYLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPALVEVVELGSARGK  776

Query  570   ENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNA  391
             ENAAAALLQLCTNSSR+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR+QRHGN+
Sbjct  777   ENAAAALLQLCTNSSRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRSQRHGNS  836

Query  390   GR  385
              R
Sbjct  837   AR  838



>ref|XP_010234999.1| PREDICTED: U-box domain-containing protein 4 isoform X2 [Brachypodium 
distachyon]
Length=827

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/842 (52%), Positives = 571/842 (68%), Gaps = 27/842 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINS----ELVHKYYQKTEDILKLLQPILSGIVDAEI  2710
             ME      LLN+IS   HLS L +  S    + + KY Q   DI  ++ P++  I  +  
Sbjct  1     MENFSPSTLLNSIS---HLSVLTSDGSTARPKPIQKYCQNVCDISSIVSPLIEEICKS--  55

Query  2709  ASDELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVS  2530
               DE L +V   L  +++E   L   WQ  +SK+YFV Q ES+I+ ++  SL++ +L   
Sbjct  56    -PDEQLNEVLRDLDTAINEASGLIGNWQQTTSKIYFVWQIESVISDIQGCSLQLCQL---  111

Query  2529  SDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSL  2350
             ++  LP+ +    +  C+ K++ ++YE +   + K +   +     S ++L K++  LSL
Sbjct  112   ANSLLPSLTGCACI--CIEKLQDINYEHM-FDLVKEVAIELTMGTQSHENLLKVSVALSL  168

Query  2349  KSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQI  2170
              +N EL +E V+LE LK  A ++E  EE++ +EQ+I +V +MH+ L+   +  S   V +
Sbjct  169   STNLELYMEAVSLENLKARAIRSENREELDLVEQMIPMVNYMHERLLRETKLLSNYPVSV  228

Query  2169  PADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVK  1990
             P DFCCPLSLELM+DPVIVASGQTYER +I+ W+D G T+CPKTRQ L+H+NLIPNYTVK
Sbjct  229   PGDFCCPLSLELMSDPVIVASGQTYERVYIKLWLDEGFTICPKTRQRLSHSNLIPNYTVK  288

Query  1989  ALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIF-SHSRANN-STSPDSA  1816
             ALIANWCE+N+IKLPDP+KSL +N PS+  +  D  A  +  +  S +R NN   SP++ 
Sbjct  289   ALIANWCELNDIKLPDPVKSLKLNFPSAASSTQDLSATGNSPLHPSVARGNNIPGSPETE  348

Query  1815  HGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLAN  1636
               + S  ++S  S   Q  ++S + P   +  +      +    D+ R+SL  SE R  +
Sbjct  349   IYMRSLNRASPPSVVHQNFDASVNRPGHETSTNQSSEYTNG-SADIARLSLASSEAR-DS  406

Query  1635  SGDRSMNSVSHFSMPLSMNSVSSADEN-SHQGHNRTTSAPSTLSNSNFSRANAHDGNEV-  1462
               +R   S    S   + ++  ++D N   + H  ++S   +L NS          N V 
Sbjct  407   LVERQAGSHLQTSEQSTEDTFQASDVNMDSRDHVGSSSMNGSLPNSGQLDGECDVNNGVM  466

Query  1461  ---SSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSR  1291
                S  T  S++AS EVA +   AA+ A  R     P     R+R   + R+ S+R   R
Sbjct  467   RVPSDRTNYSSDASGEVA-DGGPAASSAPQRENLILPRLGDVRMRGQFVRRQSSDRGFPR  525

Query  1290  IVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCG  1111
             I SS         A ++ QVR+L+EDL+S S++ QR AT+E+RLLAKHNM+NRIVI+NCG
Sbjct  526   ISSSSMDSRSDLSA-IENQVRRLIEDLRSDSIEGQRSATSEIRLLAKHNMENRIVIANCG  584

Query  1110  AISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKEN  931
             AI++LV LLHS D ++QENAVTALLNLSINDNNK AIANA A+EPLI+VLETG+PEAKEN
Sbjct  585   AINMLVGLLHSPDAKIQENAVTALLNLSINDNNKIAIANADAVEPLIHVLETGNPEAKEN  644

Query  930   SAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIV  751
             SAATLFSLSVIE+NK++IGRSGAV+ LVDLLGNGTPRGKKDAATALFNLSILHENKGRIV
Sbjct  645   SAATLFSLSVIEENKVRIGRSGAVKPLVDLLGNGTPRGKKDAATALFNLSILHENKGRIV  704

Query  750   QAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGK  571
             QA AVRHLV+LMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSARGK
Sbjct  705   QADAVRHLVDLMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPSLVEVVELGSARGK  764

Query  570   ENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNA  391
             ENAAAALLQLCTNS+R+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR+QRHGN+
Sbjct  765   ENAAAALLQLCTNSNRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRSQRHGNS  824

Query  390   GR  385
              R
Sbjct  825   AR  826



>ref|XP_003562601.2| PREDICTED: U-box domain-containing protein 4 isoform X1 [Brachypodium 
distachyon]
Length=834

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/844 (52%), Positives = 572/844 (68%), Gaps = 27/844 (3%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINS----ELVHKYYQKTEDILKLLQPILSGIVDA  2716
             G ME      LLN+IS   HLS L +  S    + + KY Q   DI  ++ P++  I  +
Sbjct  6     GLMENFSPSTLLNSIS---HLSVLTSDGSTARPKPIQKYCQNVCDISSIVSPLIEEICKS  62

Query  2715  EIASDELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELL  2536
                 DE L +V   L  +++E   L   WQ  +SK+YFV Q ES+I+ ++  SL++ +L 
Sbjct  63    ---PDEQLNEVLRDLDTAINEASGLIGNWQQTTSKIYFVWQIESVISDIQGCSLQLCQL-  118

Query  2535  VSSDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCL  2356
               ++  LP+ +    +  C+ K++ ++YE +   + K +   +     S ++L K++  L
Sbjct  119   --ANSLLPSLTGCACI--CIEKLQDINYEHM-FDLVKEVAIELTMGTQSHENLLKVSVAL  173

Query  2355  SLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSV  2176
             SL +N EL +E V+LE LK  A ++E  EE++ +EQ+I +V +MH+ L+   +  S   V
Sbjct  174   SLSTNLELYMEAVSLENLKARAIRSENREELDLVEQMIPMVNYMHERLLRETKLLSNYPV  233

Query  2175  QIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYT  1996
              +P DFCCPLSLELM+DPVIVASGQTYER +I+ W+D G T+CPKTRQ L+H+NLIPNYT
Sbjct  234   SVPGDFCCPLSLELMSDPVIVASGQTYERVYIKLWLDEGFTICPKTRQRLSHSNLIPNYT  293

Query  1995  VKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIF-SHSRANN-STSPD  1822
             VKALIANWCE+N+IKLPDP+KSL +N PS+  +  D  A  +  +  S +R NN   SP+
Sbjct  294   VKALIANWCELNDIKLPDPVKSLKLNFPSAASSTQDLSATGNSPLHPSVARGNNIPGSPE  353

Query  1821  SAHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRL  1642
             +   + S  ++S  S   Q  ++S + P   +  +      +    D+ R+SL  SE R 
Sbjct  354   TEIYMRSLNRASPPSVVHQNFDASVNRPGHETSTNQSSEYTNG-SADIARLSLASSEAR-  411

Query  1641  ANSGDRSMNSVSHFSMPLSMNSVSSADEN-SHQGHNRTTSAPSTLSNSNFSRANAHDGNE  1465
              +  +R   S    S   + ++  ++D N   + H  ++S   +L NS          N 
Sbjct  412   DSLVERQAGSHLQTSEQSTEDTFQASDVNMDSRDHVGSSSMNGSLPNSGQLDGECDVNNG  471

Query  1464  V----SSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLV  1297
             V    S  T  S++AS EVA +   AA+ A  R     P     R+R   + R+ S+R  
Sbjct  472   VMRVPSDRTNYSSDASGEVA-DGGPAASSAPQRENLILPRLGDVRMRGQFVRRQSSDRGF  530

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
              RI SS         A ++ QVR+L+EDL+S S++ QR AT+E+RLLAKHNM+NRIVI+N
Sbjct  531   PRISSSSMDSRSDLSA-IENQVRRLIEDLRSDSIEGQRSATSEIRLLAKHNMENRIVIAN  589

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI++LV LLHS D ++QENAVTALLNLSINDNNK AIANA A+EPLI+VLETG+PEAK
Sbjct  590   CGAINMLVGLLHSPDAKIQENAVTALLNLSINDNNKIAIANADAVEPLIHVLETGNPEAK  649

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAATLFSLSVIE+NK++IGRSGAV+ LVDLLGNGTPRGKKDAATALFNLSILHENKGR
Sbjct  650   ENSAATLFSLSVIEENKVRIGRSGAVKPLVDLLGNGTPRGKKDAATALFNLSILHENKGR  709

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQA AVRHLV+LMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSAR
Sbjct  710   IVQADAVRHLVDLMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPSLVEVVELGSAR  769

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAAAALLQLCTNS+R+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR+QRHG
Sbjct  770   GKENAAAALLQLCTNSNRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRSQRHG  829

Query  396   NAGR  385
             N+ R
Sbjct  830   NSAR  833



>ref|XP_004972465.1| PREDICTED: U-box domain-containing protein 4-like [Setaria italica]
Length=829

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/843 (51%), Positives = 557/843 (66%), Gaps = 27/843 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSS-LENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASD  2701
             M+ L    LLN+IS    L+S   N+  + + KY Q   DI  ++  +L  +  +    +
Sbjct  1     MDNLSPSTLLNSISRLGVLTSDGSNVRPKPIQKYCQNVYDISSIVNSLLEDLCKS---PE  57

Query  2700  ELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             E L +V   L  ++ E   L   W   +SK+YF  Q ES+I+ ++  SL++ +L  S   
Sbjct  58    EQLNEVLRDLDTAIHEASGLIGNWHQTTSKIYFGWQIESVISDIQGCSLQLCQLANS---  114

Query  2520  CLPAESSLTSLE-NCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
                   SLT     C+ K++ ++YE +   +  A     E S  SS++L K+   LSL +
Sbjct  115   ---LSPSLTGCACTCIEKLQDINYEHMFDLVKDAAVELAETSTVSSENLLKLTGLLSLST  171

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             N EL +E V+LE L+  A ++E  EE++  EQ+I LV HMHD L+  KQ      V IPA
Sbjct  172   NMELYMEAVSLENLRTRALRSENREELDLAEQMIPLVNHMHDRLLKEKQQLLINGVPIPA  231

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELM+DPVIVASGQTYER +I+ W+D G T+CPKTRQ L H+NLIPNYTVKAL
Sbjct  232   DFCCPLSLELMSDPVIVASGQTYERVYIKLWLDEGFTICPKTRQRLGHSNLIPNYTVKAL  291

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPS--SHVAHVDSGAPRDIHIFSHSRANNSTSPDSA--  1816
             IANWCE ++I+LPDP+KSL +N P+  S +  +++     +H    SRAN   SP++   
Sbjct  292   IANWCESHDIRLPDPMKSLKLNFPAAASSLQDLNAAGGSPLHPSVISRANIPGSPEADVY  351

Query  1815  -HGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLA  1639
                L+        ++       S S    S+ ++     G     D+ R+SL   E R +
Sbjct  352   LRNLNGASPPQSVANQNSHVHPSRSGHEVSTSQTSENANGS--APDISRLSLASPEARES  409

Query  1638  NSGDRSMNSVSHFSMPLSMNSVSSAD-ENSHQGHNRTTSAPSTLSNSNFSRANAHDG--N  1468
             +   R   S+   S   +  +  S++ +   Q +  ++S   +L NS        +G   
Sbjct  410   SLEGRRGGSIGQTSEQSTEEAFQSSNLDRDMQDNMASSSMNGSLPNSGQLDGECDNGVTR  469

Query  1467  EVSSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPA--IWRRPSERLVS  1294
               S  T  S++AS EV          +  +RE   P     RL P +  I R+ S+R   
Sbjct  470   VPSDRTNYSSDASGEVTDGGGAPVPSSVPQREPLIP----PRLTPRSQFIRRQASDRGFP  525

Query  1293  RIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNC  1114
             RI+SS  ++ R+DL+ ++ QVRKL+EDL+S S+D QR A +ELRLLAKHNM+NRIVI+NC
Sbjct  526   RIISSSLMDARSDLSAIENQVRKLIEDLRSDSLDVQRSAASELRLLAKHNMENRIVIANC  585

Query  1113  GAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKE  934
             GA++LLV LLHS D + QE+AVTALLNLSINDNNK AIANA A+ PLI+VLETG+ EAKE
Sbjct  586   GAVNLLVGLLHSPDAKTQEHAVTALLNLSINDNNKIAIANADAVNPLIHVLETGNAEAKE  645

Query  933   NSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRI  754
             NSAATLFSLSVIE+NK++IGRSGA++ LVDLLGNGTPRGKKDAATALFNLSILHENK RI
Sbjct  646   NSAATLFSLSVIEENKMRIGRSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKARI  705

Query  753   VQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARG  574
             VQA AVRHLV+LMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSARG
Sbjct  706   VQADAVRHLVDLMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPALVEVVELGSARG  765

Query  573   KENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGN  394
             KENAAAALLQLCTNS+R+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR+QRHGN
Sbjct  766   KENAAAALLQLCTNSNRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRSQRHGN  825

Query  393   AGR  385
             + R
Sbjct  826   SAR  828



>dbj|BAJ92958.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=831

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/849 (51%), Positives = 572/849 (67%), Gaps = 37/849 (4%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINS----ELVHKYYQKTEDILKLLQPILSGIVDAEI  2710
             ME    + LLN+IS   HLS+L +  S    + + KY Q   DI  ++ P++  I  +  
Sbjct  1     MEDFSPRALLNSIS---HLSALTSDGSTARPKPIQKYCQNVCDISSIVSPLIEDICKS--  55

Query  2709  ASDELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVS  2530
               +E L +V   L  +++E   L   W   +SK+YFV Q ES+I+ ++  SL++ +L   
Sbjct  56    -PEEQLDEVLRELDIAINEASGLIGNWHQTTSKIYFVWQIESVISDIQGCSLQLCQL---  111

Query  2529  SDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASS-DSLTKIADCLS  2353
             ++  LP+ +    +  C+ K++ ++YE +   + K +   + G+   S ++L+ ++  LS
Sbjct  112   ANSLLPSLTGCACI--CIQKLQDINYEHM-FDLAKEVAKKLNGNDTQSPENLSIVSSSLS  168

Query  2352  LKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQ  2173
             L +N EL +E V+LE L+  A ++E  +E+E  E++I +V +MH+ L+   Q  +   V 
Sbjct  169   LSTNLELYMEAVSLENLRTRAMRSENRKELELAEEMIPMVNYMHEQLLRETQLLNINGVP  228

Query  2172  IPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTV  1993
             IPADFCCPLSLELM+DPVI+ASGQTYER +I+ W+D G T+CPKTRQ L H+NLIPNYTV
Sbjct  229   IPADFCCPLSLELMSDPVILASGQTYERVYIKLWLDEGFTICPKTRQRLAHSNLIPNYTV  288

Query  1992  KALIANWCEMNNIKLPDPIKSLNVNQPS--SHVAHVDSGAPRDIHIFSHSRANNSTSPDS  1819
             KALI+NWCE ++IKLPDP+KSL +N PS  S +  + +     +H  S  R N   SP++
Sbjct  289   KALISNWCESHDIKLPDPVKSLKLNFPSAASSLQDLSTTGNSPLHP-SAGRGNIPGSPEA  347

Query  1818  ---AHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSED  1648
                   L+    S            +     +S+ +S     G     D+ ++SL  SE 
Sbjct  348   DLYMKSLNRASPSHNGVHQNSDALVNRPSHDASANQSSDYPNGSTP--DISKLSLASSEA  405

Query  1647  RLANSGDRSMNS---VSHFSMPLSMN-SVSSADENSHQGHNRTTSAPSTLSNSN-FSRAN  1483
             R +    R   S    S  S   +   S+S+ D   H G   ++S   +L NS       
Sbjct  406   RESTLEGRHAGSNVQTSEKSTEEAFQASLSNGDSQDHVG---SSSVNGSLPNSGQLDGEC  462

Query  1482  AHDGNEVSSP---TTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRP  1312
              +D   V  P   T  S++AS EVA +   + + A  R     P     R+R   + R+P
Sbjct  463   DNDNGMVRVPGDRTNYSSDASGEVA-DGGPSVSSAPQRENVMLPRLGDVRMRGQFVRRQP  521

Query  1311  SERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNR  1132
             S+R   RI+SS +++ R DL+ ++ QVRKL++DLKS S++ QR AT+E+RLLAKHNM+NR
Sbjct  522   SDRGFPRILSSSSMDARGDLSAIENQVRKLIDDLKSDSIEAQRSATSEIRLLAKHNMENR  581

Query  1131  IVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETG  952
             IVI+NCGAI+LLV LLHS D ++QENAVTALLNLSINDNNK AIA+A A++PLI+VLETG
Sbjct  582   IVIANCGAINLLVGLLHSSDAKIQENAVTALLNLSINDNNKIAIASADAVDPLIHVLETG  641

Query  951   SPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILH  772
             +PEAKENSAATLFSLSVIE+NK++IGRSGAV+ LVDLLGNGTPRGKKDAATALFNLSILH
Sbjct  642   NPEAKENSAATLFSLSVIEENKVRIGRSGAVKPLVDLLGNGTPRGKKDAATALFNLSILH  701

Query  771   ENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVE  592
             ENKGRIVQA AVR+LVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVE
Sbjct  702   ENKGRIVQADAVRYLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPALVEVVE  761

Query  591   LGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFR  412
             LGSARGKENAAAALLQLCTNS+R+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR
Sbjct  762   LGSARGKENAAAALLQLCTNSNRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFR  821

Query  411   NQRHGNAGR  385
             +QRHGN+ R
Sbjct  822   SQRHGNSAR  830



>ref|XP_008678334.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Zea mays]
Length=830

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/850 (51%), Positives = 560/850 (66%), Gaps = 40/850 (5%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSS-LENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASD  2701
             M+ L    LLN+IS    L+S +     + +HKY +   DI  ++ P+L  +  +    +
Sbjct  1     MDNLSPATLLNSISCLGALTSDVSTARPKPIHKYCKNVYDISSIVTPLLEDLCKS---PE  57

Query  2700  ELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             E L +V   L  +V+E   L   W   +SK+YF  + ES+I+ ++  SL++ +L+ S   
Sbjct  58    EQLDEVLRDLDTAVNEASGLIGNWHQTTSKMYFGWRIESVISDIQGCSLQLCQLVNS---  114

Query  2520  CLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSN  2341
              LP+ ++   +  C+ K++ +++E +   + +        S  SS +L K++  LSL +N
Sbjct  115   LLPSLTARACM--CIEKLQDINHEHVFDLVKEVAMELAATSAVSSVNLLKLSSLLSLSTN  172

Query  2340  QELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPAD  2161
              EL  E V+LE LK  A + E  EE++  EQ+I LV +MHD L+  KQ  S   V IPAD
Sbjct  173   MELYTEAVSLENLKTRALRCESREELDLAEQMIPLVNYMHDHLLKEKQQLSINGVPIPAD  232

Query  2160  FCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALI  1981
             FCCPLSLELM+DPVIVASGQTYER +I+ W+D G T+CPKT Q L H+NLIPNYTVKALI
Sbjct  233   FCCPLSLELMSDPVIVASGQTYERVYIKLWLDEGFTICPKTLQRLGHSNLIPNYTVKALI  292

Query  1980  ANWCEMNNIKLPDPIKSLNVNQPSSHVAHVD----SGAPRDIHIFSHSRANNSTSPD---  1822
             ANWCE ++I+LPDP+KSL +N PS+     D     G+P  +H    SRAN   SP+   
Sbjct  293   ANWCESHDIRLPDPMKSLKLNFPSAASFLEDLSAADGSP--LHPIVVSRANIPGSPEVDV  350

Query  1821  SAHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRL  1642
                 L+         +      ++      S+ ++  +  G     DV R+SL  SE R 
Sbjct  351   YLRNLNGASPPHSLVNQNSHAHANRHGHEVSTSQTSEKTNGS--VPDVSRLSLASSEARE  408

Query  1641  ANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDG---  1471
             ++   R   S+   S          + E + Q  N        L+NS+ + +  + G   
Sbjct  409   SSLEGRRGGSIGQIS--------EHSTEEAFQSSNLDRDLQDNLANSSLNGSLPNSGQLD  460

Query  1470  ----NEV----SSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRR  1315
                 N V    S  T  S++AS EV +        +  +RE   P  +G   +   I R+
Sbjct  461   GECDNGVTRVPSDRTNYSSDASGEVTNGGGAPVASSVPQREHLIPPRLGMGTKQ-FIRRQ  519

Query  1314  PSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDN  1135
             PS+R   RI+SS T++ R+DL+ ++ QVRKL++DLKS S+D QR A ++LRLL+KHNM+N
Sbjct  520   PSDRGFPRIISSSTMDARSDLSAIENQVRKLIDDLKSDSIDVQRSAASDLRLLSKHNMEN  579

Query  1134  RIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLET  955
             RI I+NCGA++LLV  LHS D + QE+AVTALLNLSINDNNK AIANA A++PLI+VLET
Sbjct  580   RIAIANCGAVNLLVGRLHSPDAKTQEHAVTALLNLSINDNNKIAIANADAVDPLIHVLET  639

Query  954   GSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSIL  775
             G+PEAKENSAATLFSLSVIE+NK+KIGRSGA++ LVDLLGNGTPRGK+DAATALFNLSIL
Sbjct  640   GNPEAKENSAATLFSLSVIEENKVKIGRSGAIKPLVDLLGNGTPRGKRDAATALFNLSIL  699

Query  774   HENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVV  595
             HENK RIVQA AV HLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVV
Sbjct  700   HENKARIVQADAVNHLVELMDPAAGMVDKAVAVLANLATIPEGRNAIGQARGIPALVEVV  759

Query  594   ELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYF  415
             ELGSARGKENAAAALLQLCTNS+R+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYF
Sbjct  760   ELGSARGKENAAAALLQLCTNSNRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYF  819

Query  414   RNQRHGNAGR  385
             R+QRHGN+ R
Sbjct  820   RSQRHGNSAR  829



>emb|CDJ26521.1| unnamed protein product [Triticum aestivum]
Length=831

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/845 (50%), Positives = 568/845 (67%), Gaps = 29/845 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINS----ELVHKYYQKTEDILKLLQPILSGIVDAEI  2710
             ME    + LL++IS   HLS+L +  S    + +  Y Q   DI  ++ P++  I  +  
Sbjct  1     MEDFSPRTLLDSIS---HLSALTSDGSTARPKPIQNYCQNVCDISSIVSPLIEDICKS--  55

Query  2709  ASDELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVS  2530
               +E L +V   L  +++E   L   W   +SK+YFV Q ES+I+ ++  SL++ +L   
Sbjct  56    -PEEQLNEVLRELDTAINEASGLIGNWHQTTSKIYFVWQIESVISDIQGCSLQLCQL---  111

Query  2529  SDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASS-DSLTKIADCLS  2353
             ++  LP+ +    +  C+ K++ +DYE +   + K +   + G+   S ++L+ ++  LS
Sbjct  112   ANSLLPSLTGCACI--CIQKLQDIDYEHM-FDLAKEVATKLNGNDTQSPENLSIVSSSLS  168

Query  2352  LKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQ  2173
             L +N EL +E V+LE L+  A ++E  +E+E  E++I +V +MH+ L+   Q  +   V 
Sbjct  169   LSTNLELYMEAVSLENLRTRAMRSENRKELELAEEMIPMVKYMHERLLRETQLLNINGVP  228

Query  2172  IPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTV  1993
             IPADFCCPLSLELM+DPVI+ASGQTYER +I+ W+D G T+CPKTRQ L H+NLIPNYTV
Sbjct  229   IPADFCCPLSLELMSDPVILASGQTYERVYIKLWLDEGFTICPKTRQRLAHSNLIPNYTV  288

Query  1992  KALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIF-SHSRANNSTSPDS-  1819
             KALI+NWCE ++IKLPDP+KSL +N PS+  +  D  A  +  +  S  R N   SP++ 
Sbjct  289   KALISNWCESHDIKLPDPVKSLKLNFPSAASSLQDLSATGNSPLHPSAGRGNIPGSPEAD  348

Query  1818  --AHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDR  1645
                  L+    S  +         +     +S+ +S     G     D+ R+S+  SE R
Sbjct  349   LYMRSLNRASPSHSAVHQNSDALVNRPGHEASTNQSSDYANGS--APDISRLSVASSEAR  406

Query  1644  LANSGDRSMNSVSHFSMPLSMNSVSSADENSH-QGHNRTTSAPSTLSNSNFSRANAHDGN  1468
              +   +R   S    S   +  +  ++  N   Q H  ++S   +L NS        + N
Sbjct  407   ESGFEERHAGSNVQTSEQSTEETFEASLLNGDSQDHVGSSSVNGSLPNSGQLDGECDNAN  466

Query  1467  E-VSSP---TTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERL  1300
               V  P   T  S++AS EVA +   + + A  R     P     R+R   + R+PS+R 
Sbjct  467   GMVRVPGDRTNYSSDASGEVA-DGGPSVSSAPQRENVMLPRLGDLRMRGQFVRRQPSDRG  525

Query  1299  VSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVIS  1120
               RI S  +++ R DL+ ++ QVRKL++DL+S S++ QR AT+E+RLLAKHNM+NRIVI+
Sbjct  526   FPRITSPSSMDARGDLSAIENQVRKLIDDLRSDSIEAQRSATSEIRLLAKHNMENRIVIA  585

Query  1119  NCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEA  940
             NCGAI+LLV LLHS D ++QENAVTALLNLSINDNNK AIA+A A++PLI+VLETG+ EA
Sbjct  586   NCGAINLLVGLLHSTDAKIQENAVTALLNLSINDNNKIAIASADAVDPLIHVLETGNAEA  645

Query  939   KENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKG  760
             KENSAATLFSLSVIE+NK++IGRSGAV+ LVDLLGNGTPRGKKDAATALFNLSILHENKG
Sbjct  646   KENSAATLFSLSVIEENKVRIGRSGAVKPLVDLLGNGTPRGKKDAATALFNLSILHENKG  705

Query  759   RIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSA  580
             RIVQA AV++LVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSA
Sbjct  706   RIVQADAVKYLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPALVEVVELGSA  765

Query  579   RGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRH  400
             RGKENAAAALLQLCTNS+R+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR+QRH
Sbjct  766   RGKENAAAALLQLCTNSNRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRSQRH  825

Query  399   GNAGR  385
             GN+ R
Sbjct  826   GNSAR  830



>ref|XP_003573506.2| PREDICTED: U-box domain-containing protein 4-like [Brachypodium 
distachyon]
Length=1356

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/848 (50%), Positives = 563/848 (66%), Gaps = 32/848 (4%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINS----ELVHKYYQKTEDILKLLQPILSGIVDA  2716
             G ME    + LLN+IS   HLS L +  S    + + KY Q   DI  +++P++  +  +
Sbjct  525   GLMENFSPRTLLNSIS---HLSLLTSDGSTARPKPIQKYCQNVCDISSIVRPLIEDLCKS  581

Query  2715  EIASDELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELL  2536
                 +E   +V   L  +V+E   L   WQ  +SK+YFV Q ES+I+ ++ F+L++ +L 
Sbjct  582   ---PEEQPNEVLRDLDTAVNEASGLIGNWQQTTSKIYFVWQIESVISDIQGFTLQLCQLA  638

Query  2535  VSSDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCL  2356
              S    LP+ +    +  C+ K++ ++YE +   + K +   +     S  +L K++  L
Sbjct  639   NS---LLPSLTGCACI--CIEKLQDINYEHM-FDLVKEVAIELTMDTQSPKNLLKVSSSL  692

Query  2355  SLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSV  2176
             SL +N EL +E ++LE LK  A ++E  EE++ +EQ+I +V +MHD L+   +  S   V
Sbjct  693   SLSTNLELYMEALSLENLKARAIRSENREELDLVEQMIPMVNYMHDRLLRETKLLSTYPV  752

Query  2175  QIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYT  1996
              +P DFCCPLSLELM+DPVIVASGQTYER +I+ W+D G T+CPKTRQ + H+NLIPNYT
Sbjct  753   SVPGDFCCPLSLELMSDPVIVASGQTYERVYIKLWLDEGFTICPKTRQRINHSNLIPNYT  812

Query  1995  VKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIF-SHSRANN-STSPD  1822
             VKA IANWC++N+IKLPDP+KSL +N PS+     D GA  +  +  S +RANN   SP+
Sbjct  813   VKAFIANWCQLNDIKLPDPVKSLKLNFPSAASTTQDLGATGNSPLHPSVARANNIPGSPE  872

Query  1821  S---AHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSE  1651
             +      LD                 +     +S+ +S     G     D+ R+SL  S+
Sbjct  873   TDLYMRVLDRASPPHSVVHQNFDASVNRPGHETSTNQSSEYTNGS--APDIARLSLAISD  930

Query  1650  DRLANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDG  1471
              R  + GDR   S +  +   S      A + +    ++  S+    S  N  +      
Sbjct  931   SR-DSLGDRHAGSSNVQTSEQSTEDTFQASDVNMDSQDQVGSSSVYGSVPNSGQLGGGCD  989

Query  1470  NE------VSSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPS  1309
              E      +S  T  S+ AS EVA     A++  A R +   P     R+R   + R+ S
Sbjct  990   MEKGLMRVLSDRTNYSSNASGEVADGGSSASS--AQREKVILPRLGDVRMRGQFVSRQSS  1047

Query  1308  ERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRI  1129
             +R   RI+SSP+++ R+DL+ ++ QV +L+ DL+  S++ QR AT+E+RLLAKHNM+NRI
Sbjct  1048  DRGFPRIISSPSMDARSDLSAIESQVSRLINDLRIDSIEVQRSATSEIRLLAKHNMENRI  1107

Query  1128  VISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGS  949
             VI+N GAI++LV LLHS D ++QENAVTALLNLSINDNNK AIANA A+EPLI+VLETG+
Sbjct  1108  VIANYGAINILVGLLHSPDAKIQENAVTALLNLSINDNNKIAIANADAVEPLIHVLETGN  1167

Query  948   PEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHE  769
             PEAKENSAATLFSL+ IE NK++IGRSGAV+ LVDLLGNGTPRGKKDAATALFNLSILHE
Sbjct  1168  PEAKENSAATLFSLTFIEGNKLRIGRSGAVKPLVDLLGNGTPRGKKDAATALFNLSILHE  1227

Query  768   NKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVEL  589
             NKGRIVQA AV+HLV+LMDPAAGMVDKAVAVLSNLATI EGR +IGQ  GIP LVEVVEL
Sbjct  1228  NKGRIVQAEAVKHLVDLMDPAAGMVDKAVAVLSNLATIPEGRTAIGQARGIPSLVEVVEL  1287

Query  588   GSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRN  409
             GSARGKENAAAAL QLCTNS+R+CN+VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR+
Sbjct  1288  GSARGKENAAAALFQLCTNSNRFCNIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRS  1347

Query  408   QRHGNAGR  385
             QRHGN+ R
Sbjct  1348  QRHGNSAR  1355



>gb|AFW61428.1| putative ARM repeat-containing protein containing family protein 
[Zea mays]
Length=684

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/672 (57%), Positives = 469/672 (70%), Gaps = 31/672 (5%)
 Frame = -2

Query  2346  SNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIP  2167
             +N EL  E V+LE LK  A + E  EE++  EQ+I LV +MHD L+  KQ  S   V IP
Sbjct  25    TNMELYTEAVSLENLKTRALRCESREELDLAEQMIPLVNYMHDHLLKEKQQLSINGVPIP  84

Query  2166  ADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKA  1987
             ADFCCPLSLELM+DPVIVASGQTYER +I+ W+D G T+CPKT Q L H+NLIPNYTVKA
Sbjct  85    ADFCCPLSLELMSDPVIVASGQTYERVYIKLWLDEGFTICPKTLQRLGHSNLIPNYTVKA  144

Query  1986  LIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVD----SGAPRDIHIFSHSRANNSTSPD-  1822
             LIANWCE ++I+LPDP+KSL +N PS+     D     G+P  +H    SRAN   SP+ 
Sbjct  145   LIANWCESHDIRLPDPMKSLKLNFPSAASFLEDLSAADGSP--LHPIVVSRANIPGSPEV  202

Query  1821  --SAHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSED  1648
                   L+         +      ++      S+ ++  +  G     DV R+SL  SE 
Sbjct  203   DVYLRNLNGASPPHSLVNQNSHAHANRHGHEVSTSQTSEKTNGS--VPDVSRLSLASSEA  260

Query  1647  RLANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDG-  1471
             R ++   R   S+   S          + E + Q  N        L+NS+ + +  + G 
Sbjct  261   RESSLEGRRGGSIGQIS--------EHSTEEAFQSSNLDRDLQDNLANSSLNGSLPNSGQ  312

Query  1470  ------NEV----SSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIW  1321
                   N V    S  T  S++AS EV +        +  +RE   P  +G   +   I 
Sbjct  313   LDGECDNGVTRVPSDRTNYSSDASGEVTNGGGAPVASSVPQREHLIPPRLGMGTKQ-FIR  371

Query  1320  RRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNM  1141
             R+PS+R   RI+SS T++ R+DL+ ++ QVRKL++DLKS S+D QR A ++LRLL+KHNM
Sbjct  372   RQPSDRGFPRIISSSTMDARSDLSAIENQVRKLIDDLKSDSIDVQRSAASDLRLLSKHNM  431

Query  1140  DNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVL  961
             +NRI I+NCGA++LLV  LHS D + QE+AVTALLNLSINDNNK AIANA A++PLI+VL
Sbjct  432   ENRIAIANCGAVNLLVGRLHSPDAKTQEHAVTALLNLSINDNNKIAIANADAVDPLIHVL  491

Query  960   ETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLS  781
             ETG+PEAKENSAATLFSLSVIE+NK+KIGRSGA++ LVDLLGNGTPRGK+DAATALFNLS
Sbjct  492   ETGNPEAKENSAATLFSLSVIEENKVKIGRSGAIKPLVDLLGNGTPRGKRDAATALFNLS  551

Query  780   ILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVE  601
             ILHENK RIVQA AV HLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVE
Sbjct  552   ILHENKARIVQADAVNHLVELMDPAAGMVDKAVAVLANLATIPEGRNAIGQARGIPALVE  611

Query  600   VVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLS  421
             VVELGSARGKENAAAALLQLCTNS+R+C++VLQ GAVPPLVALSQSGTPRAREKAQALLS
Sbjct  612   VVELGSARGKENAAAALLQLCTNSNRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLS  671

Query  420   YFRNQRHGNAGR  385
             YFR+QRHGN+ R
Sbjct  672   YFRSQRHGNSAR  683



>ref|XP_008678335.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Zea mays]
Length=706

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/717 (55%), Positives = 492/717 (69%), Gaps = 31/717 (4%)
 Frame = -2

Query  2481  CVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELValekl  2302
             C+ K++ +++E +   + +        S  SS +L K++  LSL +N EL  E V+LE L
Sbjct  2     CIEKLQDINHEHVFDLVKEVAMELAATSAVSSVNLLKLSSLLSLSTNMELYTEAVSLENL  61

Query  2301  kenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLELMTDP  2122
             K  A + E  EE++  EQ+I LV +MHD L+  KQ  S   V IPADFCCPLSLELM+DP
Sbjct  62    KTRALRCESREELDLAEQMIPLVNYMHDHLLKEKQQLSINGVPIPADFCCPLSLELMSDP  121

Query  2121  VIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNIKLPD  1942
             VIVASGQTYER +I+ W+D G T+CPKT Q L H+NLIPNYTVKALIANWCE ++I+LPD
Sbjct  122   VIVASGQTYERVYIKLWLDEGFTICPKTLQRLGHSNLIPNYTVKALIANWCESHDIRLPD  181

Query  1941  PIKSLNVNQPSSHVAHVD----SGAPRDIHIFSHSRANNSTSPD---SAHGLDsprkssi  1783
             P+KSL +N PS+     D     G+P  +H    SRAN   SP+       L+       
Sbjct  182   PMKSLKLNFPSAASFLEDLSAADGSP--LHPIVVSRANIPGSPEVDVYLRNLNGASPPHS  239

Query  1782  sssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSGDRSMNSVSH  1603
               +      ++      S+ ++  +  G     DV R+SL  SE R ++   R   S+  
Sbjct  240   LVNQNSHAHANRHGHEVSTSQTSEKTNGS--VPDVSRLSLASSEARESSLEGRRGGSIGQ  297

Query  1602  FSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDG-------NEV----SS  1456
              S          + E + Q  N        L+NS+ + +  + G       N V    S 
Sbjct  298   IS--------EHSTEEAFQSSNLDRDLQDNLANSSLNGSLPNSGQLDGECDNGVTRVPSD  349

Query  1455  PTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSP  1276
              T  S++AS EV +        +  +RE   P  +G   +   I R+PS+R   RI+SS 
Sbjct  350   RTNYSSDASGEVTNGGGAPVASSVPQREHLIPPRLGMGTKQ-FIRRQPSDRGFPRIISSS  408

Query  1275  TVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLL  1096
             T++ R+DL+ ++ QVRKL++DLKS S+D QR A ++LRLL+KHNM+NRI I+NCGA++LL
Sbjct  409   TMDARSDLSAIENQVRKLIDDLKSDSIDVQRSAASDLRLLSKHNMENRIAIANCGAVNLL  468

Query  1095  VNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATL  916
             V  LHS D + QE+AVTALLNLSINDNNK AIANA A++PLI+VLETG+PEAKENSAATL
Sbjct  469   VGRLHSPDAKTQEHAVTALLNLSINDNNKIAIANADAVDPLIHVLETGNPEAKENSAATL  528

Query  915   FSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAV  736
             FSLSVIE+NK+KIGRSGA++ LVDLLGNGTPRGK+DAATALFNLSILHENK RIVQA AV
Sbjct  529   FSLSVIEENKVKIGRSGAIKPLVDLLGNGTPRGKRDAATALFNLSILHENKARIVQADAV  588

Query  735   RHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAA  556
              HLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSARGKENAAA
Sbjct  589   NHLVELMDPAAGMVDKAVAVLANLATIPEGRNAIGQARGIPALVEVVELGSARGKENAAA  648

Query  555   ALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             ALLQLCTNS+R+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR+QRHGN+ R
Sbjct  649   ALLQLCTNSNRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRSQRHGNSAR  705



>gb|EMT16948.1| U-box domain-containing protein 4 [Aegilops tauschii]
Length=855

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/847 (48%), Positives = 546/847 (64%), Gaps = 55/847 (6%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINS----ELVHKYYQKTEDILKLLQPILSGIVDA  2716
             G ME    + LL++IS   HLS+L +  S    + +  Y Q   DI  ++ P++  I  +
Sbjct  49    GLMEDFSPRTLLDSIS---HLSALTSDGSTARPKPIQNYCQNVCDISSIVSPLIEDICKS  105

Query  2715  EIASDELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELL  2536
                 +E L +V   L  +++E   L   W   +SK+YFV Q ES+I+ ++  SL++ +L 
Sbjct  106   ---PEEQLNEVLRELDTAINEASGLIGNWHQTTSKIYFVWQIESVISDIQGCSLQLCQLA  162

Query  2535  VSSDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASS-DSLTKIADC  2359
              S    LP+ +    +  C+ K++ ++YE +   + + +   + G+   S ++L+ ++  
Sbjct  163   NS---LLPSLTGCACI--CIQKLQDINYEHM-FDLAREVATKLNGNDTQSPENLSIVSSS  216

Query  2358  LSLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTS  2179
             LSL +N EL +E V+LE L+  A ++E  +E+E  E++I +V +MH+ L+   Q      
Sbjct  217   LSLSTNLELYMEAVSLENLRTRAMRSENRKELELAEEMIPMVNYMHERLLRETQ------  270

Query  2178  VQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNY  1999
                                 ++    TYER +I+ W+D G T+CPKTRQ L H+NLIPNY
Sbjct  271   --------------------LLNINGTYERVYIKLWLDEGFTICPKTRQRLAHSNLIPNY  310

Query  1998  TVKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIF-SHSRANNSTSPD  1822
             TVKALI+NWCE ++IKLPDP+KSL +N PS+  +  D  A  +  +  S  R N   SP+
Sbjct  311   TVKALISNWCESHDIKLPDPVKSLKLNFPSAASSLQDLSATGNSPLHPSAGRGNIPGSPE  370

Query  1821  S---AHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSE  1651
             +      L+    S  +         +     +S+ +S     G     D+ R+SL  SE
Sbjct  371   ADLYMKSLNRASPSHSAVHQNSDALVNRPGHEASTNQSSDYANGS--APDISRLSLASSE  428

Query  1650  DRLANSGDRSMNSVSHFSMPLSMNSVSSADENSH-QGHNRTTSAPSTLSNSNFSRANAHD  1474
              R ++  +R   S    S   +  +  ++  N   Q H  ++S   +L NS        D
Sbjct  429   ARESSLEERHAGSNVQTSEQSTDEAFQASLLNGDSQDHVGSSSVNGSLPNSGQLDGECDD  488

Query  1473  GNE-VSSP---TTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSE  1306
              N  V  P   T  S++AS EVA +   + + A  R     P     R+R   + R+PS+
Sbjct  489   ANGMVRVPGDRTNYSSDASGEVA-DGGPSVSSAPQRENVMLPRLGDLRMRGQFVRRQPSD  547

Query  1305  RLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIV  1126
             R   RI S  +++ R DL+ ++ QVRKL++DL+S S++ QR AT+E+RLLAKHNM+NRIV
Sbjct  548   RGFPRITSPSSMDARGDLSAIENQVRKLIDDLRSDSIEAQRSATSEIRLLAKHNMENRIV  607

Query  1125  ISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSP  946
             I+NCGAI+LLV LLHS D ++QENAVTALLNLSINDNNK AIA+A A++PLI+VLETG+P
Sbjct  608   IANCGAINLLVGLLHSTDAKIQENAVTALLNLSINDNNKIAIASADAVDPLIHVLETGNP  667

Query  945   EAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHEN  766
             EAKENSAATLFSLSVIE+NK++IGRSGAV+ LVDLLGNGTPRGKKDAATALFNLSILHEN
Sbjct  668   EAKENSAATLFSLSVIEENKVRIGRSGAVKPLVDLLGNGTPRGKKDAATALFNLSILHEN  727

Query  765   KGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELG  586
             KGRIVQA AV++LVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELG
Sbjct  728   KGRIVQADAVKYLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPALVEVVELG  787

Query  585   SARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQ  406
             SARGKENAAAALLQLCTNS+R+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR+Q
Sbjct  788   SARGKENAAAALLQLCTNSNRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRSQ  847

Query  405   RHGNAGR  385
             RHGN+ R
Sbjct  848   RHGNSAR  854



>gb|EMS61710.1| U-box domain-containing protein 4 [Triticum urartu]
Length=865

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/900 (45%), Positives = 548/900 (61%), Gaps = 108/900 (12%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINS----ELVHKYYQKTEDILKLLQPILSGIVDA  2716
             G ME    + LL++IS   HL++L +  S    + + KY Q   DI  ++ P++  I  +
Sbjct  6     GLMEDFSPRTLLDSIS---HLTALTSDGSTARPKPIQKYCQNVCDISSIVSPLIEDICKS  62

Query  2715  EIASDELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVL--------------------  2596
                 +E L  V   L  +++E   L   W   +SK+YFVL                    
Sbjct  63    ---PEEQLNDVLRELDTAINEASGLIGNWHQTTSKIYFVLSNSIIQLSFSTLLRAGIWPC  119

Query  2595  ---------------------------------QAESLIAKVRAFSLKIVELLVSSDWCL  2515
                                              Q ES+I+ ++  SL++ +L   ++  L
Sbjct  120   SGWVRRYSLREIAYKPKINYTTVLNYMPLMEVWQIESVISDIQGCSLQLCQL---ANSLL  176

Query  2514  PAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASS-DSLTKIADCLSLKSNQ  2338
             P+ +    +  C+ K++ ++YE +   + K +   + G+   S ++L+ ++  LSL +N 
Sbjct  177   PSLTGCACI--CIQKLQDINYEHM-FDLAKEVATKLNGNDTQSPENLSIVSSSLSLSTNL  233

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             EL +E V+LE L+  A ++E ++E+E  E++I +V +MH+ L+   Q             
Sbjct  234   ELYMEAVSLENLRTRAMRSENHKELELAEEMIPMVNYMHERLLRETQ-------------  280

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
                          ++    TYER +I+ W+D G T+CPKTRQ L H+NLIPNYTVKALI+
Sbjct  281   -------------LLNINGTYERVYIKLWLDEGFTICPKTRQRLAHSNLIPNYTVKALIS  327

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIF-SHSRANNSTSPDS---AHG  1810
             NWCE ++IKLPDP+KSL +N PS+  +  D  A  +  +  S  R N   SP++      
Sbjct  328   NWCESHDIKLPDPVKSLKLNFPSAASSLQDLSATGNSPLHPSAGRGNIPGSPEADLYMKS  387

Query  1809  LDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGSEDRLANSG  1630
             L+    S  +         +     +S+ +S     G     D+ R+SL  SE R ++  
Sbjct  388   LNRASPSHSAVHQNSDALVNRPGHEASTNQSSDYANGS--APDISRLSLASSEARESSVE  445

Query  1629  DRSMNSVSHFSMPLSMNSV-SSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEV---  1462
             +R   S    S   +  +  +S  +   Q H  ++S   +L NS        D N +   
Sbjct  446   ERHAGSNVQTSEQSTDEAFQASLLDGDSQDHVGSSSVNGSLPNSGQLDGECDDANGMVRI  505

Query  1461  -SSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIV  1285
                 T  S++AS EVA +   + + A  R     P     R+R   + R+PS+R   RI 
Sbjct  506   PGDRTNYSSDASGEVA-DGGPSVSSAPQRENVMLPRLGDLRMRGQFVRRQPSDRGFPRIT  564

Query  1284  SSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAI  1105
             S  +++ R DL+ ++ QVRKL++DL+S S++ QR AT+E+RLLAKHNM+NRIVI+NCGAI
Sbjct  565   SPSSMDARGDLSAIENQVRKLIDDLRSDSIEAQRSATSEIRLLAKHNMENRIVIANCGAI  624

Query  1104  SLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSA  925
             +LLV LLHS D ++QENAVTALLNLSINDNNK AIA+A A++PLI+VLETG+PEAKENSA
Sbjct  625   NLLVGLLHSTDAKIQENAVTALLNLSINDNNKIAIASADAVDPLIHVLETGNPEAKENSA  684

Query  924   ATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA  745
             ATLFSLSVIE+NK++IGRSGAV+ LVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA
Sbjct  685   ATLFSLSVIEENKVRIGRSGAVKPLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA  744

Query  744   GAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKEN  565
              AV++LVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSARGKEN
Sbjct  745   DAVKYLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPALVEVVELGSARGKEN  804

Query  564   AAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             AAAALLQLCTNS+R+C++VLQ GAVPPLVALSQSGTPRAREKAQALLSYFR+QRHGN+ R
Sbjct  805   AAAALLQLCTNSNRFCSIVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRSQRHGNSAR  864



>ref|XP_010246789.1| PREDICTED: U-box domain-containing protein 3-like [Nelumbo nucifera]
Length=795

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/847 (44%), Positives = 512/847 (60%), Gaps = 79/847 (9%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+   ++ L+N+IS F HL + + + S  + K Y+    +LKL++P+L  +VD ++  +E
Sbjct  1     MDTRSIRCLVNSISRFIHLVACQTVKSVPMQKDYKYMVALLKLMKPVLDDVVDYKVPMNE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    +  +V+E RE  +      SK+  VL++E L  K+R  S++I  +L +    
Sbjct  61    FLLKECEEMDIAVNEAREFMEKLSPKMSKICSVLESELLATKIRGSSVEICHILCT----  116

Query  2517  LPAESSLTSL----ENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSL  2350
             LP  S  TSL    + C+ +I+ ++ E +S  I +A+ +  +     +++L +IA+ L  
Sbjct  117   LPQSSQYTSLLAHVQQCLREIQCLEQEKISELIEEAMIDQRDNVIPCTENLIRIAEILGF  176

Query  2349  KSNQELLIELValeklkenaeqaekne-----evEYIEQIIALVTHMHDCLIMMKQSESC  2185
              SN ELL E +ALEK +  A+  +K+E     E+++I+QI+ LV H+ D ++ ++   + 
Sbjct  177   TSNHELLEESIALEKERVKAQFKKKDELDHIDELDHIDQIVYLVAHIRDSMVKLEPFAAI  236

Query  2184  TSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIP  2005
               V +P  F CPLSL LM DPVIVASGQTYER FI++W+D GL +CP+TRQTL HTN+IP
Sbjct  237   NGVAVPPYFRCPLSLGLMLDPVIVASGQTYERAFIQKWLDHGLIICPQTRQTLRHTNVIP  296

Query  2004  NYTVKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSP  1825
             NYTVKALI NWC+ NN                            +I IF++   NN +SP
Sbjct  297   NYTVKALIENWCD-NN----------------------------NIRIFNNVDCNNISSP  327

Query  1824  ---DSAHGLDsprkssisssaiqreesspshprssseeslpEIAGDDLGLDVERMSLEGS  1654
                D A   D  R  S  SS      +S S              G   G +++R+ +   
Sbjct  328   SLSDHASHQDFIRTDSFRSSLNSSISTSRSSL------------GVGNGSEIQRLEV---  372

Query  1653  EDRLANSGDRSMNSVSHFSMPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHD  1474
                 +  G+ S  S S  +      S     E S+  H+RT S  S +S+  +       
Sbjct  373   ---FSGLGEDSNGSCSKLTPKCDQLS----PEQSY-NHSRTESVSSAISSIEYMPTALTT  424

Query  1473  G----NEVSSPTTASTEASMEVASESRHAATLAASRRESEF-PSPVGTRLRPPAIWRRPS  1309
             G    + VSS    +TE S E+ S+   ++    S R S F P   G +          +
Sbjct  425   GLSELSRVSSKHGDATELSGEITSKCMFSS---PSNRSSGFSPWLSGKQFYSSKTRAEGA  481

Query  1308  ERLV---SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMD  1138
             E       R  S P  ++  D       V KLVEDLKS   + Q  A AELRLLAKHNM+
Sbjct  482   ENGCIGHCRTPSLPFSDSSLDELTTSSHVEKLVEDLKSHCNEVQTAAAAELRLLAKHNME  541

Query  1137  NRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLE  958
             NRI+I+ CGAI+ L++LL+S     QE++VT LLNLSIN++NK+ IA AGAIEPLI+VL+
Sbjct  542   NRIIIAQCGAIAPLISLLYSSVKLSQEHSVTTLLNLSINEDNKAMIAEAGAIEPLIHVLK  601

Query  957   TGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSI  778
             +G+  AKEN+AATLFSLS +E  KIKIGRSGAV++LVDLLG+GT RGKKDA TALFNLSI
Sbjct  602   SGNSCAKENAAATLFSLSTLEGYKIKIGRSGAVKALVDLLGSGTIRGKKDAVTALFNLSI  661

Query  777   LHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEV  598
              HENK RIVQAGAV++LVELMDPA  M+DKAVA+L+NL+TI EG  +I + GGIP LVEV
Sbjct  662   CHENKARIVQAGAVKYLVELMDPATKMLDKAVALLANLSTIPEGCSAITRNGGIPPLVEV  721

Query  597   VELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSY  418
             VE GS RGKENAA+ LLQLC N  ++C++VL+ GAVPPLVALSQSGTPRA+EKAQ LLS+
Sbjct  722   VETGSQRGKENAASILLQLCINCHKFCSLVLEEGAVPPLVALSQSGTPRAKEKAQQLLSH  781

Query  417   FRNQRHG  397
             FRNQR G
Sbjct  782   FRNQRGG  788



>ref|XP_007208336.1| hypothetical protein PRUPE_ppa002184mg [Prunus persica]
 gb|EMJ09535.1| hypothetical protein PRUPE_ppa002184mg [Prunus persica]
Length=704

 Score =   544 bits (1401),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 270/332 (81%), Positives = 299/332 (90%), Gaps = 2/332 (1%)
 Frame = -2

Query  1374  ESEFPSPVGTRLRPPA-IWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTS  1198
             E+E P+ +   +RP + +WRRPS  LV RIVSSP VETR DL+ ++ QVR LVEDLKSTS
Sbjct  374   ETELPTRMA-EVRPRSQMWRRPSGSLVPRIVSSPAVETRPDLSGLEAQVRSLVEDLKSTS  432

Query  1197  VDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSIND  1018
             +D QR AT ++RLLAKHNMDNRIVI+NCGAISLLV+LLHS D  +QENAVTALLNLSIND
Sbjct  433   LDTQREATLQIRLLAKHNMDNRIVIANCGAISLLVDLLHSTDTRIQENAVTALLNLSIND  492

Query  1017  NNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLL  838
             NNK+AIA A AIEPLI+VLETGS EAKENSAATLFSLSVIEDNK++IGRSGA+  LVDLL
Sbjct  493   NNKTAIATANAIEPLIHVLETGSAEAKENSAATLFSLSVIEDNKVRIGRSGAIVPLVDLL  552

Query  837   GNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLAT  658
             GNGTPRG+KDAATALFNLSI HENKGRIVQAGAVR+LVELMDPAAGMVDKAVAVL+NL+T
Sbjct  553   GNGTPRGRKDAATALFNLSIFHENKGRIVQAGAVRYLVELMDPAAGMVDKAVAVLANLST  612

Query  657   IQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLV  478
             I EGR +IGQEGGIP+LVEVVELGSARGKENAAAALLQLCTNS+RYC+MVLQ GAVPPLV
Sbjct  613   IPEGRTAIGQEGGIPVLVEVVELGSARGKENAAAALLQLCTNSNRYCSMVLQEGAVPPLV  672

Query  477   ALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              LSQSGTPRA+EKAQ LLSYFRN RHGNAGRG
Sbjct  673   VLSQSGTPRAKEKAQTLLSYFRNHRHGNAGRG  704


 Score =   418 bits (1075),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 225/359 (63%), Positives = 268/359 (75%), Gaps = 0/359 (0%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G MEI L K LL NISSFFHLSS +NIN + V KYY++ E+ILKLL+ IL  IVD+EIAS
Sbjct  5     GVMEISLFKALLKNISSFFHLSSNDNINLDPVLKYYKRAEEILKLLKTILDAIVDSEIAS  64

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
              E+L K F  LGH +DELRE  + WQ L SKV  VLQ ESLI K+    L I +LL +  
Sbjct  65    YEVLNKPFEELGHYIDELREQIEDWQPLLSKVNLVLQVESLITKIWTSGLDIFQLLKTCQ  124

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
               LP E  L SLE C+ K+K+M  E +S  I  ++ + VEG G SS+ L KIA+ LSL+S
Sbjct  125   QHLPDELGLASLERCIQKLKNMVDEQMSTVIKDSVSDQVEGVGPSSEILVKIAEGLSLRS  184

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQE+LIE VALEKLKENAEQ+EK EE EYIE +I+LVT MH+ L+ +KQS+SC+ V IPA
Sbjct  185   NQEILIEAVALEKLKENAEQSEKIEEAEYIEHMISLVTRMHERLVTIKQSQSCSPVPIPA  244

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLELMTDPVIVASGQTYER FI+ WIDLGLTVCPKTRQTL HTNLIPNYTVKAL
Sbjct  245   DFCCPLSLELMTDPVIVASGQTYERTFIKHWIDLGLTVCPKTRQTLAHTNLIPNYTVKAL  304

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGL  1807
             IANWCE NN+KLPDP KS+ +N+ +  +   + GAP+D   F HSR N   SP+SA  +
Sbjct  305   IANWCESNNVKLPDPTKSMGLNKATQLLGQAEHGAPKDSPPFPHSRVNQPMSPESARSM  363



>emb|CDX76873.1| BnaC08g34590D [Brassica napus]
Length=747

 Score =   535 bits (1377),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 288/397 (73%), Positives = 325/397 (82%), Gaps = 6/397 (2%)
 Frame = -2

Query  1560  ENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS-PTTASTEASMEVASE--SRHAATL  1390
             EN H  H R+ SA S++SN +  RA+A++ +E S   T  S++AS E+ S   +    + 
Sbjct  353   ENHH--HLRSPSAASSVSNEDSPRADANENSEESPHATPYSSDASGEIRSGPLAAATTSA  410

Query  1389  AASRRE-SEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVED  1213
             A  RR+ S+F      R      WRRPSERL SRIVS+P+ ETR DL EV+ QV+KLVE+
Sbjct  411   APPRRDLSDFSPKFMDRRSRGQFWRRPSERLGSRIVSAPSSETRRDLIEVENQVKKLVEE  470

Query  1212  LKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLN  1033
             LKS+S+D QR ATAE+RLLAKHNMDNRIVI N GAI LLV LLHS D   QENAVTALLN
Sbjct  471   LKSSSLDVQRQATAEIRLLAKHNMDNRIVIGNSGAIVLLVELLHSTDSATQENAVTALLN  530

Query  1032  LSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQS  853
             LSINDNNKS IA AGAIEPLI+VL+ GS EAKEN+AATLFSLSVIE+ KIKIG+SGA+  
Sbjct  531   LSINDNNKSLIAAAGAIEPLIHVLQNGSSEAKENAAATLFSLSVIEELKIKIGQSGAIAP  590

Query  852   LVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVL  673
             LVDLLGNGTPRGKKDAATALFNLSI  ENKG IVQ+GAVR+L++LMDPAAGMVDKAVAVL
Sbjct  591   LVDLLGNGTPRGKKDAATALFNLSIHQENKGTIVQSGAVRYLIDLMDPAAGMVDKAVAVL  650

Query  672   SNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGA  493
             +NLATI EGR +IGQEGGI +LVEVVELGSARGKENAAAALLQL TNS R+CNMVLQ GA
Sbjct  651   ANLATIPEGRNAIGQEGGIGLLVEVVELGSARGKENAAAALLQLSTNSGRFCNMVLQEGA  710

Query  492   VPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  711   VPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  747


 Score =   307 bits (786),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 172/353 (49%), Positives = 246/353 (70%), Gaps = 7/353 (2%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPIL-SGIVDAEIASDELLQKVFS  2677
             L+++ISSF +LSS  +I+ +   KYY++ E++L +L+P+  +  +++++ S+E + K F 
Sbjct  6     LVDSISSFLNLSSSRHIDLDPFEKYYKRVEELLIVLKPVADAAAINSDLVSEERIGKSFD  65

Query  2676  GLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSL  2497
              L   VD   +LF++W   SSKVYFVLQ ESLI K+R   +     L+S +  LP + + 
Sbjct  66    DLTQDVDHSIDLFRSWHAFSSKVYFVLQIESLIPKMRETIVDTFHFLMSFESNLPDDLTP  125

Query  2496  TSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELV  2317
              SLE C+ K+K + YE +S+ I  A+++  +G G + D L  I +   L+SNQE+LIE V
Sbjct  126   PSLEKCLEKVKQLSYEEISSVIDGALRDQRDGVGPTPDVLVTIGENTGLRSNQEILIEAV  185

Query  2316  aleklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLE  2137
             ALE+ KE AEQ+E N EVE+++Q+I +V  MH+ L+++KQ+++ +SV I ADF CPLSLE
Sbjct  186   ALERQKEIAEQSENNSEVEFLDQLIVIVNRMHERLLLIKQTQT-SSVAILADFFCPLSLE  244

Query  2136  LMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNN  1957
             +MTDPVIV+SGQTYE+ FI+RWIDLGL VCPKTRQTLTHT LIPNYTVKALIANWCE N+
Sbjct  245   VMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKALIANWCETND  304

Query  1956  IKLPDPIKSLNVNQPSSHVAHVDSG--APRDIHIFSHSRA---NNSTSPDSAH  1813
             +KLPDP KS ++N+ S  ++  +S   AP    + S +R    N  TS +  H
Sbjct  305   VKLPDPNKSTSLNELSPLLSCTESAPNAPGRSSVSSTTRGSVENGQTSENHHH  357



>ref|XP_009117298.1| PREDICTED: U-box domain-containing protein 4 [Brassica rapa]
Length=805

 Score =   531 bits (1368),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 286/398 (72%), Positives = 322/398 (81%), Gaps = 7/398 (2%)
 Frame = -2

Query  1560  ENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS-PTTASTEASMEVAS----ESRHAA  1396
             EN H  H R+ SA S++SN +  RA A++ +E S   T  S++AS E+ S     +  +A
Sbjct  410   ENHH--HLRSPSAASSVSNEDSPRAEANENSEESPHATPYSSDASGEIRSGPLAAATTSA  467

Query  1395  TLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVE  1216
                  R  S+F      R      WRRPSERL SRIVS+P+ ETR +L EV+ QV+KLVE
Sbjct  468   AAPPQRDLSDFSPKFMDRRSRGQFWRRPSERLGSRIVSAPSNETRRELIEVENQVKKLVE  527

Query  1215  DLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALL  1036
             +LKS+S+D QR ATAE+RLLAKHNMDNRIVI N GAI LLV LLHS D   QENAVTALL
Sbjct  528   ELKSSSLDVQRQATAEIRLLAKHNMDNRIVIGNSGAIVLLVELLHSTDSATQENAVTALL  587

Query  1035  NLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQ  856
             NLSINDNNKS IA AGAIEPLI+VL+ GS EAKEN+AATLFSLSVIE+ KIKIG+SGA+ 
Sbjct  588   NLSINDNNKSLIAQAGAIEPLIHVLQNGSSEAKENAAATLFSLSVIEELKIKIGQSGAIG  647

Query  855   SLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAV  676
              LVDLLGNGTPRGKKDAATALFNLSI  ENKG IVQ+GAVR+L++LMDPAAGMVDKAVAV
Sbjct  648   PLVDLLGNGTPRGKKDAATALFNLSIHQENKGTIVQSGAVRYLIDLMDPAAGMVDKAVAV  707

Query  675   LSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHG  496
             L+NLATI EGR +IGQEGGI +LVEVVELGSARGKENAAAALLQL TNS R+CNMVLQ G
Sbjct  708   LANLATIPEGRNAIGQEGGIGLLVEVVELGSARGKENAAAALLQLSTNSGRFCNMVLQEG  767

Query  495   AVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             AVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  768   AVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  805


 Score =   309 bits (792),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 235/324 (73%), Gaps = 2/324 (1%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGI-VDAEIASDELLQKVFS  2677
             L+++ISSF +LSS  +I+ +   KYY++ E++L +L+P+     +++ + S+E + K F 
Sbjct  6     LVDSISSFLNLSSSRHIDLDPFEKYYKRVEELLIVLKPVADAASINSHLVSEERIGKSFD  65

Query  2676  GLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSL  2497
              L   VD   +LF++W   SSKVYFVLQ ESLI K+R   +     L+S +  LP E S 
Sbjct  66    DLTQDVDHSIDLFRSWHAFSSKVYFVLQIESLIPKMRETIVDTFHFLMSFESNLPDELSP  125

Query  2496  TSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELV  2317
              SLE C+ K+K + YE +S+ I  A+++  +G+G + + L +I +   L+SNQE+LIE V
Sbjct  126   PSLEKCLEKVKQLSYEEISSVIDGALRDQRDGAGPTPEVLVRIGENTGLRSNQEILIEAV  185

Query  2316  aleklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLE  2137
             ALE+ KE AEQ+E N EVE+++Q+I +V  MH+ L+++KQ+++ +SV I ADF CPLSLE
Sbjct  186   ALERQKEIAEQSENNSEVEFLDQLIVIVNRMHERLLLIKQTQT-SSVAILADFFCPLSLE  244

Query  2136  LMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNN  1957
             +MTDPVIV+SGQTYE+ FI+RWIDLGL VCPKTRQTLTHT LIPNYTVKALIANWCE N+
Sbjct  245   VMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKALIANWCETND  304

Query  1956  IKLPDPIKSLNVNQPSSHVAHVDS  1885
             +KLPDP KS ++N+ S  ++  DS
Sbjct  305   VKLPDPNKSTSLNELSPLLSCTDS  328



>emb|CBI33734.3| unnamed protein product [Vitis vinifera]
Length=682

 Score =   523 bits (1347),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 271/335 (81%), Positives = 294/335 (88%), Gaps = 4/335 (1%)
 Frame = -2

Query  1383  SRRESEFPSPVGTRL-RPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLK  1207
             SR+ES   +     L R  A+WRRPSER V RIVSSPT ETRADL+ V+ QV++LVEDLK
Sbjct  351   SRKESSNSTGADANLARSQAMWRRPSERFVPRIVSSPTTETRADLSGVEAQVQRLVEDLK  410

Query  1206  STSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLS  1027
             S SV+ QR AT+ELRLLAKHNMDNRIVI+NCGAISLLVNLL SED + QENAVTALLNLS
Sbjct  411   SESVETQREATSELRLLAKHNMDNRIVIANCGAISLLVNLLRSEDAKAQENAVTALLNLS  470

Query  1026  INDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLV  847
             INDNNK+AIANA AIEPLI+VL+TGSPEAKENSAATLFSLSVIEDNK  IGRSGA+  LV
Sbjct  471   INDNNKTAIANAQAIEPLIHVLQTGSPEAKENSAATLFSLSVIEDNKAAIGRSGAIAPLV  530

Query  846   DLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSN  667
             +LLGNGTPRGKKDAATALFNLSI HENK RIVQAGAVRHLVELMDPAAGMVDKAVAVL+N
Sbjct  531   ELLGNGTPRGKKDAATALFNLSIFHENKTRIVQAGAVRHLVELMDPAAGMVDKAVAVLAN  590

Query  666   LATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVP  487
             LATI EGR +I Q GGIP+LVEVVELGSARGKENAAAALLQLC+NSSR C  VLQ GAVP
Sbjct  591   LATITEGRHAIDQAGGIPVLVEVVELGSARGKENAAAALLQLCSNSSRSCIKVLQEGAVP  650

Query  486   PLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             PLVALSQSGTPRA+EKAQALL+ FR+ RH  AGRG
Sbjct  651   PLVALSQSGTPRAKEKAQALLNCFRS-RH--AGRG  682


 Score =   431 bits (1109),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 231/335 (69%), Positives = 268/335 (80%), Gaps = 1/335 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             MEI LLK LLN ISSFF LSS +NI+SE V KYYQK E+ILKLL+PILS I+D+EIASDE
Sbjct  1     MEISLLKRLLNKISSFFLLSSHDNIDSEPVRKYYQKIEEILKLLKPILSTIIDSEIASDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL K F  LG SVD+L+ELF+    L SKVYFVLQ E  I+K+R   L+I + L SS  C
Sbjct  61    LLNKAFEELGRSVDDLQELFENCHPLMSKVYFVLQIELSISKIRTSGLEIFQQLKSSHQC  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E S  SLE C+ K+K M YE  S  + +AI+N V+G+G+SS+SL K+ADCLSL+SNQ
Sbjct  121   LPDELSSASLETCIQKVKHMGYEQTSTILQEAIRNQVQGAGSSSESLMKLADCLSLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELLIE VALEKLKENAEQAEK EE EYI+Q+I L T MHD  I+ KQS+SC  + IPADF
Sbjct  181   ELLIEAVALEKLKENAEQAEKTEEAEYIDQMITLATQMHDRFIITKQSQSCNPIPIPADF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FIR+W+DLGLTVCPKTRQTL HTNLIPNYTVKALIA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERAFIRKWLDLGLTVCPKTRQTLAHTNLIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVN-QPSSHVAHVDSGAP  1876
             NWCE NN+KLPDP+KSLN+N QP S  +   +G+P
Sbjct  301   NWCESNNVKLPDPVKSLNLNHQPMSPESTRFTGSP  335



>emb|CDY46092.1| BnaA09g42160D [Brassica napus]
Length=1033

 Score =   532 bits (1371),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 287/398 (72%), Positives = 324/398 (81%), Gaps = 7/398 (2%)
 Frame = -2

Query  1560  ENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSS-PTTASTEASMEVAS---ESRHAAT  1393
             EN H  H R+ SA S++SN +  RA A++ +E S   T  S++AS E+ S    +   + 
Sbjct  638   ENHH--HLRSPSAASSVSNEDSPRAEANENSEESPHATPYSSDASGEIRSGPLAAATTSA  695

Query  1392  LAASRRE-SEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVE  1216
              A  RR+ S+F      R      WRRPSERL SRIVS+P+ ETR +L EV+ QV+KLVE
Sbjct  696   AAPPRRDLSDFSPKFMDRRSRGQFWRRPSERLGSRIVSAPSNETRRELIEVENQVKKLVE  755

Query  1215  DLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALL  1036
             +LKS+S+D QR ATAE+RLLAKHNMDNRIVI N GAI LLV LLHS D   QENAVTALL
Sbjct  756   ELKSSSLDVQRQATAEIRLLAKHNMDNRIVIGNSGAIVLLVELLHSTDSATQENAVTALL  815

Query  1035  NLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQ  856
             NLSINDNNKS IA AGAIEPLI+VL+ GS EAKEN+AATLFSLSVIE+ KIKIG+SGA+ 
Sbjct  816   NLSINDNNKSLIAQAGAIEPLIHVLQNGSSEAKENAAATLFSLSVIEELKIKIGQSGAIG  875

Query  855   SLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAV  676
              LVDLLGNGTPRGKKDAATALFNLSI  ENKG IVQ+GAVR+L++LMDPAAGMVDKAVAV
Sbjct  876   PLVDLLGNGTPRGKKDAATALFNLSIHQENKGTIVQSGAVRYLIDLMDPAAGMVDKAVAV  935

Query  675   LSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHG  496
             L+NLATI EGR +IGQEGGI +LVEVVELGSARGKENAAAALLQL TNS R+CNMVLQ G
Sbjct  936   LANLATIPEGRNAIGQEGGIGLLVEVVELGSARGKENAAAALLQLSTNSGRFCNMVLQEG  995

Query  495   AVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             AVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG
Sbjct  996   AVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  1033


 Score =   308 bits (788),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 176/362 (49%), Positives = 249/362 (69%), Gaps = 7/362 (2%)
 Frame = -2

Query  2880  GMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGI-VDAEIAS  2704
             G E +    L+++ISSF +LSS  +I+ +   KYY++ E++L +L+P+     +++ + S
Sbjct  282   GWEEMGTSALVDSISSFLNLSSSRHIDLDPFEKYYKRVEELLIVLKPVADAASINSHLVS  341

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             +E + K F  L   VD   +LF++W   SSKVYFVLQ ESLI K+R   +     L+S +
Sbjct  342   EERIGKSFDDLTQDVDHSIDLFRSWHAFSSKVYFVLQIESLIPKMRETIVDTFHFLMSFE  401

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
               LP E S  SLE C+ K+K + YE +S+ I  A+++  +G+G + + L +I +   L+S
Sbjct  402   SNLPDELSPPSLEKCLEKVKQLSYEEISSVIDGALRDQRDGAGPTPEVLVRIGENTGLRS  461

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQE+LIE VALE+ KE AEQ+E N EVE+++Q+I +V  MH+ L+++KQ+++ +SV I A
Sbjct  462   NQEILIEAVALERQKEIAEQSENNSEVEFLDQLIVIVNRMHERLLLIKQTQT-SSVAILA  520

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DF CPLSLE+MTDPVIV+SGQTYE+ FI+RWIDLGL VCPKTRQTLTHT LIPNYTVKAL
Sbjct  521   DFFCPLSLEVMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKAL  580

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDS--GAPRDIHIFSHSRA---NNSTSPDS  1819
             IANWCE N++KLPDP KS ++N+ S  ++  DS   AP    + S +R    N  TS + 
Sbjct  581   IANWCETNDVKLPDPNKSTSLNELSPLLSCTDSVPNAPGRSSVSSTTRGSVENGQTSENH  640

Query  1818  AH  1813
              H
Sbjct  641   HH  642



>ref|XP_010933040.1| PREDICTED: U-box domain-containing protein 4-like [Elaeis guineensis]
Length=854

 Score =   504 bits (1299),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 270/413 (65%), Positives = 324/413 (78%), Gaps = 17/413 (4%)
 Frame = -2

Query  1581  NSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSP----TTASTEASMEVAS  1414
             +S +S  +   QGH ++ SA S++S++++ +    D N VS      T  S++AS EV  
Sbjct  446   DSQASMVDGQFQGHKQSISACSSVSDNDYPQGTG-DANVVSRVSSDLTHYSSDASGEVTQ  504

Query  1413  ES--------RHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLVSRIVSSPTVETR  1261
             ++        R     +A +RE EFP  +G  R R   I++ PS   + RI+SSP++++R
Sbjct  505   DTPASSGEVTRETPASSAPQREPEFPPRLGEARFRSQTIFQWPS---IPRIISSPSMDSR  561

Query  1260  ADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLH  1081
              DL+ V+ QVRKL EDLKS SVD QR ATAELR L KHNM+NR+VI+NCG+ISLLV+LL+
Sbjct  562   PDLSGVETQVRKLAEDLKSDSVDVQRAATAELRFLTKHNMENRVVIANCGSISLLVDLLN  621

Query  1080  SEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSV  901
             S D E QENAVTALLNLSINDNNK AIANAGAI+ LI+VLETG+ +A+ENSAATLFSLSV
Sbjct  622   SVDPETQENAVTALLNLSINDNNKIAIANAGAIDLLIHVLETGNCQARENSAATLFSLSV  681

Query  900   IEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVE  721
             I +NK++IGRSGA++ LV+LLGNGTPRGKKDA TALFNLSI HENK RIV+AGAV  LVE
Sbjct  682   IGENKVRIGRSGAIRPLVELLGNGTPRGKKDATTALFNLSIFHENKVRIVRAGAVNPLVE  741

Query  720   LMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQL  541
             LMDPAAG+VDKAVAVL+NLATIQEGR +IG   GIP LVEVVELGSARGKENAAAALLQL
Sbjct  742   LMDPAAGLVDKAVAVLANLATIQEGRTAIGHSEGIPSLVEVVELGSARGKENAAAALLQL  801

Query  540   CTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             CTNS+R+C  VLQ GAVPPLVALSQSGTPRA+EKA ALL YFR+QR  NAGRG
Sbjct  802   CTNSNRFCTQVLQQGAVPPLVALSQSGTPRAKEKAHALLRYFRDQRQCNAGRG  854


 Score =   298 bits (764),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 215/317 (68%), Gaps = 9/317 (3%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G MEI LLK LLNNI+ F  LSS   I SELV +Y +K ++IL++L+P+L   V ++I+S
Sbjct  26    GMMEISLLKTLLNNITCFDLLSSSNAIKSELVTRYVRKIDEILEILKPVLDQAVASKISS  85

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             D  L  +   L   V+E REL   W    SKVYFVLQ ES+IA +  +S+++ +LL    
Sbjct  86    DGKLILLLKELDGVVNEARELVGCWHPTMSKVYFVLQIESIIANIWKYSIEVCQLL----  141

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
                   S+ T +E+ V KI+ + YE +S  I +AI++  E      + L KI + LSL S
Sbjct  142   -----NSTSTPIEHYVQKIQHIHYEQISDVIKEAIRDQREKFIPKPELLDKILNSLSLSS  196

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQELL+E  ALEK K      E + EVE I+ +IAL+T MH+CL+ +KQ  S   V IPA
Sbjct  197   NQELLMEAAALEKFKMKVGHGENHIEVEDIDHMIALITSMHECLVKIKQLHSINGVPIPA  256

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
             DFCCPLSLEL++DPVIV SGQTYER FIR+W+D G  VCPKTRQTL +TNL+PNYTVK L
Sbjct  257   DFCCPLSLELISDPVIVDSGQTYERAFIRKWLDQGFNVCPKTRQTLGNTNLVPNYTVKLL  316

Query  1983  IANWCEMNNIKLPDPIK  1933
             IANWCE N+IKLPDP+K
Sbjct  317   IANWCESNDIKLPDPMK  333



>gb|AIU34701.1| Arm1 [Hordeum vulgare subsp. vulgare]
Length=442

 Score =   484 bits (1245),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 247/357 (69%), Positives = 298/357 (83%), Gaps = 3/357 (1%)
 Frame = -2

Query  1452  TTASTEASMEVASESRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLVSRIVSSP  1276
             T  S++AS EVA   R  +  +A +RE+     +G   +  P + R+ S++   RI+SS 
Sbjct  87    TNYSSDASGEVAD--RGLSISSAPQRENVILPRLGHVCMEGPFVQRQTSDKGFPRIISSL  144

Query  1275  TVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLL  1096
             +++ R D + ++ QVR+L+ DL S S++ QR AT+E+RLLAKHNM+NRI I+NCGAI+LL
Sbjct  145   SMDARDDFSAIENQVRELINDLGSDSIEGQRSATSEIRLLAKHNMENRIAIANCGAINLL  204

Query  1095  VNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATL  916
             V LLHS D ++QENAVTALLNLS++D NK AI NA AI+PLI+VLETG+PEAKENSAATL
Sbjct  205   VGLLHSPDAKIQENAVTALLNLSLSDINKIAIVNADAIDPLIHVLETGNPEAKENSAATL  264

Query  915   FSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAV  736
             FSLS+IE+N+++IGRSGAV+ LVDLLGNG+PRGKKDA TALFNLSILHENKGRIVQA A+
Sbjct  265   FSLSIIEENRVRIGRSGAVKPLVDLLGNGSPRGKKDAVTALFNLSILHENKGRIVQADAL  324

Query  735   RHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAA  556
             +HLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSA+ KENA A
Sbjct  325   KHLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPALVEVVELGSAKAKENATA  384

Query  555   ALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             ALLQLCTNSSR+CN+VLQ  AVPPLVALSQSGTPRAREKAQ LLSYFR+QRHGN+GR
Sbjct  385   ALLQLCTNSSRFCNIVLQEDAVPPLVALSQSGTPRAREKAQVLLSYFRSQRHGNSGR  441



>dbj|BAK03073.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score =   484 bits (1245),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 247/357 (69%), Positives = 298/357 (83%), Gaps = 3/357 (1%)
 Frame = -2

Query  1452  TTASTEASMEVASESRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLVSRIVSSP  1276
             T  S++AS EVA   R  +  +A +RE+     +G   +  P + R+ S++   RI+SS 
Sbjct  88    TNYSSDASGEVAD--RGLSISSAPQRENVILPRLGHVCMEGPFVQRQTSDKGFPRIISSL  145

Query  1275  TVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLL  1096
             +++ R D + ++ QVR+L+ DL S S++ QR AT+E+RLLAKHNM+NRI I+NCGAI+LL
Sbjct  146   SMDARDDFSAIENQVRELINDLGSDSIEGQRSATSEIRLLAKHNMENRIAIANCGAINLL  205

Query  1095  VNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATL  916
             V LLHS D ++QENAVTALLNLS++D NK AI NA AI+PLI+VLETG+PEAKENSAATL
Sbjct  206   VGLLHSPDAKIQENAVTALLNLSLSDINKIAIVNADAIDPLIHVLETGNPEAKENSAATL  265

Query  915   FSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAV  736
             FSLS+IE+N+++IGRSGAV+ LVDLLGNG+PRGKKDA TALFNLSILHENKGRIVQA A+
Sbjct  266   FSLSIIEENRVRIGRSGAVKPLVDLLGNGSPRGKKDAVTALFNLSILHENKGRIVQADAL  325

Query  735   RHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAA  556
             +HLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSA+ KENA A
Sbjct  326   KHLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPALVEVVELGSAKAKENATA  385

Query  555   ALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             ALLQLCTNSSR+CN+VLQ  AVPPLVALSQSGTPRAREKAQ LLSYFR+QRHGN+GR
Sbjct  386   ALLQLCTNSSRFCNIVLQEDAVPPLVALSQSGTPRAREKAQVLLSYFRSQRHGNSGR  442



>dbj|BAJ93866.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score =   483 bits (1244),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 247/357 (69%), Positives = 298/357 (83%), Gaps = 3/357 (1%)
 Frame = -2

Query  1452  TTASTEASMEVASESRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLVSRIVSSP  1276
             T  S++AS EVA   R  +  +A +RE+     +G   +  P + R+ S++   RI+SS 
Sbjct  88    TNYSSDASGEVAD--RGLSISSAPQRENVILPRLGHVCMEGPFVQRQTSDKGFPRIISSL  145

Query  1275  TVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLL  1096
             +++ R D + ++ QVR+L+ DL S S++ QR AT+E+RLLAKHNM+NRI I+NCGAI+LL
Sbjct  146   SMDARDDFSAIENQVRELINDLGSDSIEGQRSATSEIRLLAKHNMENRIAIANCGAINLL  205

Query  1095  VNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATL  916
             V LLHS D ++QENAVTALLNLS++D NK AI NA AI+PLI+VLETG+PEAKENSAATL
Sbjct  206   VGLLHSPDAKIQENAVTALLNLSLSDINKIAIVNADAIDPLIHVLETGNPEAKENSAATL  265

Query  915   FSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAV  736
             FSLS+IE+N+++IGRSGAV+ LVDLLGNG+PRGKKDA TALFNLSILHENKGRIVQA A+
Sbjct  266   FSLSIIEENRVRIGRSGAVKPLVDLLGNGSPRGKKDAVTALFNLSILHENKGRIVQADAL  325

Query  735   RHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAA  556
             +HLVELMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSA+ KENA A
Sbjct  326   KHLVELMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPALVEVVELGSAKAKENATA  385

Query  555   ALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             ALLQLCTNSSR+CN+VLQ  AVPPLVALSQSGTPRAREKAQ LLSYFR+QRHGN+GR
Sbjct  386   ALLQLCTNSSRFCNIVLQEDAVPPLVALSQSGTPRAREKAQVLLSYFRSQRHGNSGR  442



>emb|CDM85251.1| unnamed protein product [Triticum aestivum]
 emb|CDM85257.1| unnamed protein product [Triticum aestivum]
Length=440

 Score =   473 bits (1216),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 253/360 (70%), Positives = 297/360 (83%), Gaps = 3/360 (1%)
 Frame = -2

Query  1461  SSPTTASTEASMEVASESRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLVSRIV  1285
             S  T  S +AS EVA   R  +  +A +RE+     +G   L  P + R+ S+R   RI+
Sbjct  82    SDRTNYSGDASGEVAD--RGLSVSSAPQRENVILPRLGDVCLEGPFVRRQTSDRGFPRII  139

Query  1284  SSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAI  1105
             SS +++ R D + ++ QVR L+ DL S S++ QR AT+E+RLLAKHNM+NRIVI+NCGAI
Sbjct  140   SSTSIDARGDFSAIENQVRGLINDLGSDSIEGQRSATSEIRLLAKHNMENRIVIANCGAI  199

Query  1104  SLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSA  925
             +LLV LLHS D ++QENAVTALLNLS++D NK AI NA AI+PL++VLETG+PEAKENSA
Sbjct  200   NLLVGLLHSPDAKIQENAVTALLNLSLSDINKIAIVNADAIDPLVHVLETGNPEAKENSA  259

Query  924   ATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA  745
             ATLFSLS IEDN+ +IGRSGAV+ LVDLLGNG PRGKKDA TALFNLSILHENKGRIVQA
Sbjct  260   ATLFSLSFIEDNRARIGRSGAVKPLVDLLGNGNPRGKKDAVTALFNLSILHENKGRIVQA  319

Query  744   GAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKEN  565
              A+RHLV+LMDPAAGMVDKAVAVL+NLATI EGR +IGQ  GIP LVEVVELGSA+ KEN
Sbjct  320   DALRHLVDLMDPAAGMVDKAVAVLANLATIPEGRTAIGQARGIPALVEVVELGSAKAKEN  379

Query  564   AAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             AAAALLQLCTNS+R+C+MVLQ  AVPPLVALSQSGTPRAREKAQALLSYFRNQRHGN+GR
Sbjct  380   AAAALLQLCTNSNRFCSMVLQESAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNSGR  439



>gb|EMS55038.1| U-box domain-containing protein 4 [Triticum urartu]
Length=440

 Score =   468 bits (1204),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 248/359 (69%), Positives = 296/359 (82%), Gaps = 1/359 (0%)
 Frame = -2

Query  1461  SSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVS  1282
             S  T  S +AS EVA      ++ A  R     P      +  P++ R+ ++R   RI+S
Sbjct  82    SDRTNYSGDASGEVADGGLSVSS-APQRENVILPRLGDICMEGPSVRRQTADRGFPRIIS  140

Query  1281  SPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAIS  1102
             S +++ R D + ++ QVR+L+ DL S S++ QR AT+E+RLLAKHNM+NRIVI+NCGAI+
Sbjct  141   SSSMDARGDFSAIENQVRELINDLGSDSIEGQRSATSEIRLLAKHNMENRIVIANCGAIN  200

Query  1101  LLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAA  922
             LLV LLHS D +VQENAVTALLNLS++D NK AI NA A++PL++VLETG+PEAKENSAA
Sbjct  201   LLVGLLHSPDAKVQENAVTALLNLSLSDINKIAIVNADAVDPLVHVLETGNPEAKENSAA  260

Query  921   TLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAG  742
             TLFSLS IEDN+ +IG+SGAV+ LVDLLGNG+PRGKKDA TALFNLSIL+ENKGRIVQA 
Sbjct  261   TLFSLSFIEDNRARIGQSGAVKPLVDLLGNGSPRGKKDAVTALFNLSILNENKGRIVQAD  320

Query  741   AVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENA  562
             A+RHLVELMDPAAGMVDKAVAVL+NLATIQEGR +IGQ  GIP LVEVVELGSA+ KENA
Sbjct  321   ALRHLVELMDPAAGMVDKAVAVLANLATIQEGRTAIGQARGIPALVEVVELGSAKAKENA  380

Query  561   AAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             AAALLQLCTNS+R+CN+VLQ  AVPPLVALSQSGTPRAREKAQALLSYFR+QRHGN+GR
Sbjct  381   AAALLQLCTNSNRFCNIVLQEDAVPPLVALSQSGTPRAREKAQALLSYFRSQRHGNSGR  439



>ref|XP_002868987.1| hypothetical protein ARALYDRAFT_912596 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45246.1| hypothetical protein ARALYDRAFT_912596 [Arabidopsis lyrata subsp. 
lyrata]
Length=297

 Score =   456 bits (1173),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 231/296 (78%), Positives = 259/296 (88%), Gaps = 1/296 (0%)
 Frame = -2

Query  1275  TVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLL  1096
             T E + +L++V+ QV+ LVEDLK+ S D QR ATAELRLLAK++MDNRIVI NCGAI LL
Sbjct  2     TNEAKRNLSDVETQVKILVEDLKNDSADTQRNATAELRLLAKYDMDNRIVIENCGAIGLL  61

Query  1095  VNLLHSEDMEVQENAVTALLNLSINDN-NKSAIANAGAIEPLIYVLETGSPEAKENSAAT  919
             VNLL+S D E QENAVTALLNLSIN+N NKSAI +AGAIEPLI+VLE G  EAK NSAAT
Sbjct  62    VNLLYSNDPETQENAVTALLNLSINNNKNKSAIVDAGAIEPLIHVLENGGSEAKANSAAT  121

Query  918   LFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGA  739
             ++SLS++E+NKIKIG SGAV  LVDLLGNGTPRGKKDA TALFNLSI HENK RIVQ GA
Sbjct  122   IYSLSLLEENKIKIGSSGAVGPLVDLLGNGTPRGKKDAITALFNLSIHHENKARIVQYGA  181

Query  738   VRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAA  559
             VR+L+ELMDPA GMVDKAVAVL+NLATI EGR +IG+EGGIP+LVEVVELGSA+GKENAA
Sbjct  182   VRYLIELMDPAVGMVDKAVAVLTNLATIPEGRNAIGEEGGIPLLVEVVELGSAKGKENAA  241

Query  558   AALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNA  391
             AALL+L TNS R+CNMVLQ G VPPLVALS+SGTPR REKAQALLSY RNQRH NA
Sbjct  242   AALLRLSTNSGRFCNMVLQEGVVPPLVALSKSGTPRTREKAQALLSYLRNQRHENA  297



>ref|XP_006645135.1| PREDICTED: U-box domain-containing protein 4-like [Oryza brachyantha]
Length=795

 Score =   466 bits (1200),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 233/328 (71%), Positives = 268/328 (82%), Gaps = 0/328 (0%)
 Frame = -2

Query  1365  FPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQ  1186
              P   G R R   IW R SE+ VSRI    + +++++++    +VR L+E+LKS S D Q
Sbjct  468   LPRLGGVRPRSQPIWWRQSEKTVSRIGLPSSTDSKSEISGTDAKVRNLIEELKSDSADVQ  527

Query  1185  RIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKS  1006
             R AT EL +L+KH++DNRI ISNCGAI  LV+LLHS D   QENAVT LLNLS++DNNK 
Sbjct  528   RSATEELHVLSKHSLDNRIAISNCGAIPFLVSLLHSADPSTQENAVTILLNLSLDDNNKI  587

Query  1005  AIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGT  826
             AIA+A AIEPLI+VL+ G+PEAK NSAATLFSLSVIE+NKIKIGRSGA++ LVDLLG GT
Sbjct  588   AIASAEAIEPLIFVLQVGNPEAKANSAATLFSLSVIEENKIKIGRSGAIEPLVDLLGEGT  647

Query  825   PRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEG  646
             P+GKKDAATAL+NLSI HE+K RIV AGAV HLVELMDPAAGMVDKAVAVL+NLAT+ EG
Sbjct  648   PQGKKDAATALYNLSIFHEHKARIVHAGAVEHLVELMDPAAGMVDKAVAVLANLATVHEG  707

Query  645   RMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQ  466
             R +I Q GGI +LVEVVELGSAR KENAAAALLQLCTNSSR+C +VLQ G VPPLVALSQ
Sbjct  708   RNAIAQAGGIRVLVEVVELGSARSKENAAAALLQLCTNSSRFCTLVLQEGVVPPLVALSQ  767

Query  465   SGTPRAREKAQALLSYFRNQRHGNAGRG  382
             SGT RAREKAQ LLSYFRNQRH   GRG
Sbjct  768   SGTARAREKAQVLLSYFRNQRHVKVGRG  795


 Score =   246 bits (628),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 206/353 (58%), Gaps = 17/353 (5%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSG  2674
             LL++IS+F  LSS     +ELV KY Q  + IL  ++  L+     +I  D+ L KV   
Sbjct  8     LLDSISNFRLLSSSNASKTELVKKYCQTIDGILDHMEMALNRTF-PQITPDDELSKVLEE  66

Query  2673  LGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLT  2494
              G +++E  EL   W  + SK+YFV+Q ES+I K++   + + EL    +  +P ES  T
Sbjct  67    FGATINEASELVGDWNQMMSKIYFVIQVESIITKMQ---ICVSELCQIVNSLMPIES--T  121

Query  2493  SLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELVa  2314
              +EN    ++    E +S  I +A +  V      SD L KI   LSL +NQELL+E VA
Sbjct  122   YMEN----LECDSCEKISDVIMEASRALVGQVMPKSDELGKIQTSLSLSTNQELLMEFVA  177

Query  2313  leklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLEL  2134
             L K+K  +      E  + I  II LV HM D L+  KQ+ S   V IPADFCCPLSLEL
Sbjct  178   LVKVKTKSNHEGSKELDD-INDIIELVNHMLDILVQEKQAHSIDGVPIPADFCCPLSLEL  236

Query  2133  MTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNI  1954
             M+DPVIVASGQTYE  FIR+W DLG  +CPKTRQTL HT LIPN+TVK LI NWCE++ I
Sbjct  237   MSDPVIVASGQTYEHVFIRKWFDLGYNICPKTRQTLGHTKLIPNFTVKQLIENWCEIHGI  296

Query  1953  KLPDPIKSLNVNQPSS-HVAHV-----DSGAPRDIHIFSHSRANNSTSPDSAH  1813
              LPDPIK L+++ P S ++  V      SG+P    + S S        D  H
Sbjct  297   TLPDPIKLLSLSFPVSLNITDVSTSANKSGSPEHSQLISASHPKAECELDDGH  349



>gb|KHG13616.1| U-box domain-containing 2 -like protein [Gossypium arboreum]
Length=645

 Score =   455 bits (1170),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 228/284 (80%), Positives = 254/284 (89%), Gaps = 2/284 (1%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
             +V+KLVEDLKSTS D QR+ATA+LRLLAK N DNRI+I+NCGAI LLV+LL+S D + QE
Sbjct  362   KVKKLVEDLKSTSTDTQRVATAQLRLLAKQNRDNRIIIANCGAIILLVDLLNSPDTKTQE  421

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             N+VTALLNLS  DNNK+AIA+A AIEPLI+VL+TGSPEAKENSAATLFSLSVIEDNK++I
Sbjct  422   NSVTALLNLSNIDNNKTAIADANAIEPLIHVLKTGSPEAKENSAATLFSLSVIEDNKVRI  481

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGA++ LVDLLGNGTPRGKKDAATALFNLSI HENK RIV+AGAVR+LV LM PAAGM
Sbjct  482   GRSGAIRPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVKAGAVRYLVHLMHPAAGM  541

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVAVL++LAT  EGR +IGQEGGIP+LVEVVELGSARGK NA AALLQLCTNSSR+C
Sbjct  542   VDKAVAVLASLATTFEGRTAIGQEGGIPLLVEVVELGSARGKANATAALLQLCTNSSRFC  601

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
              MVLQ GAVPPLVALSQSGT RA+EKAQALLSYF  QRH    R
Sbjct  602   MMVLQEGAVPPLVALSQSGTQRAKEKAQALLSYF--QRHYRIFR  643


 Score =   343 bits (879),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 202/349 (58%), Positives = 249/349 (71%), Gaps = 6/349 (2%)
 Frame = -2

Query  2865  LLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPI-LSGIVDAEIASDELLQ  2689
             LL+ LL +ISSF +LSS ENINSE V KYYQ  E+ILK+L+PI L+ I D+EI SDE+L 
Sbjct  3     LLETLLRDISSFLNLSSSENINSEPVQKYYQGAEEILKVLKPIILNAIFDSEITSDEVLS  62

Query  2688  KVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPA  2509
             K F  LG SV+EL + F+ WQ LSSK YFVLQ ESLI+++R   L I  +L SS   LP 
Sbjct  63    KEFKELGVSVEELLQQFERWQPLSSKAYFVLQVESLISEIRNSCLDIFRVLKSSHQHLPY  122

Query  2508  ESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELL  2329
             E S  SLE  + KIK + YE  S+ I +A ++ V   G SS+ L +IA+ LSL SN E+L
Sbjct  123   ELSSASLELHLQKIKHVGYEQTSSVIKEAKRDQVGNFGPSSEILLRIAESLSLNSNMEVL  182

Query  2328  IELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCP  2149
             IE VALEKLKEN  QAEK  EV+ I+Q+IAL+T+MH CL + KQS +C+SV  P DF CP
Sbjct  183   IEAVALEKLKENTAQAEKLAEVDCIDQLIALITNMHHCLFLKKQSPTCSSVPTPLDFICP  242

Query  2148  LSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWC  1969
             LSLELMTDPVIVASGQTYER+FI++W DLGLTVCPKT QTL HT  IPNYT+KALIANWC
Sbjct  243   LSLELMTDPVIVASGQTYERSFIKKWFDLGLTVCPKTWQTLVHTLFIPNYTMKALIANWC  302

Query  1968  EMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPD  1822
             E+NN+KLP+ ++S  +NQ     A        D+     S++NN   PD
Sbjct  303   ELNNVKLPNLVES-TLNQVYPPRATKVKKLVEDL----KSKSNNVKLPD  346



>ref|NP_001045017.2| Os01g0884400 [Oryza sativa Japonica Group]
 dbj|BAD82582.1| putative arm repeat-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAG93036.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06931.2| Os01g0884400 [Oryza sativa Japonica Group]
Length=796

 Score =   455 bits (1171),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 228/327 (70%), Positives = 266/327 (81%), Gaps = 0/327 (0%)
 Frame = -2

Query  1362  PSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQR  1183
             P   G R R    W R S + + RI  S + +++ D +    +VR L+E+LKS S + QR
Sbjct  470   PRLGGVRSRNQPNWWRQSNKTIPRIGLSSSTDSKPDFSGNDAKVRNLIEELKSDSAEVQR  529

Query  1182  IATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSA  1003
              AT ELR+L++H+++NRI I+NCGAI  LV+LLHS D   QENAVT LLNLS++DNNK A
Sbjct  530   SATGELRILSRHSLENRIAIANCGAIPFLVSLLHSTDPSTQENAVTILLNLSLDDNNKIA  589

Query  1002  IANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTP  823
             IA+A AIEPLI+VL+ G+PEAK NSAATLFSLSVIE+NKIKIGRSGA++ LVDLLG GTP
Sbjct  590   IASAEAIEPLIFVLQVGNPEAKANSAATLFSLSVIEENKIKIGRSGAIEPLVDLLGEGTP  649

Query  822   RGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGR  643
             +GKKDAATALFNLSI HE+K RIVQAGAV HLVELMDPAAGMVDKAVAVL+NLAT+ +GR
Sbjct  650   QGKKDAATALFNLSIFHEHKTRIVQAGAVNHLVELMDPAAGMVDKAVAVLANLATVHDGR  709

Query  642   MSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQS  463
              +I Q GGI +LVEVVELGSAR KENAAAALLQLCTNS+R+C +VLQ G VPPLVALSQS
Sbjct  710   NAIAQAGGIRVLVEVVELGSARSKENAAAALLQLCTNSNRFCTLVLQEGVVPPLVALSQS  769

Query  462   GTPRAREKAQALLSYFRNQRHGNAGRG  382
             GT RAREKAQ LLSYFRNQRH   GRG
Sbjct  770   GTARAREKAQVLLSYFRNQRHVRVGRG  796


 Score =   234 bits (596),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 192/324 (59%), Gaps = 27/324 (8%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSG  2674
             LL++IS+F  LSS     +ELV KY Q  + IL  L+  L+     +I  D  L KV   
Sbjct  8     LLDSISNFRVLSSSNASKTELVKKYCQTMDGILDHLEVALNRAF-PQITPDGELSKVLEE  66

Query  2673  LGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLT  2494
             LG +++E  EL   W  + SK+YFV+QA+S+IAK++ +  ++ +++              
Sbjct  67    LGATINEATELVGGWNQMMSKIYFVIQADSIIAKMQIYVFELCQIV--------------  112

Query  2493  SLENCVLKIKSMDYELLSATITKAIKNHV-EGSGA-------SSDSLTKIADCLSLKSNQ  2338
                N +++I+SM  E L       I + + E S A       +S+   KI   LSL +NQ
Sbjct  113   ---NSLMQIESMHLEDLEHDSCGKISDVIREASRALAGEVMPNSEEFGKIQTTLSLSTNQ  169

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL+E VAL K+K      +  E  + I  I+ LV HM D  +  KQ+ S   V IPADF
Sbjct  170   ELLMEYVALVKVKTKGNHEDNKEMDD-INDIVELVNHMLDKHVEEKQTRSINGVTIPADF  228

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELM+DPVIVASGQTYE  FIR+W DLG  +CPKTRQ L HT LIPN+TVK LI 
Sbjct  229   CCPLSLELMSDPVIVASGQTYEHVFIRKWFDLGYNICPKTRQILGHTKLIPNFTVKQLIE  288

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSS  1906
             NWCE++ I LPDP+K L++  P S
Sbjct  289   NWCEVHGIMLPDPVKLLSLCFPVS  312



>gb|EEC71911.1| hypothetical protein OsI_04691 [Oryza sativa Indica Group]
Length=867

 Score =   452 bits (1162),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 228/327 (70%), Positives = 265/327 (81%), Gaps = 0/327 (0%)
 Frame = -2

Query  1362  PSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQR  1183
             P   G R R    W R S + + RI  S   +++ D +    +VR L+E+LKS S + QR
Sbjct  541   PRLGGVRSRNQPNWWRQSNKTIPRIGLSSLTDSKPDFSGNDAKVRNLIEELKSDSAEVQR  600

Query  1182  IATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSA  1003
              AT ELR+L++H+++NRI I+NCGAI  LV+LLHS D   QENAVT LLNLS++DNNK A
Sbjct  601   SATGELRILSRHSLENRIAIANCGAIPFLVSLLHSTDPSTQENAVTILLNLSLDDNNKIA  660

Query  1002  IANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTP  823
             IA+A AIEPLI+VL+ G+PEAK NSAATLFSLSVIE+NKIKIGRSGA++ LVDLLG GTP
Sbjct  661   IASAEAIEPLIFVLQVGNPEAKANSAATLFSLSVIEENKIKIGRSGAIEPLVDLLGEGTP  720

Query  822   RGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGR  643
             +GKKDAATALFNLSI HE+K RIVQAGAV HLVELMDPAAGMVDKAVAVL+NLAT+ +GR
Sbjct  721   QGKKDAATALFNLSIFHEHKTRIVQAGAVNHLVELMDPAAGMVDKAVAVLANLATVHDGR  780

Query  642   MSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQS  463
              +I Q GGI +LVEVVELGSAR KENAAAALLQLCTNS+R+C +VLQ G VPPLVALSQS
Sbjct  781   NAIAQAGGIRVLVEVVELGSARSKENAAAALLQLCTNSNRFCTLVLQEGVVPPLVALSQS  840

Query  462   GTPRAREKAQALLSYFRNQRHGNAGRG  382
             GT RAREKAQ LLSYFRNQRH   GRG
Sbjct  841   GTARAREKAQVLLSYFRNQRHVRVGRG  867


 Score =   227 bits (579),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 186/318 (58%), Gaps = 27/318 (8%)
 Frame = -2

Query  2835  SFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSGLGHSVD  2656
             +F  LSS     +ELV KY Q  + IL  L+  L+     +I  D  L KV   LG +++
Sbjct  85    NFRVLSSSNASKTELVKKYCQTMDGILDHLEVTLNRAF-PQITPDGELSKVLEELGATIN  143

Query  2655  ELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLTSLENCV  2476
             E  EL   W  + SK+YFV+QA+S+IAK++ +  ++ +++                 N +
Sbjct  144   EATELVGGWNQMMSKIYFVIQADSIIAKMQIYVFELCQIV-----------------NSL  186

Query  2475  LKIKSMDYELLSATITKAIKNHV-EGSGA-------SSDSLTKIADCLSLKSNQELLIEL  2320
             ++I+SM  E L       I + + E S A       +S+   KI   LSL +NQELL+E 
Sbjct  187   MQIESMHLEDLEHDSCGKISDVIREASRALAGEVMPNSEEFGKIQTTLSLSTNQELLMEY  246

Query  2319  ValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSL  2140
             VAL K+K      +  E  + I  I+ LV HM D  +  KQ+ S   V IPADFCCPLSL
Sbjct  247   VALVKVKTKGNHEDNKEMDD-INDIVELVNHMLDKHVEEKQTRSIDGVTIPADFCCPLSL  305

Query  2139  ELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMN  1960
             ELM+DPVIVASGQTYE  FIR+W DLG  +CPKTRQ L HT LIPN+TVK LI NWCE++
Sbjct  306   ELMSDPVIVASGQTYEHVFIRKWFDLGYNICPKTRQILGHTKLIPNFTVKQLIENWCEVH  365

Query  1959  NIKLPDPIKSLNVNQPSS  1906
              I LPDP+K L++  P S
Sbjct  366   GIMLPDPVKLLSLCFPVS  383



>gb|EEE55766.1| hypothetical protein OsJ_04318 [Oryza sativa Japonica Group]
Length=959

 Score =   452 bits (1162),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 227/323 (70%), Positives = 265/323 (82%), Gaps = 0/323 (0%)
 Frame = -2

Query  1350  GTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATA  1171
             G R R    W R S + + RI  S + +++ D +    +VR L+E+LKS S + QR AT 
Sbjct  637   GVRSRNQPNWWRQSNKTIPRIGLSSSTDSKPDFSGNDAKVRNLIEELKSDSAEVQRSATG  696

Query  1170  ELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANA  991
             ELR+L++H+++NRI I+NCGAI  LV+LLHS D   QENAVT LLNLS++DNNK AIA+A
Sbjct  697   ELRILSRHSLENRIAIANCGAIPFLVSLLHSTDPSTQENAVTILLNLSLDDNNKIAIASA  756

Query  990   GAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKK  811
              AIEPLI+VL+ G+PEAK NSAATLFSLSVIE+NKIKIGRSGA++ LVDLLG GTP+GKK
Sbjct  757   EAIEPLIFVLQVGNPEAKANSAATLFSLSVIEENKIKIGRSGAIEPLVDLLGEGTPQGKK  816

Query  810   DAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIG  631
             DAATALFNLSI HE+K RIVQAGAV HLVELMDPAAGMVDKAVAVL+NLAT+ +GR +I 
Sbjct  817   DAATALFNLSIFHEHKTRIVQAGAVNHLVELMDPAAGMVDKAVAVLANLATVHDGRNAIA  876

Query  630   QEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPR  451
             Q GGI +LVEVVELGSAR KENAAAALLQLCTNS+R+C +VLQ G VPPLVALSQSGT R
Sbjct  877   QAGGIRVLVEVVELGSARSKENAAAALLQLCTNSNRFCTLVLQEGVVPPLVALSQSGTAR  936

Query  450   AREKAQALLSYFRNQRHGNAGRG  382
             AREKAQ LLSYFRNQRH   GRG
Sbjct  937   AREKAQVLLSYFRNQRHVRVGRG  959


 Score =   233 bits (595),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 192/324 (59%), Gaps = 27/324 (8%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSG  2674
             LL++IS+F  LSS     +ELV KY Q  + IL  L+  L+     +I  D  L KV   
Sbjct  171   LLDSISNFRVLSSSNASKTELVKKYCQTMDGILDHLEVALNRAF-PQITPDGELSKVLEE  229

Query  2673  LGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLT  2494
             LG +++E  EL   W  + SK+YFV+QA+S+IAK++ +  ++ +++              
Sbjct  230   LGATINEATELVGGWNQMMSKIYFVIQADSIIAKMQIYVFELCQIV--------------  275

Query  2493  SLENCVLKIKSMDYELLSATITKAIKNHV-EGSGA-------SSDSLTKIADCLSLKSNQ  2338
                N +++I+SM  E L       I + + E S A       +S+   KI   LSL +NQ
Sbjct  276   ---NSLMQIESMHLEDLEHDSCGKISDVIREASRALAGEVMPNSEEFGKIQTTLSLSTNQ  332

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL+E VAL K+K      +  E  + I  I+ LV HM D  +  KQ+ S   V IPADF
Sbjct  333   ELLMEYVALVKVKTKGNHEDNKEMDD-INDIVELVNHMLDKHVEEKQTRSINGVTIPADF  391

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELM+DPVIVASGQTYE  FIR+W DLG  +CPKTRQ L HT LIPN+TVK LI 
Sbjct  392   CCPLSLELMSDPVIVASGQTYEHVFIRKWFDLGYNICPKTRQILGHTKLIPNFTVKQLIE  451

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSS  1906
             NWCE++ I LPDP+K L++  P S
Sbjct  452   NWCEVHGIMLPDPVKLLSLCFPVS  475



>gb|EMT06745.1| U-box domain-containing protein 4 [Aegilops tauschii]
Length=607

 Score =   439 bits (1130),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 219/319 (69%), Positives = 270/319 (85%), Gaps = 0/319 (0%)
 Frame = -2

Query  1347  TRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAE  1168
              R+R   + R+ S+R   RI SS +++ + DL+ ++ QV KL++DL+S  ++ QR AT+E
Sbjct  276   VRMRGQFVRRQTSDRGFPRITSSSSMDAQGDLSAIENQVHKLIDDLRSDFIEGQRSATSE  335

Query  1167  LRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAG  988
             +RLLAKHNM++RIV++NCGAI+LLV LLHS D ++QENAVTALLNLSI+DNN+ AI NA 
Sbjct  336   IRLLAKHNMESRIVLANCGAINLLVGLLHSPDAKIQENAVTALLNLSISDNNRIAIVNAD  395

Query  987   AIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKD  808
             A++PLI+VLETG+PEAKENSAATL SL VI++NK+++GRSGAV+ LVDLL +GTP+GKKD
Sbjct  396   AVDPLIHVLETGNPEAKENSAATLSSLLVIKENKVRVGRSGAVKPLVDLLVSGTPQGKKD  455

Query  807   AATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQ  628
             AA ALF LSILHENKGRIVQA AV+ LV+LMDPA GM DKAVAVL+NLA I EGR +I +
Sbjct  456   AAIALFYLSILHENKGRIVQADAVKQLVKLMDPALGMTDKAVAVLANLAMIPEGRTAIWE  515

Query  627   EGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRA  448
               GI  LVEVVELGS RGKENAAAALLQLCTNS+RYC++VL+ GAVPPL  LSQSGTPRA
Sbjct  516   TRGIRALVEVVELGSPRGKENAAAALLQLCTNSNRYCSLVLKEGAVPPLATLSQSGTPRA  575

Query  447   REKAQALLSYFRNQRHGNA  391
             REKAQAL+SYFR+ RHGN+
Sbjct  576   REKAQALISYFRSLRHGNS  594



>gb|EMT05611.1| U-box domain-containing protein 4 [Aegilops tauschii]
Length=685

 Score =   435 bits (1118),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 235/351 (67%), Positives = 286/351 (81%), Gaps = 3/351 (1%)
 Frame = -2

Query  1461  SSPTTASTEASMEVASESRHAATLAASRRESEFPSPVG-TRLRPPAIWRRPSERLVSRIV  1285
             S  T  S +AS EVA   R  +  +A +RE+     +G   +  P + R+ S+R   RI+
Sbjct  82    SDRTNYSGDASGEVAD--RELSVSSAPQRENVILPRLGDVCMEGPFVRRQTSDRGFPRII  139

Query  1284  SSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAI  1105
             SS +++ R D + ++ QVR+L+ DL S S++ QR AT+E+RLLAKHNM+NRIVI+NCGAI
Sbjct  140   SSSSMDARGDFSAIENQVRELINDLGSDSIEGQRSATSEIRLLAKHNMENRIVIANCGAI  199

Query  1104  SLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSA  925
             +LLV LLHS D ++QENAVTALLNLS++D NK AI NA A++PL++VLETG+PEAKENSA
Sbjct  200   NLLVGLLHSPDAKIQENAVTALLNLSLSDINKIAIVNADAVDPLVHVLETGNPEAKENSA  259

Query  924   ATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA  745
             ATLFSLS IEDN+ +IG+SGAV+ LVDLLGNG+PRGKKDA TALFNLSIL+ENKGRIVQA
Sbjct  260   ATLFSLSFIEDNRARIGQSGAVKPLVDLLGNGSPRGKKDAVTALFNLSILNENKGRIVQA  319

Query  744   GAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKEN  565
              A+RHLVELMDPAAGMVDKAVAVL+NLATIQEGR +IGQ  GIP LVEVVELGSA+ KEN
Sbjct  320   DALRHLVELMDPAAGMVDKAVAVLANLATIQEGRTAIGQARGIPALVEVVELGSAKAKEN  379

Query  564   AAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFR  412
             AAAALLQLCTNS+R+CN+VLQ  AVPPLVALSQSGTPRAREK   ++  +R
Sbjct  380   AAAALLQLCTNSNRFCNIVLQEDAVPPLVALSQSGTPRAREKMMVIVVDWR  430



>ref|XP_008238487.1| PREDICTED: U-box domain-containing protein 4-like [Prunus mume]
Length=307

 Score =   421 bits (1082),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 223/303 (74%), Positives = 249/303 (82%), Gaps = 2/303 (1%)
 Frame = -2

Query  1320  RRPSERLVSRIVSSPTVETRADLAEVKE-QVRKLVEDLKSTSVDQQRIATAELRLLAKHN  1144
             RR S  LV +  SSP  ETR D + + E QV  LVEDLKSTS D QR AT ELRLLAK +
Sbjct  4     RRASGSLVPK-TSSPASETRVDNSGLIEAQVGNLVEDLKSTSFDAQRDATFELRLLAKQS  62

Query  1143  MDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYV  964
             M+NRIVI+NCGAISLLV+LL S D  VQENAVT LLNLSIN  NK  I  A AIEPLI+V
Sbjct  63    MENRIVIANCGAISLLVDLLRSTDKRVQENAVTTLLNLSINVENKIEITAANAIEPLIHV  122

Query  963   LETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNL  784
             LETG  EAKENSAATLFSLSVIEDNK++IGRSGA+  LVDLLGNGTPRG+KDA TALF+L
Sbjct  123   LETGGAEAKENSAATLFSLSVIEDNKVRIGRSGAIGPLVDLLGNGTPRGRKDATTALFSL  182

Query  783   SILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILV  604
             SI HEN+  IVQAGA+++LVELMDPAAG+VDKAVAVL+NL+TI EG+ +IGQEGGIP LV
Sbjct  183   SIFHENRRPIVQAGAIKYLVELMDPAAGLVDKAVAVLANLSTIPEGKTAIGQEGGIPGLV  242

Query  603   EVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALL  424
             E VELGSARGKE+AAAALLQLCT+S RY  MV Q GAVPPLV LSQ GTPRA+ KAQ+LL
Sbjct  243   EAVELGSARGKEHAAAALLQLCTSSDRYRRMVQQEGAVPPLVVLSQYGTPRAQRKAQSLL  302

Query  423   SYF  415
             S  
Sbjct  303   SVL  305


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 60/121 (50%), Gaps = 2/121 (2%)
 Frame = -2

Query  1140  DNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVL  961
             +NR  I   GAI  LV L+      V + AV  L NLS     K+AI   G I  L+  +
Sbjct  187   ENRRPIVQAGAIKYLVELMDPAAGLV-DKAVAVLANLSTIPEGKTAIGQEGGIPGLVEAV  245

Query  960   ETGSPEAKENSAATLFSLSVIEDNKIK-IGRSGAVQSLVDLLGNGTPRGKKDAATALFNL  784
             E GS   KE++AA L  L    D   + + + GAV  LV L   GTPR ++ A + L  L
Sbjct  246   ELGSARGKEHAAAALLQLCTSSDRYRRMVQQEGAVPPLVVLSQYGTPRAQRKAQSLLSVL  305

Query  783   S  781
             S
Sbjct  306   S  306



>ref|XP_007206789.1| hypothetical protein PRUPE_ppa026658mg, partial [Prunus persica]
 gb|EMJ07988.1| hypothetical protein PRUPE_ppa026658mg, partial [Prunus persica]
Length=382

 Score =   422 bits (1084),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 220/300 (73%), Positives = 251/300 (84%), Gaps = 2/300 (1%)
 Frame = -2

Query  1320  RRPSERLVSRIVSSPTVETRADLAEVKE-QVRKLVEDLKSTSVDQQRIATAELRLLAKHN  1144
             RR S  LV +  SSP +ETR D + + E QV  LVEDLK TS D QR AT ELRLLAK +
Sbjct  79    RRASGSLVPQ-TSSPAIETRVDNSGLIEAQVGNLVEDLKGTSFDAQRDATFELRLLAKQS  137

Query  1143  MDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYV  964
             M+NRIVI+NCGAISLLV+LL S D  VQENAVT LLNLSIN  NK+ I  A AIEPLI+V
Sbjct  138   MENRIVIANCGAISLLVDLLRSTDKRVQENAVTTLLNLSINVENKTEITAANAIEPLIHV  197

Query  963   LETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNL  784
             LETG  EAKENSAATLFSLSVIEDNK++IGRSGA+  LVDLLGNGTPRG+KDAATALF+L
Sbjct  198   LETGGAEAKENSAATLFSLSVIEDNKVRIGRSGAIGPLVDLLGNGTPRGRKDAATALFSL  257

Query  783   SILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILV  604
             SI HEN+  IVQAGA+++LVELMDPAAG+VDK VAVL+NL+TI EG+ +IGQEGGIP LV
Sbjct  258   SIFHENRRPIVQAGAIKYLVELMDPAAGLVDKVVAVLANLSTIPEGKTAIGQEGGIPGLV  317

Query  603   EVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALL  424
             E VELGSA+GKE+AAAALLQLCT+S RYC MV Q GAVPPLV LSQ GTPRA++KA++LL
Sbjct  318   EAVELGSAKGKEHAAAALLQLCTSSDRYCRMVQQEGAVPPLVVLSQYGTPRAQKKAESLL  377


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 65/134 (49%), Gaps = 4/134 (3%)
 Frame = -2

Query  1179  ATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAI  1000
             ATA   L   H  +NR  I   GAI  LV L+      V +  V  L NLS     K+AI
Sbjct  251   ATALFSLSIFH--ENRRPIVQAGAIKYLVELMDPAAGLV-DKVVAVLANLSTIPEGKTAI  307

Query  999   ANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIK-IGRSGAVQSLVDLLGNGTP  823
                G I  L+  +E GS + KE++AA L  L    D   + + + GAV  LV L   GTP
Sbjct  308   GQEGGIPGLVEAVELGSAKGKEHAAAALLQLCTSSDRYCRMVQQEGAVPPLVVLSQYGTP  367

Query  822   RGKKDAATALFNLS  781
             R +K A + L  LS
Sbjct  368   RAQKKAESLLRVLS  381



>gb|KHN08833.1| U-box domain-containing protein 4 [Glycine soja]
Length=254

 Score =   411 bits (1057),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 201/253 (79%), Positives = 231/253 (91%), Gaps = 0/253 (0%)
 Frame = -2

Query  1143  MDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYV  964
             MDNRIVISNCGAISL+V+LL S D  +QE++VT LLNLSINDNNK+AIANAGAIEPLI+V
Sbjct  1     MDNRIVISNCGAISLIVDLLQSTDTTIQEHSVTTLLNLSINDNNKAAIANAGAIEPLIHV  60

Query  963   LETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNL  784
             L+ GSPEAKENSAATLFSLSV E+NKI+IGR+GA++ LVDLLGNGTPRGKKDAATALFNL
Sbjct  61    LQIGSPEAKENSAATLFSLSVTEENKIRIGRAGAIRPLVDLLGNGTPRGKKDAATALFNL  120

Query  783   SILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILV  604
             S+ HENK RIVQAGAV++LV+LMD AAGMVDK VAVL+NLATI EG+ +IGQ+GGIP+LV
Sbjct  121   SLFHENKDRIVQAGAVKNLVDLMDLAAGMVDKVVAVLANLATIPEGKTAIGQQGGIPVLV  180

Query  603   EVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALL  424
             EV+E GSARGKENAAAALL LC+++ RY  MVLQ GAVPPLVALSQSGTPRA+EKA ALL
Sbjct  181   EVIESGSARGKENAAAALLHLCSDNHRYLTMVLQEGAVPPLVALSQSGTPRAKEKALALL  240

Query  423   SYFRNQRHGNAGR  385
             + FR+QRHG+AGR
Sbjct  241   NQFRSQRHGSAGR  253



>ref|XP_006596458.1| PREDICTED: U-box domain-containing protein 4-like, partial [Glycine 
max]
Length=335

 Score =   407 bits (1046),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 203/258 (79%), Positives = 231/258 (90%), Gaps = 0/258 (0%)
 Frame = -2

Query  1233  VRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQEN  1054
             VRKL+E LK  SV  +R ATAEL LLAK NMDNRIVISNCGAISL+V+LL S D  +QE+
Sbjct  68    VRKLLEQLKCDSVHCKREATAELHLLAKENMDNRIVISNCGAISLIVDLLQSTDTTIQEH  127

Query  1053  AVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIG  874
             +VT LLNLSINDNNK+AIANAGAIEPLI+VL+ GSPEAKENSAATLFSLSV E+NKI+IG
Sbjct  128   SVTTLLNLSINDNNKAAIANAGAIEPLIHVLQIGSPEAKENSAATLFSLSVTEENKIRIG  187

Query  873   RSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMV  694
             R+GA++ LVDLLGNGTPRGKKDAATALFNLS+ HENK RIVQAGAV++LV+LMD AAGMV
Sbjct  188   RAGAIRPLVDLLGNGTPRGKKDAATALFNLSLFHENKDRIVQAGAVKNLVDLMDLAAGMV  247

Query  693   DKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCN  514
             DK VAVL+NLATI EG+ +IGQ+GGIP+LVEV+E GSARGKENAAAALL LC+++ RY N
Sbjct  248   DKVVAVLANLATIPEGKTAIGQQGGIPVLVEVIESGSARGKENAAAALLHLCSDNHRYLN  307

Query  513   MVLQHGAVPPLVALSQSG  460
             MVLQ GAVPPLVALSQSG
Sbjct  308   MVLQEGAVPPLVALSQSG  325



>gb|EMS49590.1| U-box domain-containing protein 4 [Triticum urartu]
Length=1215

 Score =   431 bits (1108),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 223/347 (64%), Positives = 276/347 (80%), Gaps = 32/347 (9%)
 Frame = -2

Query  1347  TRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAE  1168
              R+R   + R+ S+R    I+SS ++++R DL+ ++ QVRKL++DL+S S++ QR AT+E
Sbjct  860   VRMRGQFVRRQTSDR----IISSSSMDSRGDLSAIENQVRKLIDDLRSDSIEGQRSATSE  915

Query  1167  LRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAG  988
             +RLLAKHNM+NRIVI++CGAI+LLV LLHS D ++QENAVT+LLNLSI+DNNK AI NA 
Sbjct  916   IRLLAKHNMENRIVIADCGAINLLVGLLHSPDAKIQENAVTSLLNLSISDNNKIAIVNAY  975

Query  987   AIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKD  808
             AI+PLI+VLETG+PEAKENSAATL SLSVI++NK+++GRSGAV+ LVDLL +GTP+GK+D
Sbjct  976   AIDPLIHVLETGNPEAKENSAATLSSLSVIKENKVRVGRSGAVKPLVDLLVSGTPQGKRD  1035

Query  807   AATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQ  628
             AA AL  LSI+HENKG IVQA AV+ LV+LMDPA GM+DKAVAVL+NLA I EGR +IG+
Sbjct  1036  AAIALSYLSIIHENKGHIVQADAVKQLVKLMDPALGMIDKAVAVLANLAMIPEGRTAIGE  1095

Query  627   EGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRA  448
               GIP LVEVVELGS RGKENAAAALLQLCTNSSRYC++VL+ GAVPPLV LSQSGT RA
Sbjct  1096  TRGIPALVEVVELGSPRGKENAAAALLQLCTNSSRYCSVVLKEGAVPPLVTLSQSGTLRA  1155

Query  447   RE----------------------------KAQALLSYFRNQRHGNA  391
             RE                            +AQALLSYFR+QRHG++
Sbjct  1156  RETVCHFLQQNLHLEENHLQNHFAKNMYLLQAQALLSYFRSQRHGSS  1202



>emb|CBI37127.3| unnamed protein product [Vitis vinifera]
Length=615

 Score =   413 bits (1062),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 210/304 (69%), Positives = 250/304 (82%), Gaps = 0/304 (0%)
 Frame = -2

Query  1293  RIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNC  1114
             RI+S P  + + D       V KLVEDLKS S + Q +A +ELRLLAKHNM+NRI+I  C
Sbjct  310   RILSLPFSDPKFDDLTTSSHVEKLVEDLKSQSNELQTVAASELRLLAKHNMENRIIIGRC  369

Query  1113  GAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKE  934
             GAI+ LV LL+SE  + QENAVTALLNLSIND NK  IA AGAIE LI+VL++G+  AKE
Sbjct  370   GAIAPLVLLLYSEVKQTQENAVTALLNLSINDANKVIIAEAGAIESLIHVLKSGNAGAKE  429

Query  933   NSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRI  754
             NSAATLFSLSV+E+ K KIG SGAV++LVDLLG+GT RGKKDAATALFNLSI HENK RI
Sbjct  430   NSAATLFSLSVLEEYKAKIGCSGAVKALVDLLGSGTLRGKKDAATALFNLSICHENKPRI  489

Query  753   VQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARG  574
             +QAGAV++LV+LM+PA GMVDKAVA+L+NL+ I EGR +I +EGGIP+LVE+VE GS RG
Sbjct  490   IQAGAVKYLVQLMEPATGMVDKAVALLANLSIISEGRFAIVREGGIPLLVELVETGSVRG  549

Query  573   KENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGN  394
             KENAA+ LLQLC NS ++C +VLQ GA+PPLVALSQSGTPRA+EKAQ LLS+FRNQR G 
Sbjct  550   KENAASILLQLCINSPKFCTLVLQEGAIPPLVALSQSGTPRAKEKAQQLLSHFRNQREGA  609

Query  393   AGRG  382
             A +G
Sbjct  610   AAKG  613


 Score =   207 bits (526),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 119/316 (38%), Positives = 179/316 (57%), Gaps = 47/316 (15%)
 Frame = -2

Query  2760  ILKLLQPILSGIVDAEIASDELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESL  2581
             +LKLL+P+L  +V+ +I SDE+L K    L  +V+E RE  + W    SK++ VLQ+E L
Sbjct  4     LLKLLKPVLDDVVNCKIPSDEILFKECEELDMAVNEAREFVENWCPKMSKIFSVLQSEQL  63

Query  2580  IAKVRAFSLKIVELLVSSDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEG  2401
             + K+++ SL+I  +L       P+ S+LTS+++C+ K++ ++ + +S  I +A++ +   
Sbjct  64    VMKIQSSSLEICFILCRLLHSSPSVSNLTSIQHCMQKLQHLEQKRISEYIEQALRTY---  120

Query  2400  SGASSDSLTKIADCLSLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMH  2221
                                      EL                   + I QI+ LV+H+ 
Sbjct  121   -------------------------EL-------------------DQINQIVELVSHIR  136

Query  2220  DCLIMMKQSESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPK  2041
             DC++ +   E+   V+IP+ F CPLSLELM DPVIVASGQTYER+ I++W+D GL +CPK
Sbjct  137   DCMVRLGGFEAINGVRIPSYFRCPLSLELMMDPVIVASGQTYERSSIQKWLDQGLMICPK  196

Query  2040  TRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHI  1861
             TRQTL H NLIPNYTVKALI NWCE NNI L    +  N+    S + HV +     +  
Sbjct  197   TRQTLAHANLIPNYTVKALIENWCEENNITLSGTSEHTNITPVPSPLDHVSAQDVIGMDS  256

Query  1860  FSHSRANNSTSPDSAH  1813
             F  +  + S +P ++H
Sbjct  257   FLGNLKSWSDNPLNSH  272



>ref|XP_002456752.1| hypothetical protein SORBIDRAFT_03g041930 [Sorghum bicolor]
 gb|EES01872.1| hypothetical protein SORBIDRAFT_03g041930 [Sorghum bicolor]
Length=805

 Score =   419 bits (1078),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 222/345 (64%), Positives = 271/345 (79%), Gaps = 7/345 (2%)
 Frame = -2

Query  1434  ASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRAD  1255
             +S  +ASE+      A   + +  P   G R R   +W++ S++ V        +++R+D
Sbjct  461   SSNSIASETTRNGPTATFSKPNWLPRLGGVRSRNHLVWQQQSDKAVP-------MDSRSD  513

Query  1254  LAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSE  1075
              A    +V KL+EDLK+   D QR A  EL +L++H+M+NRI I+NCGAI  LVNLL+S 
Sbjct  514   FASADNKVCKLIEDLKNECTDLQRAAIGELLVLSRHSMENRIAIANCGAIPFLVNLLYSA  573

Query  1074  DMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIE  895
             D  +QENAVT LLNLS++DNNK  IA+A AI+PLI+VLETG+PEA+ NSAATLFSLSV E
Sbjct  574   DPSMQENAVTVLLNLSLDDNNKITIASADAIKPLIHVLETGNPEARANSAATLFSLSVNE  633

Query  894   DNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELM  715
             DNK +IGRSGA++ LVDLL +G+ +GKKDAATALFNLSI HENK RIV+AGAV+HLVELM
Sbjct  634   DNKARIGRSGAIKPLVDLLQDGSAQGKKDAATALFNLSIFHENKARIVEAGAVKHLVELM  693

Query  714   DPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCT  535
             DPAAGMVDKAVAVL+ LAT+QEGR  I Q GGIP+LVEVVELGSAR KE+AAAALLQLCT
Sbjct  694   DPAAGMVDKAVAVLAILATVQEGRSGIAQAGGIPVLVEVVELGSARAKEHAAAALLQLCT  753

Query  534   NSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRH  400
             N+SR+C++VLQ GA+PPLVALSQSGT RAREKAQ LLSYFRNQR 
Sbjct  754   NNSRFCSLVLQEGAMPPLVALSQSGTARAREKAQVLLSYFRNQRQ  798


 Score =   233 bits (595),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 134/307 (44%), Positives = 198/307 (64%), Gaps = 6/307 (2%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSG  2674
             ++++IS+F  LS+   + +ELV +Y +K ++IL LL+ +L  ++  +I  D+    +   
Sbjct  9     IISSISNFRTLSTSSVVETELVKRYCRKIDEILGLLKLVLDEVL-PQITLDDRKILLLEE  67

Query  2673  LGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLT  2494
             L  ++++  +L  +W L+ SK+YFV+Q ESLI K++ + L++ +++ S     P E++  
Sbjct  68    LDATINDAIKLVGSWDLMMSKIYFVMQVESLITKMQNYVLEVCQVVNSE--VTPPETNCV  125

Query  2493  SLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELVa  2314
             S+   + KIK    E +   I +A ++ V+     S++LT I   LSL +NQELL+E VA
Sbjct  126   SV--YLEKIKQFQCEKIMGIIKEASRDLVKKFMPKSETLTNIQVSLSLSTNQELLMEAVA  183

Query  2313  leklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLEL  2134
             L K++      + +E    I  I  LV HM +  +  KQ  S   V IPADFCCPLSLEL
Sbjct  184   LAKIRTRVSAEDSSELDG-INHISELVNHMLEKHVEEKQMHSINGVPIPADFCCPLSLEL  242

Query  2133  MTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNI  1954
             M+DPVIVA+GQTYER FIR+W+DLG  VCPKTRQTL H+NLIPNYTVK LI NW E++ +
Sbjct  243   MSDPVIVATGQTYERVFIRKWLDLGYNVCPKTRQTLGHSNLIPNYTVKQLIENWSEIHGV  302

Query  1953  KLPDPIK  1933
              LPDP+K
Sbjct  303   VLPDPVK  309



>ref|XP_010550344.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
2 [Tarenaya hassleriana]
Length=764

 Score =   416 bits (1070),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 224/359 (62%), Positives = 278/359 (77%), Gaps = 19/359 (5%)
 Frame = -2

Query  1449  TASTEASMEV---ASESRHAATLAASRRE-SEFPSPVGTRLRPPAIWRRPSERLVSRIVS  1282
             +A+ E S EV   A+ES  AA    S+RE SE      +R++   I R PS R    I+S
Sbjct  420   SATDEVSDEVPGMATESGTAAGAENSQREHSEL-----SRVQIQTIQRNPSRRRFPGIIS  474

Query  1281  SPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAIS  1102
             +   ET    + ++ +V+KLVEDLKS S++ QR ATA +R+L++++ DNRIVI+ CGAIS
Sbjct  475   ATITETGTG-SSIETEVKKLVEDLKSPSLETQREATARIRMLSRNSTDNRIVIAKCGAIS  533

Query  1101  LLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAA  922
             LLV+LL+S D ++QE+AVTALLN SINDNNK  I+ AGAIEPLI+VL+TG+PEAKENSAA
Sbjct  534   LLVDLLNSTDAKIQEDAVTALLNSSINDNNKLVISEAGAIEPLIHVLKTGTPEAKENSAA  593

Query  921   TLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAG  742
             TLFSLSVIE+NKIKIGR+GA++ LV+LLG G+ RGKKDAATALF+LS  HENK  IVQAG
Sbjct  594   TLFSLSVIEENKIKIGRAGAIEPLVELLGEGSLRGKKDAATALFSLSKQHENKAWIVQAG  653

Query  741   AVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENA  562
             AVRHLVELMDP  GMV+KA+ VL+NLATI+EG+++IGQEGGIP+LVEVVELGSARGKE  
Sbjct  654   AVRHLVELMDPGTGMVEKALVVLANLATIKEGKVAIGQEGGIPVLVEVVELGSARGKEX-  712

Query  561   AAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
                      +S R+CN V+Q GA+PPLVAL+++GT RAREKA  LL YFR QR GN GR
Sbjct  713   --------MHSPRFCNSVIQEGAIPPLVALTRTGTARAREKAHNLLRYFRTQRQGNHGR  763


 Score =   322 bits (824),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 186/359 (52%), Positives = 251/359 (70%), Gaps = 10/359 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  L+ LL+NISSF  LSSL+NINS+   KYY K E++ K+L+PILS + D++ AS+E
Sbjct  4     MEMSWLRSLLDNISSFLSLSSLDNINSDPARKYYAKGEEVAKILKPILSALFDSDAASNE  63

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL   F  L   VDELRELFQ+WQ LSS++Y VLQ ESL++KVR  S+++ +LL   +  
Sbjct  64    LLNNGFEELAQYVDELRELFQSWQPLSSRLYSVLQIESLVSKVRESSMEVFQLLTHFEQQ  123

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP E SL+S+E+C+  IK M  E++ +TI +A+K+  +G G +++ L KIA  L LKSNQ
Sbjct  124   LPDELSLSSVEHCLEMIKKMGNEVMYSTIHQALKDQGDGIGPTAEVLAKIAKNLGLKSNQ  183

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE V LE +KENAEQ EKN E E+++++I+LV  MHD L  +KQS+  + V++P DF
Sbjct  184   EILIEAVVLESMKENAEQGEKNSEAEFLDRLISLVNRMHDYLTKVKQSQMGSPVRVPPDF  243

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMT+PVIV+SGQTYER FI+ W+D+GL VCP+TRQ L+HT L PN+ VKA I 
Sbjct  244   CCPLSLELMTNPVIVSSGQTYERVFIQNWLDMGLMVCPRTRQVLSHTILTPNFIVKAFIT  303

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHV---DSGAPRDIHIFSHSRANNSTSPDSAHG  1810
             +WCE NN+K  DP++    +Q    +A     DSG        SH   N+S   D   G
Sbjct  304   SWCESNNVKPLDPLELFRSSQQFLLLAETCVDDSGN-------SHVTPNDSLYSDGPSG  355



>ref|XP_007201804.1| hypothetical protein PRUPE_ppa001702mg [Prunus persica]
 gb|EMJ03003.1| hypothetical protein PRUPE_ppa001702mg [Prunus persica]
Length=777

 Score =   416 bits (1069),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 224/393 (57%), Positives = 288/393 (73%), Gaps = 10/393 (3%)
 Frame = -2

Query  1542  HNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVASESRHAATLAASRRESEF  1363
             H+R+ SA S +S+++++       + +S+      E S E+ SE   A+T     +ES  
Sbjct  388   HSRSESATSAVSSNDYAPPAFIKVSGISNKHENVNELSGEITSEHPVAST---PNKESAM  444

Query  1362  PSPVG------TRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKST  1201
             PS +       ++++    W   S     R    P   + +D       V KL+EDLKS 
Sbjct  445   PSRLSGKHSLISKIKAEGTWTD-SPIYPDRHQLLPFSSSGSDELTTSSHVTKLIEDLKSQ  503

Query  1200  SVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSIN  1021
             S++ Q +A  ELRLLAKHNM+NR +I  CGAI+ LV+LL+S  M  QE+AVTALLNLSIN
Sbjct  504   SIEVQTLAAEELRLLAKHNMNNRTIIGQCGAITPLVSLLYSGVMLTQEHAVTALLNLSIN  563

Query  1020  DNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDL  841
             ++NK+ IA AGAI+PLI+VL+ G+  AKENSAA LFSLSV+++ K KIGRSGAV++LVDL
Sbjct  564   EDNKAMIAEAGAIDPLIHVLKMGNDGAKENSAAALFSLSVLDEYKAKIGRSGAVKALVDL  623

Query  840   LGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLA  661
             LG+GT RGKKDAATALFNLSI HENK R+VQAGAV++L+ELMDP  GMVDKAVA+L+NL+
Sbjct  624   LGSGTLRGKKDAATALFNLSIYHENKARLVQAGAVKYLIELMDPDTGMVDKAVALLANLS  683

Query  660   TIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPL  481
             TI EGR++I +EGGIP+LVE+VE GS RGKENAA+ LLQLC +S ++C +VLQ GAVPPL
Sbjct  684   TIGEGRVAIAREGGIPLLVEIVETGSQRGKENAASILLQLCLHSPKFCTLVLQEGAVPPL  743

Query  480   VALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VALSQSGTPRA+EKAQ LLS+FRNQR G  G+G
Sbjct  744   VALSQSGTPRAKEKAQQLLSHFRNQREGAMGKG  776


 Score =   228 bits (582),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 138/341 (40%), Positives = 214/341 (63%), Gaps = 8/341 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M++  +K L+N+IS F HL S +   S  + K Y+   D+LKLL+P+L  +VD +I SDE
Sbjct  1     MDMASIKCLINSISRFVHLVSSQRSKSMPIQKDYRTIVDVLKLLKPLLDEVVDYKIPSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K    L  +V+  RE  + W    SK+    + E L+  +++ SLKI  +L      
Sbjct  61    ILYKECEELDMAVNGAREFMENWSPKLSKILSAWRGEPLLITIQSSSLKICSILSRLLQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
               + SSL  L++C+ +I+ +  E ++  + +A+K+  + +  S+  L KI + LSL SNQ
Sbjct  121   SSSGSSLIGLQHCMQEIRCLKQERVTEYLEEALKSQRKDTMPSTKHLMKIIELLSLSSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +A+EK + N E ++   E++ I QI+ LV+H+ + ++ ++  E+ + + IP+ F
Sbjct  181   ELLKESIAVEKERMNVEVSDVRGELDQINQIVILVSHIREFMVKIEHLETASGIPIPSYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLS ELM DPVIVASGQT+ER+ I++W+D GLT+CPKTR  L+H NLI NYTVKA+I 
Sbjct  241   RCPLSSELMLDPVIVASGQTFERSSIQKWLDHGLTICPKTRHRLSHINLITNYTVKAMIE  300

Query  1977  NWCEMNNIKLP---DPIKSLNVNQPSSHVA-----HVDSGA  1879
             +WC+ N+IKLP   D   +++V  PS  V+     H DS +
Sbjct  301   SWCQENDIKLPTNSDGSNAISVPSPSDRVSPEGSIHTDSNS  341



>ref|XP_008235668.1| PREDICTED: U-box domain-containing protein 3 isoform X2 [Prunus 
mume]
Length=777

 Score =   415 bits (1067),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 224/393 (57%), Positives = 289/393 (74%), Gaps = 10/393 (3%)
 Frame = -2

Query  1542  HNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVASESRHAATLAASRRESEF  1363
             H+R+ SA S +S+++++       + +S+      E S E+ SE   A+T     +ES  
Sbjct  388   HSRSESATSAVSSNDYAPPAFIKVSGISNKHENVNELSGEITSEHPVAST---PNKESAM  444

Query  1362  PSPVG------TRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKST  1201
             PS +       ++++    W   S    +R    P   + +D       V KL+EDLKS 
Sbjct  445   PSRLSGKHSLISKIKAEGTWTD-SPIYPNRHQLLPFSSSGSDELTTSSHVTKLIEDLKSQ  503

Query  1200  SVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSIN  1021
             S + Q +A  ELRLLAKHNM+NR +I  CGAI+ LV+LL+S  M  QE+AVTALLNLSIN
Sbjct  504   SNEVQTLAAEELRLLAKHNMNNRTIIGQCGAITPLVSLLYSGVMLTQEHAVTALLNLSIN  563

Query  1020  DNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDL  841
             ++NK+ IA AGAI+PLI+VL+TG+  AKENSAA LFSLSV+++ K KIGRSGAV++LVDL
Sbjct  564   EDNKAMIAEAGAIDPLIHVLKTGNDGAKENSAAALFSLSVLDEYKAKIGRSGAVKALVDL  623

Query  840   LGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLA  661
             LG+GT RGKKDAATALFNLSI HENK R+VQAGAV++L+ELMDP  GMVDKAVA+L+NL+
Sbjct  624   LGSGTLRGKKDAATALFNLSIYHENKARLVQAGAVKYLIELMDPDTGMVDKAVALLANLS  683

Query  660   TIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPL  481
             TI EGR++I +EGGIP+LVE+VE GS RGKENAA+ +LQLC +S ++C +VLQ GAVPPL
Sbjct  684   TIGEGRVAIAREGGIPLLVEIVETGSQRGKENAASIMLQLCLHSPKFCTLVLQEGAVPPL  743

Query  480   VALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VALSQSGTPRA+EKAQ LLS+FRNQR G  G+G
Sbjct  744   VALSQSGTPRAKEKAQQLLSHFRNQREGAMGKG  776


 Score =   226 bits (575),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 209/330 (63%), Gaps = 3/330 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M++  +K L+N+IS F HL S +      + K Y+   D+LKLL+P+L  +VD +I SDE
Sbjct  1     MDMASIKCLINSISRFVHLVSSQRSKPMPIQKDYKTIVDVLKLLKPLLDEVVDYKIPSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K    L  +V+  RE  + W    S++    + E L+  +++ SLKI  +L      
Sbjct  61    ILYKECEELDMAVNGAREFMENWSPKLSRILSAWRGEPLLITIQSSSLKICSVLSRLLQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
               + SSL  L++C+ +I+ +  E ++  + +A+K+  + +  S+  L KI + LSL SNQ
Sbjct  121   SSSGSSLIGLQHCMQEIRCLKQERVTEYLEEALKSQRKDTMPSTKHLMKIIELLSLSSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +A+EK + N E ++   E++ I Q++ LV+H+ + ++ ++  E+ + + IP+ F
Sbjct  181   ELLKESIAVEKERMNVEVSDVRGELDQINQMVILVSHIREFMVKIEHLETASGIPIPSYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLS ELM DPVIVASGQT+ER+ I++W+D GLT+CPKTR  L+H NLI NYTVKA+I 
Sbjct  241   RCPLSSELMLDPVIVASGQTFERSSIQKWLDHGLTICPKTRHRLSHINLITNYTVKAMIE  300

Query  1977  NWCEMNNIKLP---DPIKSLNVNQPSSHVA  1897
             +WC+ N+IKLP   D   +++V  PS  V+
Sbjct  301   SWCQENDIKLPTNSDGSNAISVPSPSDRVS  330



>ref|XP_010652375.1| PREDICTED: U-box domain-containing protein 3 [Vitis vinifera]
Length=801

 Score =   416 bits (1069),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 232/395 (59%), Positives = 287/395 (73%), Gaps = 16/395 (4%)
 Frame = -2

Query  1542  HNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVASESRHAATLAASRRESEF  1363
             H+RT S  S +S+ +     + + + +S+     T  S E+ SE  HA+    S R+ EF
Sbjct  413   HSRTESTSSAVSSIDSLPTASTELSRISNKQENGTGLSGEITSEC-HAS---PSNRDLEF  468

Query  1362  -PSPVGTRLRPPAIWRRPSERLVS-------RIVSSPTVETRADLAEVKEQVRKLVEDLK  1207
              P   G +        +    +VS       RI+S P  + + D       V KLVEDLK
Sbjct  469   SPWFSGKQFHS----SKTKVEMVSNGKCGPPRILSLPFSDPKFDDLTTSSHVEKLVEDLK  524

Query  1206  STSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLS  1027
             S S + Q +A +ELRLLAKHNM+NRI+I  CGAI+ LV LL+SE  + QENAVTALLNLS
Sbjct  525   SQSNELQTVAASELRLLAKHNMENRIIIGRCGAIAPLVLLLYSEVKQTQENAVTALLNLS  584

Query  1026  INDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLV  847
             IND NK  IA AGAIE LI+VL++G+  AKENSAATLFSLSV+E+ K KIG SGAV++LV
Sbjct  585   INDANKVIIAEAGAIESLIHVLKSGNAGAKENSAATLFSLSVLEEYKAKIGCSGAVKALV  644

Query  846   DLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSN  667
             DLLG+GT RGKKDAATALFNLSI HENK RI+QAGAV++LV+LM+PA GMVDKAVA+L+N
Sbjct  645   DLLGSGTLRGKKDAATALFNLSICHENKPRIIQAGAVKYLVQLMEPATGMVDKAVALLAN  704

Query  666   LATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVP  487
             L+ I EGR +I +EGGIP+LVE+VE GS RGKENAA+ LLQLC NS ++C +VLQ GA+P
Sbjct  705   LSIISEGRFAIVREGGIPLLVELVETGSVRGKENAASILLQLCINSPKFCTLVLQEGAIP  764

Query  486   PLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             PLVALSQSGTPRA+EKAQ LLS+FRNQR G A +G
Sbjct  765   PLVALSQSGTPRAKEKAQQLLSHFRNQREGAAAKG  799


 Score =   255 bits (652),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 142/333 (43%), Positives = 214/333 (64%), Gaps = 0/333 (0%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G M+   ++ L+N+IS F HL S + +    + K  +    +LKLL+P+L  +V+ +I S
Sbjct  13    GQMDTKSVRCLINSISRFIHLVSCQTLKPMPIQKDCRNMVGLLKLLKPVLDDVVNCKIPS  72

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             DE+L K    L  +V+E RE  + W    SK++ VLQ+E L+ K+++ SL+I  +L    
Sbjct  73    DEILFKECEELDMAVNEAREFVENWCPKMSKIFSVLQSEQLVMKIQSSSLEICFILCRLL  132

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
                P+ S+LTS+++C+ K++ ++ + +S  I +A+++  +     +  L KI + LSL S
Sbjct  133   HSSPSVSNLTSIQHCMQKLQHLEQKRISEYIEQALRSQRDEIIPHTQQLAKIIESLSLTS  192

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
              QELL E VA+E+ + NA+  +   E++ I QI+ LV+H+ DC++ +   E+   V+IP+
Sbjct  193   KQELLKESVAVERERMNAQVNKTAYELDQINQIVELVSHIRDCMVRLGGFEAINGVRIPS  252

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
              F CPLSLELM DPVIVASGQTYER+ I++W+D GL +CPKTRQTL H NLIPNYTVKAL
Sbjct  253   YFRCPLSLELMMDPVIVASGQTYERSSIQKWLDQGLMICPKTRQTLAHANLIPNYTVKAL  312

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDS  1885
             I NWCE NNI L    +  N+    S + HV +
Sbjct  313   IENWCEENNITLSGTSEHTNITPVPSPLDHVSA  345



>gb|KDO60475.1| hypothetical protein CISIN_1g004078mg [Citrus sinensis]
Length=732

 Score =   414 bits (1063),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 205/294 (70%), Positives = 248/294 (84%), Gaps = 0/294 (0%)
 Frame = -2

Query  1266  TRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNL  1087
             +R+D       V+KL+EDL STS + Q  A AELRLLAKHNM+NR++I NCGAI  L++L
Sbjct  436   SRSDEVTTTPYVKKLIEDLNSTSNEIQASAAAELRLLAKHNMENRMIIGNCGAIPPLLSL  495

Query  1086  LHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSL  907
             L+SE    QE+AVTALLNLSIND NK+ IA AGAIEPLI+VL++G+  AKENSAA LFSL
Sbjct  496   LYSEAQLTQEHAVTALLNLSINDENKAMIAEAGAIEPLIHVLKSGNGGAKENSAAALFSL  555

Query  906   SVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHL  727
             SV+E+ K KIGRSGAV++LVDLLG+GT RG+KDAATALFNLSI HENK RI+QAGAV+HL
Sbjct  556   SVLEEYKAKIGRSGAVKALVDLLGSGTLRGRKDAATALFNLSIFHENKARIIQAGAVKHL  615

Query  726   VELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALL  547
             V+LMDP+ GMVDKAVA+L+NL+T+ EGR++I +EGGIP LVEVVE GS RGKENAA+ LL
Sbjct  616   VDLMDPSTGMVDKAVALLANLSTVGEGRLAIAREGGIPSLVEVVESGSQRGKENAASILL  675

Query  546   QLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             QLC +S ++C +VLQ GAVPPLV LSQSGTPRA+EKAQ LLS+FRNQR G+ G+
Sbjct  676   QLCLHSPKFCTLVLQEGAVPPLVGLSQSGTPRAKEKAQQLLSHFRNQREGSTGK  729


 Score =   251 bits (641),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 145/347 (42%), Positives = 214/347 (62%), Gaps = 0/347 (0%)
 Frame = -2

Query  2859  KVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVF  2680
             + L+N+IS F HL S + I  + + K Y+     LKLL+P+L  +VD +I  DE+L K  
Sbjct  7     RCLINSISRFIHLVSCQTIKLKPIQKDYKTMAGALKLLKPLLDEVVDYKIPLDEVLNKEC  66

Query  2679  SGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESS  2500
               L   V+E RE  + W    SK++ VL +E L+ K+++ SL+I  +L       P+ SS
Sbjct  67    EELDMVVNEAREFMENWSPKMSKIFSVLHSEPLMMKIQSSSLEICHILYRLLQSSPSNSS  126

Query  2499  LTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIEL  2320
             ++++++C+ +I  +  E +   ITKA++   + +   +D L KI + L L SNQELL E 
Sbjct  127   MSAVQHCMQEIHCLKQERIMEHITKAMRGLQDDTIRCTDHLVKIIESLGLTSNQELLKES  186

Query  2319  ValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSL  2140
             +A+E  +  AE+ +     + +  I+ L++H+ DC++ +++ E+ + V IP  F CPLSL
Sbjct  187   LAVEMERIRAERNQNKGHSDQMNYIVDLISHIRDCMLKIERFEATSGVPIPPYFRCPLSL  246

Query  2139  ELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMN  1960
             ELM DPVIVASGQTYER FI++W+D GL +CPKTRQTL HTNLIPNYTVKA+I NWCE N
Sbjct  247   ELMIDPVIVASGQTYERVFIQKWLDHGLNICPKTRQTLAHTNLIPNYTVKAMIENWCEEN  306

Query  1959  NIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDS  1819
             N++LP      N+    S + HV +        F   R +NSTS  S
Sbjct  307   NLRLPSYSVHSNIVSVLSPLDHVSAQDLIRTDSFRSLRGSNSTSRSS  353



>ref|XP_008235667.1| PREDICTED: U-box domain-containing protein 3 isoform X1 [Prunus 
mume]
Length=791

 Score =   415 bits (1067),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 224/393 (57%), Positives = 289/393 (74%), Gaps = 10/393 (3%)
 Frame = -2

Query  1542  HNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVASESRHAATLAASRRESEF  1363
             H+R+ SA S +S+++++       + +S+      E S E+ SE   A+T     +ES  
Sbjct  402   HSRSESATSAVSSNDYAPPAFIKVSGISNKHENVNELSGEITSEHPVAST---PNKESAM  458

Query  1362  PSPVG------TRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKST  1201
             PS +       ++++    W   S    +R    P   + +D       V KL+EDLKS 
Sbjct  459   PSRLSGKHSLISKIKAEGTWTD-SPIYPNRHQLLPFSSSGSDELTTSSHVTKLIEDLKSQ  517

Query  1200  SVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSIN  1021
             S + Q +A  ELRLLAKHNM+NR +I  CGAI+ LV+LL+S  M  QE+AVTALLNLSIN
Sbjct  518   SNEVQTLAAEELRLLAKHNMNNRTIIGQCGAITPLVSLLYSGVMLTQEHAVTALLNLSIN  577

Query  1020  DNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDL  841
             ++NK+ IA AGAI+PLI+VL+TG+  AKENSAA LFSLSV+++ K KIGRSGAV++LVDL
Sbjct  578   EDNKAMIAEAGAIDPLIHVLKTGNDGAKENSAAALFSLSVLDEYKAKIGRSGAVKALVDL  637

Query  840   LGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLA  661
             LG+GT RGKKDAATALFNLSI HENK R+VQAGAV++L+ELMDP  GMVDKAVA+L+NL+
Sbjct  638   LGSGTLRGKKDAATALFNLSIYHENKARLVQAGAVKYLIELMDPDTGMVDKAVALLANLS  697

Query  660   TIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPL  481
             TI EGR++I +EGGIP+LVE+VE GS RGKENAA+ +LQLC +S ++C +VLQ GAVPPL
Sbjct  698   TIGEGRVAIAREGGIPLLVEIVETGSQRGKENAASIMLQLCLHSPKFCTLVLQEGAVPPL  757

Query  480   VALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VALSQSGTPRA+EKAQ LLS+FRNQR G  G+G
Sbjct  758   VALSQSGTPRAKEKAQQLLSHFRNQREGAMGKG  790


 Score =   228 bits (580),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 133/332 (40%), Positives = 210/332 (63%), Gaps = 3/332 (1%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G M++  +K L+N+IS F HL S +      + K Y+   D+LKLL+P+L  +VD +I S
Sbjct  13    GEMDMASIKCLINSISRFVHLVSSQRSKPMPIQKDYKTIVDVLKLLKPLLDEVVDYKIPS  72

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             DE+L K    L  +V+  RE  + W    S++    + E L+  +++ SLKI  +L    
Sbjct  73    DEILYKECEELDMAVNGAREFMENWSPKLSRILSAWRGEPLLITIQSSSLKICSVLSRLL  132

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
                 + SSL  L++C+ +I+ +  E ++  + +A+K+  + +  S+  L KI + LSL S
Sbjct  133   QSSSSGSSLIGLQHCMQEIRCLKQERVTEYLEEALKSQRKDTMPSTKHLMKIIELLSLSS  192

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQELL E +A+EK + N E ++   E++ I Q++ LV+H+ + ++ ++  E+ + + IP+
Sbjct  193   NQELLKESIAVEKERMNVEVSDVRGELDQINQMVILVSHIREFMVKIEHLETASGIPIPS  252

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
              F CPLS ELM DPVIVASGQT+ER+ I++W+D GLT+CPKTR  L+H NLI NYTVKA+
Sbjct  253   YFRCPLSSELMLDPVIVASGQTFERSSIQKWLDHGLTICPKTRHRLSHINLITNYTVKAM  312

Query  1983  IANWCEMNNIKLP---DPIKSLNVNQPSSHVA  1897
             I +WC+ N+IKLP   D   +++V  PS  V+
Sbjct  313   IESWCQENDIKLPTNSDGSNAISVPSPSDRVS  344



>ref|XP_006443826.1| hypothetical protein CICLE_v10018951mg [Citrus clementina]
 ref|XP_006443827.1| hypothetical protein CICLE_v10018951mg [Citrus clementina]
 ref|XP_006479529.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Citrus sinensis]
 ref|XP_006479530.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Citrus sinensis]
 gb|ESR57066.1| hypothetical protein CICLE_v10018951mg [Citrus clementina]
 gb|ESR57067.1| hypothetical protein CICLE_v10018951mg [Citrus clementina]
Length=775

 Score =   412 bits (1060),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 205/295 (69%), Positives = 248/295 (84%), Gaps = 0/295 (0%)
 Frame = -2

Query  1269  ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVN  1090
             E+ +D       V+KL+EDL STS + Q  A AELRLLAKHNM+NR++I NCGAI  L++
Sbjct  478   ESGSDEVTTTPYVKKLIEDLNSTSNEIQASAAAELRLLAKHNMENRMIIGNCGAIPPLLS  537

Query  1089  LLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFS  910
             LL+SE    QE+AVTALLNLSIND NK+ IA AGAIEPLI+VL++G+  AKENSAA LFS
Sbjct  538   LLYSEAQLTQEHAVTALLNLSINDENKAMIAEAGAIEPLIHVLKSGNGGAKENSAAALFS  597

Query  909   LSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRH  730
             LSV+E+ K KIGRSGAV++LVDLLG+GT RG+KDAATALFNLSI HENK RI+QAGAV+H
Sbjct  598   LSVLEEYKAKIGRSGAVKALVDLLGSGTLRGRKDAATALFNLSIFHENKARIIQAGAVKH  657

Query  729   LVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAAL  550
             LV+LMDP+ GMVDKAVA+L+NL+T+ EGR++I +EGGIP LVEVVE GS RGKENAA+ L
Sbjct  658   LVDLMDPSTGMVDKAVALLANLSTVGEGRLAIAREGGIPSLVEVVESGSQRGKENAASIL  717

Query  549   LQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             LQLC +S ++C +VLQ GAVPPLV LSQSGTPRA+EKAQ LLS+FRNQR G+ G+
Sbjct  718   LQLCLHSPKFCTLVLQEGAVPPLVGLSQSGTPRAKEKAQQLLSHFRNQREGSTGK  772


 Score =   251 bits (640),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 145/347 (42%), Positives = 214/347 (62%), Gaps = 0/347 (0%)
 Frame = -2

Query  2859  KVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVF  2680
             + L+N+IS F HL S + I  + + K Y+     LKLL+P+L  +VD +I  DE+L K  
Sbjct  7     RCLINSISRFIHLVSCQTIKLKPIQKDYKTMAGALKLLKPLLDEVVDYKIPLDEVLNKEC  66

Query  2679  SGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESS  2500
               L   V+E RE  + W    SK++ VL +E L+ K+++ SL+I  +L       P+ SS
Sbjct  67    EELDMVVNEAREFMENWSPKMSKIFSVLHSEPLMMKIQSSSLEICHILYRLLQSSPSNSS  126

Query  2499  LTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIEL  2320
             ++++++C+ +I  +  E +   ITKA++   + +   +D L KI + L L SNQELL E 
Sbjct  127   MSAVQHCMQEIHCLKQERIMEHITKAMRGLQDDTIRCTDHLVKIIESLGLTSNQELLKES  186

Query  2319  ValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSL  2140
             +A+E  +  AE+ +     + +  I+ L++H+ DC++ +++ E+ + V IP  F CPLSL
Sbjct  187   LAVEMERIRAERNQNKGHSDQMNYIVDLISHIRDCMLKIERFEATSGVPIPPYFRCPLSL  246

Query  2139  ELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMN  1960
             ELM DPVIVASGQTYER FI++W+D GL +CPKTRQTL HTNLIPNYTVKA+I NWCE N
Sbjct  247   ELMIDPVIVASGQTYERVFIQKWLDHGLNICPKTRQTLAHTNLIPNYTVKAMIENWCEEN  306

Query  1959  NIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDS  1819
             N++LP      N+    S + HV +        F   R +NSTS  S
Sbjct  307   NLRLPSYSVHNNIVSVLSPLDHVSAQDLIRTDSFRSLRGSNSTSRSS  353



>gb|KDO60476.1| hypothetical protein CISIN_1g004078mg [Citrus sinensis]
Length=775

 Score =   412 bits (1060),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 205/295 (69%), Positives = 248/295 (84%), Gaps = 0/295 (0%)
 Frame = -2

Query  1269  ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVN  1090
             E+ +D       V+KL+EDL STS + Q  A AELRLLAKHNM+NR++I NCGAI  L++
Sbjct  478   ESGSDEVTTTPYVKKLIEDLNSTSNEIQASAAAELRLLAKHNMENRMIIGNCGAIPPLLS  537

Query  1089  LLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFS  910
             LL+SE    QE+AVTALLNLSIND NK+ IA AGAIEPLI+VL++G+  AKENSAA LFS
Sbjct  538   LLYSEAQLTQEHAVTALLNLSINDENKAMIAEAGAIEPLIHVLKSGNGGAKENSAAALFS  597

Query  909   LSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRH  730
             LSV+E+ K KIGRSGAV++LVDLLG+GT RG+KDAATALFNLSI HENK RI+QAGAV+H
Sbjct  598   LSVLEEYKAKIGRSGAVKALVDLLGSGTLRGRKDAATALFNLSIFHENKARIIQAGAVKH  657

Query  729   LVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAAL  550
             LV+LMDP+ GMVDKAVA+L+NL+T+ EGR++I +EGGIP LVEVVE GS RGKENAA+ L
Sbjct  658   LVDLMDPSTGMVDKAVALLANLSTVGEGRLAIAREGGIPSLVEVVESGSQRGKENAASIL  717

Query  549   LQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             LQLC +S ++C +VLQ GAVPPLV LSQSGTPRA+EKAQ LLS+FRNQR G+ G+
Sbjct  718   LQLCLHSPKFCTLVLQEGAVPPLVGLSQSGTPRAKEKAQQLLSHFRNQREGSTGK  772


 Score =   251 bits (640),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 145/347 (42%), Positives = 214/347 (62%), Gaps = 0/347 (0%)
 Frame = -2

Query  2859  KVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVF  2680
             + L+N+IS F HL S + I  + + K Y+     LKLL+P+L  +VD +I  DE+L K  
Sbjct  7     RCLINSISRFIHLVSCQTIKLKPIQKDYKTMAGALKLLKPLLDEVVDYKIPLDEVLNKEC  66

Query  2679  SGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESS  2500
               L   V+E RE  + W    SK++ VL +E L+ K+++ SL+I  +L       P+ SS
Sbjct  67    EELDMVVNEAREFMENWSPKMSKIFSVLHSEPLMMKIQSSSLEICHILYRLLQSSPSNSS  126

Query  2499  LTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIEL  2320
             ++++++C+ +I  +  E +   ITKA++   + +   +D L KI + L L SNQELL E 
Sbjct  127   MSAVQHCMQEIHCLKQERIMEHITKAMRGLQDDTIRCTDHLVKIIESLGLTSNQELLKES  186

Query  2319  ValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSL  2140
             +A+E  +  AE+ +     + +  I+ L++H+ DC++ +++ E+ + V IP  F CPLSL
Sbjct  187   LAVEMERIRAERNQNKGHSDQMNYIVDLISHIRDCMLKIERFEATSGVPIPPYFRCPLSL  246

Query  2139  ELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMN  1960
             ELM DPVIVASGQTYER FI++W+D GL +CPKTRQTL HTNLIPNYTVKA+I NWCE N
Sbjct  247   ELMIDPVIVASGQTYERVFIQKWLDHGLNICPKTRQTLAHTNLIPNYTVKAMIENWCEEN  306

Query  1959  NIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDS  1819
             N++LP      N+    S + HV +        F   R +NSTS  S
Sbjct  307   NLRLPSYSVHSNIVSVLSPLDHVSAQDLIRTDSFRSLRGSNSTSRSS  353



>ref|XP_009112370.1| PREDICTED: U-box domain-containing protein 2-like isoform X1 
[Brassica rapa]
Length=739

 Score =   410 bits (1053),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 206/333 (62%), Positives = 267/333 (80%), Gaps = 4/333 (1%)
 Frame = -2

Query  1383  SRRESEFPSPVGTRL---RPPAIWRRPSERLVSRIVSSP-TVETRADLAEVKEQVRKLVE  1216
             + R +  P+P  T +   R   + R PS R        P T+      + ++ +V+KL+E
Sbjct  403   TERNTPPPAPAVTSVSQARVETVRRLPSARHFHHPGIIPATIRETGSSSSIESEVKKLIE  462

Query  1215  DLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALL  1036
             DLKS+S++ QR ATA +R+L++++ DNRIVI+ CGAI  LVNLL+S D  +Q +AVT LL
Sbjct  463   DLKSSSLEAQREATARIRILSRNSTDNRIVIARCGAIDSLVNLLYSTDERIQADAVTCLL  522

Query  1035  NLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQ  856
             NLSINDNNKS IA++GAIEPLI+VL TG+ EAKENSAATLFSLSVIE+NK KIG +GA++
Sbjct  523   NLSINDNNKSVIADSGAIEPLIHVLRTGNLEAKENSAATLFSLSVIEENKTKIGEAGAIE  582

Query  855   SLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAV  676
              LV+LLGNG+ RGKKDAATALFNLSI HENK ++++AGAVR+LVELMDPAAGMV+KAV V
Sbjct  583   PLVELLGNGSLRGKKDAATALFNLSIHHENKAKVIEAGAVRYLVELMDPAAGMVEKAVVV  642

Query  675   LSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHG  496
             L+NLAT++EG+++IG+EGGIP+LVEVVELGSARGKENA AALLQL  +S R+CN +++ G
Sbjct  643   LANLATVKEGKVAIGEEGGIPVLVEVVELGSARGKENATAALLQLSMHSQRFCNSIIREG  702

Query  495   AVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             A+PPLVAL++SGT RA+EKA  LL YF++Q+ G
Sbjct  703   AIPPLVALTKSGTARAKEKAHNLLKYFKSQKQG  735


 Score =   322 bits (826),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 227/322 (70%), Gaps = 0/322 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  L+VLL+NISS+  +SS++ + S   HKYY + EDI KLLQP+L  +V ++ +  E
Sbjct  6     MEVSWLRVLLDNISSYLSISSMDTLYSNPAHKYYTRGEDIAKLLQPVLENLVGSDASPSE  65

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL   F  L   +DELRE FQ+W+ LSS++++VLQ ESL  K+R  SL++ +LL   +  
Sbjct  66    LLNNGFEELSQYIDELREQFQSWEPLSSRIFYVLQIESLATKLRESSLEVFQLLKHCEQH  125

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+    S E+C+  +K +  + +S TI  A+ +  EG+G +S+ L KIA+ + L+SNQ
Sbjct  126   LPADLVSPSFEDCIELVKLVGRDEVSCTIDLALIDQKEGNGPTSEVLVKIAESVGLRSNQ  185

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE V L  LKENAE  E N E E+IE +I+L+THMHD L  +KQS+   SV +P DF
Sbjct  186   EILIEGVVLASLKENAELTENNTEAEFIEGLISLITHMHDHLTNIKQSQLGCSVPVPPDF  245

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELMTDPVIV SGQTYER FI +W D+GL VCPKTRQ LT T+L PN+ VKA I+
Sbjct  246   RCPLSLELMTDPVIVTSGQTYERAFIEKWFDMGLMVCPKTRQPLTQTSLTPNFIVKAFIS  305

Query  1977  NWCEMNNIKLPDPIKSLNVNQP  1912
             NWCE NN+ LPDP++ +  +QP
Sbjct  306   NWCESNNVNLPDPLELVQSSQP  327



>ref|XP_009112371.1| PREDICTED: U-box domain-containing protein 2-like isoform X2 
[Brassica rapa]
Length=734

 Score =   409 bits (1052),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 206/333 (62%), Positives = 267/333 (80%), Gaps = 4/333 (1%)
 Frame = -2

Query  1383  SRRESEFPSPVGTRL---RPPAIWRRPSERLVSRIVSSP-TVETRADLAEVKEQVRKLVE  1216
             + R +  P+P  T +   R   + R PS R        P T+      + ++ +V+KL+E
Sbjct  398   TERNTPPPAPAVTSVSQARVETVRRLPSARHFHHPGIIPATIRETGSSSSIESEVKKLIE  457

Query  1215  DLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALL  1036
             DLKS+S++ QR ATA +R+L++++ DNRIVI+ CGAI  LVNLL+S D  +Q +AVT LL
Sbjct  458   DLKSSSLEAQREATARIRILSRNSTDNRIVIARCGAIDSLVNLLYSTDERIQADAVTCLL  517

Query  1035  NLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQ  856
             NLSINDNNKS IA++GAIEPLI+VL TG+ EAKENSAATLFSLSVIE+NK KIG +GA++
Sbjct  518   NLSINDNNKSVIADSGAIEPLIHVLRTGNLEAKENSAATLFSLSVIEENKTKIGEAGAIE  577

Query  855   SLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAV  676
              LV+LLGNG+ RGKKDAATALFNLSI HENK ++++AGAVR+LVELMDPAAGMV+KAV V
Sbjct  578   PLVELLGNGSLRGKKDAATALFNLSIHHENKAKVIEAGAVRYLVELMDPAAGMVEKAVVV  637

Query  675   LSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHG  496
             L+NLAT++EG+++IG+EGGIP+LVEVVELGSARGKENA AALLQL  +S R+CN +++ G
Sbjct  638   LANLATVKEGKVAIGEEGGIPVLVEVVELGSARGKENATAALLQLSMHSQRFCNSIIREG  697

Query  495   AVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             A+PPLVAL++SGT RA+EKA  LL YF++Q+ G
Sbjct  698   AIPPLVALTKSGTARAKEKAHNLLKYFKSQKQG  730


 Score =   323 bits (827),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 227/322 (70%), Gaps = 0/322 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  L+VLL+NISS+  +SS++ + S   HKYY + EDI KLLQP+L  +V ++ +  E
Sbjct  1     MEVSWLRVLLDNISSYLSISSMDTLYSNPAHKYYTRGEDIAKLLQPVLENLVGSDASPSE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL   F  L   +DELRE FQ+W+ LSS++++VLQ ESL  K+R  SL++ +LL   +  
Sbjct  61    LLNNGFEELSQYIDELREQFQSWEPLSSRIFYVLQIESLATKLRESSLEVFQLLKHCEQH  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+    S E+C+  +K +  + +S TI  A+ +  EG+G +S+ L KIA+ + L+SNQ
Sbjct  121   LPADLVSPSFEDCIELVKLVGRDEVSCTIDLALIDQKEGNGPTSEVLVKIAESVGLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE V L  LKENAE  E N E E+IE +I+L+THMHD L  +KQS+   SV +P DF
Sbjct  181   EILIEGVVLASLKENAELTENNTEAEFIEGLISLITHMHDHLTNIKQSQLGCSVPVPPDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELMTDPVIV SGQTYER FI +W D+GL VCPKTRQ LT T+L PN+ VKA I+
Sbjct  241   RCPLSLELMTDPVIVTSGQTYERAFIEKWFDMGLMVCPKTRQPLTQTSLTPNFIVKAFIS  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQP  1912
             NWCE NN+ LPDP++ +  +QP
Sbjct  301   NWCESNNVNLPDPLELVQSSQP  322



>ref|XP_009369474.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Pyrus x bretschneideri]
Length=784

 Score =   410 bits (1054),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 219/397 (55%), Positives = 285/397 (72%), Gaps = 19/397 (5%)
 Frame = -2

Query  1542  HNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVASESRHAATLAASRRESEF  1363
             H+R  SA S +S+ +++   +   + +S+        S E+ SE   A+T    +++S  
Sbjct  396   HSRGESATSAVSSIDYAPPASIKVSGISNKHENVRRLSGEITSEHTVAST---PKKQSAI  452

Query  1362  PSPVGTRL------RPPAIW----RRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVED  1213
             P  +  +L      +    W      P  +L+      P   + +D       VR L+ED
Sbjct  453   PPGLSGKLSHISKTKAEGAWTDSPSYPDRQLL------PFYSSGSDELTTASHVRNLIED  506

Query  1212  LKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLN  1033
             LKS S + Q +A  ELRLL KHNM+NR +I  CGAI+ LV+LL+S ++  QE+AVTALLN
Sbjct  507   LKSQSNEVQTMAAEELRLLGKHNMENRTIIGQCGAITPLVSLLYSGELTTQEHAVTALLN  566

Query  1032  LSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQS  853
             LSIN++NK+ IA AGAI+PLI+VL+TGS  AKENSAATLFSLSV+++ K KIGRSGAV++
Sbjct  567   LSINEDNKAMIAEAGAIDPLIHVLKTGSDGAKENSAATLFSLSVLDEYKAKIGRSGAVKA  626

Query  852   LVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVL  673
             LVDLL +GT RGKKDA TALFNLSI HENK R+VQAG V+HL++LMDP +GMVDKAVA+L
Sbjct  627   LVDLLASGTLRGKKDAGTALFNLSIFHENKARLVQAGVVKHLIDLMDPDSGMVDKAVALL  686

Query  672   SNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGA  493
             +NL+TI EGR++I +EGG P+LVE+VE GS RGKENAA+ LLQLC +S ++C +VLQ GA
Sbjct  687   ANLSTIAEGRIAITREGGTPLLVEIVESGSHRGKENAASILLQLCLHSPKFCTLVLQEGA  746

Query  492   VPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VPPLVALSQSGTPRA+EKAQ LLS+FRNQR G  G+G
Sbjct  747   VPPLVALSQSGTPRAKEKAQQLLSHFRNQREGAMGKG  783


 Score =   233 bits (594),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 139/341 (41%), Positives = 213/341 (62%), Gaps = 3/341 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+   +K L+N+IS F HL S + +    + K Y+   D+LKLL+P++  +VD ++ SD+
Sbjct  1     MDTSSMKCLINSISRFVHLVSSQTLKHIPIQKDYRTIVDVLKLLKPLIDEVVDFKVPSDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K    L  +V+  RE  + W   SSK+    + E L+  ++  SLKI  +L      
Sbjct  61    ILYKECEELDMAVNGAREFIENWSPKSSKISSAWRCEPLLITIQNSSLKICSILRRLSQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
               + SSLT L++C  +I+S+  E ++  + +A+++  +    S+  L KI + L+L SNQ
Sbjct  121   SSSGSSLTGLQHCTQEIQSLKLERVTEYLEEAVRSQSKDVMPSTKLLMKIIELLNLTSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +A+EK + N E ++   +++ I QI+ LV+H+ + ++ ++  E+ + V IP+ F
Sbjct  181   ELLKESIAVEKERMNVEVSDVRGKLDQINQIVVLVSHIREFMVKIEHLETISGVSIPSYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLS ELM DPVIVASGQTYER+ I++WID GLT+CPKTRQ L HTNLIPNYTVKA+I 
Sbjct  241   RCPLSSELMLDPVIVASGQTYERDSIQKWIDHGLTICPKTRQRLYHTNLIPNYTVKAMIE  300

Query  1977  NWCEMNNIKLP---DPIKSLNVNQPSSHVAHVDSGAPRDIH  1864
             +WC+ N+IKL    D   ++ V  PS  V+  DS     +H
Sbjct  301   SWCQENDIKLTANSDGSNAITVPSPSDQVSPADSTHTGGLH  341



>emb|CDX81323.1| BnaC09g07340D [Brassica napus]
Length=723

 Score =   408 bits (1049),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 196/293 (67%), Positives = 252/293 (86%), Gaps = 0/293 (0%)
 Frame = -2

Query  1275  TVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLL  1096
             T+      + ++ +V+KL+EDLKS+S++ QR ATA +R+L++++ DNRIVI+ CGAI  L
Sbjct  427   TIRETGSSSSIESEVKKLIEDLKSSSLEAQREATARIRILSRNSTDNRIVIARCGAIDSL  486

Query  1095  VNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATL  916
             VNLL+S D  +Q +AVT LLNLSINDNNKS IA++GAIEPLI+VL TG+ EAKENSAATL
Sbjct  487   VNLLYSTDERIQADAVTCLLNLSINDNNKSVIADSGAIEPLIHVLRTGNLEAKENSAATL  546

Query  915   FSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAV  736
             FSLSVIE+NK KIG +GA++ LV+LLGNG+ RGKKDAATALFNLSI HENK ++++AGAV
Sbjct  547   FSLSVIEENKTKIGEAGAIEPLVELLGNGSLRGKKDAATALFNLSIHHENKAKVIEAGAV  606

Query  735   RHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAA  556
             R+LVELMDPAAGMV+KAV VL+NLAT++EG+++IG+EGGIP+LVEVVELGSARGKENA A
Sbjct  607   RYLVELMDPAAGMVEKAVVVLANLATVKEGKVAIGEEGGIPVLVEVVELGSARGKENATA  666

Query  555   ALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             ALLQL  +S R+CN +++ GA+PPLVAL++SGT RA+EKA  LL YF++Q+ G
Sbjct  667   ALLQLSMHSQRFCNSIIREGAIPPLVALTKSGTARAKEKAHNLLKYFKSQKQG  719


 Score =   320 bits (819),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 226/322 (70%), Gaps = 0/322 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  L+VLL+NISS+  +SS++ + S   HKYY + EDI KLLQP+L  +V ++ +  E
Sbjct  1     MEVSWLRVLLDNISSYLSISSMDTLYSNPAHKYYTRGEDIAKLLQPVLENLVGSDASPSE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL   F  L   VDELRE FQ+W+ L S++++VLQ ESL  K+R  SL++ +LL   +  
Sbjct  61    LLNNGFEELSQYVDELREQFQSWEPLLSRIFYVLQIESLATKLRESSLEVFQLLKHCEQH  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+    S E+C+  +K +  + +S TI  A+ +  EG+G +S+ L KIA+ + L+SNQ
Sbjct  121   LPADLVSPSFEDCIELVKLVGRDEVSYTIDLALIDQKEGNGPTSEVLVKIAESVGLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE V L  LKENAE  E N E E+IE +I+L+THMHD L  +KQS+   SV +P DF
Sbjct  181   EILIEGVVLASLKENAELTENNTEAEFIEGLISLITHMHDHLTNIKQSQLGCSVPVPPDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELMTDPVIV SGQTYER FI +W D+GL VCPKTRQ LT T+L PN+ VKA I+
Sbjct  241   RCPLSLELMTDPVIVTSGQTYERAFIEKWFDMGLMVCPKTRQPLTQTSLTPNFIVKAFIS  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQP  1912
             NWCE NN+ LPDP++ +  +QP
Sbjct  301   NWCESNNVNLPDPLELVQSSQP  322



>ref|XP_010101417.1| U-box domain-containing protein 3 [Morus notabilis]
 gb|EXB88383.1| U-box domain-containing protein 3 [Morus notabilis]
Length=807

 Score =   410 bits (1055),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 245/285 (86%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
             QV KLVEDL+S S++ Q  A  ELRLLAKHN++NR VI  CGAI+ L++LL++E    QE
Sbjct  521   QVEKLVEDLRSLSIEVQTAAAEELRLLAKHNVENRNVIGRCGAITPLLSLLYAETKLTQE  580

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN++NK+ IA AGAIEPLI+ L TG+  AKENSAA LFSLSV+E+ K+KI
Sbjct  581   HAVTALLNLSINESNKAMIAEAGAIEPLIHALRTGNDGAKENSAAALFSLSVLEEYKVKI  640

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LV LLG+GT RGKKDAATALFNLSI HENK RIVQAGAV+HLVEL+DP +GM
Sbjct  641   GRSGAVKALVGLLGSGTLRGKKDAATALFNLSIFHENKARIVQAGAVKHLVELLDPGSGM  700

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+LSNL+T+ EGR++I +EGGIP+LVE+VE GS RGKENAA+ LLQLC +++++C
Sbjct  701   VDKAVALLSNLSTVGEGRLAIVREGGIPLLVEIVETGSQRGKENAASVLLQLCLHNTKFC  760

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR G  G+G
Sbjct  761   TLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGTTGKG  805


 Score =   237 bits (605),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 137/328 (42%), Positives = 204/328 (62%), Gaps = 11/328 (3%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L N+IS F HL S +N+    + K Y+    +LKLL+P+L  ++D E+ SDE+L K 
Sbjct  31    VKCLTNSISRFIHLVSCQNVKPTTIQKDYRTVAAVLKLLKPVLDEVLDYEMLSDEILCKE  90

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIV----ELLVSSDWCL  2515
                L  +V+  RE  + W    SK+  VL++E L+ K+++    I      LL SS    
Sbjct  91    CEELDMAVNMAREFMEDWSPKMSKICSVLRSEPLLMKIQSSLFMICCSLRRLLQSS----  146

Query  2514  PAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQE  2335
             P  SSLT+++  + +I+S+  E ++  I + +++        + SLTK+ + L L S+QE
Sbjct  147   PPNSSLTAIQQGMQEIQSLKQERIAKHIEEGMRSQRNNVFLCTKSLTKVIELLGLTSSQE  206

Query  2334  LLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFC  2155
             LL E +AL K +  AE ++   E+  I+QI+ LV+ + +C++ +++ E+   V +P  FC
Sbjct  207   LLKESIALGKEQMIAEGSKMKGELSQIDQIVDLVSGIRNCMVKLQRLEA---VPVPPYFC  263

Query  2154  CPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIAN  1975
             CPLS ELM DPVIVASGQTY R+ I++W+D GLT+CPKTRQ L HTNLIPNYTVKA+IA 
Sbjct  264   CPLSSELMCDPVIVASGQTYNRSSIQKWLDNGLTICPKTRQKLAHTNLIPNYTVKAMIAT  323

Query  1974  WCEMNNIKLPDPIKSLNVNQPSSHVAHV  1891
             WCE N +KLP  +    +   SS + HV
Sbjct  324   WCEENKVKLPVNLDHSKIVLVSSQMEHV  351



>ref|XP_008382858.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
3 [Malus domestica]
Length=789

 Score =   410 bits (1054),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 220/397 (55%), Positives = 286/397 (72%), Gaps = 19/397 (5%)
 Frame = -2

Query  1542  HNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVASESRHAATLAASRRESEF  1363
             H+R  SA S +S+ +++   +   + +S+        S E+ SE   A+T    R++S  
Sbjct  401   HSRGESATSAVSSIDYAPPASIKVSGISNKHENVRRLSGEITSEHPVAST---PRKQSAI  457

Query  1362  PSPVGTRL------RPPAIW----RRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVED  1213
             P  +  +L      +    W      P  +L+      P   + +D       VR L+ED
Sbjct  458   PPGLSGKLCHISKTKAEGAWTDSPSYPDRQLL------PFSSSGSDELTTASHVRNLIED  511

Query  1212  LKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLN  1033
             LKS S + Q +A  ELRLL KHNM+NR +I  CGAI+ L++LL+S  +  QE+AVTALLN
Sbjct  512   LKSQSNEVQTMAAEELRLLGKHNMENRTIIGQCGAITPLLSLLYSGQLTTQEHAVTALLN  571

Query  1032  LSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQS  853
             LSIN++NK+ IA AGAI+PLI+VL+TGS  AKENSAATLFSLSV+++ K KIGRSGAV++
Sbjct  572   LSINEDNKAMIAEAGAIDPLIHVLKTGSDGAKENSAATLFSLSVLDEYKAKIGRSGAVKA  631

Query  852   LVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVL  673
             LVDLL +GT RGKKDA TALFNLSI HENK R+VQAGAV+HL++LMDP +GMVDKAVA+L
Sbjct  632   LVDLLASGTLRGKKDAGTALFNLSIFHENKARLVQAGAVKHLIDLMDPDSGMVDKAVALL  691

Query  672   SNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGA  493
             +NL+TI EGR++I +EGGIP+LVE+VE GS RGKENAA+ LLQLC +S ++C +VLQ GA
Sbjct  692   ANLSTIAEGRIAITREGGIPLLVEIVESGSHRGKENAASVLLQLCLHSPKFCTLVLQEGA  751

Query  492   VPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VPPLVALSQSGTPRA+EKAQ LLS+FR+QR G  G+G
Sbjct  752   VPPLVALSQSGTPRAKEKAQQLLSHFRSQREGAMGKG  788


 Score =   243 bits (619),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 139/343 (41%), Positives = 217/343 (63%), Gaps = 3/343 (1%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G M+   +K L+N+IS F HL S + +    + K Y+   D+LKLL+P++  +VD ++ S
Sbjct  4     GDMDTASMKCLINSISRFVHLVSSQTLKHIPIQKDYRTIVDVLKLLKPLIDEVVDFKVPS  63

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             D++L +    L  +V+  RE  + W  +SSK+    + E L+  ++  SLKI  +L    
Sbjct  64    DDILYRECEELDMAVNRAREFIENWSPMSSKISSAWRCEPLLITIQNSSLKICSILHRLS  123

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
                 + SSLT L++C  +I+S+  E ++  + +A+++  +    S+  LTKI + L+L S
Sbjct  124   QSSSSGSSLTGLQHCTQEIQSLKLERVTEYLEEAVRSQSKDVMPSTKLLTKIIELLNLTS  183

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQELL E +A+EK + N E ++   +++ I QI+ LV+H+ + ++ ++  E+ + V IP+
Sbjct  184   NQELLKESIAVEKERMNVEVSDVRGKLDQINQIVVLVSHIREFMVKIEGLETVSGVPIPS  243

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
              F C LS ELM DPVIVASGQTYER+ I++WID GLT+CPKTRQ L+HTNLIPNYTVKA+
Sbjct  244   YFRCALSSELMLDPVIVASGQTYERSSIQKWIDHGLTICPKTRQRLSHTNLIPNYTVKAM  303

Query  1983  IANWCEMNNIKLP---DPIKSLNVNQPSSHVAHVDSGAPRDIH  1864
             I +WC+ N+IKL    D   +++V  PS  V+  DS     +H
Sbjct  304   IESWCQENDIKLTANSDGSNAISVXSPSYQVSPADSTHTDSLH  346



>ref|XP_008674728.1| PREDICTED: U-box domain-containing protein 4-like [Zea mays]
 ref|XP_008674729.1| PREDICTED: U-box domain-containing protein 4-like [Zea mays]
 tpg|DAA56496.1| TPA: putative ARM repeat-containing protein containing family 
protein [Zea mays]
Length=800

 Score =   409 bits (1052),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 223/346 (64%), Positives = 276/346 (80%), Gaps = 9/346 (3%)
 Frame = -2

Query  1434  ASMEVASES-RHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRA  1258
             +S  +ASE+ R+  T+  S+   + P   G R R   +W++ S++ VS       +++R+
Sbjct  456   SSNSIASETTRNGRTVTCSKPNFQ-PRLGGVRSRNHLVWQQRSDKAVS-------LDSRS  507

Query  1257  DLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHS  1078
             D A V  +VRKL+EDLK+   D +R A  EL +L++HNM++RI I+N GAI  LVNLL+S
Sbjct  508   DFAIVDNKVRKLIEDLKNERTDPERAAIGELLVLSRHNMESRISIANHGAIPFLVNLLYS  567

Query  1077  EDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVI  898
              D  +QENAVT +LNLS++DNNK  IA+A AI+PLI+VLETG+PEA+ NSAATLFSLSV 
Sbjct  568   ADPSMQENAVTVILNLSLDDNNKITIASADAIKPLIHVLETGNPEARANSAATLFSLSVN  627

Query  897   EDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVEL  718
             E+NK KIGRSGA++ LVDLL +G+ +GKKDAATALFNLSI HENK R+V+AGAV+ LVEL
Sbjct  628   EENKAKIGRSGAIKPLVDLLRDGSAQGKKDAATALFNLSIFHENKARVVEAGAVKPLVEL  687

Query  717   MDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLC  538
             MDPAAGMVDKAVAVL+ LAT+QEGR  I Q GGIP+LVEVVELGSAR KENAAAALLQLC
Sbjct  688   MDPAAGMVDKAVAVLAILATVQEGRNGIAQAGGIPVLVEVVELGSARAKENAAAALLQLC  747

Query  537   TNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRH  400
             TN+SR+C++VLQ GA+PPLVALSQSGT RAREKAQ LLSYFRNQR 
Sbjct  748   TNNSRFCSLVLQEGAMPPLVALSQSGTARAREKAQVLLSYFRNQRQ  793


 Score =   238 bits (606),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 147/346 (42%), Positives = 215/346 (62%), Gaps = 13/346 (4%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSG  2674
             ++++IS+F  LS+   + +ELV +Y +K  +IL LL+ +L  ++  +I+ D+   ++  G
Sbjct  9     VISSISNFRTLSTSSVVETELVKRYCRKINEILGLLKLVLDEVI-PQISLDD---RMLEG  64

Query  2673  LGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLT  2494
             L  ++++  +L  +W L+ SK+YFV+  ESLI K++ + L++ +++ S     P E++  
Sbjct  65    LAATINDAIKLVGSWDLMMSKIYFVMLVESLITKMQNYVLEVCQVVNSE--VTPPETNRI  122

Query  2493  SLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELVa  2314
             S+   + KIK    + +   I +A ++        S++LTKI   LSL +NQELL+E VA
Sbjct  123   SV--YLEKIKQFQCDKIMGIIKEASRDIAGKFTPKSETLTKIQVSLSLSTNQELLMEAVA  180

Query  2313  leklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLEL  2134
             L K++   +  + +E    I  I  LV HM +  +  KQ  S   V IPADFCCPLSLEL
Sbjct  181   LAKIRTRVDAEDSSELDG-INHISELVNHMLEKHVEEKQMHSINGVPIPADFCCPLSLEL  239

Query  2133  MTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNI  1954
             M+DPVIVASGQTYER FIR+W+DLG  VCPKTRQTL H+NLIPNYTVK LI NW E++ +
Sbjct  240   MSDPVIVASGQTYERVFIRKWLDLGYNVCPKTRQTLGHSNLIPNYTVKQLIENWSEVHGV  299

Query  1953  KLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSH--SRANNSTSPD  1822
              LPDP+K L++N   S      +G   D   FS   SR N   SPD
Sbjct  300   VLPDPVKLLSLNFSVS--LKPINGRTSDKSPFSENSSRENKFGSPD  343



>emb|CDY18649.1| BnaA09g07460D [Brassica napus]
Length=712

 Score =   406 bits (1044),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/333 (62%), Positives = 266/333 (80%), Gaps = 4/333 (1%)
 Frame = -2

Query  1383  SRRESEFPSPVGTRL---RPPAIWRRPSERLVSRIVSSP-TVETRADLAEVKEQVRKLVE  1216
             + R +  P+P  T +   R   + R PS R        P T+      + ++ +V+KL+E
Sbjct  376   TERNTPPPAPAVTSVSQARVETVRRLPSARHFHHPGIIPATIRETGSSSSIESEVKKLIE  435

Query  1215  DLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALL  1036
             DLKS+S++ Q  ATA +R+L++++ DNRIVI+ CGAI  LVNLL+S D  +Q +AVT LL
Sbjct  436   DLKSSSLEAQGEATARIRILSRNSTDNRIVIARCGAIDSLVNLLYSTDERIQADAVTCLL  495

Query  1035  NLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQ  856
             NLSINDNNKS IA++GAIEPLI+VL TG+ EAKENSAATLFSLSVIE+NK KIG +GA++
Sbjct  496   NLSINDNNKSVIADSGAIEPLIHVLRTGNLEAKENSAATLFSLSVIEENKTKIGEAGAIE  555

Query  855   SLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAV  676
              LV+LLGNG+ RGKKDAATALFNLSI HENK ++++AGAVR+LVELMDPAAGMV+KAV V
Sbjct  556   PLVELLGNGSLRGKKDAATALFNLSIHHENKAKVIEAGAVRYLVELMDPAAGMVEKAVVV  615

Query  675   LSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHG  496
             L+NLAT++EG+++IG+EGGIP+LVEVVELGSARGKENA AALLQL  +S R+CN +++ G
Sbjct  616   LANLATVKEGKVAIGEEGGIPVLVEVVELGSARGKENATAALLQLSMHSQRFCNSIIREG  675

Query  495   AVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             A+PPLVAL++SGT RA+EKA  LL YF++Q+ G
Sbjct  676   AIPPLVALTKSGTARAKEKAHNLLKYFKSQKQG  708


 Score =   318 bits (814),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 166/322 (52%), Positives = 226/322 (70%), Gaps = 0/322 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  L+VLL+NISS+  +SS++ + S   HKYY + EDI KLLQP+L  +V ++ +  E
Sbjct  1     MEVSWLRVLLDNISSYLSISSMDTLYSNPAHKYYTRGEDIAKLLQPVLENLVGSDASPSE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL   F  L   +DELRE FQ+W+ LSS++++VLQ ESL  K+R  SL++ +LL   +  
Sbjct  61    LLNNGFEELSQYIDELREQFQSWEPLSSRIFYVLQIESLATKLRESSLEVFQLLKHCEQH  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+    S E+C+  +K +  + +S TI  A+ +  EG+G +S+ L KIA+ + L+SNQ
Sbjct  121   LPADLVSPSFEDCIELVKLVGRDEVSCTIDLALIDQREGNGPTSEVLVKIAESVGLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE V L  LKENAE  E N E E+IE +I+L+T MHD L  +KQS+   SV +P DF
Sbjct  181   EILIEGVVLASLKENAELTENNTEAEFIEGLISLITRMHDHLTNIKQSQLGCSVPVPPDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELMTDPVIV SGQTYER FI +W D+GL VCPKTRQ L+ T+L PN+ VKA I+
Sbjct  241   RCPLSLELMTDPVIVTSGQTYERAFIEKWFDMGLMVCPKTRQPLSQTSLTPNFIVKAFIS  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQP  1912
             NWCE NN+ LPDP++ +  +QP
Sbjct  301   NWCESNNVNLPDPLELVQSSQP  322



>ref|XP_007050279.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX94436.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
Length=750

 Score =   407 bits (1047),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 245/285 (86%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V+KLV++LKS S + Q  A AELRLLAKHNMDNRI+I  CGAI+ L++LL+SE    QE
Sbjct  464   HVKKLVDNLKSLSNEVQTTAAAELRLLAKHNMDNRIIIGRCGAIAPLLSLLYSEVKLTQE  523

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN++NK+ IA +GAIEPLI+VL++G+  A+ENSAA LFSLSV+E+ K +I
Sbjct  524   HAVTALLNLSINEDNKAMIAKSGAIEPLIHVLKSGNDGARENSAAALFSLSVLEEYKARI  583

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LV+LLG+GT RGKKDA TALFNLSI HENK RIVQAGAV++LVELMDP +GM
Sbjct  584   GRSGAVKALVNLLGSGTLRGKKDAVTALFNLSIFHENKARIVQAGAVKYLVELMDPDSGM  643

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+LSNL+TI EGR++I +EGGIP+LVE +E GS RGKENAA+ LLQLC NS ++C
Sbjct  644   VDKAVALLSNLSTIGEGRLAIVREGGIPVLVEAIESGSQRGKENAASVLLQLCLNSPKFC  703

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR G  G+G
Sbjct  704   TLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGATGKG  748


 Score =   216 bits (551),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 126/295 (43%), Positives = 190/295 (64%), Gaps = 3/295 (1%)
 Frame = -2

Query  2727  IVDAEIASDELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKI  2548
             +VD EI SDE+L K    L   V+E RE  + W    SK+  VLQ+E  + K+++ SL+I
Sbjct  15    VVDREIPSDEILCKECEELDLVVNEAREFMENWSPKMSKIRRVLQSEPFLIKMQSSSLQI  74

Query  2547  VELLVSSDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKI  2368
               ++       P+ SS+TS++NC+ +IK +  E +S  I +A+++    +    D L ++
Sbjct  75    CHMIYKMLQSSPSTSSITSVQNCMREIKCLKQERVSENIEEALRSQRNDAIPCPDHLVEV  134

Query  2367  ADCLSLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSES  2188
                L+L SNQELL E VA+EK + NA+      +++ I QI+ L++H+ D L+ ++  E 
Sbjct  135   IKSLNLTSNQELLKETVAVEKERMNAQVNNAKGKLDQINQIVDLISHVRDYLLKIEHFEP  194

Query  2187  CTSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLI  2008
              T V IP  F CPLSLELM DPVIVASGQTY+R  I++W+D GLT+CPKT QTLTHTNLI
Sbjct  195   TTGVLIPPHFLCPLSLELMLDPVIVASGQTYDRASIQKWLDNGLTICPKTHQTLTHTNLI  254

Query  2007  PNYTVKALIANWCEMNNIKLPD---PIKSLNVNQPSSHVAHVDSGAPRDIHIFSH  1852
             PNY VKA++A+WCE NN++L +     K ++++ PS++++  D     + H F++
Sbjct  255   PNYMVKAMVASWCEENNLQLSNNSGHAKLISISSPSNYISSQDFTHTDNCHCFAN  309



>ref|XP_009417313.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=299

 Score =   391 bits (1004),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 210/296 (71%), Positives = 256/296 (86%), Gaps = 2/296 (1%)
 Frame = -2

Query  1272  VETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLV  1093
             +++R D++  + +V +L+EDLKS S D QR ATAELRLLA+H M+NR+VI+NCGAISLLV
Sbjct  5     MDSRFDISGDESKVFELIEDLKSNSTDVQRAATAELRLLARH-MENRMVIANCGAISLLV  63

Query  1092  NLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLF  913
              LLHS D + QENAVTALLNLS++DN K AIANA AI+PLI+VL+TG+PEA+ENSAATL 
Sbjct  64    GLLHSTDPKTQENAVTALLNLSLSDN-KIAIANANAIDPLIHVLKTGNPEAQENSAATLL  122

Query  912   SLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVR  733
             SLSV E+NK++IGRSGA+  LV+LL NGT RGKKDA +AL+NLS L +NK RIVQAGA+ 
Sbjct  123   SLSVTEENKLQIGRSGAIGPLVELLANGTLRGKKDAVSALYNLSTLRDNKLRIVQAGAMS  182

Query  732   HLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAA  553
             HLVELMDPA GMVDKAVAVL+NLA+I EGR ++GQ+GGI +LVEVVELGSAR KENAAAA
Sbjct  183   HLVELMDPATGMVDKAVAVLANLASIPEGRNALGQDGGIFVLVEVVELGSARAKENAAAA  242

Query  552   LLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             LLQLC NS R+C++VLQ GAVPPLVALSQ GTPRA+EKA+ALL+ F+NQ + ++GR
Sbjct  243   LLQLCKNSGRFCSLVLQEGAVPPLVALSQFGTPRAKEKARALLNCFQNQGYLHSGR  298



>ref|XP_007050278.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94435.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=786

 Score =   408 bits (1048),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 245/285 (86%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V+KLV++LKS S + Q  A AELRLLAKHNMDNRI+I  CGAI+ L++LL+SE    QE
Sbjct  500   HVKKLVDNLKSLSNEVQTTAAAELRLLAKHNMDNRIIIGRCGAIAPLLSLLYSEVKLTQE  559

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN++NK+ IA +GAIEPLI+VL++G+  A+ENSAA LFSLSV+E+ K +I
Sbjct  560   HAVTALLNLSINEDNKAMIAKSGAIEPLIHVLKSGNDGARENSAAALFSLSVLEEYKARI  619

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LV+LLG+GT RGKKDA TALFNLSI HENK RIVQAGAV++LVELMDP +GM
Sbjct  620   GRSGAVKALVNLLGSGTLRGKKDAVTALFNLSIFHENKARIVQAGAVKYLVELMDPDSGM  679

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+LSNL+TI EGR++I +EGGIP+LVE +E GS RGKENAA+ LLQLC NS ++C
Sbjct  680   VDKAVALLSNLSTIGEGRLAIVREGGIPVLVEAIESGSQRGKENAASVLLQLCLNSPKFC  739

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR G  G+G
Sbjct  740   TLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGATGKG  784


 Score =   230 bits (587),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 219/345 (63%), Gaps = 3/345 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+   ++ L+N+IS F HL S + I    V K Y+    +LKLL+P+L  +VD EI SDE
Sbjct  1     MDTTSVQCLINSISRFIHLVSCQTIKVVPVEKDYRYMVVVLKLLKPLLDDVVDREIPSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K    L   V+E RE  + W    SK+  VLQ+E  + K+++ SL+I  ++      
Sbjct  61    ILCKECEELDLVVNEAREFMENWSPKMSKIRRVLQSEPFLIKMQSSSLQICHMIYKMLQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P+ SS+TS++NC+ +IK +  E +S  I +A+++    +    D L ++   L+L SNQ
Sbjct  121   SPSTSSITSVQNCMREIKCLKQERVSENIEEALRSQRNDAIPCPDHLVEVIKSLNLTSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E VA+EK + NA+      +++ I QI+ L++H+ D L+ ++  E  T V IP  F
Sbjct  181   ELLKETVAVEKERMNAQVNNAKGKLDQINQIVDLISHVRDYLLKIEHFEPTTGVLIPPHF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTY+R  I++W+D GLT+CPKT QTLTHTNLIPNY VKA++A
Sbjct  241   LCPLSLELMLDPVIVASGQTYDRASIQKWLDNGLTICPKTHQTLTHTNLIPNYMVKAMVA  300

Query  1977  NWCEMNNIKLPD---PIKSLNVNQPSSHVAHVDSGAPRDIHIFSH  1852
             +WCE NN++L +     K ++++ PS++++  D     + H F++
Sbjct  301   SWCEENNLQLSNNSGHAKLISISSPSNYISSQDFTHTDNCHCFAN  345



>ref|XP_009417311.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009417312.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=300

 Score =   390 bits (1003),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 210/296 (71%), Positives = 256/296 (86%), Gaps = 2/296 (1%)
 Frame = -2

Query  1272  VETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLV  1093
             +++R D++  + +V +L+EDLKS S D QR ATAELRLLA+H M+NR+VI+NCGAISLLV
Sbjct  6     MDSRFDISGDESKVFELIEDLKSNSTDVQRAATAELRLLARH-MENRMVIANCGAISLLV  64

Query  1092  NLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLF  913
              LLHS D + QENAVTALLNLS++DN K AIANA AI+PLI+VL+TG+PEA+ENSAATL 
Sbjct  65    GLLHSTDPKTQENAVTALLNLSLSDN-KIAIANANAIDPLIHVLKTGNPEAQENSAATLL  123

Query  912   SLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVR  733
             SLSV E+NK++IGRSGA+  LV+LL NGT RGKKDA +AL+NLS L +NK RIVQAGA+ 
Sbjct  124   SLSVTEENKLQIGRSGAIGPLVELLANGTLRGKKDAVSALYNLSTLRDNKLRIVQAGAMS  183

Query  732   HLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAA  553
             HLVELMDPA GMVDKAVAVL+NLA+I EGR ++GQ+GGI +LVEVVELGSAR KENAAAA
Sbjct  184   HLVELMDPATGMVDKAVAVLANLASIPEGRNALGQDGGIFVLVEVVELGSARAKENAAAA  243

Query  552   LLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             LLQLC NS R+C++VLQ GAVPPLVALSQ GTPRA+EKA+ALL+ F+NQ + ++GR
Sbjct  244   LLQLCKNSGRFCSLVLQEGAVPPLVALSQFGTPRAKEKARALLNCFQNQGYLHSGR  299



>ref|XP_004289953.1| PREDICTED: U-box domain-containing protein 3-like [Fragaria vesca 
subsp. vesca]
Length=758

 Score =   407 bits (1045),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 203/299 (68%), Positives = 246/299 (82%), Gaps = 0/299 (0%)
 Frame = -2

Query  1278  PTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISL  1099
             P   + +D       V KL+EDLKS   D Q +A  ELRLLAKHNMDNRI+I  CGAI+ 
Sbjct  459   PFSSSESDGLTTTSHVMKLIEDLKSQLDDVQTMAAEELRLLAKHNMDNRIIIGQCGAITP  518

Query  1098  LVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAAT  919
             L++LL+SE   +QE+AVTALLNLSIN++NK+ IA AGAIEPLI+VL+TG+  AKENSAA 
Sbjct  519   LLSLLYSEVKIMQEHAVTALLNLSINEDNKAMIAEAGAIEPLIHVLKTGNDGAKENSAAA  578

Query  918   LFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGA  739
             LFSLSV+++ K KIGRSGAV++LVDLL +GT RGKKDAATALFNLSI HENK R+VQAGA
Sbjct  579   LFSLSVLDEYKAKIGRSGAVKALVDLLRSGTLRGKKDAATALFNLSIFHENKARLVQAGA  638

Query  738   VRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAA  559
             V++L+ELMDP  GM DKAVA+L+NL+TI EGR++I + GGIP+LVE+VE GS RGKEN+A
Sbjct  639   VKYLIELMDPDTGMADKAVALLANLSTIAEGRLAIARGGGIPLLVEIVESGSQRGKENSA  698

Query  558   AALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             + LLQLC +S ++C MVLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR G  G+G
Sbjct  699   SVLLQLCLHSPKFCTMVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGAMGKG  757


 Score =   219 bits (559),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 134/334 (40%), Positives = 201/334 (60%), Gaps = 8/334 (2%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G M+   +K L+N+IS   HL S + + S  + K Y+   D+LKLL+P+L  +VD  I S
Sbjct  10    GEMDTASIKCLINSISRLVHLVSCQTVKSVPIQKVYRTIVDVLKLLKPLLDEVVDYHIPS  69

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             D++L +    L   V+E RE  + W   SSK+   L++E L+ K++  SLKI   L    
Sbjct  70    DDILFQECEELDMVVNEAREFIENWSPKSSKLLSALRSEPLLIKIQNSSLKICCTLSRLL  129

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
                 + S L  L+ C+ +I+ +  E ++  + +A+K+  +    S+  L KI + LSL S
Sbjct  130   QSSSSRSGLMGLQQCMQEIERLKPERVTEYLEEALKSQTKDFMPSTKYLMKITELLSLTS  189

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTS--VQI  2170
             +QELL E +A+EK + N E  +   E+  I+Q++ LV+H+ +    M +S+  T+  + +
Sbjct  190   SQELLKESIAVEKERMNVEVRDIRGELAKIDQVVVLVSHIRE---FMVKSDHITASGIPV  246

Query  2169  PADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVK  1990
             P  F CPLS ELM DPVIVASGQTYER  I++W+D GL +CPKTR  LTHTNLIPNYT K
Sbjct  247   PPYFRCPLSSELMLDPVIVASGQTYERTSIQKWLDHGLIICPKTRHRLTHTNLIPNYTFK  306

Query  1989  ALIANWCEMNNIKLP---DPIKSLNVNQPSSHVA  1897
             A++ +WC+ NNI L        ++ V  PS H++
Sbjct  307   AMVESWCQENNIILAMNSHCTNAITVPSPSGHIS  340



>ref|XP_004970816.1| PREDICTED: U-box domain-containing protein 4-like [Setaria italica]
Length=806

 Score =   408 bits (1048),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 234/374 (63%), Positives = 282/374 (75%), Gaps = 17/374 (5%)
 Frame = -2

Query  1515  TLSNSNFSRANA-HDGNEVSSPTTASTEASMEVASESRHAATLAASRRE-SEFPSPVGTR  1342
             T S+SN   A A H   +VSS ++AS  A        R+   + +S  E +  P   G R
Sbjct  441   TSSSSNHLEAVAKHKEEQVSSNSSASETA--------RNDQMVTSSMVEPNRLPRFGGIR  492

Query  1341  LRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELR  1162
              R   +WR+ S++ V         ++R+D   V  QVR+L+EDLK+ S + QR A  EL 
Sbjct  493   SRSQLVWRQLSDKAV-------PADSRSDSPGVDVQVRRLIEDLKNESTELQRSAIGELL  545

Query  1161  LLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAI  982
             +L++H+M+NRI I+N GAI  LV+LL+S D   QE+AVT LLNLSINDNNK AIA A AI
Sbjct  546   ILSRHSMENRIAIANHGAIPFLVSLLYSADPSTQESAVTVLLNLSINDNNKIAIACANAI  605

Query  981   EPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAA  802
             EPLI+VLETG+PEAK NSAATLFSLSV E+NK KIGRSGA++ LVDLL +G  +GKKDAA
Sbjct  606   EPLIHVLETGNPEAKANSAATLFSLSVNEENKAKIGRSGAIKPLVDLLEDGNAQGKKDAA  665

Query  801   TALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEG  622
             TALFNLSI HENK RI++AGAV+ LVELMDPAAGMVDKAV+VLS LAT+QEGR  I Q G
Sbjct  666   TALFNLSIFHENKARIIEAGAVKPLVELMDPAAGMVDKAVSVLSILATVQEGRDGIAQAG  725

Query  621   GIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRARE  442
             GIP+LVEVVELGSAR KENAAAALLQLCTN+S++C++VLQ GA+PPLVALSQSGT RARE
Sbjct  726   GIPVLVEVVELGSARAKENAAAALLQLCTNNSKFCSLVLQEGAMPPLVALSQSGTARARE  785

Query  441   KAQALLSYFRNQRH  400
             KAQ LLS+FRNQR 
Sbjct  786   KAQVLLSFFRNQRQ  799


 Score =   244 bits (623),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 146/344 (42%), Positives = 212/344 (62%), Gaps = 6/344 (2%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSG  2674
             ++N+IS+F  L S   + +ELV +Y +K ++IL LL+ ++ G++  ++  D+ L  V   
Sbjct  9     IINSISNFRALFSSNAVETELVKRYGRKIDEILDLLKMVIDGVL-TQVTPDDKLLDVLEE  67

Query  2673  LGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLT  2494
             L  +++E  +L  +W  + SK+YF  Q ESLI K++ + L++ + L S    LP+E++  
Sbjct  68    LDVTINEALKLVGSWDWMMSKIYFATQVESLITKMQKYVLEVCQALNS--LMLPSETNCI  125

Query  2493  SLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELVa  2314
             S+   + K K    + ++A + +A ++ V  S   S+ LT I   LSL +NQELL+E VA
Sbjct  126   SV--YLEKAKQFHCDKMTAVVGEASRDLVGKSMPKSEQLTNIQVSLSLSTNQELLMEAVA  183

Query  2313  leklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLEL  2134
             L K++      +  E    +  I  LV +M D  +  KQ  S   V IPADFCCPLSLEL
Sbjct  184   LSKIRMRVSADDSAELDG-VNDISKLVNYMLDKHVEEKQMHSINGVPIPADFCCPLSLEL  242

Query  2133  MTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNI  1954
             M+DPVIVASGQTYER FI++W+DLG  VCPKTRQTL HTNLIPNYTVK LI NW E++ I
Sbjct  243   MSDPVIVASGQTYERVFIKKWLDLGYNVCPKTRQTLGHTNLIPNYTVKQLIENWSEIHGI  302

Query  1953  KLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPD  1822
              LPDP+K L+++ P       DS + R     +  R+N   SP+
Sbjct  303   VLPDPVKLLSLSFPVFLNLTNDSTSDRSRLSDNSPRSNMCGSPE  346



>ref|XP_006857297.1| hypothetical protein AMTR_s00067p00049340 [Amborella trichopoda]
 gb|ERN18764.1| hypothetical protein AMTR_s00067p00049340 [Amborella trichopoda]
Length=841

 Score =   407 bits (1047),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 252/319 (79%), Gaps = 7/319 (2%)
 Frame = -2

Query  1338  RPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRL  1159
             R P++W   SE     +++  TV +      +  QVRKLVE L S S   Q+ A AELRL
Sbjct  527   RDPSLWNPESEN--KNLMNPSTVGST-----MGNQVRKLVESLGSQSSQVQKEAAAELRL  579

Query  1158  LAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIE  979
             LAKH M+NR++I+ CGAI  LV+LL S+D + QENAVTALLNLSIN+ NK  I ++GAI+
Sbjct  580   LAKHEMENRVLIAECGAIPPLVSLLRSQDEKTQENAVTALLNLSINEKNKRLIVDSGAID  639

Query  978   PLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAAT  799
              LI VL +G+ EAKENSAATLFSLSVIE+ K+KIGRSGA+QSLV+LL +GT RGKKDAAT
Sbjct  640   SLIEVLNSGTSEAKENSAATLFSLSVIEEYKVKIGRSGAIQSLVELLNSGTLRGKKDAAT  699

Query  798   ALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGG  619
             ALFNLSI HENK RIV+AGAV+ L+ LMD   GMVDK+VAVLSNLATI EGR +I +EGG
Sbjct  700   ALFNLSIFHENKARIVKAGAVKCLIWLMDLTGGMVDKSVAVLSNLATIPEGRSAIAEEGG  759

Query  618   IPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREK  439
             IP LVEVVELGS RGKENAA+ LL LC NS+RYC +VLQ GAVPPLVALSQSGTPRA+EK
Sbjct  760   IPALVEVVELGSQRGKENAASTLLLLCMNSNRYCTLVLQEGAVPPLVALSQSGTPRAKEK  819

Query  438   AQALLSYFRNQRHGNAGRG  382
             AQ LLS+FRNQR GN  +G
Sbjct  820   AQQLLSHFRNQREGNVVKG  838


 Score =   241 bits (615),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/290 (44%), Positives = 190/290 (66%), Gaps = 1/290 (0%)
 Frame = -2

Query  2796  ELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSGLGHSVDELRELFQTWQLLS  2617
             E + K ++   ++LKLL+ +L   +D +  S+E L +V   L   V+E RE  ++W    
Sbjct  4     EPIQKDFRNIANLLKLLKTVLDEALDFDKHSEEALLRVLEDLDVLVNEAREFLESWHPKK  63

Query  2616  SKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLTSLENCVLKIKSMDYELLSA  2437
             SK+  V+Q+E ++ K++  SL+I  +  +        S +T +++C  ++K ++YE  + 
Sbjct  64    SKLCTVIQSELMLVKIQKSSLEICNMQETYLQSCLIPSHMTHIQHCRQELKCLEYERRTE  123

Query  2436  TITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELValeklkenaeqaekneevEY  2257
              I  A+++  E     S+ L  I + L+L SNQELLIE VALE+ +   E  +K    ++
Sbjct  124   AIEAALRDQKENLIPHSECLVNIMESLNLTSNQELLIESVALERERMKIESGKKKGAEDF  183

Query  2256  IEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIR  2077
             I QII L+ HM +CL  +KQSE+   +  P+ FCCPLSLELM+DPVIVASGQT+ER FI+
Sbjct  184   INQIIILLAHMRECLFNIKQSENEDGMP-PSYFCCPLSLELMSDPVIVASGQTFERAFIQ  242

Query  2076  RWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDPIKSL  1927
             +W+D G+ +CPKTRQTL HTNLIPNYTVKALI+NWCE+NN +L DPIK +
Sbjct  243   KWLDEGMDICPKTRQTLNHTNLIPNYTVKALISNWCEVNNKRLQDPIKPI  292



>ref|XP_010935918.1| PREDICTED: U-box domain-containing protein 3-like [Elaeis guineensis]
Length=792

 Score =   405 bits (1041),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 198/279 (71%), Positives = 243/279 (87%), Gaps = 0/279 (0%)
 Frame = -2

Query  1233  VRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQEN  1054
             V+KLVEDL+S + + QR A +ELRLLAKHNM+NR++I  CGA+  LV+LLHS+   VQEN
Sbjct  499   VQKLVEDLESQAPEVQRAAASELRLLAKHNMENRVLIVKCGAVPPLVSLLHSKVKRVQEN  558

Query  1053  AVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIG  874
             AVTALLNLSINDNNK +I  AGAIEPLI+VLE GS EAKENSAA LFSLSV+E+ K+KIG
Sbjct  559   AVTALLNLSINDNNKVSIVEAGAIEPLIHVLEYGSAEAKENSAAALFSLSVLEEYKVKIG  618

Query  873   RSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMV  694
             RSGA+++LV+LLG+G+ RGKKDAATALF+LSI HENK RIVQAGAV++LVEL+D + GMV
Sbjct  619   RSGAIKALVNLLGSGSLRGKKDAATALFSLSIFHENKARIVQAGAVKYLVELLDTSTGMV  678

Query  693   DKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCN  514
             DK+VAVL+NL T+ EG ++I Q+GGIP+LVE+VE GS RGKENAA+ALLQLC NS ++C+
Sbjct  679   DKSVAVLANLTTVPEGCLAISQQGGIPLLVEIVETGSQRGKENAASALLQLCLNSHKFCS  738

Query  513   MVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             +VLQ GAVPPL+ALSQ GTPRA+EKAQ +LS+FR+QR G
Sbjct  739   LVLQEGAVPPLIALSQFGTPRAKEKAQQILSHFRSQREG  777


 Score =   242 bits (617),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 143/338 (42%), Positives = 214/338 (63%), Gaps = 1/338 (0%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G M+  ++  L+N+IS F HL    ++ +  + K ++     LKLL+PIL    D++I S
Sbjct  15    GVMDGKIIGGLINSISRFIHLIGCNSMKTTFL-KDFKSIVGTLKLLKPILDEAYDSQIPS  73

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             D  L K F+ L  +V++ RE  +      SK+Y VLQ+ES++ KV+  S++I ++L    
Sbjct  74    DGQLIKAFAELDLAVNQAREFMEKRPQKMSKIYSVLQSESMMLKVQRSSIEICDVLSKLL  133

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
                   S L  +++C+ K++ ++ +L S  +  A+K+  E    S + L KI D L L +
Sbjct  134   QSSHHTSLLARIQHCLQKLQCIEQDLTSELVENALKDQREYVIPSIEDLIKIMDTLGLTT  193

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQELL+E +ALEK +  AE  EK E+ ++I QIIALVT M  C+  ++QS     + IP+
Sbjct  194   NQELLMERIALEKERSKAELKEKTEDADHISQIIALVTQMCCCVAKLEQSGFTNGLPIPS  253

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
               CCPLSL+LM DPVIVASGQTYER++I++W+D GL +CPKTRQ L HTNLIPN+TVKAL
Sbjct  254   HLCCPLSLQLMLDPVIVASGQTYERSYIQKWLDGGLRICPKTRQILAHTNLIPNFTVKAL  313

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRD  1870
             IANWC+ NN++  + ++S  ++ P    A +D   P +
Sbjct  314   IANWCKDNNVRPSNSVQSNCISNPFLTDAILDHFTPEN  351



>ref|XP_002866707.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH42966.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=710

 Score =   402 bits (1033),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 219/409 (54%), Positives = 290/409 (71%), Gaps = 25/409 (6%)
 Frame = -2

Query  1596  MPLSMNSV-SSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEV  1420
              PL + SV +S+ ENS    N               +A+A +  +V S + ++     EV
Sbjct  323   FPLLLESVRASSSENSSPIKN--------------GQADAEELRQVFSRSASAPGIVSEV  368

Query  1419  ASESRHA--ATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAE  1246
               +++ +  AT AA R  S+  S    +      WR P        +   T+      + 
Sbjct  369   VCKTKRSTNATAAADRSVSQARSNTPWKFPEERHWRHPG-------IIPATIRETGSSSS  421

Query  1245  VKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDME  1066
             ++ +V+KL+EDLKS+S+D QR ATA +R+L++++ DNRIVI+ CGAI  LV+LL+S D  
Sbjct  422   IETEVKKLIEDLKSSSLDTQREATARIRILSRNSTDNRIVIARCGAIPSLVSLLYSTDER  481

Query  1065  VQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGS-PEAKENSAATLFSLSVIEDN  889
             +Q +AVT LLNLSINDNNKS IA +GAIEPLI+VL+TG   EAK NSAATLFSLSVIE+ 
Sbjct  482   IQADAVTCLLNLSINDNNKSLIAESGAIEPLIHVLKTGYLEEAKANSAATLFSLSVIEEY  541

Query  888   KIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDP  709
             K +IG +GA++ LVDLLG+G+  GKKDAATALFNLSI HENK ++++AGAVR+LVELMDP
Sbjct  542   KTEIGEAGAIEPLVDLLGSGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELMDP  601

Query  708   AAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNS  529
             A GMV+KAV VL+NLAT++EG+++IG+EGGIP+LVEVVELGSARGKENA AALLQLCT+S
Sbjct  602   AFGMVEKAVVVLANLATVREGKIAIGEEGGIPVLVEVVELGSARGKENATAALLQLCTHS  661

Query  528   SRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              ++CN V++ G +PPLVAL++SGT R +EKAQ LL YF+  R  N  RG
Sbjct  662   PKFCNSVIREGVIPPLVALTKSGTARGKEKAQNLLKYFKVHRQNNQRRG  710


 Score =   302 bits (774),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 154/322 (48%), Positives = 229/322 (71%), Gaps = 0/322 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  L+VLL+NISS+  LSS+++++S    KYY + E+I  LL+P+L  ++D++ A  E
Sbjct  1     MEVSWLRVLLDNISSYLTLSSMDDLSSNPALKYYTRGEEISNLLKPVLENLIDSDAAPSE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL   F  L    DELRE F++WQ LS+++++VL+ ESL +K+R  SL++ +LL   +  
Sbjct  61    LLNNGFEELAQYCDELREQFESWQPLSTRIFYVLRIESLASKLRESSLEVFQLLKHCEQH  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA++   S E C+  +K +  + +S TI +A+K+   G G +S+ L KIA+   L+SNQ
Sbjct  121   LPADTISPSFEECIELVKLVARDEISYTIDQALKDQKNGVGPTSEVLVKIAESTGLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE V L  +KE+AE  + + E EYI+ +I+L T MH+ L  +KQ++    V++P+DF
Sbjct  181   EILIEGVVLTNMKEDAELTDNDTEAEYIDGLISLTTRMHEYLSDIKQAQLRCPVRVPSDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              C LSLELMTDPVIVASGQTYER FI++WID+GL VCPKTRQ+L+HT L PN+ V+A +A
Sbjct  241   RCSLSLELMTDPVIVASGQTYERVFIQKWIDMGLMVCPKTRQSLSHTTLTPNFIVRAFLA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQP  1912
             +WCE NN+  PDP++ ++ +QP
Sbjct  301   SWCETNNVYPPDPLELIHSSQP  322



>ref|XP_002306856.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE93852.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=748

 Score =   401 bits (1030),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 241/285 (85%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
             QV+KLVE LKS S + +  A  ELRLLAKHN++NRI+I + GAI  L++LL+SE    QE
Sbjct  462   QVKKLVEGLKSQSNEIKTKAAEELRLLAKHNVENRIIIGHSGAIRPLLSLLYSEVKITQE  521

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTA+LNLSIN+ NK+ IA AGAIEPLI+VL +G+  AKENSAA LFSLSV+E+ K KI
Sbjct  522   HAVTAVLNLSINEENKAMIAEAGAIEPLIHVLRSGNDGAKENSAAALFSLSVLEEYKAKI  581

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLL  GT RGKKDAATALFNLSI HENK RIVQAGAV++LVELMDP  GM
Sbjct  582   GRSGAVKALVDLLAYGTIRGKKDAATALFNLSIFHENKARIVQAGAVKYLVELMDPVTGM  641

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGRM+I + GGIP+LVEVVE GS RGKENAA+ L+QLC NS ++C
Sbjct  642   VDKAVALLANLSTISEGRMAIAKAGGIPLLVEVVESGSQRGKENAASILMQLCLNSPKFC  701

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FR+QR G+AG+G
Sbjct  702   TLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRSQREGSAGKG  746


 Score =   237 bits (605),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 132/331 (40%), Positives = 214/331 (65%), Gaps = 7/331 (2%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             ++ L+N IS F HL S +      + K Y+    +LK L+P+L G+VD  I+SDE+L K 
Sbjct  6     VRCLINTISRFIHLVSCQTRKFMPIQKDYKSMVMMLKHLKPVLDGVVDYSISSDEVLCKE  65

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L  +V+E RE  + W    SK+  V Q+E+L+ K+++ +L+I ++L       P+ S
Sbjct  66    CEELDTTVNEAREFMENWCPQMSKICSVQQSEALLKKIQSSALEICQILCRLLQSSPSAS  125

Query  2502  SLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIE  2323
             +LT +++C+ +++ + +E ++  I +A+++  +     ++ L K+ + L L SNQELL E
Sbjct  126   TLTIVQHCMQELQGLKHETITELIEEALRSLSDDVSPCTNHLMKLTETLGLTSNQELLKE  185

Query  2322  LValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLS  2143
              VA+EK + N +  +   +++ I+QI+ L++H+ + L+ +++ +  +   IP  F CPLS
Sbjct  186   SVAVEKERMNVKVNKAKGDLDQIDQIVDLISHIRNWLLKVERFDPKSGAPIPPYFRCPLS  245

Query  2142  LELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEM  1963
             LELM DPVIVASGQTY+R  I++W+D GL++CP+TRQTL+HTNLIPNYTVKA+IANWCE 
Sbjct  246   LELMLDPVIVASGQTYDRVSIQKWLDHGLSICPRTRQTLSHTNLIPNYTVKAMIANWCEE  305

Query  1962  NNIKLPDPIKSLNVNQPSSH-VAHVDSGAPR  1873
             NN+++         + PS H + H+DS   R
Sbjct  306   NNVRVSSD------SVPSHHDLLHLDSFRYR  330



>ref|XP_011004045.1| PREDICTED: U-box domain-containing protein 3-like [Populus euphratica]
Length=774

 Score =   401 bits (1031),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 242/285 (85%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
             QV+KLVE LKS S + +  A  ELRLLAKHN++NRI+I + GAI  L++LL+SE    QE
Sbjct  488   QVKKLVEGLKSQSNEVKTKAAEELRLLAKHNVENRIIIGHSGAIRPLLSLLYSEVKITQE  547

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTA+LNLSIN+ NK+ IA AGAIEPLI+VL +G+  AKENSAA LFSLSV+E+ K KI
Sbjct  548   HAVTAVLNLSINEENKAMIAEAGAIEPLIHVLRSGNDGAKENSAAALFSLSVLEEYKAKI  607

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLL +GT RGKKDAATALFNLSI HENK RIVQAGAV++LVELMDP  GM
Sbjct  608   GRSGAVKALVDLLASGTIRGKKDAATALFNLSIFHENKARIVQAGAVKYLVELMDPVTGM  667

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGRM+I + GGIP+LVEVVE GS RGKENAA+ L+QLC NS ++C
Sbjct  668   VDKAVALLANLSTIGEGRMAIAKAGGIPLLVEVVESGSQRGKENAASILMQLCLNSPKFC  727

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FR+QR G+AG+G
Sbjct  728   TLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRSQREGSAGKG  772


 Score =   239 bits (611),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 134/334 (40%), Positives = 216/334 (65%), Gaps = 7/334 (2%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             ++ L+N+IS F HL S +      + K Y+    +LK L+P+L G+VD  I+SDE+L K 
Sbjct  6     VRCLINSISRFIHLVSCQTRKFMPIQKDYKSMVMMLKHLKPVLDGVVDYSISSDEVLCKE  65

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L  +V+E RE  + W    SK+  V Q+E+L+ K+++ +L+I ++L       P+ S
Sbjct  66    CEELDTTVNEAREFMENWCPQMSKICSVQQSEALLKKIQSSALEICQILCRLLQSFPSAS  125

Query  2502  SLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIE  2323
             +LT +++C+ +++ + +E ++  I +A+++  +     ++ L K+ + L L SNQELL E
Sbjct  126   TLTIVQHCMQELQGLKHETITELIEEALRSLRDDVSPCTNHLMKLTETLGLTSNQELLKE  185

Query  2322  LValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLS  2143
              VA+EK + N +  +   +++ I+QI+ L++HM + L+ ++  +  +   IP  F CPLS
Sbjct  186   SVAVEKERMNVKVNKAKGDLDQIDQIVDLISHMCNWLLKVELFDPKSGAPIPPYFRCPLS  245

Query  2142  LELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEM  1963
             LELM DPVIVASGQTY+R  I++W D GL++CP+TRQTL+H NLIPNYTVKA+IANWCE 
Sbjct  246   LELMLDPVIVASGQTYDRVSIQKWFDHGLSICPRTRQTLSHRNLIPNYTVKAMIANWCEE  305

Query  1962  NNIKLPDPIKSLNVNQPSSH-VAHVDSGAPRDIH  1864
             NN++    + S ++  PS H + H+DS   R +H
Sbjct  306   NNVR----VSSNSI--PSHHDLLHLDSFRYRSLH  333



>ref|XP_008451242.1| PREDICTED: U-box domain-containing protein 3 [Cucumis melo]
 ref|XP_008451243.1| PREDICTED: U-box domain-containing protein 3 [Cucumis melo]
Length=775

 Score =   400 bits (1028),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 201/304 (66%), Positives = 249/304 (82%), Gaps = 0/304 (0%)
 Frame = -2

Query  1293  RIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNC  1114
             R+ S   VE+ +D       ++KL+ DLKS   + Q  A  ELRLLAK N++NR++I  C
Sbjct  471   RMDSLIPVESESDNLSGDLHIKKLIADLKSQRDEVQMKAAEELRLLAKDNVENRVIIGQC  530

Query  1113  GAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKE  934
             GAI  L++LL+SE   +QE+AVTALLNLSI +NNK+ IA AGAIEPLI+VL+TGS  AKE
Sbjct  531   GAIGPLLSLLYSEGKLIQEHAVTALLNLSIEENNKAMIAEAGAIEPLIHVLKTGSSAAKE  590

Query  933   NSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRI  754
             NSAA+LFSLSV+E+ K KIGRSGA+++LV+LLG GT RGKKDAATALFNLSI HENK RI
Sbjct  591   NSAASLFSLSVLEEYKAKIGRSGAIRALVELLGAGTLRGKKDAATALFNLSIFHENKARI  650

Query  753   VQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARG  574
             VQAGAV++LVEL+D A GMVDKA A+L+NL+TI EGR++I +EGGIP+LVE+VE G+ RG
Sbjct  651   VQAGAVKYLVELLDTATGMVDKAAALLANLSTISEGRLAIAREGGIPLLVEIVETGTMRG  710

Query  573   KENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGN  394
             KENAA+ LLQLC +S+++C +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR G 
Sbjct  711   KENAASILLQLCLHSNKFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQRDGT  770

Query  393   AGRG  382
              G+G
Sbjct  771   TGKG  774


 Score =   178 bits (452),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 116/305 (38%), Positives = 184/305 (60%), Gaps = 0/305 (0%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             ++ L N+IS F HL S        + K  +    +LKLL+ +L  ++  +++SDEL    
Sbjct  6     VQCLTNSISRFIHLVSCHTTKPLPLPKKCRNLVVVLKLLKVVLDDVISLKLSSDELFYSE  65

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L  +V+E RE  + W   +SK+   L+ + L+ K+++ S  I E++      +   S
Sbjct  66    CESLDTAVNEAREFIENWCPKTSKICSALKCDPLLIKIQSSSQVICEIIWKLSESVSCSS  125

Query  2502  SLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIE  2323
             SL++++ C+  ++S+  E +S +I +A+ +   G G +S+ L K+ + L L SNQELL E
Sbjct  126   SLSAVQKCLEGLQSLKQERISDSIEEALISQRSGIGPNSEHLLKLIEALHLTSNQELLKE  185

Query  2322  LValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLS  2143
              +A+EK + NAE+    +E+ +I QI+ L+  + D ++          V +P+ F CPLS
Sbjct  186   TIAVEKERINAERNNAKKELHHINQIMDLIIRIRDWMVRKDYFHGINGVSVPSYFRCPLS  245

Query  2142  LELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEM  1963
             LELM DPVIVASGQTY+R+ I++WID GL +CP T Q LTHTNLI N+TVKA+I +WC+ 
Sbjct  246   LELMLDPVIVASGQTYDRSSIQKWIDSGLNICPNTHQMLTHTNLISNHTVKAMILSWCDE  305

Query  1962  NNIKL  1948
             N +  
Sbjct  306   NKLNF  310



>gb|KHG15816.1| U-box domain-containing 3 -like protein [Gossypium arboreum]
Length=784

 Score =   399 bits (1025),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 222/398 (56%), Positives = 274/398 (69%), Gaps = 32/398 (8%)
 Frame = -2

Query  1542  HNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVASESRHAATLAASRRESEF  1363
             HNRT SA ST+ + +++            PT AS + SM       +     +S+    F
Sbjct  394   HNRTESASSTIYSVDYA------------PTPASNDLSMRSKKNEMNELAEISSKSLGNF  441

Query  1362  PSP----------------VGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQV  1231
             PS                  GT++           R  S   S P  +   DL      V
Sbjct  442   PSTKEYGVSHSIMGKQLQVSGTKIEDAVNGNHNYNRACSSAFSRPGCD---DLI-TSSHV  497

Query  1230  RKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENA  1051
             + LV++L+S S + Q  A AELRLLAKHNMDNRI+I  CGAI+ L+ LL+SE    QE+A
Sbjct  498   KNLVDNLQSVSNEVQTTAAAELRLLAKHNMDNRIIIGRCGAIAPLLPLLYSEVKITQEHA  557

Query  1050  VTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGR  871
             VTALLNLSIN++NK+ IA +GAIEPLI+VL++G+  AKEN+AA LFSLSV+E+ K +IGR
Sbjct  558   VTALLNLSINEDNKAVIAKSGAIEPLIHVLKSGNDGAKENAAAALFSLSVLEECKARIGR  617

Query  870   SGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
             SGAV++LV+LL +GT RGKKDA  ALFNLSI HENK RIVQAGAV++LVELMDP  GMVD
Sbjct  618   SGAVKALVNLLSSGTLRGKKDAVAALFNLSIFHENKARIVQAGAVKYLVELMDPDNGMVD  677

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+LSNL+TI EGR++I +E GIPILVEV+E GS RGKENAA+ LLQLC NS ++C +
Sbjct  678   KAVALLSNLSTIGEGRLAIVRESGIPILVEVIESGSRRGKENAASVLLQLCLNSPKFCTL  737

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             VLQ GAVPPLVALSQSGTPRA+EKAQ LL +FRNQR G
Sbjct  738   VLQEGAVPPLVALSQSGTPRAKEKAQQLLGHFRNQREG  775


 Score =   201 bits (511),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 132/338 (39%), Positives = 209/338 (62%), Gaps = 10/338 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+   ++ L+N+IS F HL S + I    V K Y+    +LKLL+P+L  +++ EI SD+
Sbjct  1     MDTTSVRCLVNSISRFIHLVSCQAIKVAPVEKDYRNMVIVLKLLKPLLDDVIECEIPSDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVS--SD  2524
             +L K    L   V+E RE  + W    SK++  ++ E+L   +   S    E  +S  S 
Sbjct  61    ILYKECEELDMLVNEAREFMENWCPKMSKIHRFIE-ENLNDTLLGISANGGEAAISLRSC  119

Query  2523  WCLP------AESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIAD  2362
              C P      + SS+TS+++C+ +IKSM+ E  S  I +A+++  + +   +D L  +  
Sbjct  120   TCKPLLQSTPSSSSITSVQHCMREIKSMEQERPSENIGQALRSKKDDAIPCTDHLINVMK  179

Query  2361  CLSLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCT  2182
              L+L SNQELL E +ALE+ + +A+      +++ I QI+ L++H+ D ++ ++  E  +
Sbjct  180   SLNLMSNQELLKETLALERERTDAQVNNAKVKIDQINQIMDLISHIRDYMLKIEHFEPTS  239

Query  2181  SVQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPN  2002
              + IP  F CPLSL LM DPV VASGQTY+R  I++W+D GLT+CPKTRQTL H NLIPN
Sbjct  240   GILIPPGFLCPLSLGLMLDPVFVASGQTYDRASIQKWLDSGLTICPKTRQTLAHKNLIPN  299

Query  2001  YTVKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVD  1888
             YTVKA++ +WCE NN++L +    ++++ PS+H++  D
Sbjct  300   YTVKAMVTSWCEENNLQLSNA-NLVSISSPSNHISSRD  336



>ref|XP_009336148.1| PREDICTED: U-box domain-containing protein 3-like [Pyrus x bretschneideri]
Length=784

 Score =   399 bits (1024),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 199/299 (67%), Positives = 245/299 (82%), Gaps = 0/299 (0%)
 Frame = -2

Query  1278  PTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISL  1099
             P   + +D       VRKL+EDL+S S + Q +A  ELRLL K N +NR +I  CGAI+ 
Sbjct  485   PFSSSGSDELTTASHVRKLIEDLQSQSNEVQTMAAEELRLLGKRNTENRTMIGQCGAITP  544

Query  1098  LVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAAT  919
             L++LL+S  M  QE+AVTALLNLSIN++NK+ IA AGAI+PLI+VL+TGS  AKENSAA 
Sbjct  545   LLSLLYSGVMITQEHAVTALLNLSINEDNKAMIAEAGAIDPLIHVLKTGSDGAKENSAAA  604

Query  918   LFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGA  739
             LFS+SV+++ K KIGRSGAV++LVDLL +GT RGKKDAATALFNLSI HENK R+VQAGA
Sbjct  605   LFSISVLDEYKAKIGRSGAVKALVDLLASGTLRGKKDAATALFNLSIFHENKVRLVQAGA  664

Query  738   VRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAA  559
             V+HL++LMDP  GMVDKAVA+L+NL+TI EGR++I +EGGIP+LVE+VE GS RGKENAA
Sbjct  665   VKHLIDLMDPDTGMVDKAVALLANLSTIAEGRVAIAREGGIPLLVEIVESGSQRGKENAA  724

Query  558   AALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             + LLQLC +S ++C +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR G  G+G
Sbjct  725   SILLQLCLHSPKFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGAMGKG  783


 Score =   234 bits (598),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 140/329 (43%), Positives = 210/329 (64%), Gaps = 3/329 (1%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L+N+IS F HL S +      + K Y+   D+LKLL+P+L  +VD +I SD++L K 
Sbjct  6     IKCLINSISRFVHLVSSQTSKHIPIQKDYRTIVDVLKLLKPLLDEVVDFKIPSDDILYKE  65

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L  +V+  RE  + W   SSK+     +E L+  +++ SLKI  +L        + S
Sbjct  66    CDELDMAVNGAREFMEKWSPKSSKILSAWWSEPLLITIQSSSLKICGILPRMLQSSSSGS  125

Query  2502  SLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIE  2323
             SLT L++C+ +I+S+  E +S  + +A+K+  +    S+  L  I + L+L SNQELL E
Sbjct  126   SLTGLQHCMQEIQSLKLERVSEYLEEALKSPRKDVMPSTKLLMTIIELLNLTSNQELLKE  185

Query  2322  LValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLS  2143
              +A+EK + N E ++   E++ I QI+ LV+H+ + ++ ++  E+ + V IP+ F CPLS
Sbjct  186   SIAVEKERMNVEVSDVRGELDQINQIVVLVSHIREFMVKIEHLETASGVPIPSYFRCPLS  245

Query  2142  LELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEM  1963
              ELM DPVIVASGQTYER+ I++WID GLT+CPKTRQ L+HTNL+PNYTVKA+I +WC+ 
Sbjct  246   SELMLDPVIVASGQTYERSSIQKWIDHGLTICPKTRQRLSHTNLLPNYTVKAMIESWCQE  305

Query  1962  NNIKLP---DPIKSLNVNQPSSHVAHVDS  1885
             N+IKL    D   ++ V  PS  V+  DS
Sbjct  306   NDIKLTANSDGSNAILVPSPSDQVSPADS  334



>ref|XP_004148950.1| PREDICTED: U-box domain-containing protein 3-like [Cucumis sativus]
 ref|XP_004169427.1| PREDICTED: U-box domain-containing protein 3-like [Cucumis sativus]
 gb|KGN44724.1| hypothetical protein Csa_7G374670 [Cucumis sativus]
Length=775

 Score =   398 bits (1023),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 201/304 (66%), Positives = 250/304 (82%), Gaps = 0/304 (0%)
 Frame = -2

Query  1293  RIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNC  1114
             R+ S   VE+ +D       ++KL+ DLKS   + Q  A  ELRLLAK N++NR++I  C
Sbjct  471   RMDSLIPVESESDNLSGDLHIKKLIADLKSQRDEVQMKAAEELRLLAKDNVENRVIIGQC  530

Query  1113  GAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKE  934
             GAI  L++LL+SE   +QE+AVTALLNLSI++NNK+ IA AGAIEPLI+VL+TGS  AKE
Sbjct  531   GAIGPLLSLLYSEGKLIQEHAVTALLNLSIDENNKAMIAEAGAIEPLIHVLKTGSSAAKE  590

Query  933   NSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRI  754
             NSAA+LFSLSV+E+ K KIGRSGA+++LV+LLG GT RGKKDAATALFNLSI HENK RI
Sbjct  591   NSAASLFSLSVLEEYKAKIGRSGAIRALVELLGVGTLRGKKDAATALFNLSIFHENKARI  650

Query  753   VQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARG  574
             VQAGAV++LVEL+D A GMVDKA A+L+NL+TI EGR++I +EGGIP+LVE+VE G+ RG
Sbjct  651   VQAGAVKYLVELLDTATGMVDKAAALLANLSTISEGRLAIAREGGIPLLVEIVETGTMRG  710

Query  573   KENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGN  394
             KENAA+ LLQLC +S+++C +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR G 
Sbjct  711   KENAASILLQLCLHSNKFCILVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQRDGT  770

Query  393   AGRG  382
              G+G
Sbjct  771   TGKG  774


 Score =   179 bits (454),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 184/305 (60%), Gaps = 0/305 (0%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             ++ L N+IS F HL S        + K  +    +LKLL+ +L  ++  +++SDELL   
Sbjct  6     VQCLTNSISRFIHLVSCHTTKPLPLPKKCKNLVVVLKLLKVVLDDVISLKLSSDELLYSE  65

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L  +V+E RE  + W   +SK+   L+ + L+ K+++ S  I E++      +   S
Sbjct  66    CESLDAAVNEAREFVENWCPKTSKICSALKCDPLLIKIQSSSQVICEIIWKLSESVSCSS  125

Query  2502  SLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIE  2323
             SL++++ C+  ++S+  E +S +I +A+ +   G G +S+ L K+ + L L SNQELL E
Sbjct  126   SLSAVQKCLEGLQSLKQERISDSIEEALISQRSGIGPNSEHLLKLIEALHLTSNQELLKE  185

Query  2322  LValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLS  2143
              +A+EK + NA +    EE+ +I QI+ L+  + D ++          V +P+ F CPLS
Sbjct  186   TIAVEKERINAARNNAKEELHHINQIMDLIIRIRDWMVRKDYFHGINGVSVPSYFRCPLS  245

Query  2142  LELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEM  1963
             LELM DPVIVASGQTY+R+ I++WID GL +CP T Q LTHTNLI N+TVKA+I +WC+ 
Sbjct  246   LELMLDPVIVASGQTYDRSSIQKWIDSGLNICPNTHQMLTHTNLISNHTVKAMILSWCDE  305

Query  1962  NNIKL  1948
             N +  
Sbjct  306   NKLNF  310



>ref|XP_010262328.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010262329.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010262330.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Nelumbo nucifera]
Length=793

 Score =   398 bits (1023),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 202/300 (67%), Positives = 247/300 (82%), Gaps = 0/300 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             +R +S P +++  D       V KLVEDLKS S + Q  A  ELRLL KHNM+NRI+I+ 
Sbjct  483   NRSLSLPLLDSGLDNMASSSYVEKLVEDLKSQSNEVQTAAATELRLLGKHNMENRIIIAQ  542

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI  LV+LL+S++   QE+AVTALLNLSIND+NK+ IA AGAIEPLI+VL+TG+  AK
Sbjct  543   CGAIPPLVSLLYSDEKMTQEHAVTALLNLSINDDNKAMIAEAGAIEPLIHVLKTGNAGAK  602

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAATLFSLSV+E  K+KIGRSGAV++LVDLL +GT RGKKDAATALFNLSI HENK R
Sbjct  603   ENSAATLFSLSVLEQYKVKIGRSGAVKALVDLLRSGTLRGKKDAATALFNLSISHENKAR  662

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IV+AGAV++LVE++DPA GM++KAVA+L+NL+TI EG  +IG+EGGIP LVE++E GS R
Sbjct  663   IVRAGAVKYLVEMLDPATGMLEKAVALLANLSTIPEGCSAIGREGGIPPLVEILETGSQR  722

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAA+ LLQLC NS R+C +VLQ GAVPPLVALSQSGT RA+EK+Q LL++FR QR G
Sbjct  723   GKENAASILLQLCINSRRFCTLVLQEGAVPPLVALSQSGTTRAKEKSQQLLTHFRTQREG  782


 Score =   238 bits (607),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 140/356 (39%), Positives = 212/356 (60%), Gaps = 15/356 (4%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+   ++ L+N+ S F HL++ + + S  + K Y+    +LKLL+P+L  +VD ++  +E
Sbjct  1     MDTRSIRCLVNSFSRFIHLAACQTVKSVPIQKDYRYMVGLLKLLKPVLDEVVDHKVPMNE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    +  +V+E RE  + W    SK+  VLQ+E L  K++  S++I  +L  +   
Sbjct  61    HLLKECEEMDVAVNEAREFMEKWSSKMSKICSVLQSEPLATKIQRSSMEICHILCRTLQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
                 S L  ++ C+ +I+    E +S  I +A+ +        +++L KI + L L SN 
Sbjct  121   SQYASLLAHVQKCIQEIQCFGQEKISELIEEAMIDQRNNVIPRTENLIKIVEILGLTSNH  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +ALEK +   +   K EE+++I+QI+ LV ++ +C++ ++   +   V IP+ F
Sbjct  181   ELLAESIALEKERMKDQFKTKKEELDHIDQIVYLVANIRNCMVKLEPFVAINGVPIPSYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTYER FI++W+D GLT+CP+TRQTLTHTNLIPNYTVKALI 
Sbjct  241   RCPLSLELMLDPVIVASGQTYERAFIQKWLDHGLTLCPQTRQTLTHTNLIPNYTVKALIR  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHG  1810
             NWC+ NNI+L +   S N+           SG    + +F H+        DS HG
Sbjct  301   NWCDQNNIRLCNTSASNNI-----------SG----LSLFGHTCPQYFIHTDSFHG  341



>ref|XP_008440337.1| PREDICTED: U-box domain-containing protein 4 [Cucumis melo]
 ref|XP_008440338.1| PREDICTED: U-box domain-containing protein 4 [Cucumis melo]
Length=320

 Score =   380 bits (977),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 254/306 (83%), Gaps = 1/306 (0%)
 Frame = -2

Query  1320  RRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNM  1141
             ++P ER+V  IVS+P +E  +DL  +K +V+KLVEDL+S S++  R +TAELRLL K + 
Sbjct  11    QQPYERMVHEIVSTPVLEVISDLTGIKAKVQKLVEDLRSDSLETLRTSTAELRLLTKIDA  70

Query  1140  DNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVL  961
             +N  VI++ GAISLLVNLL+S D ++QENAVTAL+NLSI++N K+ I  A AIEPLI+VL
Sbjct  71    NNWTVIADYGAISLLVNLLNSTDTKIQENAVTALVNLSIDNNCKTIIVQANAIEPLIHVL  130

Query  960   ETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLS  781
             +TGSPEAKENSAATL SLSV++DN++ IGRSGA+  LVDLL +GTPRGK+DAATALFNLS
Sbjct  131   QTGSPEAKENSAATLGSLSVVDDNQVNIGRSGAIGPLVDLLKDGTPRGKRDAATALFNLS  190

Query  780   ILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVE  601
             +L ENK +IV+AG+++HLV+LMDPA GMV+KAV VL+NLA+  EGR+ I +EGGI +LV+
Sbjct  191   LLSENKPKIVEAGSIKHLVKLMDPATGMVEKAVTVLANLASTDEGRIEIVREGGIALLVD  250

Query  600   VVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLS  421
              +ELGSAR KE AAAALL LC  +SRYC M +Q GA+PPLVALSQSGT RA+EKA+ALL+
Sbjct  251   TIELGSARAKEYAAAALLWLCGITSRYCIMAIQEGAIPPLVALSQSGTARAKEKARALLT  310

Query  420   YF-RNQ  406
              F RN+
Sbjct  311   CFSRNK  316



>ref|XP_004495092.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Cicer arietinum]
Length=761

 Score =   395 bits (1016),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 239/285 (84%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V KL+EDL+S S++ Q  A  ELRLL KHN +NRI++  CGA+  L++LL+S+    QE
Sbjct  475   HVNKLIEDLRSQSIEVQTTAAEELRLLTKHNTENRIIVGQCGAVKPLLSLLYSDGNLTQE  534

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN++NK+ I  AGAI+PLI+VL+TG+  AKENSAA LFSLSV+E++K KI
Sbjct  535   HAVTALLNLSINEDNKALIMEAGAIDPLIHVLKTGNDGAKENSAAALFSLSVLENSKAKI  594

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLL +GT RGKKDAATAL+NLSI HENK RIVQAGAV+ LV++MDP  GM
Sbjct  595   GRSGAVKALVDLLASGTLRGKKDAATALYNLSIFHENKARIVQAGAVKFLVQMMDPDDGM  654

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKA+A+LSNL+TI EGR+ I +EGGIP+LVE+VE GS RGKENAA+ LLQLC +SSR+C
Sbjct  655   VDKAIALLSNLSTIAEGRLEIAREGGIPLLVEIVESGSQRGKENAASILLQLCLHSSRFC  714

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGT RA+EKAQ LLS+FRNQR G  G+G
Sbjct  715   TLVLQEGAVPPLVALSQSGTLRAKEKAQQLLSHFRNQREGATGKG  759


 Score =   216 bits (549),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 187/302 (62%), Gaps = 0/302 (0%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L+N+IS F  L S + +      K      ++LK L+P+L  ++D  I+S E L KV
Sbjct  11    VKCLINSISRFILLVSCQTVKPMPFQKICNNMVEVLKRLKPVLDDVMDYNISSHENLCKV  70

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L   V+E R+  + W    SK++ VLQ+ +L+ K+++ SL I  ++V S    P+ S
Sbjct  71    CEELDIRVNEARDFIENWGPKKSKIHSVLQSGTLLIKLQSTSLDICHMIVKSLQSPPSAS  130

Query  2502  SLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIE  2323
              L +L++ + +++ +  E     I KA++N  +    S + L +I + L L SNQELL E
Sbjct  131   VLANLQHYIQELQCLKKETAMVYIEKALRNQRDNIEPSYEHLKEIIELLKLASNQELLKE  190

Query  2322  LValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLS  2143
              +A+EK + N E  +   E+E I +I+ LV ++ D ++  +     + V +P  F CPLS
Sbjct  191   SIAVEKERLNMEGHKMIGELEEINEIVNLVRNICDYVVKTECFSVKSGVSLPPYFRCPLS  250

Query  2142  LELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEM  1963
             LELM DPVIVASGQTYER  I++W+D GLTVCPKTRQ LTHTNLIPNYTVKA+I+ WCE 
Sbjct  251   LELMLDPVIVASGQTYERQSIQKWLDHGLTVCPKTRQRLTHTNLIPNYTVKAMISTWCEE  310

Query  1962  NN  1957
             NN
Sbjct  311   NN  312



>ref|XP_011013568.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Populus euphratica]
 ref|XP_011013569.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Populus euphratica]
 ref|XP_011013571.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Populus euphratica]
 ref|XP_011013572.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Populus euphratica]
Length=784

 Score =   396 bits (1018),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 199/285 (70%), Positives = 240/285 (84%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
             QV+KLVE LKS S + +  A  ELRLLAKHN++NRI+I + GAI  L+++L SE    QE
Sbjct  498   QVKKLVEGLKSQSNEVKTKAAEELRLLAKHNVENRIIIGHSGAIRPLLSMLSSEVKLTQE  557

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN+ NK+ IA AGAIEP+I+VL +G+  A+ENSAA LFSLSV+E+ K KI
Sbjct  558   HAVTALLNLSINEENKAIIAEAGAIEPIIHVLRSGNDGARENSAAALFSLSVLEEYKAKI  617

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLLG+GT RGKKDAAT LFNLSI HENK RIVQAGAV++LVELMDP  GM
Sbjct  618   GRSGAVKALVDLLGSGTLRGKKDAATTLFNLSIFHENKARIVQAGAVKYLVELMDPVTGM  677

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGRM+I + GGIP+LVEVVE GS RGKENAA+ L+QLC NS ++C
Sbjct  678   VDKAVALLANLSTIGEGRMAIAKAGGIPLLVEVVESGSQRGKENAASILMQLCLNSPKFC  737

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FR+QR  +AG+G
Sbjct  738   TLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRSQREASAGKG  782


 Score =   227 bits (578),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 133/333 (40%), Positives = 203/333 (61%), Gaps = 2/333 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME   ++ L+N+IS F HL S +      + K Y+    +LK L+P+L  + D  I+SDE
Sbjct  1     MEKSSVRCLINSISRFMHLVSCQTKKYLPIQKDYEIMVIMLKHLKPVLDEVDDYNISSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +  +    L  +V+E RE  + W    S++  V Q+E+L+ K+++ +L+I + L      
Sbjct  61    IPCRECEELDAAVNEAREFMEKWCPQMSRICSVQQSEALLKKIQSSALEICQALCRLLHG  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P  SSLT +++C+ ++K + +E ++  I +A+++  +     +D L K+   LSL SNQ
Sbjct  121   SPTTSSLTIVQHCMQELKGLKHETITEIIEEALRSLKDDVVPCTDHLMKLIQTLSLTSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E VA+EK + N    +    +  I+QI+ L+T +   L+ ++  +  +   IP  F
Sbjct  181   ELLKESVAVEKERTNVHINKAEGYLYQIDQIVDLITQIRSWLLKVEHRDPKSGAPIPPYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTY+R  I++W+D GLT CP+TRQTL+HTN IPNYTVKA+IA
Sbjct  241   RCPLSLELMLDPVIVASGQTYDRVSIQKWLDHGLTFCPRTRQTLSHTNFIPNYTVKAMIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSH--VAHVDS  1885
             NWCE NN+++       N    SSH  + H+DS
Sbjct  301   NWCEENNVRVSGHSDCNNHVLASSHHDLLHLDS  333



>ref|XP_011028811.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Populus euphratica]
 ref|XP_011028813.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Populus euphratica]
 ref|XP_011028814.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Populus euphratica]
 ref|XP_011028815.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Populus euphratica]
Length=784

 Score =   395 bits (1016),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 199/285 (70%), Positives = 240/285 (84%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
             QV+KLVE LKS S + Q  A  ELRLLAKH+M+NRI+I + GAI  L+++L SE    QE
Sbjct  498   QVKKLVEGLKSLSNEVQTKAAEELRLLAKHDMENRIIIGHSGAIRPLLSMLSSEVKLTQE  557

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN+ NK+ IA AGAIEP+I+VL +G+  A+ENSAA LFSLSV+E+ K KI
Sbjct  558   HAVTALLNLSINEENKAIIAEAGAIEPIIHVLRSGNDGARENSAAALFSLSVLEEYKAKI  617

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLLG+GT RGKKDAAT LFNLSI HENK RIVQAGAV++LVELMDP  GM
Sbjct  618   GRSGAVKALVDLLGSGTLRGKKDAATTLFNLSIFHENKARIVQAGAVKYLVELMDPVTGM  677

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGR++I + GGIP+LVEVVE GS RGKENAA+ L+QLC +S R+C
Sbjct  678   VDKAVALLANLSTIGEGRLAIAKAGGIPLLVEVVESGSQRGKENAASILMQLCLSSPRFC  737

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FR+QR  +AG+G
Sbjct  738   TLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRSQREASAGKG  782


 Score =   227 bits (578),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 133/333 (40%), Positives = 203/333 (61%), Gaps = 2/333 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME   ++ L+N+IS F HL S +      + K Y+    +LK L+P+L  + D  I+SDE
Sbjct  1     MEKSSVRCLINSISRFMHLVSCQTKKYLPIQKDYEIMVIMLKHLKPVLDEVDDYNISSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +  +    L  +V+E RE  + W    S++  V Q+E+L+ K+++ +L+I + L      
Sbjct  61    IPCRECEELDAAVNEAREFMEKWCPQMSRICSVQQSEALLKKIQSSALEICQALCRLLHG  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P  SSLT +++C+ ++K + +E ++  I +A+++  +     +D L K+   LSL SNQ
Sbjct  121   SPTTSSLTIVQHCMQELKGLKHETITEIIEEALRSLKDDVVPCTDHLMKLIQTLSLTSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E VA+EK + N    +    +  I+QI+ L+T +   L+ ++  +  +   IP  F
Sbjct  181   ELLKESVAVEKERTNVHINKAEGYLYQIDQIVDLITQIRSWLLKVEHRDPKSGAPIPPYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTY+R  I++W+D GLT CP+TRQTL+HTN IPNYTVKA+IA
Sbjct  241   RCPLSLELMLDPVIVASGQTYDRVSIQKWLDHGLTFCPRTRQTLSHTNFIPNYTVKAMIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSH--VAHVDS  1885
             NWCE NN+++       N    SSH  + H+DS
Sbjct  301   NWCEENNVRVSGHSDCNNHVLASSHHDLLHLDS  333



>ref|XP_004495091.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Cicer arietinum]
Length=784

 Score =   395 bits (1015),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 239/285 (84%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V KL+EDL+S S++ Q  A  ELRLL KHN +NRI++  CGA+  L++LL+S+    QE
Sbjct  498   HVNKLIEDLRSQSIEVQTTAAEELRLLTKHNTENRIIVGQCGAVKPLLSLLYSDGNLTQE  557

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN++NK+ I  AGAI+PLI+VL+TG+  AKENSAA LFSLSV+E++K KI
Sbjct  558   HAVTALLNLSINEDNKALIMEAGAIDPLIHVLKTGNDGAKENSAAALFSLSVLENSKAKI  617

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLL +GT RGKKDAATAL+NLSI HENK RIVQAGAV+ LV++MDP  GM
Sbjct  618   GRSGAVKALVDLLASGTLRGKKDAATALYNLSIFHENKARIVQAGAVKFLVQMMDPDDGM  677

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKA+A+LSNL+TI EGR+ I +EGGIP+LVE+VE GS RGKENAA+ LLQLC +SSR+C
Sbjct  678   VDKAIALLSNLSTIAEGRLEIAREGGIPLLVEIVESGSQRGKENAASILLQLCLHSSRFC  737

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGT RA+EKAQ LLS+FRNQR G  G+G
Sbjct  738   TLVLQEGAVPPLVALSQSGTLRAKEKAQQLLSHFRNQREGATGKG  782


 Score =   216 bits (550),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 187/302 (62%), Gaps = 0/302 (0%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L+N+IS F  L S + +      K      ++LK L+P+L  ++D  I+S E L KV
Sbjct  11    VKCLINSISRFILLVSCQTVKPMPFQKICNNMVEVLKRLKPVLDDVMDYNISSHENLCKV  70

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L   V+E R+  + W    SK++ VLQ+ +L+ K+++ SL I  ++V S    P+ S
Sbjct  71    CEELDIRVNEARDFIENWGPKKSKIHSVLQSGTLLIKLQSTSLDICHMIVKSLQSPPSAS  130

Query  2502  SLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIE  2323
              L +L++ + +++ +  E     I KA++N  +    S + L +I + L L SNQELL E
Sbjct  131   VLANLQHYIQELQCLKKETAMVYIEKALRNQRDNIEPSYEHLKEIIELLKLASNQELLKE  190

Query  2322  LValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLS  2143
              +A+EK + N E  +   E+E I +I+ LV ++ D ++  +     + V +P  F CPLS
Sbjct  191   SIAVEKERLNMEGHKMIGELEEINEIVNLVRNICDYVVKTECFSVKSGVSLPPYFRCPLS  250

Query  2142  LELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEM  1963
             LELM DPVIVASGQTYER  I++W+D GLTVCPKTRQ LTHTNLIPNYTVKA+I+ WCE 
Sbjct  251   LELMLDPVIVASGQTYERQSIQKWLDHGLTVCPKTRQRLTHTNLIPNYTVKAMISTWCEE  310

Query  1962  NN  1957
             NN
Sbjct  311   NN  312



>gb|KHG28018.1| U-box domain-containing 3 -like protein [Gossypium arboreum]
Length=776

 Score =   395 bits (1014),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 242/285 (85%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V+ LV++LKS S + Q  A AELR LAKHNM+NRI+I  CGAI+ L++LL+SE    QE
Sbjct  490   HVKMLVDNLKSLSNEVQTAAAAELRFLAKHNMENRIIIGQCGAIAPLLSLLYSEVKLTQE  549

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN++NK+ IA  GAIEPLI+VL++G+  AKENSAA LFSLSV+E+ K +I
Sbjct  550   HAVTALLNLSINEDNKARIAKLGAIEPLIHVLKSGNDGAKENSAAALFSLSVLEEYKARI  609

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LV+LLG+GT RG+KDAATALFNLSI HENK RIVQAG V++LV+ +DP +GM
Sbjct  610   GRSGAVKALVNLLGSGTLRGRKDAATALFNLSIFHENKTRIVQAGTVKYLVKFLDPDSGM  669

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+LSNL+TI EGR++I QEGGIP+L+EVVE GS RGKENAA+ALLQLC NSS++C
Sbjct  670   VDKAVALLSNLSTITEGRLAIVQEGGIPVLIEVVESGSPRGKENAASALLQLCLNSSKFC  729

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VL  GA+P LVALSQSGTPRA+EKAQ LLS+FR++R G  G+G
Sbjct  730   TLVLYEGAIPSLVALSQSGTPRAKEKAQQLLSHFRSRREGATGKG  774


 Score =   221 bits (564),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 135/361 (37%), Positives = 220/361 (61%), Gaps = 3/361 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME   ++ L+N+IS F HL+S + I    + K Y+    +LK+L+P+L  IVD +I SDE
Sbjct  1     METTSVRYLINSISRFIHLTSCQKIKVVPMEKNYRNMVVVLKILKPLLDDIVDCKIPSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    L   V+E REL + W    SK++ VLQ+ES + K+++ SL+I  +L  S   
Sbjct  61    TLYKECEELDLLVNEARELVEKWCYNMSKIHRVLQSESFLIKMQSSSLQICRVLQRSLQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
               + SS+T++++C+ +IK +  E     + +A+++  + +   +D L K+   L+L S++
Sbjct  121   SLSTSSITTVQHCMREIKRLQQERSLENVGEALRSLRDDAIPCTDHLIKVFKSLNLLSSR  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             +L  E VA+EK + N +      +++ I QI+ L++ + D ++  +       + IP  F
Sbjct  181   DLFKETVAVEKERMNVQVNSAKGKLDQINQIVDLISCIRDYMLKTQHFVPTCGILIPPRF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTY+R  I++W+D GL++CPKT QTLTHT LIPN  VKA++A
Sbjct  241   LCPLSLELMMDPVIVASGQTYDRTSIQKWLDTGLSICPKTHQTLTHTKLIPNDIVKAMVA  300

Query  1977  NWCEMNNIKLPD---PIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHGL  1807
             +WCE NN++L       K ++++ PS+H++  D          + S + + +SP+  +GL
Sbjct  301   SWCEENNLQLSSNNGRAKLVSMSSPSNHLSSQDLNHTDSTCFANGSCSTSRSSPEGRNGL  360

Query  1806  D  1804
             +
Sbjct  361   E  361



>ref|XP_002302042.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE81315.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=753

 Score =   394 bits (1012),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 199/285 (70%), Positives = 240/285 (84%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
             QV+KLVE LKS S + Q  A  ELRLLAKH+M+NRI+I + GAI  L++LL SE    QE
Sbjct  467   QVKKLVEGLKSLSNEVQTKAAEELRLLAKHDMENRIIIGHSGAIRPLLSLLSSEVKLTQE  526

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN++NK+ IA AGAIEP+I+VL +G+  AKENSAA LFSLSV+E+ K KI
Sbjct  527   HAVTALLNLSINEDNKAIIAEAGAIEPIIHVLRSGNNGAKENSAAALFSLSVLEEYKAKI  586

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLL +GT RGKKDAAT LFNLSI HENK RIVQAGAV++LVELMDP  GM
Sbjct  587   GRSGAVKALVDLLSSGTLRGKKDAATTLFNLSIFHENKARIVQAGAVKYLVELMDPVTGM  646

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGR++I + GGIP+LVEVVE GS RGKENAA+ L+QLC +S ++C
Sbjct  647   VDKAVALLANLSTIGEGRLAIAKAGGIPLLVEVVESGSQRGKENAASILMQLCLSSPKFC  706

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FR+QR  +AG+G
Sbjct  707   TLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRSQREASAGKG  751


 Score =   231 bits (589),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 206/333 (62%), Gaps = 2/333 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME   ++ L+N+IS F HL S +      + K Y+    +LK L+P+L  + D  I+SDE
Sbjct  1     METSSVRCLINSISRFMHLVSCQTKKYMPIQKDYEIMVIMLKHLKPVLDEVDDYNISSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L +    L  +V+E RE  + W    S++  V Q+E+L+ K+++ +L+I ++L      
Sbjct  61    ILCRECEELDVAVNEAREFMEKWCPQMSRICSVQQSEALLKKIQSSALEICQVLCRLLQG  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P  SSLT +++C+ +++ + +E ++  I +A++   +     +D L K+ + LSL SNQ
Sbjct  121   SPTTSSLTIVQHCMQELQGLKHETITEIIEEALRGLKDDVVPCTDHLMKLIETLSLTSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E VA+EK + N    +    +  I+QI+ L+T +   L+ ++  +  +   IP  F
Sbjct  181   ELLKESVAVEKERTNVHINKAEGYLYQIDQIVDLITQIRSWLLKVEHRDPKSGAPIPPYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTY+R  I++W+D GLT CP+TRQTL+HTNLIPNYTVKA+IA
Sbjct  241   RCPLSLELMLDPVIVASGQTYDRVSIQKWLDHGLTFCPRTRQTLSHTNLIPNYTVKAMIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSH--VAHVDS  1885
             NWCE NN+++       N    SSH  + H+DS
Sbjct  301   NWCEENNVRVSSHSDCNNHVLASSHHDLLHLDS  333



>ref|NP_201535.3| ARM repeat superfamily protein [Arabidopsis thaliana]
 sp|Q5XEZ8.1|PUB2_ARATH RecName: Full=U-box domain-containing protein 2; AltName: Full=Plant 
U-box protein 2 [Arabidopsis thaliana]
 gb|AAU94381.1| At5g67340 [Arabidopsis thaliana]
 gb|AAV59272.1| At5g67340 [Arabidopsis thaliana]
 gb|AED98330.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=707

 Score =   392 bits (1008),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 218/407 (54%), Positives = 285/407 (70%), Gaps = 28/407 (7%)
 Frame = -2

Query  1596  MPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVA  1417
              PL + SV ++  +S  GH+ +  A        FSR+        S+P   S     EV 
Sbjct  327   FPLLVESVRAS--SSENGHSESLDAEEL--RQVFSRS-------ASAPGIVS-----EVV  370

Query  1416  SESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSP-TVETRADLAEVK  1240
              +++     AA R  +   +P          W+ P ER        P TV      + ++
Sbjct  371   CKTKRNNNAAADRSLTRSNTP----------WKFPEERHWRHPGIIPATVRETGSSSSIE  420

Query  1239  EQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQ  1060
              +V+KL++DLKS+S+D QR ATA +R+LA+++ DNRIVI+ C AI  LV+LL+S D  +Q
Sbjct  421   TEVKKLIDDLKSSSLDTQREATARIRILARNSTDNRIVIARCEAIPSLVSLLYSTDERIQ  480

Query  1059  ENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGS-PEAKENSAATLFSLSVIEDNKI  883
              +AVT LLNLSINDNNKS IA +GAI PLI+VL+TG   EAK NSAATLFSLSVIE+ K 
Sbjct  481   ADAVTCLLNLSINDNNKSLIAESGAIVPLIHVLKTGYLEEAKANSAATLFSLSVIEEYKT  540

Query  882   KIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAA  703
             +IG +GA++ LVDLLG+G+  GKKDAATALFNLSI HENK ++++AGAVR+LVELMDPA 
Sbjct  541   EIGEAGAIEPLVDLLGSGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELMDPAF  600

Query  702   GMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSR  523
             GMV+KAV VL+NLAT++EG+++IG+EGGIP+LVEVVELGSARGKENA AALLQLCT+S +
Sbjct  601   GMVEKAVVVLANLATVREGKIAIGEEGGIPVLVEVVELGSARGKENATAALLQLCTHSPK  660

Query  522   YCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             +CN V++ G +PPLVAL++SGT R +EKAQ LL YF+  R  N  RG
Sbjct  661   FCNNVIREGVIPPLVALTKSGTARGKEKAQNLLKYFKAHRQSNQRRG  707


 Score =   294 bits (753),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/322 (48%), Positives = 231/322 (72%), Gaps = 0/322 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  L+VLL+NISS+  LSS+++++S   HKYY + EDI KL++P+L  ++D++ A  E
Sbjct  5     MEVSWLRVLLDNISSYLSLSSMDDLSSNPAHKYYTRGEDIGKLIKPVLENLIDSDAAPSE  64

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL   F  L   VDELRE FQ+WQ LS+++++VL+ ESL +K+R  SL++ +LL   +  
Sbjct  65    LLNNGFEELAQYVDELREQFQSWQPLSTRIFYVLRIESLASKLRESSLEVFQLLKHCEQH  124

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+    S E C+  +K +  + +S TI +A+K+  +G G +S+ L KIA+   L+SNQ
Sbjct  125   LPADLISPSFEECIELVKLVARDEISYTIDQALKDQKKGVGPTSEVLVKIAESTGLRSNQ  184

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+L+E V L  +KE+AE  + + E EY++ +I+L T MH+ L  +KQ++    V++P+DF
Sbjct  185   EILVEGVVLTNMKEDAELTDNDTEAEYLDGLISLTTQMHEYLSDIKQAQLRCPVRVPSDF  244

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              C LSLELMTDPVIVASGQT+ER FI++WID+GL VCPKTRQ L+HT L PN+ V+A +A
Sbjct  245   RCSLSLELMTDPVIVASGQTFERVFIQKWIDMGLMVCPKTRQALSHTTLTPNFIVRAFLA  304

Query  1977  NWCEMNNIKLPDPIKSLNVNQP  1912
             +WCE NN+  PDP++ ++ ++P
Sbjct  305   SWCETNNVYPPDPLELIHSSEP  326



>ref|XP_004141993.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus]
 ref|XP_004163841.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus]
 gb|KGN48574.1| hypothetical protein Csa_6G493330 [Cucumis sativus]
Length=538

 Score =   386 bits (991),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 211/386 (55%), Positives = 276/386 (72%), Gaps = 12/386 (3%)
 Frame = -2

Query  1512  LSNSN----FSRANAHDGNEVSSPTTA------STEASMEVASESRHAATLAASRRESEF  1363
             LS++N    FS   + D  + +S  ++      + +AS  V  ES  +AT A  + E E 
Sbjct  154   LSDTNAKPTFSLVRSRDAEDTTSTLSSIESAGRTRDASEIVKLESPASATPAFLQVEPEL  213

Query  1362  PSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQR  1183
             P P     R   I  + + +L   IVSS   + +++L  V+  ++KLVEDL S S++  R
Sbjct  214   P-PRLLVERKSDIIEQQAHKL-PEIVSSSVADHKSELGSVESGIQKLVEDLNSNSLETIR  271

Query  1182  IATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSA  1003
              A AELR LA+HN +NRI+I+  GAI+ LV L++S D   QE+AVT LLNLSI  ++K A
Sbjct  272   AAIAELRSLARHNTENRILIAKHGAITFLVKLMYSTDAITQEHAVTTLLNLSIQSDHKVA  331

Query  1002  IANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTP  823
             I  A  IEPLI+VL TGSPEA+ENSAAT FSL+++ +N++KIG+SGA+  LV+LLGNGTP
Sbjct  332   ITEANVIEPLIHVLVTGSPEARENSAATFFSLAMVVENRVKIGKSGAIGPLVELLGNGTP  391

Query  822   RGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGR  643
             RG+KDA TALF LS+L ENK +IVQAGAV+HLVELMDP+ GMVDK VAVL+NLATIQEG+
Sbjct  392   RGRKDATTALFYLSMLPENKVKIVQAGAVKHLVELMDPSVGMVDKTVAVLANLATIQEGK  451

Query  642   MSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQS  463
             + IG+ GGIP+LVE +ELGSARGKENAAAALL++C+ S+R+C M LQ G +PPLVALSQS
Sbjct  452   VEIGRMGGIPVLVEAIELGSARGKENAAAALLRVCSTSNRFCIMALQEGVIPPLVALSQS  511

Query  462   GTPRAREKAQALLSYFRNQRHGNAGR  385
             GT RA++KAQ LL+  R     N  +
Sbjct  512   GTRRAKDKAQELLNLLRKHVRSNVEK  537



>gb|KEH42514.1| armadillo/beta-catenin repeat protein [Medicago truncatula]
Length=608

 Score =   388 bits (996),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 196/305 (64%), Positives = 239/305 (78%), Gaps = 0/305 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             SR+ S P   +  +       V KL+EDL++ S++ +  A  ELRLL KHN +NRI++  
Sbjct  302   SRVDSHPVSNSGLNELTTSSHVNKLIEDLQNESIEVKSTAAEELRLLTKHNTENRIIVGQ  361

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGA+  L++LL+S     QE+AVTALLNLSIN++NK  I  AGAIEPLI+VL+TG+  AK
Sbjct  362   CGAVMPLLSLLYSNGKGTQEHAVTALLNLSINEDNKPLIMEAGAIEPLIHVLKTGNDGAK  421

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAA LFSLSV+E+ K KIGRSGA+++L +LL +GT RGKKDAATAL+NLSI HENK R
Sbjct  422   ENSAAALFSLSVMENGKAKIGRSGAIKALAELLASGTLRGKKDAATALYNLSIFHENKAR  481

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV+ LVEL DPA GM DKAVA+LSNL+TI EGR+ I +EGGIP LVE+VE GS R
Sbjct  482   IVQAGAVKFLVELTDPADGMADKAVALLSNLSTIAEGRLEIAREGGIPSLVEIVESGSQR  541

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAA+ LLQLC +SSR+C +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR  
Sbjct  542   GKENAASILLQLCLHSSRFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREA  601

Query  396   NAGRG  382
                +G
Sbjct  602   ATTKG  606


 Score =   156 bits (394),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 124/191 (65%), Gaps = 0/191 (0%)
 Frame = -2

Query  2541  LLVSSDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIAD  2362
             ++V S    P+ S L +L++ + +++ +  E     I KA++   E S    ++L +I +
Sbjct  1     MIVKSLESPPSASVLANLQHYIQELQCLKKETAMVYIEKALREQREDSEPCKENLKEIIE  60

Query  2361  CLSLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCT  2182
              L L S QELL E +A+EK + NAE+ +   ++E I +I+ LV  + D ++  +     +
Sbjct  61    LLKLTSTQELLNETIAVEKERLNAERQKMKGDLEEINEIVNLVRVLRDYVMKTEYFAVKS  120

Query  2181  SVQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPN  2002
              V  P  F CPLSLELM DPVIVASGQTYER  I++W+D GLTVCPKTRQ LTHTNLIPN
Sbjct  121   GVSFPPYFRCPLSLELMLDPVIVASGQTYERQSIKKWLDHGLTVCPKTRQRLTHTNLIPN  180

Query  2001  YTVKALIANWC  1969
             YTVKA+IA WC
Sbjct  181   YTVKAMIATWC  191



>emb|CDP03751.1| unnamed protein product [Coffea canephora]
Length=769

 Score =   393 bits (1009),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 202/305 (66%), Positives = 245/305 (80%), Gaps = 1/305 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             SR +S P+ E R +       V KL++DLKS S + Q  ATAELR LAK+N +NRI+I N
Sbjct  464   SRSLSLPS-EARCNDLTSTSHVEKLIKDLKSQSTELQTAATAELRFLAKYNTENRIIIGN  522

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI+ L++LLHS+    QE+AVTALLNLSIN+  K+ IA  GA++PLI+VL  G+  AK
Sbjct  523   CGAIAPLISLLHSDVKTTQEHAVTALLNLSINEKIKALIAEEGALDPLIHVLRIGNAGAK  582

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             EN+AA LFSLSV+E+ + KIG S AV++LVDLLG+GT RGKKDAATALFNLSILHENK R
Sbjct  583   ENAAACLFSLSVLEEYRTKIGHSAAVRALVDLLGSGTVRGKKDAATALFNLSILHENKAR  642

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV++LVEL+DP   MVDKAVA+L+NL+TI EG  +I +EGGIP LVE+V++GS R
Sbjct  643   IVQAGAVKYLVELLDPDREMVDKAVALLANLSTITEGCSAIAREGGIPSLVEIVDIGSQR  702

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAA+ LLQLC NS RYC +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FR+QR G
Sbjct  703   GKENAASILLQLCINSPRYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRSQREG  762

Query  396   NAGRG  382
               GRG
Sbjct  763   AMGRG  767


 Score =   231 bits (590),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 136/334 (41%), Positives = 204/334 (61%), Gaps = 10/334 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+++ ++ L+N++S F HL +   + +      Y     +LK L+P+L  +VD ++ SDE
Sbjct  1     MDLVAVRCLINSVSRFIHLVTCSPVKAMPAQNDYVHLSCLLKHLKPLLDNVVDGKVPSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L   +  L  +V+E RE F+ W    SK+  V+++  L+  + + SLKI ++L      
Sbjct  61    FLCNEYEQLDVAVNEAREFFEKWSPKMSKILCVVRSGLLVHNIESTSLKITQVLSG----  116

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
                 S+ T   N +   +   +  LS  + + ++   EG+  SS+ L  I + L+L SNQ
Sbjct  117   FLQSSAYT---NSLCDSQKFQHLKLSNHVNEVLQKITEGNIPSSEHLIPIIESLNLASNQ  173

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +ALEK +  AE  + N+ +E I +II L++H+ D ++ +   +S   ++IP  F
Sbjct  174   ELLNECIALEKERMKAEDHKLNQSLEEINRIIVLLSHIRDIMVKLDNFKSIDGIKIPPYF  233

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLS+ELM DPVIVASGQTYER  I++W+D GL +CPKTRQ L+HTNLIPNYTVK LIA
Sbjct  234   LCPLSVELMMDPVIVASGQTYERTSIKKWLDHGLNICPKTRQKLSHTNLIPNYTVKVLIA  293

Query  1977  NWCEMNNIKLPDP---IKSLNVNQPSSHVAHVDS  1885
             NWCE  NIKLP+P   +K  +V   S +V HVD+
Sbjct  294   NWCEEKNIKLPNPPDCLKCGSVTPQSENVNHVDN  327



>ref|XP_008346169.1| PREDICTED: U-box domain-containing protein 3-like [Malus domestica]
Length=780

 Score =   392 bits (1006),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 201/299 (67%), Positives = 246/299 (82%), Gaps = 0/299 (0%)
 Frame = -2

Query  1278  PTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISL  1099
             P   + +D      +VRKL+EDL+S S + Q +A  ELRLL K N +NR +I  CGAIS 
Sbjct  481   PFSSSGSDELTTASRVRKLIEDLQSQSNEVQTMAAEELRLLGKRNTENRTIIGQCGAISS  540

Query  1098  LVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAAT  919
             L++LL+S  M  QE+AVTALLNLSIN++NK+ IA AGAI+PLI+VL+TGS  AKENSAA 
Sbjct  541   LLSLLYSGVMITQEHAVTALLNLSINEDNKAMIAEAGAIDPLIHVLKTGSDGAKENSAAA  600

Query  918   LFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGA  739
             LFSLSV+++ K KIGRSGAV++LVDLL +GT RGKKDAATALFNLSI HENK R+VQAGA
Sbjct  601   LFSLSVLDEYKAKIGRSGAVKALVDLLASGTLRGKKDAATALFNLSIFHENKARLVQAGA  660

Query  738   VRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAA  559
             V+HL++LMDP  GMVDKAVA+L+NL+TI EGR++I +EGGIP+LVE+VE GS RGKENAA
Sbjct  661   VKHLIDLMDPDTGMVDKAVALLANLSTIAEGRVAIAREGGIPLLVEIVESGSQRGKENAA  720

Query  558   AALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             + LLQLC +S ++C +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR G  G+G
Sbjct  721   SILLQLCLHSPKFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGAMGKG  779


 Score =   214 bits (545),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 133/310 (43%), Positives = 200/310 (65%), Gaps = 0/310 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+I  +K L+N+IS F HL S +      + K Y+   D+LKLL+ +L  +VD +I SD+
Sbjct  1     MDIASIKCLINSISRFVHLVSSQTSKHIPIQKDYRTIVDVLKLLKXLLDEVVDFKIPSDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K    L  +V+  RE  + W   SSK+      E L+  +++ SLKI  +L      
Sbjct  61    ILYKECDELDMAVNGAREFMEKWSPKSSKILSAWWGEPLLITIQSSSLKICGILPRLLQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
               + S L  L++C+ +I+S+  E +S  + +A+K+  +    S+  L KI + L+L SNQ
Sbjct  121   SSSGSILAGLQHCMQEIQSLKLERVSEYLEEALKSPRKDVMPSTKLLMKIIELLNLTSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +A+EK + N E ++   E++ I QI+ LV+H+ + ++ ++  E+ + V IP+ F
Sbjct  181   ELLKESIAVEKERMNVEVSDVRGELDQINQIVVLVSHIREFMVKIEHLETASGVPIPSYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLS ELM DPVIVASGQTYER+ I++WID GLT+CPKTRQ L+HTNL+PNYTVKA+I 
Sbjct  241   RCPLSSELMLDPVIVASGQTYERSSIQKWIDHGLTLCPKTRQRLSHTNLLPNYTVKAMIE  300

Query  1977  NWCEMNNIKL  1948
             +WC+ N+IKL
Sbjct  301   SWCQENDIKL  310



>gb|KCW84730.1| hypothetical protein EUGRSUZ_B01548 [Eucalyptus grandis]
Length=612

 Score =   385 bits (990),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 191/285 (67%), Positives = 238/285 (84%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V+ L+E+LK+ S +    A AELR LAKHNM+NR++I   GAI+ L++LL+S     QE
Sbjct  326   HVKILIENLKNQSNEVHTKAAAELRFLAKHNMENRLIIGQSGAITPLLSLLYSRVRYTQE  385

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTA+LNLSIN+ NK+ IA AGAIEPLI+VL++G+  A+EN+AATLFS+S++E+ K KI
Sbjct  386   HAVTAILNLSINEENKAMIAEAGAIEPLIHVLKSGNEGARENAAATLFSISLLEEYKAKI  445

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLLG+GTPRGKKDAATALFNLSI HENK RIVQAGAV++L+ELMDP  GM
Sbjct  446   GRSGAVKALVDLLGSGTPRGKKDAATALFNLSIFHENKARIVQAGAVKYLIELMDPDTGM  505

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+T  EGR++I +EGGIP+LVEV+E GS RGKENAA+ LLQLC NS ++C
Sbjct  506   VDKAVALLANLSTTGEGRLAIVREGGIPLLVEVIESGSHRGKENAASVLLQLCLNSPKFC  565

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGT RA+EKAQ LL +FRNQR G   +G
Sbjct  566   TLVLQEGAVPPLVALSQSGTARAKEKAQQLLGHFRNQREGAMVKG  610


 Score =   144 bits (364),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = -2

Query  2256  IEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIR  2077
             I Q+I L++++ D +I     E+   + IP  F CPLSLELM DPVIVASGQTYER  I+
Sbjct  15    INQVIRLMSYIRDFMIETDFLEADDGMLIPPYFRCPLSLELMMDPVIVASGQTYERASIQ  74

Query  2076  RWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDPIKS  1930
             +W+D GLTVCPKTRQ LTHTNLIPNYTVKA++  WC+ NNI+L + ++S
Sbjct  75    KWLDHGLTVCPKTRQLLTHTNLIPNYTVKAMVEGWCKHNNIRLFNSLES  123



>ref|XP_004141892.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus]
 ref|XP_004163838.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus]
 gb|KGN48575.1| hypothetical protein Csa_6G493830 [Cucumis sativus]
Length=321

 Score =   375 bits (963),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 252/306 (82%), Gaps = 1/306 (0%)
 Frame = -2

Query  1320  RRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNM  1141
             ++P ER+V  IVSSP +E  +D   +K +V+KLVE+L S S +  R +TAELRLL K + 
Sbjct  11    QQPYERMVHEIVSSPVLEAISDHTGIKAKVQKLVENLTSDSPETLRTSTAELRLLTKIDA  70

Query  1140  DNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVL  961
             +NR +I++ GAISLLVNLL+S D ++QENAVTAL+NLSI++N KS I  A AIEPLI+VL
Sbjct  71    NNRTLIADYGAISLLVNLLNSTDTKIQENAVTALVNLSIDNNCKSIIVQANAIEPLIHVL  130

Query  960   ETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLS  781
             +TGSPEAKENSAATL SLSV++DN++ IGRS A+  LVDLL +GTPRGK+DAATALFNLS
Sbjct  131   QTGSPEAKENSAATLGSLSVVDDNQVNIGRSRAIGPLVDLLKDGTPRGKRDAATALFNLS  190

Query  780   ILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVE  601
             +L ENK +IV+AG+++HLV+LMDPA GMV+KAV VL+NLA+  EGR+ I +EGGIP+LV+
Sbjct  191   LLSENKPKIVEAGSIKHLVKLMDPATGMVEKAVTVLANLASTDEGRIEIVREGGIPLLVD  250

Query  600   VVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLS  421
              +ELGSAR KE AAAALL LC  +SRYC M +Q GA+PPLVALSQSGT RA+EKA+ALLS
Sbjct  251   TIELGSARAKEYAAAALLWLCGITSRYCIMAIQEGAIPPLVALSQSGTARAKEKARALLS  310

Query  420   YF-RNQ  406
              F RN+
Sbjct  311   CFSRNK  316



>gb|KHG16511.1| U-box domain-containing 3 -like protein [Gossypium arboreum]
Length=783

 Score =   390 bits (1003),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 242/284 (85%), Gaps = 0/284 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V KLV++LKS S + Q  A  ELRLLAK+NM+NRI+I  CGAI+ L++LL+SE    QE
Sbjct  498   HVMKLVDNLKSLSNEVQTKAALELRLLAKNNMENRIIIGRCGAIAPLLSLLYSEVKLTQE  557

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSI+++NK+ IA +GAIEPLI+VL++G+  AKENSAA LFSLS +ED K +I
Sbjct  558   HAVTALLNLSISEDNKAIIAKSGAIEPLIHVLKSGNDGAKENSAAALFSLSALEDYKARI  617

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LV+LL +GT RGKKDAATALFNLSI HENK R+VQAGAV++LV+LMDP +GM
Sbjct  618   GRSGAVKALVNLLSSGTLRGKKDAATALFNLSIFHENKARMVQAGAVKYLVQLMDPDSGM  677

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+LSNL+T+ EGR++I +EGG+P+LVE++E GS RGKENAA+ LLQLC NS ++C
Sbjct  678   VDKAVALLSNLSTVAEGRVAIVREGGVPLLVEILESGSQRGKENAASVLLQLCLNSPKFC  737

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
              +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR G  G+
Sbjct  738   TLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGATGK  781


 Score =   224 bits (572),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 141/339 (42%), Positives = 216/339 (64%), Gaps = 8/339 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+   ++ L+N+I+ F HL S +      + K Y+    +LKLL+P+L  +VD EI SDE
Sbjct  1     MDTTSVRCLINSIARFVHLVSCQTRKVVPIEKDYRNMVVVLKLLKPLLDDVVDCEIPSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K    +   V+E RE  + W    SK++ VLQ+E  + K+++ SL+I  +L  S   
Sbjct  61    ILCKECEEIDMLVNEAREFMENWCPKMSKIHMVLQSEPFLIKMQSSSLQICHILYKSLQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P+ SS+TS+++C+ +IK ++ E LS  I  A+++  +G+   +D L K+   L+L SNQ
Sbjct  121   SPSTSSITSVQHCIREIKCLNLERLSENIGDALRSLKDGAIPCTDHLVKVIKSLNLTSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E VA+EK + NA+      +++ I QI+ L++H+ D ++ ++  E  + + IP  F
Sbjct  181   ELLKETVAVEKERMNAQANNAKGKLDQINQIVDLISHIRDYMLKIEHFEPTSGILIPPHF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTY+R  I++W D GLT+CPKT QTL HTNL PN TVKA++A
Sbjct  241   VCPLSLELMMDPVIVASGQTYDRASIQKWFDSGLTICPKTCQTLKHTNLTPNSTVKAMLA  300

Query  1977  NWCEMNNIKLPDPI---KSLNVNQPSSH-----VAHVDS  1885
             NWC+ NN++L +     K ++++ PS+H     + H DS
Sbjct  301   NWCDKNNLQLSNRTGHAKLVSISSPSNHKSSQDLTHTDS  339



>gb|KEH42515.1| armadillo/beta-catenin repeat protein [Medicago truncatula]
Length=725

 Score =   388 bits (996),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/305 (64%), Positives = 239/305 (78%), Gaps = 0/305 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             SR+ S P   +  +       V KL+EDL++ S++ +  A  ELRLL KHN +NRI++  
Sbjct  419   SRVDSHPVSNSGLNELTTSSHVNKLIEDLQNESIEVKSTAAEELRLLTKHNTENRIIVGQ  478

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGA+  L++LL+S     QE+AVTALLNLSIN++NK  I  AGAIEPLI+VL+TG+  AK
Sbjct  479   CGAVMPLLSLLYSNGKGTQEHAVTALLNLSINEDNKPLIMEAGAIEPLIHVLKTGNDGAK  538

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAA LFSLSV+E+ K KIGRSGA+++L +LL +GT RGKKDAATAL+NLSI HENK R
Sbjct  539   ENSAAALFSLSVMENGKAKIGRSGAIKALAELLASGTLRGKKDAATALYNLSIFHENKAR  598

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV+ LVEL DPA GM DKAVA+LSNL+TI EGR+ I +EGGIP LVE+VE GS R
Sbjct  599   IVQAGAVKFLVELTDPADGMADKAVALLSNLSTIAEGRLEIAREGGIPSLVEIVESGSQR  658

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAA+ LLQLC +SSR+C +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR  
Sbjct  659   GKENAASILLQLCLHSSRFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREA  718

Query  396   NAGRG  382
                +G
Sbjct  719   ATTKG  723


 Score =   206 bits (523),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 123/295 (42%), Positives = 179/295 (61%), Gaps = 0/295 (0%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSG  2674
             L+N+IS F HL S + +      K       +LK L+P+L   +D +I   + L KV   
Sbjct  14    LINSISRFVHLVSCQTVKPMPFQKICNNMVGVLKRLKPVLDDAMDYKIPLHQNLCKVCEE  73

Query  2673  LGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLT  2494
             L   V+E R+  + W    SK++ VLQ+ +L+ K+++ SL I  ++V S    P+ S L 
Sbjct  74    LDICVNEARDFIEKWGPKMSKIHSVLQSGTLLIKLQSTSLDICHMIVKSLESPPSASVLA  133

Query  2493  SLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELVa  2314
             +L++ + +++ +  E     I KA++   E S    ++L +I + L L S QELL E +A
Sbjct  134   NLQHYIQELQCLKKETAMVYIEKALREQREDSEPCKENLKEIIELLKLTSTQELLNETIA  193

Query  2313  leklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLEL  2134
             +EK + NAE+ +   ++E I +I+ LV  + D ++  +     + V  P  F CPLSLEL
Sbjct  194   VEKERLNAERQKMKGDLEEINEIVNLVRVLRDYVMKTEYFAVKSGVSFPPYFRCPLSLEL  253

Query  2133  MTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWC  1969
             M DPVIVASGQTYER  I++W+D GLTVCPKTRQ LTHTNLIPNYTVKA+IA WC
Sbjct  254   MLDPVIVASGQTYERQSIKKWLDHGLTVCPKTRQRLTHTNLIPNYTVKAMIATWC  308



>ref|XP_006393931.1| hypothetical protein EUTSA_v10003745mg [Eutrema salsugineum]
 gb|ESQ31217.1| hypothetical protein EUTSA_v10003745mg [Eutrema salsugineum]
Length=689

 Score =   387 bits (993),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 209/368 (57%), Positives = 272/368 (74%), Gaps = 29/368 (8%)
 Frame = -2

Query  1479  HDGNEVSSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERL  1300
              + ++V S +T++     EV S+ +  +T AA    S+   PV T      +WR PS R 
Sbjct  349   EEQHQVLSRSTSAPGIVAEVVSKVQQRSTDAADTSISQ--EPVET------VWRLPSVRH  400

Query  1299  VSR--IVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIV  1126
                  I+ +   ET +                 S+S++ +  AT+ +R+L++ + +NRIV
Sbjct  401   FRHPGIIPATIRETGS-----------------SSSIEAE--ATSRIRILSRTSTENRIV  441

Query  1125  ISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSP  946
             I+ CGAI+ LV+LL+S D  +Q +AVT LLNLSINDNNKS IA++GAI PLI+VL+TGS 
Sbjct  442   IARCGAINSLVDLLYSTDERIQTDAVTCLLNLSINDNNKSVIADSGAIGPLIHVLKTGSI  501

Query  945   EAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHEN  766
             EAKENSAATLFSLSVIE+NK KIG +GA++ LVDLLG G+ RGKKDAATALFNLSI HEN
Sbjct  502   EAKENSAATLFSLSVIEENKTKIGEAGAIEPLVDLLGYGSLRGKKDAATALFNLSIHHEN  561

Query  765   KGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELG  586
             K R+++AGAVR+LVELMDPAAGMV++AV VL+NLAT +EG+++IG+EGGIP+LVEVVELG
Sbjct  562   KTRVIEAGAVRYLVELMDPAAGMVERAVVVLANLATTKEGKIAIGEEGGIPVLVEVVELG  621

Query  585   SARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQ  406
             SARGKENA AALLQLC +S R+CN V++ GA+PPLVAL++SGT RA+EKAQ LL YF+ Q
Sbjct  622   SARGKENATAALLQLCMHSPRFCNTVIREGAIPPLVALTKSGTARAKEKAQNLLKYFKAQ  681

Query  405   RHGNAGRG  382
             + GN  R 
Sbjct  682   KQGNQRRA  689


 Score =   308 bits (790),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 163/322 (51%), Positives = 226/322 (70%), Gaps = 0/322 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  L+VLL+NISS+  +S+++N+ S   H+YY + E+I KLL+ +L  +V ++ A  E
Sbjct  1     MEVSWLRVLLDNISSYMSISTMDNLESNPAHRYYTRGEEIGKLLKLVLEDLVGSDAAPSE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL   F  L   VDELRE F++WQ LSS++++VL+ ESL +++R  SL++ +LL   +  
Sbjct  61    LLNNGFEELSQYVDELREQFESWQPLSSRIFYVLRIESLASQLRESSLEVFQLLKHCEQH  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP +    S E C+  +K +  E +S TI  A+ +  EG G SS+ L KIA+ + L+SNQ
Sbjct  121   LPVDLISPSFEECIELVKLVGREEISYTIDLALIDQKEGVGPSSEVLVKIAESIGLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE V L  LKENAE AE + E E+I+ +I+L+T MHD L  +KQS+      +P+DF
Sbjct  181   EILIEGVVLANLKENAELAENDTEAEFIDGLISLMTQMHDYLSNIKQSQLLCPDPVPSDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
             CCPLSLELMTDPVIVASGQTYER FI +WI +GL VCPKTRQ L+HT L PN++VKA IA
Sbjct  241   CCPLSLELMTDPVIVASGQTYERVFIEKWIGMGLMVCPKTRQALSHTTLTPNFSVKAFIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQP  1912
             NWCE NN+  PDP++ +  +QP
Sbjct  301   NWCESNNVNPPDPLELIQSSQP  322



>gb|KEH42516.1| armadillo/beta-catenin repeat protein [Medicago truncatula]
Length=729

 Score =   388 bits (996),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 196/305 (64%), Positives = 239/305 (78%), Gaps = 0/305 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             SR+ S P   +  +       V KL+EDL++ S++ +  A  ELRLL KHN +NRI++  
Sbjct  423   SRVDSHPVSNSGLNELTTSSHVNKLIEDLQNESIEVKSTAAEELRLLTKHNTENRIIVGQ  482

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGA+  L++LL+S     QE+AVTALLNLSIN++NK  I  AGAIEPLI+VL+TG+  AK
Sbjct  483   CGAVMPLLSLLYSNGKGTQEHAVTALLNLSINEDNKPLIMEAGAIEPLIHVLKTGNDGAK  542

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAA LFSLSV+E+ K KIGRSGA+++L +LL +GT RGKKDAATAL+NLSI HENK R
Sbjct  543   ENSAAALFSLSVMENGKAKIGRSGAIKALAELLASGTLRGKKDAATALYNLSIFHENKAR  602

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV+ LVEL DPA GM DKAVA+LSNL+TI EGR+ I +EGGIP LVE+VE GS R
Sbjct  603   IVQAGAVKFLVELTDPADGMADKAVALLSNLSTIAEGRLEIAREGGIPSLVEIVESGSQR  662

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAA+ LLQLC +SSR+C +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR  
Sbjct  663   GKENAASILLQLCLHSSRFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREA  722

Query  396   NAGRG  382
                +G
Sbjct  723   ATTKG  727


 Score =   206 bits (523),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 123/295 (42%), Positives = 179/295 (61%), Gaps = 0/295 (0%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSG  2674
             L+N+IS F HL S + +      K       +LK L+P+L   +D +I   + L KV   
Sbjct  18    LINSISRFVHLVSCQTVKPMPFQKICNNMVGVLKRLKPVLDDAMDYKIPLHQNLCKVCEE  77

Query  2673  LGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLT  2494
             L   V+E R+  + W    SK++ VLQ+ +L+ K+++ SL I  ++V S    P+ S L 
Sbjct  78    LDICVNEARDFIEKWGPKMSKIHSVLQSGTLLIKLQSTSLDICHMIVKSLESPPSASVLA  137

Query  2493  SLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELVa  2314
             +L++ + +++ +  E     I KA++   E S    ++L +I + L L S QELL E +A
Sbjct  138   NLQHYIQELQCLKKETAMVYIEKALREQREDSEPCKENLKEIIELLKLTSTQELLNETIA  197

Query  2313  leklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLEL  2134
             +EK + NAE+ +   ++E I +I+ LV  + D ++  +     + V  P  F CPLSLEL
Sbjct  198   VEKERLNAERQKMKGDLEEINEIVNLVRVLRDYVMKTEYFAVKSGVSFPPYFRCPLSLEL  257

Query  2133  MTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWC  1969
             M DPVIVASGQTYER  I++W+D GLTVCPKTRQ LTHTNLIPNYTVKA+IA WC
Sbjct  258   MLDPVIVASGQTYERQSIKKWLDHGLTVCPKTRQRLTHTNLIPNYTVKAMIATWC  312



>gb|KHN03887.1| U-box domain-containing protein 3 [Glycine soja]
Length=761

 Score =   388 bits (996),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 242/306 (79%), Gaps = 1/306 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             SR  S P   + +D       V +L+EDL S S++ Q  A  ELRLL KHN +NRI++  
Sbjct  454   SRFDSHPVFNSGSDELTTSSHVIRLIEDLHSQSIETQTAAAEELRLLTKHNKENRIIVGQ  513

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
              GA++ L++LL+S+    QE+AVTALLNLSIN++NK+ I  AGAIEPLI+VL TG+  AK
Sbjct  514   YGAVAPLLSLLYSDLQVTQEHAVTALLNLSINEDNKALIMEAGAIEPLIHVLSTGNDSAK  573

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAAT+FSLS+IE+NK +IGRSGAV++LVDLL +GT RGKKDAATALFNLSI HENK R
Sbjct  574   ENSAATIFSLSIIENNKARIGRSGAVKALVDLLASGTLRGKKDAATALFNLSIFHENKAR  633

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV+ LV LMD A GMVDKAVA+LSNL+TI EGR+ I +E GIP+LVE+VE GS R
Sbjct  634   IVQAGAVKFLVWLMDHAEGMVDKAVALLSNLSTIPEGRLEIARERGIPLLVEIVEYGSQR  693

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRH-  400
             GKENAA+ LLQLC +SS++C +VLQ GAVPPLVALS SGTPRA+EKAQ LLS+FRNQR  
Sbjct  694   GKENAASILLQLCLHSSKFCTLVLQEGAVPPLVALSISGTPRAKEKAQQLLSHFRNQREA  753

Query  399   GNAGRG  382
                G+G
Sbjct  754   ATTGKG  759


 Score =   200 bits (508),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 181/294 (62%), Gaps = 3/294 (1%)
 Frame = -2

Query  2760  ILKLLQPILSGIVDAEIASDELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESL  2581
             +LK L+P+L  I+D +I S+  L K    L   V+E R+  + W    SK++ VLQ  +L
Sbjct  16    VLKRLKPVLDDIMDYQIPSNVNLCKECEELDMQVNEARDFIEKWSPKMSKIHSVLQGGTL  75

Query  2580  IAKVRAFSLKIVELLVSSDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEG  2401
             + K+++ SL I  ++V S    P+ S L +L++ + +++    E+    I +A++N  + 
Sbjct  76    LIKLQSTSLDICHMIVKSLQSPPSASVLANLQHYIQELQCFKKEMAMVFIEEALRNQRDN  135

Query  2400  SGASSDSLTKIADCLSLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMH  2221
                 ++ L +I + L L SNQELL E +A+EK + NAE  +   ++E ++ I+ LV ++ 
Sbjct  136   VELCTEHLKEIIELLKLTSNQELLRESIAVEKERLNAEVNKMKGDLEELDDIVILVCNLR  195

Query  2220  DCLIMMKQSESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPK  2041
             D ++  +     + + IP  F CPLSLELM DPVIVASGQTYER  I++W+D GLTVCPK
Sbjct  196   DYVMKTECPVVKSGLLIPLYFRCPLSLELMLDPVIVASGQTYERQSIQKWLDHGLTVCPK  255

Query  2040  TRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDPIKSLN---VNQPSSHVAHVD  1888
             TRQ LT TNLIPNYTVKA+IA WCE NN+KL    +  N   +  PS H+   D
Sbjct  256   TRQRLTPTNLIPNYTVKAMIATWCEENNVKLSGNSEQNNSACITSPSDHLLPQD  309



>gb|EYU46447.1| hypothetical protein MIMGU_mgv1a002302mg [Erythranthe guttata]
 gb|EYU46448.1| hypothetical protein MIMGU_mgv1a002302mg [Erythranthe guttata]
Length=690

 Score =   385 bits (988),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 192/310 (62%), Positives = 246/310 (79%), Gaps = 1/310 (0%)
 Frame = -2

Query  1311  SERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNR  1132
             S + +SR++S P+     +L      V KLV  L+S S + Q  +  ELR LAK+N++NR
Sbjct  380   SSKTISRMLSFPSYSLHNELTSTP-HVEKLVNGLRSLSTEVQTASAGELRFLAKYNIENR  438

Query  1131  IVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETG  952
             ++I  CGAI+ L++LLHS++  +QE++VTALLNLSI++N KS IA  GA+EPLI+VL+TG
Sbjct  439   VIIGQCGAIAPLISLLHSDNELIQEHSVTALLNLSIDENIKSRIAEEGALEPLIHVLKTG  498

Query  951   SPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILH  772
             +  AKEN+AA LFS+S+++D ++KIGRSGAV  LVDLL  GT RGKKDAATALFNLSI H
Sbjct  499   NTGAKENAAAALFSISLLDDYRVKIGRSGAVNGLVDLLKTGTVRGKKDAATALFNLSIFH  558

Query  771   ENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVE  592
             ENK RIVQAGAV++LV LM+P + MVDKAVA+L+NL+TI EG  +I +EGGIP+LVE+V+
Sbjct  559   ENKARIVQAGAVKYLVGLMEPCSEMVDKAVALLANLSTIVEGCSAIAREGGIPLLVEIVD  618

Query  591   LGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFR  412
             +GS RGKENAA+ LLQ+C N+S+YC  VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FR
Sbjct  619   MGSQRGKENAASILLQMCINNSKYCRSVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFR  678

Query  411   NQRHGNAGRG  382
             NQR     RG
Sbjct  679   NQRESAVARG  688


 Score =   191 bits (485),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 124/311 (40%), Positives = 185/311 (59%), Gaps = 14/311 (5%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M++  L+ L N+IS   HL +     +    K Y      LKL++P+L  I + +   DE
Sbjct  1     MDLTPLRCLNNSISRLIHLVTCRISTAMPAEKDYINLVSSLKLVKPVLDDIANRKAPLDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    L  +V+E RE  + W   +SK+  VLQ++ L+ K++  S+K+         C
Sbjct  61    ALSKECDELDTAVNEAREFLEKWSPKTSKILCVLQSKPLVLKIQNSSVKL---------C  111

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEG-SGASSDSLTKIADCLSLKSN  2341
                ESS  + + C+ + +++    LS  I + +K+  +      +D LT+I +  SL+S+
Sbjct  112   GFCESSPNA-QICIQESRNLKLGQLSEHIEEILKSQEDWEKNPCADHLTEIIESFSLRSS  170

Query  2340  QELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPAD  2161
             QELL E +ALEK K+ AE +    E++ I QI+ L++H+ +    +++++S  +VQIP+ 
Sbjct  171   QELLNERIALEKEKQKAESSNIKSELDRISQILELISHIRE---FVEKNKSVNNVQIPSY  227

Query  2160  FCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALI  1981
             F CPLSLELM DPVIVASGQTYER  I++W+D GL  CPKT   L H NLIPNYTVKALI
Sbjct  228   FRCPLSLELMWDPVIVASGQTYERAHIQKWLDQGLVRCPKTNYELAHKNLIPNYTVKALI  287

Query  1980  ANWCEMNNIKL  1948
              NWC  N ++L
Sbjct  288   VNWCNENKVEL  298



>ref|XP_010905800.1| PREDICTED: U-box domain-containing protein 3-like [Elaeis guineensis]
Length=784

 Score =   387 bits (995),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 209/322 (65%), Positives = 260/322 (81%), Gaps = 4/322 (1%)
 Frame = -2

Query  1344  RLRPPAIW--RRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATA  1171
             R  PP ++  R      V+  +S P +    DL      V+KL+EDLKS + + Q  A +
Sbjct  463   RFSPPQLYGLRNGHVNNVASQLSLP-IPGSTDLT-TSSHVQKLIEDLKSQAPEVQTAAAS  520

Query  1170  ELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANA  991
             ELRLL+KHNM+NR++I+  GAI  LV LLHS+  +VQENAVTALLNLS+NDNNK +IA A
Sbjct  521   ELRLLSKHNMENRVLIAKYGAIPPLVYLLHSKVKKVQENAVTALLNLSLNDNNKVSIAEA  580

Query  990   GAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKK  811
             GAIEPLIYVLE GS EAKENSAA LFSLSV+E+ K+KIGRSGA+++LV+LLG+G+ RGKK
Sbjct  581   GAIEPLIYVLECGSTEAKENSAAALFSLSVLEEYKVKIGRSGAIKALVNLLGSGSLRGKK  640

Query  810   DAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIG  631
             DAATALFNLSILHENK RIVQAGAV++LVELMDP+ GMVDK+VA+L+NL+T+ EGR++I 
Sbjct  641   DAATALFNLSILHENKARIVQAGAVKYLVELMDPSTGMVDKSVALLANLSTVPEGRLAIS  700

Query  630   QEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPR  451
             QEGGIP+LVE+VE GS RGKENAA+ALLQLC +S ++C++VLQ G VPPL+ALSQ GTPR
Sbjct  701   QEGGIPLLVEIVETGSQRGKENAASALLQLCLHSHKFCSLVLQEGVVPPLIALSQFGTPR  760

Query  450   AREKAQALLSYFRNQRHGNAGR  385
             A+EKAQ +L +FR+QR G   R
Sbjct  761   AKEKAQQILGHFRSQREGMMRR  782


 Score =   238 bits (606),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 151/362 (42%), Positives = 222/362 (61%), Gaps = 10/362 (3%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G M+  ++  L+N+IS F HL   +   + ++ K ++    ILKLL+PIL      +I S
Sbjct  16    GAMDGNVIGGLINSISRFIHLVGCQTTKTTVL-KEFKSIVGILKLLKPILHEAFGPQIPS  74

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIV----ELL  2536
             DE L K F  L  +V+E RE  +      S++Y VLQ+E ++ KV+  S++I     ELL
Sbjct  75    DEQLIKAFEELDVAVNEAREFMEKRPQRMSRIYSVLQSEPMVLKVQKSSIEICHVLSELL  134

Query  2535  VSSDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCL  2356
              SS +     S L  +++C+ +++ +  +L S  I  A+K+       S + + KI D L
Sbjct  135   PSSQYT----SHLAGIQHCLQELQCIQQDLTSELIENALKDQRGYVIPSLEDIIKIMDML  190

Query  2355  SLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSV  2176
              L SNQELL+E +ALEK +E AE  EK E+ ++I QIIALV HM  C+  ++Q      +
Sbjct  191   GLASNQELLMENIALEKEREKAELKEKTEDADHISQIIALVAHMRYCVAKLEQFGFINGL  250

Query  2175  QIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYT  1996
              IP+ F  PLSL+LM DPVIVASGQTYER+FI++W+D GL +CP+T Q L+HTNLIPN+T
Sbjct  251   PIPSHFRGPLSLQLMLDPVIVASGQTYERSFIQKWLDSGLRICPRTHQILSHTNLIPNFT  310

Query  1995  VKALIANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPR-DIHIFSHSRANNSTSPDS  1819
             VK LIANWCE NNI+L + ++S  V+ P    A ++   P  ++H   H  + ++ S + 
Sbjct  311   VKELIANWCEGNNIRLNNSVQSDCVSNPFLSSAMLEDFRPENNLHGSLHRDSTSTPSFEC  370

Query  1818  AH  1813
             AH
Sbjct  371   AH  372



>ref|XP_010039247.1| PREDICTED: U-box domain-containing protein 3 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010039255.1| PREDICTED: U-box domain-containing protein 3 isoform X3 [Eucalyptus 
grandis]
Length=805

 Score =   388 bits (996),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/285 (67%), Positives = 238/285 (84%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V+ L+E+LK+ S +    A AELR LAKHNM+NR++I   GAI+ L++LL+S     QE
Sbjct  519   HVKILIENLKNQSNEVHTKAAAELRFLAKHNMENRLIIGQSGAITPLLSLLYSRVRYTQE  578

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTA+LNLSIN+ NK+ IA AGAIEPLI+VL++G+  A+EN+AATLFS+S++E+ K KI
Sbjct  579   HAVTAILNLSINEENKAMIAEAGAIEPLIHVLKSGNEGARENAAATLFSISLLEEYKAKI  638

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLLG+GTPRGKKDAATALFNLSI HENK RIVQAGAV++L+ELMDP  GM
Sbjct  639   GRSGAVKALVDLLGSGTPRGKKDAATALFNLSIFHENKARIVQAGAVKYLIELMDPDTGM  698

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+T  EGR++I +EGGIP+LVEV+E GS RGKENAA+ LLQLC NS ++C
Sbjct  699   VDKAVALLANLSTTGEGRLAIVREGGIPLLVEVIESGSHRGKENAASVLLQLCLNSPKFC  758

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGT RA+EKAQ LL +FRNQR G   +G
Sbjct  759   TLVLQEGAVPPLVALSQSGTARAKEKAQQLLGHFRNQREGAMVKG  803


 Score =   203 bits (517),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 195/309 (63%), Gaps = 1/309 (0%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS-DELLQKVFS  2677
             L+N+IS F HL   +   S+ + + Y KT ++LKLL+P+L  +V+      DE+L K F 
Sbjct  8     LINSISRFIHLVMCQTRKSQHLQQIYGKTTEVLKLLKPLLDDVVEHTTPILDEILYKEFE  67

Query  2676  GLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSL  2497
              L  +V+  RE  + W    SK+  VLQ+++ + K++  SL+I ++L        A SS 
Sbjct  68    ELDMAVNMSREFLENWSPRMSKICSVLQSKTSLMKIQTSSLEICQILCRLSQSGQAGSSF  127

Query  2496  TSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELV  2317
             + ++  + +++ +  E ++  I + + N  +G    +D+++KI + L+L+S QEL  E +
Sbjct  128   SRIQYSLQELQRLKQEGVAEFIEEVLINQRDGILPCADTVSKIIELLNLRSKQELFKESL  187

Query  2316  aleklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLE  2137
             A+EK +  A+  E   E + I Q+I L++++ D +I     E+   + IP  F CPLSLE
Sbjct  188   AVEKERMRADVNEVRGEFDEINQVIRLMSYIRDFMIETDFLEADDGMLIPPYFRCPLSLE  247

Query  2136  LMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNN  1957
             LM DPVIVASGQTYER  I++W+D GLTVCPKTRQ LTHTNLIPNYTVKA++  WC+ NN
Sbjct  248   LMMDPVIVASGQTYERASIQKWLDHGLTVCPKTRQLLTHTNLIPNYTVKAMVEGWCKHNN  307

Query  1956  IKLPDPIKS  1930
             I+L + ++S
Sbjct  308   IRLFNSLES  316



>ref|XP_010039241.1| PREDICTED: U-box domain-containing protein 3 isoform X2 [Eucalyptus 
grandis]
Length=806

 Score =   388 bits (996),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/285 (67%), Positives = 238/285 (84%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V+ L+E+LK+ S +    A AELR LAKHNM+NR++I   GAI+ L++LL+S     QE
Sbjct  520   HVKILIENLKNQSNEVHTKAAAELRFLAKHNMENRLIIGQSGAITPLLSLLYSRVRYTQE  579

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTA+LNLSIN+ NK+ IA AGAIEPLI+VL++G+  A+EN+AATLFS+S++E+ K KI
Sbjct  580   HAVTAILNLSINEENKAMIAEAGAIEPLIHVLKSGNEGARENAAATLFSISLLEEYKAKI  639

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLLG+GTPRGKKDAATALFNLSI HENK RIVQAGAV++L+ELMDP  GM
Sbjct  640   GRSGAVKALVDLLGSGTPRGKKDAATALFNLSIFHENKARIVQAGAVKYLIELMDPDTGM  699

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+T  EGR++I +EGGIP+LVEV+E GS RGKENAA+ LLQLC NS ++C
Sbjct  700   VDKAVALLANLSTTGEGRLAIVREGGIPLLVEVIESGSHRGKENAASVLLQLCLNSPKFC  759

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGT RA+EKAQ LL +FRNQR G   +G
Sbjct  760   TLVLQEGAVPPLVALSQSGTARAKEKAQQLLGHFRNQREGAMVKG  804


 Score =   199 bits (507),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 194/309 (63%), Gaps = 5/309 (2%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS-DELLQKVFS  2677
             L+N+IS F HL   +   S+ + + Y KT ++LKLL+P+L  +V+      DE+L K F 
Sbjct  13    LINSISRFIHLVMCQTRKSQHLQQIYGKTTEVLKLLKPLLDDVVEHTTPILDEILYKEFE  72

Query  2676  GLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSL  2497
              L  +V+  RE  + W    SK+  VLQ+++ + K++  SL+I ++L        A SS 
Sbjct  73    ELDMAVNMSREFLENWSPRMSKICSVLQSKTSLMKIQTSSLEICQILCRLSQSGQAGSSF  132

Query  2496  TSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELV  2317
             + ++    +++ +  E ++  I + + N  +G    +D+++KI + L+L+S QEL  E +
Sbjct  133   SRIQ----ELQRLKQEGVAEFIEEVLINQRDGILPCADTVSKIIELLNLRSKQELFKESL  188

Query  2316  aleklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLE  2137
             A+EK +  A+  E   E + I Q+I L++++ D +I     E+   + IP  F CPLSLE
Sbjct  189   AVEKERMRADVNEVRGEFDEINQVIRLMSYIRDFMIETDFLEADDGMLIPPYFRCPLSLE  248

Query  2136  LMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNN  1957
             LM DPVIVASGQTYER  I++W+D GLTVCPKTRQ LTHTNLIPNYTVKA++  WC+ NN
Sbjct  249   LMMDPVIVASGQTYERASIQKWLDHGLTVCPKTRQLLTHTNLIPNYTVKAMVEGWCKHNN  308

Query  1956  IKLPDPIKS  1930
             I+L + ++S
Sbjct  309   IRLFNSLES  317



>ref|XP_010039237.1| PREDICTED: U-box domain-containing protein 3 isoform X1 [Eucalyptus 
grandis]
Length=810

 Score =   388 bits (996),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/285 (67%), Positives = 238/285 (84%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V+ L+E+LK+ S +    A AELR LAKHNM+NR++I   GAI+ L++LL+S     QE
Sbjct  524   HVKILIENLKNQSNEVHTKAAAELRFLAKHNMENRLIIGQSGAITPLLSLLYSRVRYTQE  583

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTA+LNLSIN+ NK+ IA AGAIEPLI+VL++G+  A+EN+AATLFS+S++E+ K KI
Sbjct  584   HAVTAILNLSINEENKAMIAEAGAIEPLIHVLKSGNEGARENAAATLFSISLLEEYKAKI  643

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLLG+GTPRGKKDAATALFNLSI HENK RIVQAGAV++L+ELMDP  GM
Sbjct  644   GRSGAVKALVDLLGSGTPRGKKDAATALFNLSIFHENKARIVQAGAVKYLIELMDPDTGM  703

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+T  EGR++I +EGGIP+LVEV+E GS RGKENAA+ LLQLC NS ++C
Sbjct  704   VDKAVALLANLSTTGEGRLAIVREGGIPLLVEVIESGSHRGKENAASVLLQLCLNSPKFC  763

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGT RA+EKAQ LL +FRNQR G   +G
Sbjct  764   TLVLQEGAVPPLVALSQSGTARAKEKAQQLLGHFRNQREGAMVKG  808


 Score =   203 bits (517),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 195/309 (63%), Gaps = 1/309 (0%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS-DELLQKVFS  2677
             L+N+IS F HL   +   S+ + + Y KT ++LKLL+P+L  +V+      DE+L K F 
Sbjct  13    LINSISRFIHLVMCQTRKSQHLQQIYGKTTEVLKLLKPLLDDVVEHTTPILDEILYKEFE  72

Query  2676  GLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSL  2497
              L  +V+  RE  + W    SK+  VLQ+++ + K++  SL+I ++L        A SS 
Sbjct  73    ELDMAVNMSREFLENWSPRMSKICSVLQSKTSLMKIQTSSLEICQILCRLSQSGQAGSSF  132

Query  2496  TSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELV  2317
             + ++  + +++ +  E ++  I + + N  +G    +D+++KI + L+L+S QEL  E +
Sbjct  133   SRIQYSLQELQRLKQEGVAEFIEEVLINQRDGILPCADTVSKIIELLNLRSKQELFKESL  192

Query  2316  aleklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLE  2137
             A+EK +  A+  E   E + I Q+I L++++ D +I     E+   + IP  F CPLSLE
Sbjct  193   AVEKERMRADVNEVRGEFDEINQVIRLMSYIRDFMIETDFLEADDGMLIPPYFRCPLSLE  252

Query  2136  LMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNN  1957
             LM DPVIVASGQTYER  I++W+D GLTVCPKTRQ LTHTNLIPNYTVKA++  WC+ NN
Sbjct  253   LMMDPVIVASGQTYERASIQKWLDHGLTVCPKTRQLLTHTNLIPNYTVKAMVEGWCKHNN  312

Query  1956  IKLPDPIKS  1930
             I+L + ++S
Sbjct  313   IRLFNSLES  321



>gb|KDP26522.1| hypothetical protein JCGZ_17680 [Jatropha curcas]
Length=780

 Score =   386 bits (991),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 197/304 (65%), Positives = 243/304 (80%), Gaps = 0/304 (0%)
 Frame = -2

Query  1293  RIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNC  1114
             R  S+P ++  +    +   V+ L+EDLKS S + Q  A AELRLLAK  M+NRI+I  C
Sbjct  476   RTQSAPFLDMGSGYVTISSHVKNLIEDLKSQSNELQTTAAAELRLLAKDKMENRIIIGCC  535

Query  1113  GAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKE  934
             GAI  L++LL+SE    QE+AVTALLN+SIN+  K+ IA AGAIEPLI+VL++G+  AKE
Sbjct  536   GAIPPLLSLLYSEVKLTQEHAVTALLNMSINEEVKTMIAEAGAIEPLIHVLKSGNDGAKE  595

Query  933   NSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRI  754
             NSAATLFSLSV+E+ + KIGRSGAV++LV LL +GT RGKKDAATALFNLSILH+NK  I
Sbjct  596   NSAATLFSLSVLEEYRAKIGRSGAVKALVGLLASGTLRGKKDAATALFNLSILHDNKACI  655

Query  753   VQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARG  574
             VQAGAV++LV+LMDPA GM DKAVA+L+NL+TI EG+++I + GGIP LVE+VE GS RG
Sbjct  656   VQAGAVKYLVKLMDPATGMADKAVALLANLSTIGEGQLAIVRAGGIPSLVEIVESGSQRG  715

Query  573   KENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGN  394
             KENAA+ LLQLC NS ++C +VLQ GAVPPLVALSQ GTPRA+EKAQ LL +FRNQR G 
Sbjct  716   KENAASVLLQLCLNSPKFCTLVLQEGAVPPLVALSQFGTPRAKEKAQQLLCHFRNQREGA  775

Query  393   AGRG  382
              G+G
Sbjct  776   MGKG  779


 Score =   243 bits (621),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 135/323 (42%), Positives = 208/323 (64%), Gaps = 3/323 (1%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             ++ L+N+IS F  L S +N  +  + K Y+    +LK L+P+L  +VD +++SD++L K 
Sbjct  5     IRCLINSISRFILLVSCQNRKAMPIQKDYRNMVMVLKHLKPVLDEVVDYKLSSDDILYKE  64

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L  +V+E RE  + W    SK+  V ++E+L  K+R  +L I  +L       P+  
Sbjct  65    CEELDLAVNEAREFMENWYPKMSKICSVWRSEALFTKIRTSALDICHILPRLLQSSPSTP  124

Query  2502  SLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIE  2323
             SLT +++C+ +++ ++ E+++  I +A+++  EG     D LTKI + LSL S++E L E
Sbjct  125   SLTGVQHCMQELQCLEQEMITDHIEEAVRSKREGVIPCIDHLTKIIESLSLTSDREFLKE  184

Query  2322  LValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLS  2143
             +VA+EK + N E  +   ++ +I++I+ L++ + +CL+ +++ E  + V IP  F CPLS
Sbjct  185   IVAVEKERVNIEVNKGKGDLGHIDKIVDLISEIRNCLLKIERLEPESGVPIPPYFRCPLS  244

Query  2142  LELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEM  1963
             LELM DPVIVASGQTYER  I++W+D GLT+CPKTRQ L HTNLIPNYTVKA+IANWCE 
Sbjct  245   LELMLDPVIVASGQTYERASIQKWLDHGLTICPKTRQELAHTNLIPNYTVKAMIANWCEE  304

Query  1962  NNIKLPDPIKSLNVNQ---PSSH  1903
             N I+L    K  N+     PS H
Sbjct  305   NQIRLSSNSKQANLTSAPTPSDH  327



>ref|XP_008807731.1| PREDICTED: U-box domain-containing protein 3 [Phoenix dactylifera]
Length=783

 Score =   385 bits (989),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 204/318 (64%), Positives = 257/318 (81%), Gaps = 4/318 (1%)
 Frame = -2

Query  1344  RLRPPAI--WRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATA  1171
             R  PP +  +R     + +  +S P   + +D       V+KL+EDLKS + + Q  A +
Sbjct  463   RFSPPELSGFRNGHANICASQLSLP--RSGSDELTTSSHVQKLIEDLKSQAPEVQTAAAS  520

Query  1170  ELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANA  991
             ELRLLAKHNM+NR++I+  GAI  LV+LL+S+   VQE AVTALLNLS+NDNNK +IA A
Sbjct  521   ELRLLAKHNMENRVLIAKYGAIPPLVSLLYSKVKRVQEIAVTALLNLSLNDNNKVSIAEA  580

Query  990   GAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKK  811
             GAIEPLIYVLE GS EAKENSAA LFSLS++ED K+KIGRSGA+++LV+LLG+G+ RGKK
Sbjct  581   GAIEPLIYVLECGSTEAKENSAAALFSLSILEDYKVKIGRSGAIKALVNLLGSGSLRGKK  640

Query  810   DAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIG  631
             DAATALFNLSI HENK RIVQAGAVR+LVELMDP+ GM DK+VA+L+NL+T+ EGR+++ 
Sbjct  641   DAATALFNLSIFHENKARIVQAGAVRYLVELMDPSTGMADKSVALLANLSTVPEGRLAVS  700

Query  630   QEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPR  451
             QEGGIP+LVE+VE GS RGKENAA+ALLQLC +S ++C++VLQ GAVPPL+ALSQ GTPR
Sbjct  701   QEGGIPLLVEIVETGSQRGKENAASALLQLCLHSHKFCSLVLQEGAVPPLIALSQFGTPR  760

Query  450   AREKAQALLSYFRNQRHG  397
             A+EKAQ +L +FR+QR G
Sbjct  761   AKEKAQQILGHFRSQREG  778


 Score =   248 bits (634),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 147/328 (45%), Positives = 210/328 (64%), Gaps = 9/328 (3%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G M+  ++  L+N+IS F HL   +   S L+ K ++    ILKLL+PIL    D++I S
Sbjct  16    GAMDENVIGGLINSISRFIHLVGCQTAKSTLL-KDFKSIVGILKLLKPILHEAFDSQIPS  74

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIV----ELL  2536
             DE L K F  L  +V+E RE  +       ++Y VLQ+E ++ KV+  S++I     ELL
Sbjct  75    DEHLIKAFEELDVAVNEAREFMEKQHQRMGRIYSVLQSEPMVLKVQKSSIEICHVLSELL  134

Query  2535  VSSDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCL  2356
              SS +     S L S+++C+ +++ M  +L S  I  A+K+  +    S + + KI D L
Sbjct  135   QSSHYT----SYLASIQHCLQELQCMQQDLTSELIENALKDQRDYVIPSLEDIIKIMDTL  190

Query  2355  SLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSV  2176
              L SNQELL+E +ALEK +  AE  EK E+ ++I QIIALV HM  C+  ++Q      +
Sbjct  191   GLASNQELLMESIALEKERAKAELKEKTEDADHISQIIALVVHMRYCVAKLEQFGFINGL  250

Query  2175  QIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYT  1996
              IP+ F CPLSL+LM DPVIVASGQTYER+FI++W+D GL +CP+T Q L+HTNLIPN+T
Sbjct  251   PIPSHFRCPLSLQLMLDPVIVASGQTYERSFIQKWLDSGLRICPRTHQILSHTNLIPNFT  310

Query  1995  VKALIANWCEMNNIKLPDPIKSLNVNQP  1912
             VK LIANWCE NNI+L + ++S  ++ P
Sbjct  311   VKELIANWCEHNNIRLSNSVQSDCISNP  338



>ref|XP_007144888.1| hypothetical protein PHAVU_007G192300g [Phaseolus vulgaris]
 gb|ESW16882.1| hypothetical protein PHAVU_007G192300g [Phaseolus vulgaris]
Length=794

 Score =   385 bits (989),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 196/286 (69%), Positives = 234/286 (82%), Gaps = 1/286 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
             Q  +L+EDL S S++ Q  A  ELRLL KHN +NR ++  CGA   L++LL+S+    QE
Sbjct  507   QASRLIEDLHSQSIETQTTAAEELRLLTKHNRENRTIVGQCGAAMPLLSLLYSDMKVTQE  566

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN++NK+ I  AGAIEPLI+VL+TG+  AKENSAATLFSLSVIE+NK +I
Sbjct  567   HAVTALLNLSINEDNKALIMEAGAIEPLIHVLKTGNDSAKENSAATLFSLSVIENNKARI  626

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLL +GT RGKKDAATALFNLSI HENK RIVQAGAV+ LV LMD A GM
Sbjct  627   GRSGAVKALVDLLASGTLRGKKDAATALFNLSIFHENKARIVQAGAVKFLVRLMDNAGGM  686

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
              DK+VA+LSNL+TI EGR+ I +E GIP+LVE VE GS RGKENAA+ LLQLC +SS++C
Sbjct  687   ADKSVALLSNLSTIPEGRIEIARERGIPLLVEFVESGSQRGKENAASILLQLCLHSSKFC  746

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNA-GRG  382
             N+VLQ GAVPPLVALS SGTPRA+EKAQ LLS+FRNQR   A G+G
Sbjct  747   NLVLQEGAVPPLVALSVSGTPRAKEKAQQLLSHFRNQREQAASGKG  792


 Score =   220 bits (560),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 186/305 (61%), Gaps = 0/305 (0%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L+N+IS F HL S + +      K       +LK L+P+L  ++D  I SD  L K 
Sbjct  11    VKCLINSISRFIHLVSCQTMKPVTFQKICNNMVGVLKRLKPVLDDVMDHLIPSDVNLCKE  70

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L   V+E R+  + W   +S+++ VLQ  +L+ K+++ SL I  ++V S    P+ S
Sbjct  71    CEELDKRVNEARDFIEKWSPKTSRIHSVLQGGTLLIKLQSTSLDICHMIVRSLQSPPSAS  130

Query  2502  SLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIE  2323
              L +L++ + +++ +  E+    I +A++N  +        L +I + L L SNQELL E
Sbjct  131   VLANLQHYIQELQCLKKEIAMVYIEEALRNQRDNIEPCKVRLKEIIELLKLTSNQELLKE  190

Query  2322  LValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLS  2143
              +A+EK + N E  +   ++E I +I+ LV  + D +I  +     + + IP  F CPLS
Sbjct  191   SIAVEKERLNTEANKMIADIEEINEIVNLVRSLRDYVIKTECPVVKSGLSIPPYFLCPLS  250

Query  2142  LELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEM  1963
             LELM DPVIVASGQTYER  I++W+D GLTVCPKTRQ LTHTNLIPNYTVKA+IA WCE 
Sbjct  251   LELMLDPVIVASGQTYERQSIQKWLDHGLTVCPKTRQRLTHTNLIPNYTVKAMIATWCEE  310

Query  1962  NNIKL  1948
             NN+KL
Sbjct  311   NNVKL  315



>ref|XP_007144889.1| hypothetical protein PHAVU_007G192300g [Phaseolus vulgaris]
 gb|ESW16883.1| hypothetical protein PHAVU_007G192300g [Phaseolus vulgaris]
Length=790

 Score =   385 bits (988),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 196/286 (69%), Positives = 234/286 (82%), Gaps = 1/286 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
             Q  +L+EDL S S++ Q  A  ELRLL KHN +NR ++  CGA   L++LL+S+    QE
Sbjct  503   QASRLIEDLHSQSIETQTTAAEELRLLTKHNRENRTIVGQCGAAMPLLSLLYSDMKVTQE  562

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN++NK+ I  AGAIEPLI+VL+TG+  AKENSAATLFSLSVIE+NK +I
Sbjct  563   HAVTALLNLSINEDNKALIMEAGAIEPLIHVLKTGNDSAKENSAATLFSLSVIENNKARI  622

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLL +GT RGKKDAATALFNLSI HENK RIVQAGAV+ LV LMD A GM
Sbjct  623   GRSGAVKALVDLLASGTLRGKKDAATALFNLSIFHENKARIVQAGAVKFLVRLMDNAGGM  682

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
              DK+VA+LSNL+TI EGR+ I +E GIP+LVE VE GS RGKENAA+ LLQLC +SS++C
Sbjct  683   ADKSVALLSNLSTIPEGRIEIARERGIPLLVEFVESGSQRGKENAASILLQLCLHSSKFC  742

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNA-GRG  382
             N+VLQ GAVPPLVALS SGTPRA+EKAQ LLS+FRNQR   A G+G
Sbjct  743   NLVLQEGAVPPLVALSVSGTPRAKEKAQQLLSHFRNQREQAASGKG  788


 Score =   215 bits (547),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 184/305 (60%), Gaps = 4/305 (1%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L+N+IS F HL S + +      K       +LK L+P+L  ++D  I SD  L K 
Sbjct  11    VKCLINSISRFIHLVSCQTMKPVTFQKICNNMVGVLKRLKPVLDDVMDHLIPSDVNLCKE  70

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L   V+E R+  + W   +S+++ VLQ  +L+ K+++ SL I  ++V S    P+ S
Sbjct  71    CEELDKRVNEARDFIEKWSPKTSRIHSVLQGGTLLIKLQSTSLDICHMIVRSLQSPPSAS  130

Query  2502  SLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIE  2323
              L +L+    +++ +  E+    I +A++N  +        L +I + L L SNQELL E
Sbjct  131   VLANLQ----ELQCLKKEIAMVYIEEALRNQRDNIEPCKVRLKEIIELLKLTSNQELLKE  186

Query  2322  LValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLS  2143
              +A+EK + N E  +   ++E I +I+ LV  + D +I  +     + + IP  F CPLS
Sbjct  187   SIAVEKERLNTEANKMIADIEEINEIVNLVRSLRDYVIKTECPVVKSGLSIPPYFLCPLS  246

Query  2142  LELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEM  1963
             LELM DPVIVASGQTYER  I++W+D GLTVCPKTRQ LTHTNLIPNYTVKA+IA WCE 
Sbjct  247   LELMLDPVIVASGQTYERQSIQKWLDHGLTVCPKTRQRLTHTNLIPNYTVKAMIATWCEE  306

Query  1962  NNIKL  1948
             NN+KL
Sbjct  307   NNVKL  311



>ref|XP_002532036.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF30352.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=753

 Score =   383 bits (984),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 244/306 (80%), Gaps = 0/306 (0%)
 Frame = -2

Query  1299  VSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVIS  1120
             ++R  + P +++  D       V  L+E LKS S + Q  A  ELRLLAK+ M+NRI+I 
Sbjct  446   LNRTRAVPFLDSGFDDLTTTSHVECLIEGLKSQSNELQATAAEELRLLAKNKMENRIIIG  505

Query  1119  NCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEA  940
               GAI+ L++LL+S   + QE+AVTALLNLSIN+  KS IA AGA+EPLI+VL++G+  A
Sbjct  506   RSGAITPLLSLLYSGVKQTQEHAVTALLNLSINEEVKSMIAEAGALEPLIHVLKSGNDGA  565

Query  939   KENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKG  760
             KENSAA LFSLSV+E+ K KIG SGAV++LVDLL +GT RGKKDAATALFNLSILHENK 
Sbjct  566   KENSAAALFSLSVLEEYKAKIGCSGAVKALVDLLASGTLRGKKDAATALFNLSILHENKA  625

Query  759   RIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSA  580
             RIVQAGAV++LVELMDPA GMVDK+VA+L+NL+TI EGR++I + GGIP LVE+VE GS 
Sbjct  626   RIVQAGAVKYLVELMDPATGMVDKSVALLANLSTIGEGRLAIARAGGIPSLVEIVESGSQ  685

Query  579   RGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRH  400
             RGKENAA+ LLQLC NS ++C  VLQ GAVPPLVALSQSGT RA+EKAQ LLS+FRNQR 
Sbjct  686   RGKENAASVLLQLCLNSPKFCTFVLQEGAVPPLVALSQSGTLRAKEKAQQLLSHFRNQRE  745

Query  399   GNAGRG  382
             G+ G+G
Sbjct  746   GSMGKG  751


 Score =   223 bits (569),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 202/309 (65%), Gaps = 0/309 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M++  ++ L+N+IS F  L S +      + K Y     +LK L+P+L  I+D +++SD+
Sbjct  1     MDMTPVRCLVNSISRFILLVSCQTRKPAPIQKDYGNMVTVLKHLKPVLDEIIDCKLSSDQ  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K    L  +V+  R+  + W    SK+  V Q+E+L  K+R  S+KI  LL      
Sbjct  61    ILYKECEELDLAVNGARDFMENWCPKMSKLCSVQQSEALYMKIRISSVKICHLLSRLLRS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P+ SSLTS+++C+ +++S+  E+++  I +A++N  +     SD L KI   LSL S Q
Sbjct  121   SPSTSSLTSIQHCMQELQSLKQEMMTEHIEEAVRNKRDEVVPCSDPLVKIIQSLSLTSGQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+L E VA+EK + N +  +   +++ I QI+ L++ + +CL+ +++ +  + V IP+ F
Sbjct  181   EILKESVAVEKERMNIQVNKAKGDLDQINQIVDLISDIRNCLLKIERVDPKSGVLIPSYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTYER  I++W++ GLT+CPKTR+TL H+NLIPNYTVKA+I+
Sbjct  241   RCPLSLELMLDPVIVASGQTYERASIQKWLEHGLTICPKTRKTLAHSNLIPNYTVKAMIS  300

Query  1977  NWCEMNNIK  1951
             NWCE N+I+
Sbjct  301   NWCEENHIR  309



>ref|XP_010679334.1| PREDICTED: U-box domain-containing protein 3 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=760

 Score =   383 bits (984),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 233/284 (82%), Gaps = 0/284 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V ++VE LK  S   Q  A AELRLLAKHNM+NRI+I  CGAI  L++LLH++    QE
Sbjct  474   HVDEMVEHLKGPSNSLQTSAAAELRLLAKHNMENRIIIGKCGAIGPLISLLHTDVKITQE  533

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLS+N+  K+ IA AG IEPLI+VL+TG+  AKENSAA LFS S++ED K KI
Sbjct  534   HAVTALLNLSLNEEIKAKIAEAGIIEPLIHVLKTGTDTAKENSAAALFSFSLLEDFKSKI  593

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGA++ LVDLL  GT RGKKDAATALFNLSI HEN  RIVQ GAV++LV+L++P+ GM
Sbjct  594   GRSGAIKVLVDLLARGTIRGKKDAATALFNLSICHENIARIVQGGAVKYLVQLLEPSTGM  653

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDK+VA+L+NL+ I EGR++I +EGGIP+LVE+V+ GS RGKENAA+ LLQLC NS+++C
Sbjct  654   VDKSVALLANLSPITEGRLAIAKEGGIPLLVEIVDSGSQRGKENAASVLLQLCLNSNKFC  713

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             N+VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FR QR G +G+
Sbjct  714   NLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTQREGGSGK  757


 Score =   192 bits (487),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 122/318 (38%), Positives = 186/318 (58%), Gaps = 6/318 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME   ++ L N+IS F HL S +   +      ++    +LK L+P+L  I D +IAS+ 
Sbjct  1     MEAKYMRCLNNSISRFIHLMSCQTSKAMPTRNEFEILATMLKHLKPVLDEIDDDKIASEA  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K    L   ++  RE  + W    S +  V ++E L+  ++  +L+I  +L      
Sbjct  61    VLWKECEDLDIYINTAREFMEQWSPKMSSILSVSRSEQLLKTIKRSALEICSILCRLLRT  120

Query  2517  LPAESSL------TSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCL  2356
              P+ SS       T + +CV +++S   E +S  + +A+++  +   + S  L +I + L
Sbjct  121   SPSSSSFAGVQVCTEIMHCVQELQSWQPERISGHMEQALRSKNDNLISCSQHLAEIVESL  180

Query  2355  SLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSV  2176
             SL SNQELL E +A+EK +   +  +  EEV+ I QI+ L+  + D L+      +   V
Sbjct  181   SLVSNQELLKESIAVEKERVKLDANKCVEEVDQINQIVDLLALIRDYLLKNGCFGTMKGV  240

Query  2175  QIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYT  1996
              IP+ F CPLSL  M DPVIVASGQT+ER+ I++W+D GL +CPKTRQ L+HTN+IPNYT
Sbjct  241   LIPSYFRCPLSLIFMLDPVIVASGQTFERSSIQKWLDHGLRICPKTRQYLSHTNVIPNYT  300

Query  1995  VKALIANWCEMNNIKLPD  1942
             VKALIANW + NN+K P+
Sbjct  301   VKALIANWLQENNLKPPN  318



>ref|XP_010679335.1| PREDICTED: U-box domain-containing protein 3 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=754

 Score =   383 bits (984),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 233/284 (82%), Gaps = 0/284 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V ++VE LK  S   Q  A AELRLLAKHNM+NRI+I  CGAI  L++LLH++    QE
Sbjct  468   HVDEMVEHLKGPSNSLQTSAAAELRLLAKHNMENRIIIGKCGAIGPLISLLHTDVKITQE  527

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLS+N+  K+ IA AG IEPLI+VL+TG+  AKENSAA LFS S++ED K KI
Sbjct  528   HAVTALLNLSLNEEIKAKIAEAGIIEPLIHVLKTGTDTAKENSAAALFSFSLLEDFKSKI  587

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGA++ LVDLL  GT RGKKDAATALFNLSI HEN  RIVQ GAV++LV+L++P+ GM
Sbjct  588   GRSGAIKVLVDLLARGTIRGKKDAATALFNLSICHENIARIVQGGAVKYLVQLLEPSTGM  647

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDK+VA+L+NL+ I EGR++I +EGGIP+LVE+V+ GS RGKENAA+ LLQLC NS+++C
Sbjct  648   VDKSVALLANLSPITEGRLAIAKEGGIPLLVEIVDSGSQRGKENAASVLLQLCLNSNKFC  707

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             N+VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FR QR G +G+
Sbjct  708   NLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTQREGGSGK  751


 Score =   197 bits (502),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 121/312 (39%), Positives = 186/312 (60%), Gaps = 0/312 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME   ++ L N+IS F HL S +   +      ++    +LK L+P+L  I D +IAS+ 
Sbjct  1     MEAKYMRCLNNSISRFIHLMSCQTSKAMPTRNEFEILATMLKHLKPVLDEIDDDKIASEA  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K    L   ++  RE  + W    S +  V ++E L+  ++  +L+I  +L      
Sbjct  61    VLWKECEDLDIYINTAREFMEQWSPKMSSILSVSRSEQLLKTIKRSALEICSILCRLLRT  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P+ SS   +++CV +++S   E +S  + +A+++  +   + S  L +I + LSL SNQ
Sbjct  121   SPSSSSFAGVQHCVQELQSWQPERISGHMEQALRSKNDNLISCSQHLAEIVESLSLVSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +A+EK +   +  +  EEV+ I QI+ L+  + D L+      +   V IP+ F
Sbjct  181   ELLKESIAVEKERVKLDANKCVEEVDQINQIVDLLALIRDYLLKNGCFGTMKGVLIPSYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSL  M DPVIVASGQT+ER+ I++W+D GL +CPKTRQ L+HTN+IPNYTVKALIA
Sbjct  241   RCPLSLIFMLDPVIVASGQTFERSSIQKWLDHGLRICPKTRQYLSHTNVIPNYTVKALIA  300

Query  1977  NWCEMNNIKLPD  1942
             NW + NN+K P+
Sbjct  301   NWLQENNLKPPN  312



>ref|XP_009401620.1| PREDICTED: U-box domain-containing protein 3 [Musa acuminata 
subsp. malaccensis]
Length=764

 Score =   383 bits (983),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 189/294 (64%), Positives = 240/294 (82%), Gaps = 0/294 (0%)
 Frame = -2

Query  1266  TRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNL  1087
             +R D       V+ +++DLKS + + Q  A ++LRLLAK+NM+NR++I  CGAI  LV+L
Sbjct  468   SRLDDLTTAPHVQNIIDDLKSEAPELQTAAASKLRLLAKNNMENRVLIGKCGAIPSLVSL  527

Query  1086  LHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSL  907
             L+S   +VQENAVTALLNLSIND+NK  IA AGA+EPLI+VLE G+ EAKENSAA  FSL
Sbjct  528   LYSNVKKVQENAVTALLNLSINDDNKVLIAEAGAVEPLIHVLECGTTEAKENSAAAFFSL  587

Query  906   SVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHL  727
             SV+++ K KIGRSGAV++LV LL  G+ RGKKDAATALFNLSI HENK RIVQAGAV++L
Sbjct  588   SVMDEYKAKIGRSGAVKALVYLLETGSVRGKKDAATALFNLSIFHENKARIVQAGAVKYL  647

Query  726   VELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALL  547
             ++LM+ + GMVDK+VA+L+NL+TI EGR++I QEGGIP+LVEVVE GS RGKENAA+ L 
Sbjct  648   IKLMELSTGMVDKSVALLANLSTIPEGRIAIAQEGGIPLLVEVVETGSQRGKENAASTLF  707

Query  546   QLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             QLC +S ++C++VLQ GAVPPL+ALSQ GTPR +EKAQ +LS+FR+QR G A +
Sbjct  708   QLCLSSQKFCSLVLQEGAVPPLIALSQFGTPRGKEKAQQILSHFRSQREGAARK  761


 Score =   244 bits (623),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 217/348 (62%), Gaps = 5/348 (1%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G M+  ++  L+N+IS F HL + + I S  + K ++K   ILKLL+P+L   +D+E+  
Sbjct  4     GAMDGEIIGGLINSISRFIHLVACQTIKSAAI-KDFRKIVGILKLLKPVLDEALDSELPL  62

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             D  L K F  L  +V++ REL +      SK+Y VLQ+E ++ +V+  + +I   L +  
Sbjct  63    DGHLVKEFEELDVAVNDARELLEKAPQRMSKIYSVLQSEPMLLRVQKSASEICHFLSA--  120

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
               L +     S+++C+ +++ M+ + +S  I  A+K+  E +  S D + KI D LSL S
Sbjct  121   --LQSSPFSASIQHCMQEVQYMEQDPISELIDHALKDLKENTIPSLDDVIKIMDTLSLAS  178

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQELL+E +ALEK K  AE   K E +++I  I  LV+H+  C+  ++Q      V +P 
Sbjct  179   NQELLMESIALEKEKAKAELKSKTEIIDHINWITVLVSHICYCMEKLEQFGFVNGVPVPL  238

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
              F CPLSL+LM DPVI+ASGQTYER+FI++W+D GL  CPKTRQTL HTNLIPNYTVKAL
Sbjct  239   HFRCPLSLQLMLDPVILASGQTYERSFIQKWLDNGLRFCPKTRQTLVHTNLIPNYTVKAL  298

Query  1983  IANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRAN  1840
             IANWCE NNIKL    +  N++ P S +A  +     D H  S SR++
Sbjct  299   IANWCEKNNIKLDVSAQPENISYPYSSIAAFEDIQHEDDHRHSTSRSS  346



>ref|XP_009369475.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Pyrus x bretschneideri]
Length=764

 Score =   382 bits (981),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 206/378 (54%), Positives = 270/378 (71%), Gaps = 19/378 (5%)
 Frame = -2

Query  1542  HNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVASESRHAATLAASRRESEF  1363
             H+R  SA S +S+ +++   +   + +S+        S E+ SE   A+T    +++S  
Sbjct  396   HSRGESATSAVSSIDYAPPASIKVSGISNKHENVRRLSGEITSEHTVAST---PKKQSAI  452

Query  1362  PSPVGTRL------RPPAIW----RRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVED  1213
             P  +  +L      +    W      P  +L+      P   + +D       VR L+ED
Sbjct  453   PPGLSGKLSHISKTKAEGAWTDSPSYPDRQLL------PFYSSGSDELTTASHVRNLIED  506

Query  1212  LKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLN  1033
             LKS S + Q +A  ELRLL KHNM+NR +I  CGAI+ LV+LL+S ++  QE+AVTALLN
Sbjct  507   LKSQSNEVQTMAAEELRLLGKHNMENRTIIGQCGAITPLVSLLYSGELTTQEHAVTALLN  566

Query  1032  LSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQS  853
             LSIN++NK+ IA AGAI+PLI+VL+TGS  AKENSAATLFSLSV+++ K KIGRSGAV++
Sbjct  567   LSINEDNKAMIAEAGAIDPLIHVLKTGSDGAKENSAATLFSLSVLDEYKAKIGRSGAVKA  626

Query  852   LVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVL  673
             LVDLL +GT RGKKDA TALFNLSI HENK R+VQAG V+HL++LMDP +GMVDKAVA+L
Sbjct  627   LVDLLASGTLRGKKDAGTALFNLSIFHENKARLVQAGVVKHLIDLMDPDSGMVDKAVALL  686

Query  672   SNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGA  493
             +NL+TI EGR++I +EGG P+LVE+VE GS RGKENAA+ LLQLC +S ++C +VLQ GA
Sbjct  687   ANLSTIAEGRIAITREGGTPLLVEIVESGSHRGKENAASILLQLCLHSPKFCTLVLQEGA  746

Query  492   VPPLVALSQSGTPRAREK  439
             VPPLVALSQSGTPRA+EK
Sbjct  747   VPPLVALSQSGTPRAKEK  764


 Score =   233 bits (593),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 139/341 (41%), Positives = 213/341 (62%), Gaps = 3/341 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+   +K L+N+IS F HL S + +    + K Y+   D+LKLL+P++  +VD ++ SD+
Sbjct  1     MDTSSMKCLINSISRFVHLVSSQTLKHIPIQKDYRTIVDVLKLLKPLIDEVVDFKVPSDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +L K    L  +V+  RE  + W   SSK+    + E L+  ++  SLKI  +L      
Sbjct  61    ILYKECEELDMAVNGAREFIENWSPKSSKISSAWRCEPLLITIQNSSLKICSILRRLSQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
               + SSLT L++C  +I+S+  E ++  + +A+++  +    S+  L KI + L+L SNQ
Sbjct  121   SSSGSSLTGLQHCTQEIQSLKLERVTEYLEEAVRSQSKDVMPSTKLLMKIIELLNLTSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +A+EK + N E ++   +++ I QI+ LV+H+ + ++ ++  E+ + V IP+ F
Sbjct  181   ELLKESIAVEKERMNVEVSDVRGKLDQINQIVVLVSHIREFMVKIEHLETISGVSIPSYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLS ELM DPVIVASGQTYER+ I++WID GLT+CPKTRQ L HTNLIPNYTVKA+I 
Sbjct  241   RCPLSSELMLDPVIVASGQTYERDSIQKWIDHGLTICPKTRQRLYHTNLIPNYTVKAMIE  300

Query  1977  NWCEMNNIKLP---DPIKSLNVNQPSSHVAHVDSGAPRDIH  1864
             +WC+ N+IKL    D   ++ V  PS  V+  DS     +H
Sbjct  301   SWCQENDIKLTANSDGSNAITVPSPSDQVSPADSTHTGGLH  341



>gb|KCW84729.1| hypothetical protein EUGRSUZ_B01548 [Eucalyptus grandis]
Length=609

 Score =   377 bits (968),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 189/285 (66%), Positives = 236/285 (83%), Gaps = 3/285 (1%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V+ L+E+LK+ S +    A AELR LAKHNM+NR++I   GAI+ L++LL+S     QE
Sbjct  326   HVKILIENLKNQSNEVHTKAAAELRFLAKHNMENRLIIGQSGAITPLLSLLYSRVRYTQE  385

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTA+LNLSIN+ NK+ IA AGAIEPLI+VL++G+  A+EN+AATLFS+S++E+ K KI
Sbjct  386   HAVTAILNLSINEENKAMIAEAGAIEPLIHVLKSGNEGARENAAATLFSISLLEEYKAKI  445

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLLG+GTPRGKKDAATALFNLSI HENK RIVQAGAV++L+ELMDP  GM
Sbjct  446   GRSGAVKALVDLLGSGTPRGKKDAATALFNLSIFHENKARIVQAGAVKYLIELMDPDTGM  505

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+T  EGR++I +EGGIP+LVEV+E GS RGKENAA+ LLQLC NS ++C
Sbjct  506   VDKAVALLANLSTTGEGRLAIVREGGIPLLVEVIESGSHRGKENAASVLLQLCLNSPKFC  565

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGT RA+EK   LL +FRNQR G   +G
Sbjct  566   TLVLQEGAVPPLVALSQSGTARAKEK---LLGHFRNQREGAMVKG  607


 Score =   144 bits (364),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = -2

Query  2256  IEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIR  2077
             I Q+I L++++ D +I     E+   + IP  F CPLSLELM DPVIVASGQTYER  I+
Sbjct  15    INQVIRLMSYIRDFMIETDFLEADDGMLIPPYFRCPLSLELMMDPVIVASGQTYERASIQ  74

Query  2076  RWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDPIKS  1930
             +W+D GLTVCPKTRQ LTHTNLIPNYTVKA++  WC+ NNI+L + ++S
Sbjct  75    KWLDHGLTVCPKTRQLLTHTNLIPNYTVKAMVEGWCKHNNIRLFNSLES  123



>ref|XP_008440336.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis melo]
Length=538

 Score =   374 bits (961),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 258/351 (74%), Gaps = 2/351 (1%)
 Frame = -2

Query  1437  EASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRA  1258
             +AS +V  ES   AT A  + E + P  +    +   I ++  E  +  IV S   +  +
Sbjct  189   DASEKVKLESPAPATPAFLQVEPQLPRRLLVERKSDTIGQQGQE--LPEIVCSSVADHES  246

Query  1257  DLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHS  1078
             +L   +  ++KLVEDL S S++  R A AE R LA+ N +NRI+I+  GAI  LV L++S
Sbjct  247   ELGSDEAGIQKLVEDLNSNSLETIRAAIAEFRSLARQNTENRILIAKHGAIPFLVKLMYS  306

Query  1077  EDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVI  898
              D  +QE+AVT LLNLSI+ ++K AIA A  IEPLI+VL TGSPEA+ENSAAT FSL+++
Sbjct  307   TDAIIQEHAVTTLLNLSIHSDHKIAIAEANVIEPLIHVLVTGSPEARENSAATFFSLAML  366

Query  897   EDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVEL  718
              +N++KIG+SGA+  LV+LLGNGTPRG+KDA TALF LS+L ENK +IVQAGAV+HL+EL
Sbjct  367   VENRVKIGKSGAIGPLVELLGNGTPRGRKDATTALFYLSMLPENKVKIVQAGAVKHLLEL  426

Query  717   MDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLC  538
             MDP+ GMVDK VAVL+NLATIQEG++ +G+ GGIP+LVE +ELGSARGKENAAAALL++C
Sbjct  427   MDPSVGMVDKTVAVLANLATIQEGKVEVGRMGGIPVLVEAIELGSARGKENAAAALLRVC  486

Query  537   TNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             + S+R+C M LQ G +PPLVALSQSGT RA++KAQ LL+  R     N  +
Sbjct  487   STSNRFCIMALQEGVIPPLVALSQSGTRRAKDKAQELLNLLRKHVRSNVEK  537



>ref|XP_006604492.1| PREDICTED: U-box domain-containing protein 3-like isoform X3 
[Glycine max]
Length=796

 Score =   382 bits (982),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 194/305 (64%), Positives = 238/305 (78%), Gaps = 0/305 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             S++ S P     +D       V +L+EDL+S S + +  A  +LR   KHNM+NRI++  
Sbjct  490   SKVASHPVSNLGSDELITTSHVHELIEDLQSQSNETRTAAAEQLRFCTKHNMENRIIVGQ  549

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI  L++LL+S+    QE+AVTALLNLSIN+ NK+ I  AGAIEPLI++LE G+  AK
Sbjct  550   CGAIMPLLSLLYSDMKITQEHAVTALLNLSINEGNKALIMEAGAIEPLIHLLEKGNDGAK  609

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAA LFSLSVI++NK KIGRSGAV++LV LL +GT RGKKDAATALFNLSI HENK R
Sbjct  610   ENSAAALFSLSVIDNNKAKIGRSGAVKALVGLLASGTLRGKKDAATALFNLSIFHENKAR  669

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV+ LV L+DP   MVDKAVA+L+NL+TI EGR+ I +EGGIP LVE+VE GS R
Sbjct  670   IVQAGAVKFLVLLLDPTDKMVDKAVALLANLSTIAEGRIEIAREGGIPSLVEIVESGSQR  729

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAA+ LLQ+C +S ++C +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR G
Sbjct  730   GKENAASILLQMCLHSQKFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREG  789

Query  396   NAGRG  382
               G+G
Sbjct  790   ATGKG  794


 Score =   219 bits (559),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 138/331 (42%), Positives = 195/331 (59%), Gaps = 9/331 (3%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L+N+IS F HL   + +    + K       +LK L+P+L  IVD +I  DE L + 
Sbjct  12    VKCLVNSISRFMHLVCCQAVKPMPLQKNCNNMVGVLKRLKPVLDDIVDFKIPLDENLHRE  71

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L   V+E RE  +      S+++ VLQ+  L+ K++  S KI  ++V S   L A +
Sbjct  72    CEELDMQVNEAREFIEKLGPKMSRIHSVLQSGELLIKLQNSSYKICHMIVKS---LKAPA  128

Query  2502  S---LTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQEL  2332
             S   L +L+  + +++ +  E     I +A++N  +      DSL +I   L L SNQEL
Sbjct  129   SVLVLGNLQQYMQELQCLKKEPAMVYIEEALRNQRDNIEPCYDSLKEIIGLLKLTSNQEL  188

Query  2331  LIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCC  2152
             L E +A+EK + NAE  +    ++ I QI+ LV ++ D ++  +  E  + V IP  F C
Sbjct  189   LKESIAVEKERSNAEVNKTKGNLDEINQIVNLVCNLRDYVMKFECPEVKSGVSIPPYFRC  248

Query  2151  PLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANW  1972
             PLSLELM+DPVIVASGQTYER  I++W+D GLTVCP T   L HTNLIPNYTVKA+IANW
Sbjct  249   PLSLELMSDPVIVASGQTYERQSIQKWLDHGLTVCPNTHHRLVHTNLIPNYTVKAMIANW  308

Query  1971  CEMNNIKLPDPIKSLN---VNQPSSHVAHVD  1888
             CE NN+KLP   K  N   ++ PS H+ H D
Sbjct  309   CEENNVKLPCNSKQSNSTRISSPSDHLLHQD  339



>ref|XP_009780997.1| PREDICTED: U-box domain-containing protein 3 [Nicotiana sylvestris]
Length=779

 Score =   382 bits (980),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 199/305 (65%), Positives = 243/305 (80%), Gaps = 1/305 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             +R +S PT     DL      V KL+ DL S S + Q  A AELR LAKHNM+NR +I  
Sbjct  474   ARQLSLPTKSMPDDLT-TSSHVEKLIRDLDSQSTEVQTTAAAELRFLAKHNMENRAIIGR  532

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI+ L++LLHS+    QE+AVTALLNLSIN++ K+ IA  GA+EPLI+VL TG+  AK
Sbjct  533   CGAIAPLISLLHSDVKLTQEHAVTALLNLSINEDIKAIIAEQGALEPLIHVLRTGNAGAK  592

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             EN+AA LFSLS++E+ + KIGRSGAV++LVDLLG+GT RGKKDAATALFNLSI HENK R
Sbjct  593   ENAAAALFSLSLLEEYRKKIGRSGAVKALVDLLGSGTIRGKKDAATALFNLSIFHENKAR  652

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV+HL+ L+DP+  +VDKAVA+L+NL+TI EG ++I +EGGIP LVE+VE GS R
Sbjct  653   IVQAGAVKHLIRLLDPSNELVDKAVALLANLSTIAEGSLAIAREGGIPSLVEIVETGSQR  712

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAA+ LLQLC NS +YC +VLQ GAVPPLVALSQSG+PRA+EKAQ LLS+FR+QR G
Sbjct  713   GKENAASILLQLCLNSPKYCRLVLQEGAVPPLVALSQSGSPRAKEKAQQLLSHFRSQREG  772

Query  396   NAGRG  382
               GRG
Sbjct  773   ATGRG  777


 Score =   209 bits (533),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 119/312 (38%), Positives = 191/312 (61%), Gaps = 3/312 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  ++ L+N+IS F HL +     +    K Y+    +LKLL+P+L  I   +  SDE
Sbjct  1     MELTSVRCLINSISRFIHLVTCLTSKTMPGQKSYKNIAILLKLLKPVLDDIAQQKAPSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              + +    L  +++E REL + W    SK+ +V Q+E  + K+++ +LKI  +L      
Sbjct  61    TISRQCEELDIAINEARELLEEWSPKKSKILWVFQSEPQLLKIQSLALKISHILSKLVES  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P+  SL+ +++ + ++++ +   +S  I  A++    G    S+SLT+I   L+L S++
Sbjct  121   SPSTLSLSEIQHFIQELQNCEVGKISKHINVALEG---GKILCSESLTEIIHSLNLTSHE  177

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +ALEK +  A+  +   +++ I   + L +H+ DC++ +   ++   ++IP  F
Sbjct  178   ELLNECIALEKERMKAKDNKTRGDLDKITISVDLFSHIRDCMLELDTLKAIDGIKIPPYF  237

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM +PVI+ASGQTYE+  I++W+D GL+ CPKT Q L H+NLIPNYTVKALI 
Sbjct  238   RCPLSLELMVNPVIIASGQTYEKTSIQKWLDHGLSTCPKTLQVLAHSNLIPNYTVKALIE  297

Query  1977  NWCEMNNIKLPD  1942
             NWCE N +KL D
Sbjct  298   NWCEENKVKLDD  309



>ref|XP_006576944.1| PREDICTED: U-box domain-containing protein 3-like isoform X5 
[Glycine max]
Length=813

 Score =   382 bits (982),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 193/285 (68%), Positives = 233/285 (82%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V +L+EDL+S S + Q  A  +LRL  KHNM+NRI +  CGAI  L++LL+SE   +QE
Sbjct  527   HVNELIEDLQSQSNETQTAAAEQLRLCTKHNMENRISVGRCGAIMPLLSLLYSERKIIQE  586

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN+ NK+ I  AGAIEPLI+VL+TG+  AKENSAA LFSLSVI++NK KI
Sbjct  587   HAVTALLNLSINEGNKALIMEAGAIEPLIHVLKTGNDGAKENSAAALFSLSVIDNNKAKI  646

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LV LL +GT RGKKD+ATALFNLSI HENK RIVQAGAV+ LV L+DP   M
Sbjct  647   GRSGAVKALVGLLASGTLRGKKDSATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKM  706

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGR+ I +EGGIP LVE+VE GS RGKENAA+ LLQLC ++ ++C
Sbjct  707   VDKAVALLANLSTIAEGRIEIAREGGIPSLVEIVESGSLRGKENAASILLQLCLHNQKFC  766

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR G  G+G
Sbjct  767   TLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGVKGKG  811


 Score =   212 bits (540),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 188/309 (61%), Gaps = 7/309 (2%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L+N+IS F HL S + +    + K       +LK L+P+L  IVD +I  DE L + 
Sbjct  32    VKCLVNSISRFIHLVSCQAVKPMPLQKNCNNMVCVLKHLKPVLDDIVDFKIPFDENLHRE  91

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L   V+E RE  + W    S+++ VLQ+  L+ K++  S KI  ++V S   L   +
Sbjct  92    CEELDMRVNEAREFIEKWGPKMSRIHSVLQSGELLIKLQNSSYKICHMIVKS---LKGPA  148

Query  2502  SLT---SLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQEL  2332
             S+    +L+  + +++ +  E     I  A++N  +      DSL +I   L + SNQEL
Sbjct  149   SVLVSGNLQQYMQELQCLKKEPAMIYIEDALRNQRDNIEPCYDSLKEIIRLLMI-SNQEL  207

Query  2331  LIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCC  2152
             LIE +A+EK + NAE  +   +++ I QI+ LV  + D ++  ++ E  + V IP  F C
Sbjct  208   LIESIAVEKERSNAEVNKTKGDLDEINQIVNLVCSLRDYVMKFERPEVKSGVSIPPYFRC  267

Query  2151  PLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANW  1972
             PLSLELM+D VIVASGQTYER  I++W+D GLTVCP TRQ L HTNLIPNYTVKA+IANW
Sbjct  268   PLSLELMSDAVIVASGQTYERQSIQKWLDHGLTVCPNTRQILVHTNLIPNYTVKAMIANW  327

Query  1971  CEMNNIKLP  1945
             CE NN+KLP
Sbjct  328   CEENNVKLP  336



>gb|KHN02500.1| U-box domain-containing protein 3 [Glycine soja]
Length=774

 Score =   380 bits (977),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 193/305 (63%), Positives = 237/305 (78%), Gaps = 0/305 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             S++ S P     +D       V +L+EDL+S S + +  A  +LR   KHNM+NRI++  
Sbjct  468   SKVASHPVSNLGSDELITTSHVHELIEDLQSQSNETRTAAAEQLRFCTKHNMENRIIVGQ  527

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI  L++LL+S+    QE+AVTALLNLSIN+ NK+ I  AGAIEPLI++LE G+  AK
Sbjct  528   CGAIMPLLSLLYSDMKITQEHAVTALLNLSINEGNKALIMEAGAIEPLIHLLEKGNDGAK  587

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAA LFSL VI++NK KIGRSGAV++LV LL +GT RGKKDAATALFNLSI HENK R
Sbjct  588   ENSAAALFSLPVIDNNKAKIGRSGAVKALVGLLASGTLRGKKDAATALFNLSIFHENKAR  647

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV+ LV L+DP   MVDKAVA+L+NL+TI EGR+ I +EGGIP LVE+VE GS R
Sbjct  648   IVQAGAVKFLVLLLDPTDKMVDKAVALLANLSTIAEGRIEIAREGGIPSLVEIVESGSQR  707

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAA+ LLQ+C +S ++C +VLQ GAVPPLVALSQSGTPRA+EKAQ LLS+FRNQR G
Sbjct  708   GKENAASILLQMCLHSQKFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREG  767

Query  396   NAGRG  382
               G+G
Sbjct  768   ATGKG  772


 Score =   208 bits (529),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 186/320 (58%), Gaps = 9/320 (3%)
 Frame = -2

Query  2829  FHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSGLGHSVDEL  2650
              HL   + +    + K       +LK L+P+L  IVD +I  DE L +    L   V+E 
Sbjct  1     MHLVCCQAVKPMPLQKNCNNMVGVLKRLKPVLDDIVDFKIPLDENLHRECEELDMQVNEA  60

Query  2649  RELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESS---LTSLENC  2479
             RE  +      S+++ VLQ+  L+ K++  S KI  ++V S   L A +S   L +L+  
Sbjct  61    REFIEKLGPKMSRIHSVLQSGELLIKLQNSSYKICHMIVKS---LKAPASVLVLGNLQQY  117

Query  2478  VLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELValeklk  2299
             + +++ +  E     I +A++N  +      DSL +I   L L SNQELL E +A+EK +
Sbjct  118   MQELQCLKKEPAMVYIEEALRNQRDNIEPCYDSLKEIIGLLKLTSNQELLKESIAVEKER  177

Query  2298  enaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLELMTDPV  2119
              NAE  +    ++ I QI+ LV ++ D ++  +  E  + V IP  F CPLSLELM+DPV
Sbjct  178   SNAEVNKTKGNLDEINQIVNLVCNLRDYVMKFECPEVKSGVSIPPYFRCPLSLELMSDPV  237

Query  2118  IVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDP  1939
             IVASGQTYER  I++W+D GLTVCP T   L HTNLIPNYTVKA+IANWCE NN+KLP  
Sbjct  238   IVASGQTYERQSIQKWLDHGLTVCPNTHHRLVHTNLIPNYTVKAMIANWCEENNVKLPCN  297

Query  1938  IKSLN---VNQPSSHVAHVD  1888
              K  N   ++ PS H+ H D
Sbjct  298   SKQSNSTRISSPSDHLLHQD  317



>ref|XP_009367841.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri]
Length=315

 Score =   364 bits (934),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 197/284 (69%), Positives = 234/284 (82%), Gaps = 4/284 (1%)
 Frame = -2

Query  1287  VSSPTVETRADLAEVKE-QVRKLVEDLKSTS-VDQQRIATAELRLLAKHNMDNRIVISNC  1114
             V SP  ET  D + + E +VR LV+DL  TS V+ QR AT ELRLLA+H M+NR+VI+NC
Sbjct  11    VPSPAGETIVDNSGLIEARVRDLVDDLNGTSSVESQRAATFELRLLARHGMENRVVIANC  70

Query  1113  GAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIAN-AGAIEPLIYVLETGSPEAK  937
             GAI  LV+LL S D  VQENAVTALLNLSI   NK+AIAN A AIE L++VLETGS EAK
Sbjct  71    GAIGFLVDLLQSADNGVQENAVTALLNLSIYGPNKTAIANTANAIEHLVHVLETGSAEAK  130

Query  936   ENSAATLFSLSVIED-NKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKG  760
             ENSAATL+SLSV E+ N ++IGRSGA++ LVDLL NGT RGK DAA+  F+LS   ENK 
Sbjct  131   ENSAATLYSLSVHEEGNSVRIGRSGAIRLLVDLLRNGTLRGKNDAASTFFSLSNFRENKP  190

Query  759   RIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSA  580
             RIV+AGAV++LVELM+PAAGMVDKAVA+L+NL+TI EGR +I QEGGIP LVEV+ELGSA
Sbjct  191   RIVEAGAVKYLVELMNPAAGMVDKAVAILANLSTIPEGRTAISQEGGIPGLVEVLELGSA  250

Query  579   RGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRA  448
             RGKENA AALLQLCT+S+R+CN +L+ GA+PPLVAL+QSGTPRA
Sbjct  251   RGKENAVAALLQLCTDSNRHCNTLLRQGALPPLVALNQSGTPRA  294


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 80/162 (49%), Gaps = 11/162 (7%)
 Frame = -2

Query  861  VQSLVDLLGNGTPRGKKDAATALFNLSIL----HENKGRIVQAGAVRHLVELMDPAA-GM  697
            V+ LVD L NGT   +   A A F L +L     EN+  I   GA+  LV+L+  A  G+
Sbjct  30   VRDLVDDL-NGTSSVESQRA-ATFELRLLARHGMENRVVIANCGAIGFLVDLLQSADNGV  87

Query  696  VDKAVAVLSNLATIQEGRMSIGQEG-GIPILVEVVELGSARGKENAAAALLQLCTNSSRY  520
             + AV  L NL+     + +I      I  LV V+E GSA  KEN+AA L  L  +    
Sbjct  88   QENAVTALLNLSIYGPNKTAIANTANAIEHLVHVLETGSAEAKENSAATLYSLSVHEEGN  147

Query  519  CNMVLQHGAVPPLVALSQSGTPRAREKAQAL---LSYFRNQR  403
               + + GA+  LV L ++GT R +  A +    LS FR  +
Sbjct  148  SVRIGRSGAIRLLVDLLRNGTLRGKNDAASTFFSLSNFRENK  189



>ref|XP_009614286.1| PREDICTED: U-box domain-containing protein 3 isoform X2 [Nicotiana 
tomentosiformis]
Length=779

 Score =   380 bits (975),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 242/305 (79%), Gaps = 1/305 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             +R +S PT     DL      V KL+ DL S S + Q  A AELR LAKHNM+NR +I  
Sbjct  474   ARQLSLPTKSMSDDLT-TSSHVEKLIRDLDSHSTEVQTTAAAELRFLAKHNMENRAIIGR  532

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI+ L++LLHS     QE+AVTALLNLSIN++ K+ IA  GA+EPLI+VL TG+  AK
Sbjct  533   CGAIAPLISLLHSVVKLTQEHAVTALLNLSINEDIKAIIAEQGALEPLIHVLRTGNAGAK  592

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             EN+AA LFSLS++E+ + KIGRSGAV++LVDLLG+GT RGKKDAATALFNLSI HENK R
Sbjct  593   ENAAAALFSLSLLEEYRKKIGRSGAVKALVDLLGSGTIRGKKDAATALFNLSIFHENKAR  652

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV+HL+ L+DP+  +VDKAVA+L+NL+TI EG ++I +EGGIP LVE+VE GS R
Sbjct  653   IVQAGAVKHLIRLLDPSNELVDKAVALLANLSTIAEGCLAIAREGGIPSLVEIVETGSQR  712

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAAA LLQLC NS +YC +VLQ GAVPPLVALSQSG+PRA+EKAQ LLS+FR+QR G
Sbjct  713   GKENAAAILLQLCLNSPKYCRLVLQEGAVPPLVALSQSGSPRAKEKAQQLLSHFRSQREG  772

Query  396   NAGRG  382
               GRG
Sbjct  773   ATGRG  777


 Score =   211 bits (537),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 121/312 (39%), Positives = 191/312 (61%), Gaps = 3/312 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  ++ L+N+IS F HL +     +    K Y+    +LKLL+P+L  I   +  SDE
Sbjct  1     MELTSVRCLINSISRFIHLVTCLTSKTMPGQKSYKNIATLLKLLKPVLDDIAQQKAPSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              + +    L  +++E REL + W    SK+ +VL++E  + K+++ +LKI  +L      
Sbjct  61    TISRQCEELDIAINEARELLEEWSPKKSKILWVLRSEPQLLKIQSIALKISHILSKLVES  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P   SL+ +++ + ++++ +   +S  I  A++    G    S+SLT+I   L+L S++
Sbjct  121   SPPTLSLSEIQHFIQELQNCEVGKISKHINMALEG---GKVLRSESLTEIIHSLNLASHE  177

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +ALEK +  A+  +   +++ I   I L +H+ DC++ +   ++   V+IP  F
Sbjct  178   ELLNECIALEKERMKAKDNKTRGDLDKITVSIDLFSHIRDCMLELDTFKAIDGVKIPPYF  237

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM +PVI+ASGQTYE+  I++W+D GLT CPKT Q L H+NLIPNYTVKALI 
Sbjct  238   RCPLSLELMVNPVIIASGQTYEQTSIQKWLDHGLTTCPKTLQALAHSNLIPNYTVKALIE  297

Query  1977  NWCEMNNIKLPD  1942
             NWCE N ++L D
Sbjct  298   NWCEENKVRLDD  309



>ref|XP_009614285.1| PREDICTED: U-box domain-containing protein 3 isoform X1 [Nicotiana 
tomentosiformis]
Length=785

 Score =   380 bits (975),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 242/305 (79%), Gaps = 1/305 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             +R +S PT     DL      V KL+ DL S S + Q  A AELR LAKHNM+NR +I  
Sbjct  480   ARQLSLPTKSMSDDLT-TSSHVEKLIRDLDSHSTEVQTTAAAELRFLAKHNMENRAIIGR  538

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI+ L++LLHS     QE+AVTALLNLSIN++ K+ IA  GA+EPLI+VL TG+  AK
Sbjct  539   CGAIAPLISLLHSVVKLTQEHAVTALLNLSINEDIKAIIAEQGALEPLIHVLRTGNAGAK  598

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             EN+AA LFSLS++E+ + KIGRSGAV++LVDLLG+GT RGKKDAATALFNLSI HENK R
Sbjct  599   ENAAAALFSLSLLEEYRKKIGRSGAVKALVDLLGSGTIRGKKDAATALFNLSIFHENKAR  658

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV+HL+ L+DP+  +VDKAVA+L+NL+TI EG ++I +EGGIP LVE+VE GS R
Sbjct  659   IVQAGAVKHLIRLLDPSNELVDKAVALLANLSTIAEGCLAIAREGGIPSLVEIVETGSQR  718

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAAA LLQLC NS +YC +VLQ GAVPPLVALSQSG+PRA+EKAQ LLS+FR+QR G
Sbjct  719   GKENAAAILLQLCLNSPKYCRLVLQEGAVPPLVALSQSGSPRAKEKAQQLLSHFRSQREG  778

Query  396   NAGRG  382
               GRG
Sbjct  779   ATGRG  783


 Score =   211 bits (536),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 121/312 (39%), Positives = 191/312 (61%), Gaps = 3/312 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  ++ L+N+IS F HL +     +    K Y+    +LKLL+P+L  I   +  SDE
Sbjct  7     MELTSVRCLINSISRFIHLVTCLTSKTMPGQKSYKNIATLLKLLKPVLDDIAQQKAPSDE  66

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              + +    L  +++E REL + W    SK+ +VL++E  + K+++ +LKI  +L      
Sbjct  67    TISRQCEELDIAINEARELLEEWSPKKSKILWVLRSEPQLLKIQSIALKISHILSKLVES  126

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P   SL+ +++ + ++++ +   +S  I  A++    G    S+SLT+I   L+L S++
Sbjct  127   SPPTLSLSEIQHFIQELQNCEVGKISKHINMALEG---GKVLRSESLTEIIHSLNLASHE  183

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +ALEK +  A+  +   +++ I   I L +H+ DC++ +   ++   V+IP  F
Sbjct  184   ELLNECIALEKERMKAKDNKTRGDLDKITVSIDLFSHIRDCMLELDTFKAIDGVKIPPYF  243

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM +PVI+ASGQTYE+  I++W+D GLT CPKT Q L H+NLIPNYTVKALI 
Sbjct  244   RCPLSLELMVNPVIIASGQTYEQTSIQKWLDHGLTTCPKTLQALAHSNLIPNYTVKALIE  303

Query  1977  NWCEMNNIKLPD  1942
             NWCE N ++L D
Sbjct  304   NWCEENKVRLDD  315



>ref|XP_010262331.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Nelumbo nucifera]
Length=790

 Score =   379 bits (974),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 194/286 (68%), Positives = 236/286 (83%), Gaps = 0/286 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             +R +S P +++  D       V KLVEDLKS S + Q  A  ELRLL KHNM+NRI+I+ 
Sbjct  483   NRSLSLPLLDSGLDNMASSSYVEKLVEDLKSQSNEVQTAAATELRLLGKHNMENRIIIAQ  542

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI  LV+LL+S++   QE+AVTALLNLSIND+NK+ IA AGAIEPLI+VL+TG+  AK
Sbjct  543   CGAIPPLVSLLYSDEKMTQEHAVTALLNLSINDDNKAMIAEAGAIEPLIHVLKTGNAGAK  602

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAATLFSLSV+E  K+KIGRSGAV++LVDLL +GT RGKKDAATALFNLSI HENK R
Sbjct  603   ENSAATLFSLSVLEQYKVKIGRSGAVKALVDLLRSGTLRGKKDAATALFNLSISHENKAR  662

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IV+AGAV++LVE++DPA GM++KAVA+L+NL+TI EG  +IG+EGGIP LVE++E GS R
Sbjct  663   IVRAGAVKYLVEMLDPATGMLEKAVALLANLSTIPEGCSAIGREGGIPPLVEILETGSQR  722

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREK  439
             GKENAA+ LLQLC NS R+C +VLQ GAVPPLVALSQSGT RA+EK
Sbjct  723   GKENAASILLQLCINSRRFCTLVLQEGAVPPLVALSQSGTTRAKEK  768


 Score =   237 bits (605),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 140/356 (39%), Positives = 212/356 (60%), Gaps = 15/356 (4%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+   ++ L+N+ S F HL++ + + S  + K Y+    +LKLL+P+L  +VD ++  +E
Sbjct  1     MDTRSIRCLVNSFSRFIHLAACQTVKSVPIQKDYRYMVGLLKLLKPVLDEVVDHKVPMNE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    +  +V+E RE  + W    SK+  VLQ+E L  K++  S++I  +L  +   
Sbjct  61    HLLKECEEMDVAVNEAREFMEKWSSKMSKICSVLQSEPLATKIQRSSMEICHILCRTLQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
                 S L  ++ C+ +I+    E +S  I +A+ +        +++L KI + L L SN 
Sbjct  121   SQYASLLAHVQKCIQEIQCFGQEKISELIEEAMIDQRNNVIPRTENLIKIVEILGLTSNH  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +ALEK +   +   K EE+++I+QI+ LV ++ +C++ ++   +   V IP+ F
Sbjct  181   ELLAESIALEKERMKDQFKTKKEELDHIDQIVYLVANIRNCMVKLEPFVAINGVPIPSYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTYER FI++W+D GLT+CP+TRQTLTHTNLIPNYTVKALI 
Sbjct  241   RCPLSLELMLDPVIVASGQTYERAFIQKWLDHGLTLCPQTRQTLTHTNLIPNYTVKALIR  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNSTSPDSAHG  1810
             NWC+ NNI+L +   S N+           SG    + +F H+        DS HG
Sbjct  301   NWCDQNNIRLCNTSASNNI-----------SG----LSLFGHTCPQYFIHTDSFHG  341



>gb|KEH23933.1| armadillo/beta-catenin repeat protein [Medicago truncatula]
Length=767

 Score =   378 bits (970),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 193/301 (64%), Positives = 237/301 (79%), Gaps = 0/301 (0%)
 Frame = -2

Query  1284  SSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAI  1105
             +SP   +  D       V KL+EDL+S S + +  A  ELRLL KHNM+NRI++  CG I
Sbjct  465   ASPVFNSEHDKLTTASHVSKLIEDLQSQSNETKSAAAEELRLLTKHNMENRIIVGQCGTI  524

Query  1104  SLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSA  925
             + L+ LL S     QE+AVTA+LNLSIN++NK+ I  AGAIEPLI+VL++G+  AKENSA
Sbjct  525   THLLPLLSSNTKITQEHAVTAILNLSINEDNKTLIMEAGAIEPLIHVLKSGNNGAKENSA  584

Query  924   ATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQA  745
             ATLFSLSV E+NK  IGRSGAV++LV+LL +GT RGKKDAATALFNLSI HENK RIVQA
Sbjct  585   ATLFSLSVPENNKANIGRSGAVKALVELLASGTLRGKKDAATALFNLSIFHENKARIVQA  644

Query  744   GAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKEN  565
             GAV+ LV L+DPA GMVDKAVA+L+NL+TI EGR+ I +E GIP LVE+VE GS RGKEN
Sbjct  645   GAVKFLVMLLDPADGMVDKAVALLANLSTIPEGRVEIVRERGIPFLVELVESGSQRGKEN  704

Query  564   AAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
             AA+ LLQL  +S ++C ++LQ GAVPP+VALSQ GTPRA+EKAQ LLS+FR+QR G +GR
Sbjct  705   AASILLQLSLHSRKFCTLILQEGAVPPVVALSQFGTPRAKEKAQQLLSHFRSQREGASGR  764

Query  384   G  382
             G
Sbjct  765   G  765


 Score =   212 bits (539),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 128/313 (41%), Positives = 190/313 (61%), Gaps = 0/313 (0%)
 Frame = -2

Query  2883  GGMEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS  2704
             G M++   K +LN+IS   HL S + +    + K        L+ L+P+L  +VD +I  
Sbjct  4     GQMDLTSAKCVLNSISRLIHLVSCQAVKPVPLQKNCNNMVAALRCLKPVLDDVVDYKIPL  63

Query  2703  DELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSD  2524
             DE   +    L   V+E RE  + W   +S+++ VLQ+  L+ K+++ S++I  ++  S 
Sbjct  64    DENPYRECDELDIQVNEAREFVEKWSPKTSRIHSVLQSGELLIKLQSTSVRICHMIYRSS  123

Query  2523  WCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
                 + S L +L++ + +++S++ E  +  I +A++N  + S    +SL +I + L L S
Sbjct  124   KSTSSASVLDNLQHHIQELQSLEKESATLYIEEALRNQKDNSKPCYESLGEIIELLKLTS  183

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQELL E +A+EK + NAE  +   E++ I QI+ L+  + D L+  K  E  + V +  
Sbjct  184   NQELLKESIAVEKERLNAEVNKTKGELDKINQIVNLLCSLRDYLMKAKCPEVKSGVSVSP  243

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
              F CPLSLELM DPVIVASGQTYER  I+ W+D GL VCPKT Q LTH NLIPNYTVKA+
Sbjct  244   YFRCPLSLELMLDPVIVASGQTYERQSIQMWLDHGLNVCPKTHQRLTHANLIPNYTVKAM  303

Query  1983  IANWCEMNNIKLP  1945
             IANWCE NN+ LP
Sbjct  304   IANWCEENNVDLP  316



>ref|XP_011080054.1| PREDICTED: U-box domain-containing protein 3 isoform X2 [Sesamum 
indicum]
Length=770

 Score =   377 bits (968),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 236/298 (79%), Gaps = 0/298 (0%)
 Frame = -2

Query  1275  TVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLL  1096
             T E+R +       V KL+ DLKS S + Q  A  ELR LAK+NMDNR++I   GAI+ L
Sbjct  471   TSESRYNELTSTSYVEKLINDLKSVSTEVQTAAAGELRFLAKYNMDNRLIIGQSGAIAPL  530

Query  1095  VNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATL  916
             ++LLHS+    QE+AVTALLNLSIN++ K+ IA  GA+EPLI+ L TG+  AKEN+AA L
Sbjct  531   ISLLHSDVELTQEHAVTALLNLSINESIKARIAEEGALEPLIHALRTGNTGAKENAAAAL  590

Query  915   FSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAV  736
             FS+S++++ +IKIGRSGAV++LVDLLG+GT RGKKDAATALFNLSI HENK RIVQAGAV
Sbjct  591   FSISLLDEYRIKIGRSGAVKALVDLLGSGTFRGKKDAATALFNLSIFHENKVRIVQAGAV  650

Query  735   RHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAA  556
             ++LV  +DPA  MVDKAVA+L+NL+T+ EG  +I +EGGIP+LVE++E GS RGKENAA+
Sbjct  651   KYLVRFLDPATEMVDKAVALLANLSTVVEGCSAIAREGGIPLLVEILETGSPRGKENAAS  710

Query  555   ALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              LLQLC NS +YC  +LQ GAVPPLVALSQSGTPRA+EKAQ LLS+FR+QR     RG
Sbjct  711   ILLQLCINSPKYCRSILQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRSQRENATSRG  768


 Score =   216 bits (550),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 188/310 (61%), Gaps = 0/310 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M++  L+ L+N+IS F HL +     +    + Y+    +LK L+PIL  + D E    E
Sbjct  1     MDLTSLRCLINSISRFAHLVTCRISKTMPAEEDYRNLVSLLKHLKPILDDVADHEAPQGE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    L  +V+E RE  + W    SK+ FVLQ++  + K++  S+K+  +L      
Sbjct  61    ALSKECEELDIAVNEAREFLEKWSSRKSKLLFVLQSKPYVLKIQISSIKLSLVLHVLSES  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP  S+L++ + CV + +++    LS  I + ++   EG    ++ L +I +  +L S+Q
Sbjct  121   LPTNSTLSNAQFCVQESQNLKLGQLSEHIEEILRRQKEGKTPDAEHLMEIIESFNLGSSQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +ALE  K+ A+ ++   +++ I Q + L++H+ DC++ +   +S   +QIP+ F
Sbjct  181   ELLSESIALENEKQKAQDSKGKGDLDQISQTVDLISHIRDCVVELGNFKSLNGIQIPSYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTYER  I++W+D GL  CPKT   L+H NLIPN+TVKALIA
Sbjct  241   RCPLSLELMLDPVIVASGQTYERAAIQKWLDHGLVTCPKTGCRLSHKNLIPNFTVKALIA  300

Query  1977  NWCEMNNIKL  1948
             NWC  N ++L
Sbjct  301   NWCSENRVEL  310



>ref|XP_006604490.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Glycine max]
Length=798

 Score =   377 bits (969),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 194/307 (63%), Positives = 238/307 (78%), Gaps = 2/307 (1%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             S++ S P     +D       V +L+EDL+S S + +  A  +LR   KHNM+NRI++  
Sbjct  490   SKVASHPVSNLGSDELITTSHVHELIEDLQSQSNETRTAAAEQLRFCTKHNMENRIIVGQ  549

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI  L++LL+S+    QE+AVTALLNLSIN+ NK+ I  AGAIEPLI++LE G+  AK
Sbjct  550   CGAIMPLLSLLYSDMKITQEHAVTALLNLSINEGNKALIMEAGAIEPLIHLLEKGNDGAK  609

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAA LFSLSVI++NK KIGRSGAV++LV LL +GT RGKKDAATALFNLSI HENK R
Sbjct  610   ENSAAALFSLSVIDNNKAKIGRSGAVKALVGLLASGTLRGKKDAATALFNLSIFHENKAR  669

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV+ LV L+DP   MVDKAVA+L+NL+TI EGR+ I +EGGIP LVE+VE GS R
Sbjct  670   IVQAGAVKFLVLLLDPTDKMVDKAVALLANLSTIAEGRIEIAREGGIPSLVEIVESGSQR  729

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREK--AQALLSYFRNQR  403
             GKENAA+ LLQ+C +S ++C +VLQ GAVPPLVALSQSGTPRA+EK  AQ LLS+FRNQR
Sbjct  730   GKENAASILLQMCLHSQKFCTLVLQEGAVPPLVALSQSGTPRAKEKMQAQQLLSHFRNQR  789

Query  402   HGNAGRG  382
              G  G+G
Sbjct  790   EGATGKG  796


 Score =   219 bits (559),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 138/331 (42%), Positives = 195/331 (59%), Gaps = 9/331 (3%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L+N+IS F HL   + +    + K       +LK L+P+L  IVD +I  DE L + 
Sbjct  12    VKCLVNSISRFMHLVCCQAVKPMPLQKNCNNMVGVLKRLKPVLDDIVDFKIPLDENLHRE  71

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L   V+E RE  +      S+++ VLQ+  L+ K++  S KI  ++V S   L A +
Sbjct  72    CEELDMQVNEAREFIEKLGPKMSRIHSVLQSGELLIKLQNSSYKICHMIVKS---LKAPA  128

Query  2502  S---LTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQEL  2332
             S   L +L+  + +++ +  E     I +A++N  +      DSL +I   L L SNQEL
Sbjct  129   SVLVLGNLQQYMQELQCLKKEPAMVYIEEALRNQRDNIEPCYDSLKEIIGLLKLTSNQEL  188

Query  2331  LIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCC  2152
             L E +A+EK + NAE  +    ++ I QI+ LV ++ D ++  +  E  + V IP  F C
Sbjct  189   LKESIAVEKERSNAEVNKTKGNLDEINQIVNLVCNLRDYVMKFECPEVKSGVSIPPYFRC  248

Query  2151  PLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANW  1972
             PLSLELM+DPVIVASGQTYER  I++W+D GLTVCP T   L HTNLIPNYTVKA+IANW
Sbjct  249   PLSLELMSDPVIVASGQTYERQSIQKWLDHGLTVCPNTHHRLVHTNLIPNYTVKAMIANW  308

Query  1971  CEMNNIKLPDPIKSLN---VNQPSSHVAHVD  1888
             CE NN+KLP   K  N   ++ PS H+ H D
Sbjct  309   CEENNVKLPCNSKQSNSTRISSPSDHLLHQD  339



>ref|XP_006604491.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Glycine max]
Length=797

 Score =   377 bits (969),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 194/307 (63%), Positives = 238/307 (78%), Gaps = 2/307 (1%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             S++ S P     +D       V +L+EDL+S S + +  A  +LR   KHNM+NRI++  
Sbjct  489   SKVASHPVSNLGSDELITTSHVHELIEDLQSQSNETRTAAAEQLRFCTKHNMENRIIVGQ  548

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI  L++LL+S+    QE+AVTALLNLSIN+ NK+ I  AGAIEPLI++LE G+  AK
Sbjct  549   CGAIMPLLSLLYSDMKITQEHAVTALLNLSINEGNKALIMEAGAIEPLIHLLEKGNDGAK  608

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             ENSAA LFSLSVI++NK KIGRSGAV++LV LL +GT RGKKDAATALFNLSI HENK R
Sbjct  609   ENSAAALFSLSVIDNNKAKIGRSGAVKALVGLLASGTLRGKKDAATALFNLSIFHENKAR  668

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             IVQAGAV+ LV L+DP   MVDKAVA+L+NL+TI EGR+ I +EGGIP LVE+VE GS R
Sbjct  669   IVQAGAVKFLVLLLDPTDKMVDKAVALLANLSTIAEGRIEIAREGGIPSLVEIVESGSQR  728

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREK--AQALLSYFRNQR  403
             GKENAA+ LLQ+C +S ++C +VLQ GAVPPLVALSQSGTPRA+EK  AQ LLS+FRNQR
Sbjct  729   GKENAASILLQMCLHSQKFCTLVLQEGAVPPLVALSQSGTPRAKEKMQAQQLLSHFRNQR  788

Query  402   HGNAGRG  382
              G  G+G
Sbjct  789   EGATGKG  795


 Score =   219 bits (559),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 138/331 (42%), Positives = 195/331 (59%), Gaps = 9/331 (3%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L+N+IS F HL   + +    + K       +LK L+P+L  IVD +I  DE L + 
Sbjct  11    VKCLVNSISRFMHLVCCQAVKPMPLQKNCNNMVGVLKRLKPVLDDIVDFKIPLDENLHRE  70

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L   V+E RE  +      S+++ VLQ+  L+ K++  S KI  ++V S   L A +
Sbjct  71    CEELDMQVNEAREFIEKLGPKMSRIHSVLQSGELLIKLQNSSYKICHMIVKS---LKAPA  127

Query  2502  S---LTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQEL  2332
             S   L +L+  + +++ +  E     I +A++N  +      DSL +I   L L SNQEL
Sbjct  128   SVLVLGNLQQYMQELQCLKKEPAMVYIEEALRNQRDNIEPCYDSLKEIIGLLKLTSNQEL  187

Query  2331  LIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCC  2152
             L E +A+EK + NAE  +    ++ I QI+ LV ++ D ++  +  E  + V IP  F C
Sbjct  188   LKESIAVEKERSNAEVNKTKGNLDEINQIVNLVCNLRDYVMKFECPEVKSGVSIPPYFRC  247

Query  2151  PLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANW  1972
             PLSLELM+DPVIVASGQTYER  I++W+D GLTVCP T   L HTNLIPNYTVKA+IANW
Sbjct  248   PLSLELMSDPVIVASGQTYERQSIQKWLDHGLTVCPNTHHRLVHTNLIPNYTVKAMIANW  307

Query  1971  CEMNNIKLPDPIKSLN---VNQPSSHVAHVD  1888
             CE NN+KLP   K  N   ++ PS H+ H D
Sbjct  308   CEENNVKLPCNSKQSNSTRISSPSDHLLHQD  338



>ref|XP_010484515.1| PREDICTED: U-box domain-containing protein 2-like [Camelina sativa]
Length=717

 Score =   375 bits (963),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 290/417 (70%), Gaps = 43/417 (10%)
 Frame = -2

Query  1641  ANSGDRSMNSVSHFSMPLSMNSVSSAD-ENSHQGHNRTTSAPSTLSNSNFSRANAHDGNE  1465
             + SGD S  +V   S  L     SS D E  HQ  NR+ SAP  +S+  FS+        
Sbjct  334   SGSGDDSSGTVLDDS--LKSEKASSLDAEELHQIFNRSASAPGIVSDV-FSKPKRR----  386

Query  1464  VSSPTTASTEASMEVASESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSR--  1291
                                 +AA  + +   S  P            W+ P ER   +  
Sbjct  387   -------------------TYAADTSGALTRSNIP------------WKFPEERHWRQPG  415

Query  1290  IVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCG  1111
             I+S+   ET +  + +  +V+KL+EDL S+S+D QR ATA++R+L++++ DNRIV++ CG
Sbjct  416   IISATIRETGSS-SSIDPEVKKLIEDLTSSSLDTQREATAQIRILSRNSTDNRIVVARCG  474

Query  1110  AISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGS-PEAKE  934
             AI  LV+LLHS D  +Q +AVT LLNLSIN+NNKS IA++GAIEPLI+VL+TG   EAK 
Sbjct  475   AIPSLVSLLHSTDERIQTDAVTCLLNLSINNNNKSLIADSGAIEPLIHVLKTGYLEEAKS  534

Query  933   NSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRI  754
             NSAATLFSLSVIE+ K +IG++GA++ LVDLL NG+  GKKDAATALF LSI HENK ++
Sbjct  535   NSAATLFSLSVIEEYKTEIGKAGAIEPLVDLLANGSLSGKKDAATALFILSIHHENKTKV  594

Query  753   VQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARG  574
             ++AGAVR+LVELMDPA GMV+KAV VLSNLAT++EG+++IG+EGGIP+LVEVVELGSARG
Sbjct  595   IEAGAVRYLVELMDPAFGMVEKAVVVLSNLATVREGKIAIGEEGGIPVLVEVVELGSARG  654

Query  573   KENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQR  403
             KENA AALLQLCT+S ++CN V++ G +PPLVAL++SGT R +EKAQ LL YFR Q+
Sbjct  655   KENATAALLQLCTHSPKFCNNVIREGVIPPLVALTKSGTARGKEKAQNLLKYFRAQK  711


 Score =   295 bits (756),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 228/333 (68%), Gaps = 1/333 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENI-NSELVHKYYQKTEDILKLLQPILSGIVDAEIASD  2701
             M++  L+VLL+NISS+  LSS+E + +S   ++YY + EDI KLL P+L  ++D++ A  
Sbjct  5     MDVSWLRVLLDNISSYLSLSSMEGLLHSNPAYEYYTRGEDISKLLMPVLDNLIDSDAAPS  64

Query  2700  ELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             ELL   F  L   VDELR+ FQ+WQ LS+++++VL+ ESL +K+R  SL++ +LL   + 
Sbjct  65    ELLNNGFEELSQYVDELRDQFQSWQPLSTRIFYVLRIESLASKLRESSLEVFQLLKHCEQ  124

Query  2520  CLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSN  2341
              LPA+    S E C+  +K +  E +S TI +A+K+  +G G + + + KIA C+ L+SN
Sbjct  125   HLPADLLSPSFEECIELVKLVAREEISNTIDQALKDQKKGVGPTLEVMLKIAKCVGLRSN  184

Query  2340  QELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPAD  2161
             QE+LIE V L  +KE AE  + + E EY++ +I+L T MHD L  +K ++    V++P+D
Sbjct  185   QEILIEGVVLSNMKETAEITDNDTEAEYLDGLISLTTRMHDYLTDIKHAQLRCPVRVPSD  244

Query  2160  FCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALI  1981
             F C LSLELMTDPVIVASGQTYER +I++WID+GL VCPKT+Q L+HT L PN  V+A I
Sbjct  245   FRCSLSLELMTDPVIVASGQTYERVYIQKWIDMGLMVCPKTKQALSHTTLTPNVIVRAFI  304

Query  1980  ANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSG  1882
             A+WCE ++I  PDP++ +  +QP   +    SG
Sbjct  305   ASWCETHDIYPPDPLELIQSSQPFPLLVESGSG  337



>ref|XP_011080053.1| PREDICTED: U-box domain-containing protein 3 isoform X1 [Sesamum 
indicum]
Length=802

 Score =   377 bits (969),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 236/298 (79%), Gaps = 0/298 (0%)
 Frame = -2

Query  1275  TVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLL  1096
             T E+R +       V KL+ DLKS S + Q  A  ELR LAK+NMDNR++I   GAI+ L
Sbjct  503   TSESRYNELTSTSYVEKLINDLKSVSTEVQTAAAGELRFLAKYNMDNRLIIGQSGAIAPL  562

Query  1095  VNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATL  916
             ++LLHS+    QE+AVTALLNLSIN++ K+ IA  GA+EPLI+ L TG+  AKEN+AA L
Sbjct  563   ISLLHSDVELTQEHAVTALLNLSINESIKARIAEEGALEPLIHALRTGNTGAKENAAAAL  622

Query  915   FSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAV  736
             FS+S++++ +IKIGRSGAV++LVDLLG+GT RGKKDAATALFNLSI HENK RIVQAGAV
Sbjct  623   FSISLLDEYRIKIGRSGAVKALVDLLGSGTFRGKKDAATALFNLSIFHENKVRIVQAGAV  682

Query  735   RHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAA  556
             ++LV  +DPA  MVDKAVA+L+NL+T+ EG  +I +EGGIP+LVE++E GS RGKENAA+
Sbjct  683   KYLVRFLDPATEMVDKAVALLANLSTVVEGCSAIAREGGIPLLVEILETGSPRGKENAAS  742

Query  555   ALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              LLQLC NS +YC  +LQ GAVPPLVALSQSGTPRA+EKAQ LLS+FR+QR     RG
Sbjct  743   ILLQLCINSPKYCRSILQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRSQRENATSRG  800


 Score =   215 bits (548),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 188/310 (61%), Gaps = 0/310 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M++  L+ L+N+IS F HL +     +    + Y+    +LK L+PIL  + D E    E
Sbjct  33    MDLTSLRCLINSISRFAHLVTCRISKTMPAEEDYRNLVSLLKHLKPILDDVADHEAPQGE  92

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    L  +V+E RE  + W    SK+ FVLQ++  + K++  S+K+  +L      
Sbjct  93    ALSKECEELDIAVNEAREFLEKWSSRKSKLLFVLQSKPYVLKIQISSIKLSLVLHVLSES  152

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LP  S+L++ + CV + +++    LS  I + ++   EG    ++ L +I +  +L S+Q
Sbjct  153   LPTNSTLSNAQFCVQESQNLKLGQLSEHIEEILRRQKEGKTPDAEHLMEIIESFNLGSSQ  212

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +ALE  K+ A+ ++   +++ I Q + L++H+ DC++ +   +S   +QIP+ F
Sbjct  213   ELLSESIALENEKQKAQDSKGKGDLDQISQTVDLISHIRDCVVELGNFKSLNGIQIPSYF  272

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTYER  I++W+D GL  CPKT   L+H NLIPN+TVKALIA
Sbjct  273   RCPLSLELMLDPVIVASGQTYERAAIQKWLDHGLVTCPKTGCRLSHKNLIPNFTVKALIA  332

Query  1977  NWCEMNNIKL  1948
             NWC  N ++L
Sbjct  333   NWCSENRVEL  342



>ref|XP_010464200.1| PREDICTED: U-box domain-containing protein 2 isoform X2 [Camelina 
sativa]
Length=712

 Score =   374 bits (961),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 203/333 (61%), Positives = 266/333 (80%), Gaps = 6/333 (2%)
 Frame = -2

Query  1392  LAASRRESEFPSPVGTRLRPPAIWRRPSERLVSR--IVSSPTVETRADLAEVKEQVRKLV  1219
              + +RR +   S   TR   P  W+ P ER   +  I+S+   ET +  + +  +V+KL+
Sbjct  377   FSKTRRSNNAASGALTRSNIP--WKFPEERHWRQPGIISATIRETGSS-SSIDPEVKKLI  433

Query  1218  EDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTAL  1039
             +DL S+S++ QR ATA++R+L++++ DNRIVI+ CGAI  LV+LLHS D  +Q +AVT L
Sbjct  434   DDLTSSSLETQREATAQIRILSRNSTDNRIVIARCGAIPSLVSLLHSTDERIQTDAVTCL  493

Query  1038  LNLSINDNNKSAIANAGAIEPLIYVLETGS-PEAKENSAATLFSLSVIEDNKIKIGRSGA  862
             LNLSIN+NNKS IA++GAIEPLI+VL+TG   EAK NSAATLFSLSVIE+ K +IG++GA
Sbjct  494   LNLSINNNNKSLIADSGAIEPLIHVLKTGYLEEAKSNSAATLFSLSVIEEYKTEIGKAGA  553

Query  861   VQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAV  682
             ++ LVDLL NG+  GKKDAATALFNLSI HENK ++++AGAVR+LVELMDPA GMV+KAV
Sbjct  554   IEPLVDLLANGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELMDPAFGMVEKAV  613

Query  681   AVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQ  502
              VLSNLAT++EG+++IG+EGGIP+LVEVVELGSARGKENA AALLQLCT+S ++CN V++
Sbjct  614   VVLSNLATVREGKIAIGEEGGIPVLVEVVELGSARGKENATAALLQLCTHSPKFCNNVIR  673

Query  501   HGAVPPLVALSQSGTPRAREKAQALLSYFRNQR  403
              G +PPLVAL++SGT R +EKAQ LL YFR Q+
Sbjct  674   EGVIPPLVALTKSGTARGKEKAQNLLKYFRAQK  706


 Score =   294 bits (752),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 223/323 (69%), Gaps = 1/323 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENI-NSELVHKYYQKTEDILKLLQPILSGIVDAEIASD  2701
             M++  L+VLL+NISS+  LSS+E + +S   ++YY + EDI KLL P+L  ++D++ A  
Sbjct  1     MDVSWLRVLLDNISSYLSLSSMEGLLHSNPAYEYYTRGEDISKLLMPVLENLIDSDAAPS  60

Query  2700  ELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             ELL   F  L    DELR+ FQ+WQ LS+++++VL+ ESL +K+R  SL++ +LL   + 
Sbjct  61    ELLNNGFEELSQYCDELRDQFQSWQPLSTRIFYVLRIESLASKLRESSLEVFQLLKHCEQ  120

Query  2520  CLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSN  2341
              LPA+    S E C+  +K +  E +S TI +A+K+  +G G + + + KIA C+ L+SN
Sbjct  121   HLPADLLSPSFEECIELVKLVAREEISTTIDQALKDQKKGVGPTLEVMLKIAKCVGLRSN  180

Query  2340  QELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPAD  2161
             QE+LIE V L  +KE AE  + + E EY++ +I+L T MHD L  +K ++    V++P+D
Sbjct  181   QEILIEGVVLSNMKETAEITDNDTEAEYLDGLISLTTRMHDYLTDIKHAQLRCPVRVPSD  240

Query  2160  FCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALI  1981
             F C LSLELMTDPVIVASGQTYER +I++WID+GL VCPKT+Q L+HT L PN  V+A I
Sbjct  241   FRCSLSLELMTDPVIVASGQTYERVYIQKWIDMGLMVCPKTKQALSHTTLTPNVIVRAFI  300

Query  1980  ANWCEMNNIKLPDPIKSLNVNQP  1912
             A+WCE +NI  PDP+  +  +QP
Sbjct  301   ASWCETHNIYPPDPLVLIQSSQP  323



>ref|XP_010464193.1| PREDICTED: U-box domain-containing protein 2 isoform X1 [Camelina 
sativa]
Length=716

 Score =   374 bits (961),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 203/333 (61%), Positives = 266/333 (80%), Gaps = 6/333 (2%)
 Frame = -2

Query  1392  LAASRRESEFPSPVGTRLRPPAIWRRPSERLVSR--IVSSPTVETRADLAEVKEQVRKLV  1219
              + +RR +   S   TR   P  W+ P ER   +  I+S+   ET +  + +  +V+KL+
Sbjct  381   FSKTRRSNNAASGALTRSNIP--WKFPEERHWRQPGIISATIRETGSS-SSIDPEVKKLI  437

Query  1218  EDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTAL  1039
             +DL S+S++ QR ATA++R+L++++ DNRIVI+ CGAI  LV+LLHS D  +Q +AVT L
Sbjct  438   DDLTSSSLETQREATAQIRILSRNSTDNRIVIARCGAIPSLVSLLHSTDERIQTDAVTCL  497

Query  1038  LNLSINDNNKSAIANAGAIEPLIYVLETGS-PEAKENSAATLFSLSVIEDNKIKIGRSGA  862
             LNLSIN+NNKS IA++GAIEPLI+VL+TG   EAK NSAATLFSLSVIE+ K +IG++GA
Sbjct  498   LNLSINNNNKSLIADSGAIEPLIHVLKTGYLEEAKSNSAATLFSLSVIEEYKTEIGKAGA  557

Query  861   VQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAV  682
             ++ LVDLL NG+  GKKDAATALFNLSI HENK ++++AGAVR+LVELMDPA GMV+KAV
Sbjct  558   IEPLVDLLANGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELMDPAFGMVEKAV  617

Query  681   AVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQ  502
              VLSNLAT++EG+++IG+EGGIP+LVEVVELGSARGKENA AALLQLCT+S ++CN V++
Sbjct  618   VVLSNLATVREGKIAIGEEGGIPVLVEVVELGSARGKENATAALLQLCTHSPKFCNNVIR  677

Query  501   HGAVPPLVALSQSGTPRAREKAQALLSYFRNQR  403
              G +PPLVAL++SGT R +EKAQ LL YFR Q+
Sbjct  678   EGVIPPLVALTKSGTARGKEKAQNLLKYFRAQK  710


 Score =   293 bits (751),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 223/323 (69%), Gaps = 1/323 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENI-NSELVHKYYQKTEDILKLLQPILSGIVDAEIASD  2701
             M++  L+VLL+NISS+  LSS+E + +S   ++YY + EDI KLL P+L  ++D++ A  
Sbjct  5     MDVSWLRVLLDNISSYLSLSSMEGLLHSNPAYEYYTRGEDISKLLMPVLENLIDSDAAPS  64

Query  2700  ELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             ELL   F  L    DELR+ FQ+WQ LS+++++VL+ ESL +K+R  SL++ +LL   + 
Sbjct  65    ELLNNGFEELSQYCDELRDQFQSWQPLSTRIFYVLRIESLASKLRESSLEVFQLLKHCEQ  124

Query  2520  CLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSN  2341
              LPA+    S E C+  +K +  E +S TI +A+K+  +G G + + + KIA C+ L+SN
Sbjct  125   HLPADLLSPSFEECIELVKLVAREEISTTIDQALKDQKKGVGPTLEVMLKIAKCVGLRSN  184

Query  2340  QELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPAD  2161
             QE+LIE V L  +KE AE  + + E EY++ +I+L T MHD L  +K ++    V++P+D
Sbjct  185   QEILIEGVVLSNMKETAEITDNDTEAEYLDGLISLTTRMHDYLTDIKHAQLRCPVRVPSD  244

Query  2160  FCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALI  1981
             F C LSLELMTDPVIVASGQTYER +I++WID+GL VCPKT+Q L+HT L PN  V+A I
Sbjct  245   FRCSLSLELMTDPVIVASGQTYERVYIQKWIDMGLMVCPKTKQALSHTTLTPNVIVRAFI  304

Query  1980  ANWCEMNNIKLPDPIKSLNVNQP  1912
             A+WCE +NI  PDP+  +  +QP
Sbjct  305   ASWCETHNIYPPDPLVLIQSSQP  327



>ref|XP_010444664.1| PREDICTED: U-box domain-containing protein 2-like isoform X2 
[Camelina sativa]
Length=713

 Score =   374 bits (959),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 212/396 (54%), Positives = 278/396 (70%), Gaps = 36/396 (9%)
 Frame = -2

Query  1587  SMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVASES  1408
             S  + S  DE  HQ  +R+ SAP  +S+  FS+                           
Sbjct  347   SEKAASLDDEELHQIFSRSASAPGIVSDV-FSKTKRR-----------------------  382

Query  1407  RHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVR  1228
                 T AA R  +   S +  +      WR+P        + S T+      + +  +V+
Sbjct  383   ----TYAADRSGALTRSNIPWKFPEERHWRQPG-------IISATIRETGSSSCIDPEVK  431

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KL+EDL S+S+D QR ATA++R+L++++ DNRIVI+ CGAI  LV+LLHS D  +Q +AV
Sbjct  432   KLIEDLTSSSLDTQREATAQIRILSRNSTDNRIVIARCGAIPSLVSLLHSTDEGIQTDAV  491

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGS-PEAKENSAATLFSLSVIEDNKIKIGR  871
             T LLNLSIN+NNKS IA++GAIEPLI+VL+TG   EAK NSA TLFSLSVIE+ K +IG+
Sbjct  492   TCLLNLSINNNNKSLIADSGAIEPLIHVLKTGYLEEAKSNSATTLFSLSVIEEYKTEIGK  551

Query  870   SGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
             +GA++ LVDLL NG+  GKKDAATALFNLSI HENK ++++AGAVR+LVELMDPA GMV+
Sbjct  552   AGAIEPLVDLLANGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELMDPAFGMVE  611

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAV VLSNLAT++EG+++IG+EGGIP+LV+VVELGSARGKENA AALLQLCT+S ++CN 
Sbjct  612   KAVVVLSNLATVREGKIAIGEEGGIPVLVDVVELGSARGKENATAALLQLCTHSPKFCNT  671

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQR  403
             V++ G +PPLVAL++SGT R +EKAQ LL YFR Q+
Sbjct  672   VIREGVIPPLVALTKSGTARGKEKAQNLLKYFRAQK  707


 Score =   297 bits (760),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 228/333 (68%), Gaps = 1/333 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENI-NSELVHKYYQKTEDILKLLQPILSGIVDAEIASD  2701
             M++  L+VLL+NISS+  LSS+E + +S   ++YY + EDI KLL P+L  ++D++ A  
Sbjct  1     MDVSWLRVLLDNISSYLSLSSMEGLLHSNPAYEYYTRGEDISKLLMPVLDNLIDSDAAPS  60

Query  2700  ELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             ELL   F  L   VDELR+ FQ+WQ LS+++++VL+ ESL +K+R  SL++ +LL   + 
Sbjct  61    ELLNNGFEELSQYVDELRDQFQSWQPLSTRIFYVLRIESLASKLRESSLEVFQLLKHCEQ  120

Query  2520  CLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSN  2341
              LPA+    S E C+  +K +  E +S TI +A+K+  +G G + + + KIA C+ L+SN
Sbjct  121   HLPADLLSPSFEECIELVKLVAREEISYTIDQALKDQKKGVGPTLEVMLKIAKCVGLRSN  180

Query  2340  QELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPAD  2161
             QE+LIE V L  +KE AE  + + E EY++ +I+L T MHD L  +K ++    V++P+D
Sbjct  181   QEILIEGVVLSNIKETAEITDNDTEAEYLDGLISLTTRMHDYLTDIKHAQLRCPVRVPSD  240

Query  2160  FCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALI  1981
             F C LSLELMTDPVIVASGQTYER +I++WID+GL VCPKT+Q L+HT L PN  V+A I
Sbjct  241   FRCSLSLELMTDPVIVASGQTYERVYIQKWIDMGLMVCPKTKQALSHTTLTPNVIVRAFI  300

Query  1980  ANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSG  1882
             A+WCE +NI  PDP++ +  +QP   +    SG
Sbjct  301   ASWCETHNIYPPDPLELIQSSQPFPLLVESGSG  333



>ref|XP_010444662.1| PREDICTED: U-box domain-containing protein 2-like isoform X1 
[Camelina sativa]
 ref|XP_010444663.1| PREDICTED: U-box domain-containing protein 2-like isoform X1 
[Camelina sativa]
Length=717

 Score =   374 bits (959),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 212/396 (54%), Positives = 278/396 (70%), Gaps = 36/396 (9%)
 Frame = -2

Query  1587  SMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVASES  1408
             S  + S  DE  HQ  +R+ SAP  +S+  FS+                           
Sbjct  351   SEKAASLDDEELHQIFSRSASAPGIVSDV-FSKTKRR-----------------------  386

Query  1407  RHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVR  1228
                 T AA R  +   S +  +      WR+P        + S T+      + +  +V+
Sbjct  387   ----TYAADRSGALTRSNIPWKFPEERHWRQPG-------IISATIRETGSSSCIDPEVK  435

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KL+EDL S+S+D QR ATA++R+L++++ DNRIVI+ CGAI  LV+LLHS D  +Q +AV
Sbjct  436   KLIEDLTSSSLDTQREATAQIRILSRNSTDNRIVIARCGAIPSLVSLLHSTDEGIQTDAV  495

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGS-PEAKENSAATLFSLSVIEDNKIKIGR  871
             T LLNLSIN+NNKS IA++GAIEPLI+VL+TG   EAK NSA TLFSLSVIE+ K +IG+
Sbjct  496   TCLLNLSINNNNKSLIADSGAIEPLIHVLKTGYLEEAKSNSATTLFSLSVIEEYKTEIGK  555

Query  870   SGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
             +GA++ LVDLL NG+  GKKDAATALFNLSI HENK ++++AGAVR+LVELMDPA GMV+
Sbjct  556   AGAIEPLVDLLANGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELMDPAFGMVE  615

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAV VLSNLAT++EG+++IG+EGGIP+LV+VVELGSARGKENA AALLQLCT+S ++CN 
Sbjct  616   KAVVVLSNLATVREGKIAIGEEGGIPVLVDVVELGSARGKENATAALLQLCTHSPKFCNT  675

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQR  403
             V++ G +PPLVAL++SGT R +EKAQ LL YFR Q+
Sbjct  676   VIREGVIPPLVALTKSGTARGKEKAQNLLKYFRAQK  711


 Score =   296 bits (759),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 228/333 (68%), Gaps = 1/333 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENI-NSELVHKYYQKTEDILKLLQPILSGIVDAEIASD  2701
             M++  L+VLL+NISS+  LSS+E + +S   ++YY + EDI KLL P+L  ++D++ A  
Sbjct  5     MDVSWLRVLLDNISSYLSLSSMEGLLHSNPAYEYYTRGEDISKLLMPVLDNLIDSDAAPS  64

Query  2700  ELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             ELL   F  L   VDELR+ FQ+WQ LS+++++VL+ ESL +K+R  SL++ +LL   + 
Sbjct  65    ELLNNGFEELSQYVDELRDQFQSWQPLSTRIFYVLRIESLASKLRESSLEVFQLLKHCEQ  124

Query  2520  CLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSN  2341
              LPA+    S E C+  +K +  E +S TI +A+K+  +G G + + + KIA C+ L+SN
Sbjct  125   HLPADLLSPSFEECIELVKLVAREEISYTIDQALKDQKKGVGPTLEVMLKIAKCVGLRSN  184

Query  2340  QELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPAD  2161
             QE+LIE V L  +KE AE  + + E EY++ +I+L T MHD L  +K ++    V++P+D
Sbjct  185   QEILIEGVVLSNIKETAEITDNDTEAEYLDGLISLTTRMHDYLTDIKHAQLRCPVRVPSD  244

Query  2160  FCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALI  1981
             F C LSLELMTDPVIVASGQTYER +I++WID+GL VCPKT+Q L+HT L PN  V+A I
Sbjct  245   FRCSLSLELMTDPVIVASGQTYERVYIQKWIDMGLMVCPKTKQALSHTTLTPNVIVRAFI  304

Query  1980  ANWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSG  1882
             A+WCE +NI  PDP++ +  +QP   +    SG
Sbjct  305   ASWCETHNIYPPDPLELIQSSQPFPLLVESGSG  337



>dbj|BAB09019.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAP16467.1| hypothetical protein [Cloning vector pTACAtg1]
Length=698

 Score =   372 bits (955),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 209/393 (53%), Positives = 275/393 (70%), Gaps = 28/393 (7%)
 Frame = -2

Query  1596  MPLSMNSVSSADENSHQGHNRTTSAPSTLSNSNFSRANAHDGNEVSSPTTASTEASMEVA  1417
              PL + SV ++  +S  GH+ +  A        FSR+        S+P   S     EV 
Sbjct  323   FPLLVESVRAS--SSENGHSESLDAEEL--RQVFSRS-------ASAPGIVS-----EVV  366

Query  1416  SESRHAATLAASRRESEFPSPVGTRLRPPAIWRRPSERLVSRIVSSP-TVETRADLAEVK  1240
              +++     AA R  +   +P          W+ P ER        P TV      + ++
Sbjct  367   CKTKRNNNAAADRSLTRSNTP----------WKFPEERHWRHPGIIPATVRETGSSSSIE  416

Query  1239  EQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQ  1060
              +V+KL++DLKS+S+D QR ATA +R+LA+++ DNRIVI+ C AI  LV+LL+S D  +Q
Sbjct  417   TEVKKLIDDLKSSSLDTQREATARIRILARNSTDNRIVIARCEAIPSLVSLLYSTDERIQ  476

Query  1059  ENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGS-PEAKENSAATLFSLSVIEDNKI  883
              +AVT LLNLSINDNNKS IA +GAI PLI+VL+TG   EAK NSAATLFSLSVIE+ K 
Sbjct  477   ADAVTCLLNLSINDNNKSLIAESGAIVPLIHVLKTGYLEEAKANSAATLFSLSVIEEYKT  536

Query  882   KIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAA  703
             +IG +GA++ LVDLLG+G+  GKKDAATALFNLSI HENK ++++AGAVR+LVELMDPA 
Sbjct  537   EIGEAGAIEPLVDLLGSGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELMDPAF  596

Query  702   GMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSR  523
             GMV+KAV VL+NLAT++EG+++IG+EGGIP+LVEVVELGSARGKENA AALLQLCT+S +
Sbjct  597   GMVEKAVVVLANLATVREGKIAIGEEGGIPVLVEVVELGSARGKENATAALLQLCTHSPK  656

Query  522   YCNMVLQHGAVPPLVALSQSGTPRAREKAQALL  424
             +CN V++ G +PPLVAL++SGT R +EK   L 
Sbjct  657   FCNNVIREGVIPPLVALTKSGTARGKEKVLFLF  689


 Score =   293 bits (750),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 154/322 (48%), Positives = 231/322 (72%), Gaps = 0/322 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  L+VLL+NISS+  LSS+++++S   HKYY + EDI KL++P+L  ++D++ A  E
Sbjct  1     MEVSWLRVLLDNISSYLSLSSMDDLSSNPAHKYYTRGEDIGKLIKPVLENLIDSDAAPSE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL   F  L   VDELRE FQ+WQ LS+++++VL+ ESL +K+R  SL++ +LL   +  
Sbjct  61    LLNNGFEELAQYVDELREQFQSWQPLSTRIFYVLRIESLASKLRESSLEVFQLLKHCEQH  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+    S E C+  +K +  + +S TI +A+K+  +G G +S+ L KIA+   L+SNQ
Sbjct  121   LPADLISPSFEECIELVKLVARDEISYTIDQALKDQKKGVGPTSEVLVKIAESTGLRSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+L+E V L  +KE+AE  + + E EY++ +I+L T MH+ L  +KQ++    V++P+DF
Sbjct  181   EILVEGVVLTNMKEDAELTDNDTEAEYLDGLISLTTQMHEYLSDIKQAQLRCPVRVPSDF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              C LSLELMTDPVIVASGQT+ER FI++WID+GL VCPKTRQ L+HT L PN+ V+A +A
Sbjct  241   RCSLSLELMTDPVIVASGQTFERVFIQKWIDMGLMVCPKTRQALSHTTLTPNFIVRAFLA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQP  1912
             +WCE NN+  PDP++ ++ ++P
Sbjct  301   SWCETNNVYPPDPLELIHSSEP  322



>ref|XP_001778307.1| predicted protein [Physcomitrella patens]
 gb|EDQ56855.1| predicted protein [Physcomitrella patens]
Length=465

 Score =   364 bits (935),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 202/299 (68%), Positives = 235/299 (79%), Gaps = 4/299 (1%)
 Frame = -2

Query  1305  RLVSRIVSSPTV---ETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDN  1135
             R V R  S P +    T    + V+  + K V+DL+S  +D QR A  ELR+LAK+NM+N
Sbjct  162   RGVDRDASLPRIVHDNTSGTDSTVQSDLEKWVQDLQSPDIDTQRQAACELRMLAKYNMEN  221

Query  1134  RIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLET  955
             R+ I+N GAI  LV LL SED + QENAVTALLNLSINDNNK+ IA AGAI PL+ VL  
Sbjct  222   RVTIANSGAIEPLVALLSSEDGKTQENAVTALLNLSINDNNKAEIARAGAIGPLVNVLRV  281

Query  954   GSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSIL  775
             G+ EA EN+AATLFSLSV++DNK+ IG SGA+  LV LL NG+PRGKKDAATALFNLSI 
Sbjct  282   GNAEAMENAAATLFSLSVMDDNKVAIGSSGAIPPLVHLLINGSPRGKKDAATALFNLSIY  341

Query  774   HENKGRIVQAGAVRHLVELM-DPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEV  598
             HENKGRIV+AGA++ LVELM DPAAGMVDKAVAVL+NLATI EGR +IG+E GIP LVEV
Sbjct  342   HENKGRIVEAGAIKPLVELMADPAAGMVDKAVAVLANLATITEGRQAIGEEQGIPALVEV  401

Query  597   VELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLS  421
             VE GS RGKENAAAALLQLCTNS R+  +VLQ GA+PPLVALSQSG+PRA+EK    LS
Sbjct  402   VEAGSLRGKENAAAALLQLCTNSHRHRALVLQEGAIPPLVALSQSGSPRAKEKVGNFLS  460


 Score =   125 bits (315),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -2

Query  2199  QSESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTH  2020
             +  +   ++IPADF CPLS +LM+DPVIVASGQTYER +I+ W++ G   CPKT Q L+H
Sbjct  6     EGAAVEGLEIPADFRCPLSGDLMSDPVIVASGQTYERIYIQHWLNEGHARCPKTHQKLSH  65

Query  2019  TNLIPNYTVKALIANWCEMNNIKLPDPI  1936
              NLIPNYTVKALIANWCE   +  P P+
Sbjct  66    RNLIPNYTVKALIANWCETYGVPAPGPL  93


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 70/164 (43%), Gaps = 42/164 (26%)
 Frame = -2

Query  1140  DNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIY--  967
             DN++ I + GAI  LV+LL +     +++A TAL NLSI   NK  I  AGAI+PL+   
Sbjct  302   DNKVAIGSSGAIPPLVHLLINGSPRGKKDAATALFNLSIYHENKGRIVEAGAIKPLVELM  361

Query  966   ---------------------------------------VLETGSPEAKENSAATLFSLS  904
                                                    V+E GS   KEN+AA L  L 
Sbjct  362   ADPAAGMVDKAVAVLANLATITEGRQAIGEEQGIPALVEVVEAGSLRGKENAAAALLQLC  421

Query  903   V-IEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSIL  775
                  ++  + + GA+  LV L  +G+PR K+     L  +  L
Sbjct  422   TNSHRHRALVLQEGAIPPLVALSQSGSPRAKEKVGNFLSQVPCL  465



>ref|XP_010555859.1| PREDICTED: U-box domain-containing protein 3 [Tarenaya hassleriana]
Length=760

 Score =   374 bits (959),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 185/282 (66%), Positives = 232/282 (82%), Gaps = 0/282 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLKS S + +  A AE+R + K NM+NRIVI +CGAI  L++LL+SE    QE+AV
Sbjct  477   KLVEDLKSRSNEVKTAAAAEIRHVTKTNMENRIVIGHCGAIVYLLSLLYSEKWVTQEHAV  536

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRS  868
             TALLNLSIN+ NK+ IA AGA+EPL++VL TG+  AKENSAATLFSLSV++D + KIG+S
Sbjct  537   TALLNLSINETNKAMIAEAGALEPLVHVLNTGNDRAKENSAATLFSLSVLQDYRAKIGQS  596

Query  867   GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDK  688
              AV++LV+LLG GT RGKKD+A+ALFNLSI HENK RI+QAGAV++L+EL+D  + MVDK
Sbjct  597   NAVRALVNLLGTGTIRGKKDSASALFNLSIFHENKARIIQAGAVKYLIELLDLNSVMVDK  656

Query  687   AVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMV  508
             AVA+L+NL+T+ EGR  I +EGG+P+LVE V+ GS RGKENAA+ LLQLC NS ++C +V
Sbjct  657   AVALLANLSTVGEGRREIVKEGGVPLLVETVDSGSHRGKENAASVLLQLCLNSPKFCTLV  716

Query  507   LQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             LQ GA+PPLVALSQSGTPRA+EKAQ LLS+FRNQR     +G
Sbjct  717   LQEGAIPPLVALSQSGTPRAKEKAQQLLSHFRNQREAKMKKG  758


 Score =   196 bits (497),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 122/312 (39%), Positives = 189/312 (61%), Gaps = 2/312 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ + +  LLN++S + HL S   I    V         +LKLL+P+L  +VD ++ SDE
Sbjct  1     MDPMPVGCLLNSMSRYLHLVSCRIIKFIPVQTCIGNIVLVLKLLRPVLDEVVDCKLPSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L +    L  +V+E RE  + W    SK   V + E L ++++  SL+I  +L+     
Sbjct  61    CLNRECEELDVAVNEAREFLENWSPKMSKFCSVFRCEMLWSRIQTCSLEICHILLQLAQS  120

Query  2517  LPAESSLTSLENCVLKIKSM--DYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKS  2344
              P  SSL+ +E C+ +I+S+   Y LL+  + KA+K   +   +S + L  +   L L  
Sbjct  121   TPTTSSLSGVELCMQEIESLVKQYGLLTEHMEKALKIQEDDVISSDNHLENLVQALDLIP  180

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
               +LL E +A+EK + NAE ++  E+++   +++ LV+ + + ++  +  E  +SV +P 
Sbjct  181   IHDLLKESIAVEKERINAEASKLKEKLDQAVKLVDLVSCIREYMLRTEFLEVASSVPVPP  240

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
              F CPLS+ELM DPVIVASGQTY+R  I++W+D GLTVCP+TR+ LTH  LIPNYTVKA+
Sbjct  241   YFRCPLSMELMLDPVIVASGQTYDRTSIQKWLDSGLTVCPRTRKILTHNELIPNYTVKAM  300

Query  1983  IANWCEMNNIKL  1948
             IA+W E NNI+L
Sbjct  301   IASWLEANNIRL  312



>ref|XP_009407189.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=680

 Score =   371 bits (953),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 230/280 (82%), Gaps = 0/280 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V+KL + LKS S + Q  A +ELRLLAKHNM+NR++I   GAI  LV+LLHS   +VQE
Sbjct  394   HVQKLTDGLKSESPELQTAAASELRLLAKHNMENRVLIGKFGAIPPLVSLLHSMGKKVQE  453

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             NAVTALLNLSIND+NK  IA AGAI  L++VL++G+ EAKENSAA LF+LS +E+ K KI
Sbjct  454   NAVTALLNLSINDDNKILIAEAGAIGALMHVLDSGTTEAKENSAAALFTLSALEEYKAKI  513

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGA ++LV LLG+G  RG+KDAA ALFNLSI HENK RIVQAGAV++LVELMDP++GM
Sbjct  514   GRSGAAKALVHLLGSGNLRGRKDAAAALFNLSIFHENKVRIVQAGAVKYLVELMDPSSGM  573

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDK+VA+L+NL+TI EGRM+I QE GIP LVE+VE GSARG+ENAA+ L QLC NS + C
Sbjct  574   VDKSVALLANLSTIPEGRMAIVQERGIPPLVEIVETGSARGRENAASTLSQLCLNSQKIC  633

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             ++VLQ G VPPL+AL+Q GTPRA+EKAQ +LS+ R+QR G
Sbjct  634   SLVLQEGVVPPLIALAQFGTPRAKEKAQQILSHLRSQREG  673



>ref|XP_010326171.1| PREDICTED: U-box domain-containing protein 3 [Solanum lycopersicum]
 ref|XP_010326172.1| PREDICTED: U-box domain-containing protein 3 [Solanum lycopersicum]
Length=776

 Score =   372 bits (955),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 195/305 (64%), Positives = 240/305 (79%), Gaps = 1/305 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             +R +S PT     DL      V KL+ DL+S S + Q  A AE R LAKHNM+NR +I  
Sbjct  471   ARQLSLPTKSASDDLT-TSSHVEKLIRDLESQSTEVQMAAAAEFRFLAKHNMENRAIIGR  529

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI+ L++LL+S+    QE+AVTALLNLSIN++ K+ IA  GA+EPLI+VL TG+  AK
Sbjct  530   CGAIAPLISLLNSDVKPTQEHAVTALLNLSINEDIKAMIAEQGALEPLIHVLRTGNAGAK  589

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             EN+AA LFSLS++E+ + KIGRSGAV++LVDLLG GT RGKKDAATALFNLSI HENK R
Sbjct  590   ENAAAALFSLSLLEEYRKKIGRSGAVKALVDLLGLGTIRGKKDAATALFNLSIFHENKAR  649

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             I+Q GAV+HL+ L+DP+  MVDKAVA+L+NL+TI EG ++I +E GIP LVE+VE GS R
Sbjct  650   IIQVGAVKHLIRLLDPSNVMVDKAVALLANLSTISEGCLAIAREEGIPSLVEIVETGSQR  709

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAA+ LLQLC NS +YC +VLQ GAVPPLVALSQSG+PRA+EKAQ LLS+FR+QR G
Sbjct  710   GKENAASILLQLCLNSPKYCRLVLQEGAVPPLVALSQSGSPRAKEKAQQLLSHFRSQREG  769

Query  396   NAGRG  382
               GRG
Sbjct  770   ATGRG  774


 Score =   196 bits (497),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 123/329 (37%), Positives = 193/329 (59%), Gaps = 18/329 (5%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  ++ L+N+IS F HL +     S    K Y+    +LKLL+P+L  +   +  SDE
Sbjct  1     MELTSVRCLINSISRFIHLVTCLTSKSMPGQKNYKNIATLLKLLKPVLDDVAQQKAPSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKI----VELLVS  2530
              + +    L  +++E RE  + W L  SK+ +VLQ+E  + K+++ +LK+     ELL S
Sbjct  61    TICRQCEELDVAINEARESLEEWSLKKSKILWVLQSEPELLKIQSIALKLSHTLCELLES  120

Query  2529  SDWCLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSL  2350
             S    P     + ++  + +I+  +   +S  +  A +    G    S+SLT++   L+ 
Sbjct  121   S----PPSLGPSEIQPFIQEIQKFEVGQISKQMNMAPE---VGKILVSESLTEMIHSLNF  173

Query  2349  KSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQI  2170
              S++ELL E +ALEK + NA+  E   +++ I   I L + + DC++ +   ++   ++I
Sbjct  174   VSHEELLNECIALEKERMNAKDNETRGDLDKISLSIDLFSDIRDCMLELDHFKAIDGIKI  233

Query  2169  PADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVK  1990
             P  F CPLSLELM +PVI+ASGQTYE+  I++W+D GLT CP+T Q L H+NLIPNYTVK
Sbjct  234   PPYFRCPLSLELMVNPVIIASGQTYEKTSIQKWLDHGLTTCPRTNQALAHSNLIPNYTVK  293

Query  1989  ALIANWCEMNNIKLPDPIKSLNVNQPSSH  1903
             ALI NWCE+N ++       LN N  S+H
Sbjct  294   ALIENWCEVNKVR-------LNGNPESTH  315



>ref|XP_006280091.1| hypothetical protein CARUB_v10025974mg [Capsella rubella]
 gb|EOA12989.1| hypothetical protein CARUB_v10025974mg [Capsella rubella]
Length=713

 Score =   369 bits (948),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 212/377 (56%), Positives = 274/377 (73%), Gaps = 14/377 (4%)
 Frame = -2

Query  1500  NFSRANAHDGNEVSSPTTASTEAS---MEVASESRHAATLAASRRESEFPSPVGTRLRPP  1330
             N  RA++ D  E+    + S  A     EV S+ +   T A +       S   TR   P
Sbjct  345   NSERASSLDAEELRQVYSRSASAPGIVSEVFSKKKRRTTAADT-------SVALTRSNIP  397

Query  1329  AIWRRPSERLVSRIVSSP-TVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLA  1153
               W+ P ER        P T+      +    +V+KL+EDLK++S+D QR A A++R+L+
Sbjct  398   --WKFPEERHWHHPGIVPATIREAGSSSNDDTEVKKLIEDLKNSSLDTQREAAAQIRILS  455

Query  1152  KHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPL  973
             +++ DNRIVI+ CGAI  LV+LL+S D  +Q ++VT LLNLSIN+NNKS IA +GAIEPL
Sbjct  456   RNSTDNRIVIAGCGAIPSLVSLLYSTDERIQADSVTCLLNLSINNNNKSLIAESGAIEPL  515

Query  972   IYVLETGS-PEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATA  796
             I+VL+TG   EAK N+AATLFSLSVIE+ K  IG +GA++ LVDLLGNG+  GKKDAATA
Sbjct  516   IHVLKTGYLEEAKANAAATLFSLSVIEEYKTDIGNAGAIEPLVDLLGNGSLSGKKDAATA  575

Query  795   LFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGI  616
             LFNLSI HENK ++++AGAVR+LVELMDPA GMV+KAV VLSNLAT++EG+++IG+EGGI
Sbjct  576   LFNLSIHHENKTKVIEAGAVRYLVELMDPAFGMVEKAVVVLSNLATVREGKIAIGEEGGI  635

Query  615   PILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKA  436
             P+LVEVVELGSARGKENA AALLQLCT+S + CN V++ G +PPLVAL++SGT R +EKA
Sbjct  636   PVLVEVVELGSARGKENATAALLQLCTHSPKLCNAVIREGVIPPLVALTKSGTARGKEKA  695

Query  435   QALLSYFRNQRHGNAGR  385
             Q+LL YF+  R GN  R
Sbjct  696   QSLLKYFKAHRQGNQRR  712


 Score =   301 bits (770),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 157/332 (47%), Positives = 226/332 (68%), Gaps = 0/332 (0%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  L+VLL+N SS+  LSS+E+ +S   HKYY + EDI KLL P+L  +VD++ A  E
Sbjct  5     MEVSWLRVLLDNTSSYLSLSSMEDFHSNPAHKYYTRGEDISKLLMPVLENLVDSDAAPSE  64

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             LL   F  L   VDEL + F++WQ LS+++++VL+ ESL +K+R  SL++ +LL   +  
Sbjct  65    LLNNGFEELAQYVDELTDQFRSWQPLSTRIFYVLRIESLASKLRESSLEVFQLLKHCEQH  124

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             LPA+    S E C+  +K +  E  S TI + +K+  EG G + + L KIA  + L+SNQ
Sbjct  125   LPADLFSPSFEECIELVKLVAREETSYTIDQVLKDQKEGVGPTLEVLLKIAKSVGLRSNQ  184

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             E+LIE V L  +KE AE  + + +VEY++ +++L T MH+ L  +KQ++    V++P DF
Sbjct  185   EILIESVVLSNMKETAELTDDDSKVEYLDGLVSLTTRMHNYLTDIKQAQLRCPVRVPPDF  244

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              C LSLELMTDPVIVASGQTYER FI++WID+GL VCP TRQ L+HTNL PN+ V+A IA
Sbjct  245   RCSLSLELMTDPVIVASGQTYERVFIQKWIDMGLLVCPITRQALSHTNLTPNFIVRAFIA  304

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSHVAHVDSG  1882
             +WCE +N+  PDP++ +  +QP   +  + SG
Sbjct  305   SWCETHNVYPPDPLELIQSSQPFPLLVELGSG  336



>ref|XP_009407188.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=765

 Score =   370 bits (951),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 230/280 (82%), Gaps = 0/280 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V+KL + LKS S + Q  A +ELRLLAKHNM+NR++I   GAI  LV+LLHS   +VQE
Sbjct  479   HVQKLTDGLKSESPELQTAAASELRLLAKHNMENRVLIGKFGAIPPLVSLLHSMGKKVQE  538

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             NAVTALLNLSIND+NK  IA AGAI  L++VL++G+ EAKENSAA LF+LS +E+ K KI
Sbjct  539   NAVTALLNLSINDDNKILIAEAGAIGALMHVLDSGTTEAKENSAAALFTLSALEEYKAKI  598

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGA ++LV LLG+G  RG+KDAA ALFNLSI HENK RIVQAGAV++LVELMDP++GM
Sbjct  599   GRSGAAKALVHLLGSGNLRGRKDAAAALFNLSIFHENKVRIVQAGAVKYLVELMDPSSGM  658

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDK+VA+L+NL+TI EGRM+I QE GIP LVE+VE GSARG+ENAA+ L QLC NS + C
Sbjct  659   VDKSVALLANLSTIPEGRMAIVQERGIPPLVEIVETGSARGRENAASTLSQLCLNSQKIC  718

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             ++VLQ G VPPL+AL+Q GTPRA+EKAQ +LS+ R+QR G
Sbjct  719   SLVLQEGVVPPLIALAQFGTPRAKEKAQQILSHLRSQREG  758



>ref|XP_011013573.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Populus euphratica]
Length=768

 Score =   370 bits (951),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 187/266 (70%), Positives = 224/266 (84%), Gaps = 0/266 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
             QV+KLVE LKS S + +  A  ELRLLAKHN++NRI+I + GAI  L+++L SE    QE
Sbjct  498   QVKKLVEGLKSQSNEVKTKAAEELRLLAKHNVENRIIIGHSGAIRPLLSMLSSEVKLTQE  557

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN+ NK+ IA AGAIEP+I+VL +G+  A+ENSAA LFSLSV+E+ K KI
Sbjct  558   HAVTALLNLSINEENKAIIAEAGAIEPIIHVLRSGNDGARENSAAALFSLSVLEEYKAKI  617

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLLG+GT RGKKDAAT LFNLSI HENK RIVQAGAV++LVELMDP  GM
Sbjct  618   GRSGAVKALVDLLGSGTLRGKKDAATTLFNLSIFHENKARIVQAGAVKYLVELMDPVTGM  677

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGRM+I + GGIP+LVEVVE GS RGKENAA+ L+QLC NS ++C
Sbjct  678   VDKAVALLANLSTIGEGRMAIAKAGGIPLLVEVVESGSQRGKENAASILMQLCLNSPKFC  737

Query  516   NMVLQHGAVPPLVALSQSGTPRAREK  439
              +VLQ GAVPPLVALSQSGTPRA+EK
Sbjct  738   TLVLQEGAVPPLVALSQSGTPRAKEK  763


 Score =   226 bits (576),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 133/333 (40%), Positives = 203/333 (61%), Gaps = 2/333 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME   ++ L+N+IS F HL S +      + K Y+    +LK L+P+L  + D  I+SDE
Sbjct  1     MEKSSVRCLINSISRFMHLVSCQTKKYLPIQKDYEIMVIMLKHLKPVLDEVDDYNISSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +  +    L  +V+E RE  + W    S++  V Q+E+L+ K+++ +L+I + L      
Sbjct  61    IPCRECEELDAAVNEAREFMEKWCPQMSRICSVQQSEALLKKIQSSALEICQALCRLLHG  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P  SSLT +++C+ ++K + +E ++  I +A+++  +     +D L K+   LSL SNQ
Sbjct  121   SPTTSSLTIVQHCMQELKGLKHETITEIIEEALRSLKDDVVPCTDHLMKLIQTLSLTSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E VA+EK + N    +    +  I+QI+ L+T +   L+ ++  +  +   IP  F
Sbjct  181   ELLKESVAVEKERTNVHINKAEGYLYQIDQIVDLITQIRSWLLKVEHRDPKSGAPIPPYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTY+R  I++W+D GLT CP+TRQTL+HTN IPNYTVKA+IA
Sbjct  241   RCPLSLELMLDPVIVASGQTYDRVSIQKWLDHGLTFCPRTRQTLSHTNFIPNYTVKAMIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSH--VAHVDS  1885
             NWCE NN+++       N    SSH  + H+DS
Sbjct  301   NWCEENNVRVSGHSDCNNHVLASSHHDLLHLDS  333



>ref|XP_006351668.1| PREDICTED: U-box domain-containing protein 3-like [Solanum tuberosum]
Length=778

 Score =   371 bits (952),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 194/305 (64%), Positives = 239/305 (78%), Gaps = 1/305 (0%)
 Frame = -2

Query  1296  SRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISN  1117
             +R +S PT     DL      V KL+ DL+S S + Q  A AE R LAKHNM+NR +I  
Sbjct  473   ARQLSLPTKSASDDLT-TSSHVEKLIRDLESQSTEVQMAAAAEFRFLAKHNMENRAIIGR  531

Query  1116  CGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAK  937
             CGAI+ L++LL+S+    QE+AVTALLNLSIN++ K+ IA  GA+EPLIYVL TG+  AK
Sbjct  532   CGAIAPLISLLNSDVKPTQEHAVTALLNLSINEDIKAMIAEQGALEPLIYVLRTGNAGAK  591

Query  936   ENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGR  757
             EN+AA LFSLS++E+ + KIGRSGAV++LVDLLG GT RGKKDAATALFNLSI HENK R
Sbjct  592   ENAAAALFSLSLLEEYRKKIGRSGAVKALVDLLGLGTIRGKKDAATALFNLSIFHENKAR  651

Query  756   IVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSAR  577
             I+Q GAV+HL+ L+DP+  +VDKAVA+L+NL+TI EG ++I +E GIP LVE+VE GS R
Sbjct  652   IIQVGAVKHLIRLLDPSNELVDKAVALLANLSTISEGCLAIAREEGIPSLVEIVETGSQR  711

Query  576   GKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHG  397
             GKENAA+ LLQLC NS +YC +VLQ GAVPPLVALSQSG+PRA+EKAQ LLS+FR+QR  
Sbjct  712   GKENAASILLQLCLNSPKYCRLVLQEGAVPPLVALSQSGSPRAKEKAQQLLSHFRSQREA  771

Query  396   NAGRG  382
               GRG
Sbjct  772   ATGRG  776


 Score =   196 bits (497),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 114/310 (37%), Positives = 184/310 (59%), Gaps = 3/310 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+  ++ L+N+IS F HL +     S    K Y+    +LKLL+P+L  +   +  SDE
Sbjct  1     MELTSVRCLMNSISRFIHLVTCLTSKSMPGQKNYKNIATLLKLLKPVLDDVAQQKAPSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              + +    L  +++E REL + W    SK+ +VLQ+E  + K+++ +LK+  +L      
Sbjct  61    TICRQCEELDVAINEARELLEEWSPKKSKILWVLQSEPELLKIQSIALKLSHILCQLLES  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P     + ++  + +I+  +   +S  +  A +    G    S+SLT++   L+  S++
Sbjct  121   SPPSLGPSEIQPFIQEIQKFEVGQISKQMNMAPE---VGKILVSESLTEMIHSLNFVSHE  177

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +ALEK +  A+  E   +++ I   I L + + DC++ +   ++   ++IP  F
Sbjct  178   ELLNECIALEKERMKAKDNETRGDLDKISLSIDLFSDIRDCMLELDHFKAIDGIKIPPYF  237

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM +PVI+ASGQTYE+  I++W+D GLT CP+T Q L H+NLIPNYTVKALI 
Sbjct  238   RCPLSLELMVNPVIIASGQTYEKASIQKWLDHGLTTCPRTNQALAHSNLIPNYTVKALIE  297

Query  1977  NWCEMNNIKL  1948
             NWCE+N ++L
Sbjct  298   NWCEVNKVRL  307



>ref|XP_011028816.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Populus euphratica]
Length=768

 Score =   370 bits (949),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 187/266 (70%), Positives = 224/266 (84%), Gaps = 0/266 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
             QV+KLVE LKS S + Q  A  ELRLLAKH+M+NRI+I + GAI  L+++L SE    QE
Sbjct  498   QVKKLVEGLKSLSNEVQTKAAEELRLLAKHDMENRIIIGHSGAIRPLLSMLSSEVKLTQE  557

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN+ NK+ IA AGAIEP+I+VL +G+  A+ENSAA LFSLSV+E+ K KI
Sbjct  558   HAVTALLNLSINEENKAIIAEAGAIEPIIHVLRSGNDGARENSAAALFSLSVLEEYKAKI  617

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLLG+GT RGKKDAAT LFNLSI HENK RIVQAGAV++LVELMDP  GM
Sbjct  618   GRSGAVKALVDLLGSGTLRGKKDAATTLFNLSIFHENKARIVQAGAVKYLVELMDPVTGM  677

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGR++I + GGIP+LVEVVE GS RGKENAA+ L+QLC +S R+C
Sbjct  678   VDKAVALLANLSTIGEGRLAIAKAGGIPLLVEVVESGSQRGKENAASILMQLCLSSPRFC  737

Query  516   NMVLQHGAVPPLVALSQSGTPRAREK  439
              +VLQ GAVPPLVALSQSGTPRA+EK
Sbjct  738   TLVLQEGAVPPLVALSQSGTPRAKEK  763


 Score =   226 bits (575),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 133/333 (40%), Positives = 203/333 (61%), Gaps = 2/333 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME   ++ L+N+IS F HL S +      + K Y+    +LK L+P+L  + D  I+SDE
Sbjct  1     MEKSSVRCLINSISRFMHLVSCQTKKYLPIQKDYEIMVIMLKHLKPVLDEVDDYNISSDE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
             +  +    L  +V+E RE  + W    S++  V Q+E+L+ K+++ +L+I + L      
Sbjct  61    IPCRECEELDAAVNEAREFMEKWCPQMSRICSVQQSEALLKKIQSSALEICQALCRLLHG  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P  SSLT +++C+ ++K + +E ++  I +A+++  +     +D L K+   LSL SNQ
Sbjct  121   SPTTSSLTIVQHCMQELKGLKHETITEIIEEALRSLKDDVVPCTDHLMKLIQTLSLTSNQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E VA+EK + N    +    +  I+QI+ L+T +   L+ ++  +  +   IP  F
Sbjct  181   ELLKESVAVEKERTNVHINKAEGYLYQIDQIVDLITQIRSWLLKVEHRDPKSGAPIPPYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTY+R  I++W+D GLT CP+TRQTL+HTN IPNYTVKA+IA
Sbjct  241   RCPLSLELMLDPVIVASGQTYDRVSIQKWLDHGLTFCPRTRQTLSHTNFIPNYTVKAMIA  300

Query  1977  NWCEMNNIKLPDPIKSLNVNQPSSH--VAHVDS  1885
             NWCE NN+++       N    SSH  + H+DS
Sbjct  301   NWCEENNVRVSGHSDCNNHVLASSHHDLLHLDS  333



>gb|KCW84732.1| hypothetical protein EUGRSUZ_B01548 [Eucalyptus grandis]
Length=794

 Score =   365 bits (938),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/266 (68%), Positives = 225/266 (85%), Gaps = 0/266 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V+ L+E+LK+ S +    A AELR LAKHNM+NR++I   GAI+ L++LL+S     QE
Sbjct  524   HVKILIENLKNQSNEVHTKAAAELRFLAKHNMENRLIIGQSGAITPLLSLLYSRVRYTQE  583

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTA+LNLSIN+ NK+ IA AGAIEPLI+VL++G+  A+EN+AATLFS+S++E+ K KI
Sbjct  584   HAVTAILNLSINEENKAMIAEAGAIEPLIHVLKSGNEGARENAAATLFSISLLEEYKAKI  643

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLLG+GTPRGKKDAATALFNLSI HENK RIVQAGAV++L+ELMDP  GM
Sbjct  644   GRSGAVKALVDLLGSGTPRGKKDAATALFNLSIFHENKARIVQAGAVKYLIELMDPDTGM  703

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+T  EGR++I +EGGIP+LVEV+E GS RGKENAA+ LLQLC NS ++C
Sbjct  704   VDKAVALLANLSTTGEGRLAIVREGGIPLLVEVIESGSHRGKENAASVLLQLCLNSPKFC  763

Query  516   NMVLQHGAVPPLVALSQSGTPRAREK  439
              +VLQ GAVPPLVALSQSGT RA+EK
Sbjct  764   TLVLQEGAVPPLVALSQSGTARAKEK  789


 Score =   202 bits (515),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 195/309 (63%), Gaps = 1/309 (0%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS-DELLQKVFS  2677
             L+N+IS F HL   +   S+ + + Y KT ++LKLL+P+L  +V+      DE+L K F 
Sbjct  13    LINSISRFIHLVMCQTRKSQHLQQIYGKTTEVLKLLKPLLDDVVEHTTPILDEILYKEFE  72

Query  2676  GLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSL  2497
              L  +V+  RE  + W    SK+  VLQ+++ + K++  SL+I ++L        A SS 
Sbjct  73    ELDMAVNMSREFLENWSPRMSKICSVLQSKTSLMKIQTSSLEICQILCRLSQSGQAGSSF  132

Query  2496  TSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELV  2317
             + ++  + +++ +  E ++  I + + N  +G    +D+++KI + L+L+S QEL  E +
Sbjct  133   SRIQYSLQELQRLKQEGVAEFIEEVLINQRDGILPCADTVSKIIELLNLRSKQELFKESL  192

Query  2316  aleklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLE  2137
             A+EK +  A+  E   E + I Q+I L++++ D +I     E+   + IP  F CPLSLE
Sbjct  193   AVEKERMRADVNEVRGEFDEINQVIRLMSYIRDFMIETDFLEADDGMLIPPYFRCPLSLE  252

Query  2136  LMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNN  1957
             LM DPVIVASGQTYER  I++W+D GLTVCPKTRQ LTHTNLIPNYTVKA++  WC+ NN
Sbjct  253   LMMDPVIVASGQTYERASIQKWLDHGLTVCPKTRQLLTHTNLIPNYTVKAMVEGWCKHNN  312

Query  1956  IKLPDPIKS  1930
             I+L + ++S
Sbjct  313   IRLFNSLES  321



>gb|KCW84733.1| hypothetical protein EUGRSUZ_B01548 [Eucalyptus grandis]
Length=789

 Score =   365 bits (938),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/266 (68%), Positives = 225/266 (85%), Gaps = 0/266 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V+ L+E+LK+ S +    A AELR LAKHNM+NR++I   GAI+ L++LL+S     QE
Sbjct  519   HVKILIENLKNQSNEVHTKAAAELRFLAKHNMENRLIIGQSGAITPLLSLLYSRVRYTQE  578

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTA+LNLSIN+ NK+ IA AGAIEPLI+VL++G+  A+EN+AATLFS+S++E+ K KI
Sbjct  579   HAVTAILNLSINEENKAMIAEAGAIEPLIHVLKSGNEGARENAAATLFSISLLEEYKAKI  638

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLLG+GTPRGKKDAATALFNLSI HENK RIVQAGAV++L+ELMDP  GM
Sbjct  639   GRSGAVKALVDLLGSGTPRGKKDAATALFNLSIFHENKARIVQAGAVKYLIELMDPDTGM  698

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+T  EGR++I +EGGIP+LVEV+E GS RGKENAA+ LLQLC NS ++C
Sbjct  699   VDKAVALLANLSTTGEGRLAIVREGGIPLLVEVIESGSHRGKENAASVLLQLCLNSPKFC  758

Query  516   NMVLQHGAVPPLVALSQSGTPRAREK  439
              +VLQ GAVPPLVALSQSGT RA+EK
Sbjct  759   TLVLQEGAVPPLVALSQSGTARAKEK  784


 Score =   202 bits (514),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 195/309 (63%), Gaps = 1/309 (0%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS-DELLQKVFS  2677
             L+N+IS F HL   +   S+ + + Y KT ++LKLL+P+L  +V+      DE+L K F 
Sbjct  8     LINSISRFIHLVMCQTRKSQHLQQIYGKTTEVLKLLKPLLDDVVEHTTPILDEILYKEFE  67

Query  2676  GLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSL  2497
              L  +V+  RE  + W    SK+  VLQ+++ + K++  SL+I ++L        A SS 
Sbjct  68    ELDMAVNMSREFLENWSPRMSKICSVLQSKTSLMKIQTSSLEICQILCRLSQSGQAGSSF  127

Query  2496  TSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELV  2317
             + ++  + +++ +  E ++  I + + N  +G    +D+++KI + L+L+S QEL  E +
Sbjct  128   SRIQYSLQELQRLKQEGVAEFIEEVLINQRDGILPCADTVSKIIELLNLRSKQELFKESL  187

Query  2316  aleklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLE  2137
             A+EK +  A+  E   E + I Q+I L++++ D +I     E+   + IP  F CPLSLE
Sbjct  188   AVEKERMRADVNEVRGEFDEINQVIRLMSYIRDFMIETDFLEADDGMLIPPYFRCPLSLE  247

Query  2136  LMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNN  1957
             LM DPVIVASGQTYER  I++W+D GLTVCPKTRQ LTHTNLIPNYTVKA++  WC+ NN
Sbjct  248   LMMDPVIVASGQTYERASIQKWLDHGLTVCPKTRQLLTHTNLIPNYTVKAMVEGWCKHNN  307

Query  1956  IKLPDPIKS  1930
             I+L + ++S
Sbjct  308   IRLFNSLES  316



>gb|KCW84731.1| hypothetical protein EUGRSUZ_B01548 [Eucalyptus grandis]
Length=790

 Score =   365 bits (937),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/266 (68%), Positives = 225/266 (85%), Gaps = 0/266 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V+ L+E+LK+ S +    A AELR LAKHNM+NR++I   GAI+ L++LL+S     QE
Sbjct  520   HVKILIENLKNQSNEVHTKAAAELRFLAKHNMENRLIIGQSGAITPLLSLLYSRVRYTQE  579

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTA+LNLSIN+ NK+ IA AGAIEPLI+VL++G+  A+EN+AATLFS+S++E+ K KI
Sbjct  580   HAVTAILNLSINEENKAMIAEAGAIEPLIHVLKSGNEGARENAAATLFSISLLEEYKAKI  639

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLLG+GTPRGKKDAATALFNLSI HENK RIVQAGAV++L+ELMDP  GM
Sbjct  640   GRSGAVKALVDLLGSGTPRGKKDAATALFNLSIFHENKARIVQAGAVKYLIELMDPDTGM  699

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+T  EGR++I +EGGIP+LVEV+E GS RGKENAA+ LLQLC NS ++C
Sbjct  700   VDKAVALLANLSTTGEGRLAIVREGGIPLLVEVIESGSHRGKENAASVLLQLCLNSPKFC  759

Query  516   NMVLQHGAVPPLVALSQSGTPRAREK  439
              +VLQ GAVPPLVALSQSGT RA+EK
Sbjct  760   TLVLQEGAVPPLVALSQSGTARAKEK  785


 Score =   199 bits (505),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 194/309 (63%), Gaps = 5/309 (2%)
 Frame = -2

Query  2853  LLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIAS-DELLQKVFS  2677
             L+N+IS F HL   +   S+ + + Y KT ++LKLL+P+L  +V+      DE+L K F 
Sbjct  13    LINSISRFIHLVMCQTRKSQHLQQIYGKTTEVLKLLKPLLDDVVEHTTPILDEILYKEFE  72

Query  2676  GLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSL  2497
              L  +V+  RE  + W    SK+  VLQ+++ + K++  SL+I ++L        A SS 
Sbjct  73    ELDMAVNMSREFLENWSPRMSKICSVLQSKTSLMKIQTSSLEICQILCRLSQSGQAGSSF  132

Query  2496  TSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELV  2317
             + ++    +++ +  E ++  I + + N  +G    +D+++KI + L+L+S QEL  E +
Sbjct  133   SRIQ----ELQRLKQEGVAEFIEEVLINQRDGILPCADTVSKIIELLNLRSKQELFKESL  188

Query  2316  aleklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLE  2137
             A+EK +  A+  E   E + I Q+I L++++ D +I     E+   + IP  F CPLSLE
Sbjct  189   AVEKERMRADVNEVRGEFDEINQVIRLMSYIRDFMIETDFLEADDGMLIPPYFRCPLSLE  248

Query  2136  LMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNN  1957
             LM DPVIVASGQTYER  I++W+D GLTVCPKTRQ LTHTNLIPNYTVKA++  WC+ NN
Sbjct  249   LMMDPVIVASGQTYERASIQKWLDHGLTVCPKTRQLLTHTNLIPNYTVKAMVEGWCKHNN  308

Query  1956  IKLPDPIKS  1930
             I+L + ++S
Sbjct  309   IRLFNSLES  317



>ref|XP_001781593.1| predicted protein [Physcomitrella patens]
 gb|EDQ53549.1| predicted protein [Physcomitrella patens]
Length=563

 Score =   353 bits (907),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 206/323 (64%), Positives = 239/323 (74%), Gaps = 11/323 (3%)
 Frame = -2

Query  1374  ESEFPSPVGTRLRPPAIWRRPSER--LVSRIVSSPTVETRADLAEVKEQVRKLVEDLKST  1201
             E E P+ +  R   P+  RR  +R   + RI+S  T    A     +  V + V DL+S 
Sbjct  240   EPESPARLPER---PSFGRRGVDRDSCLPRIISDNTSGGTA-----QSDVERWVLDLQSP  291

Query  1200  SVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSIN  1021
               + QR A  ELR+LAKHNM+NR+ I+N GAI  LV LL S D + QENAVTALLNLSIN
Sbjct  292   DTETQRQAACELRMLAKHNMENRVTIANAGAIEPLVALLSSVDAKTQENAVTALLNLSIN  351

Query  1020  DNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDL  841
             DNNKS IA AGAI PL+ VL  G+ EA EN+AATLFSLSV++DN + IG SGAV  LV L
Sbjct  352   DNNKSEIARAGAIGPLVNVLRVGNAEAMENAAATLFSLSVMDDNNVTIGASGAVPPLVHL  411

Query  840   LGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELM-DPAAGMVDKAVAVLSNL  664
             L NG+PRGKKDAATALFNLSI HENK RIV+AGA+R LVELM DPAAGMVDKAVAVL+NL
Sbjct  412   LINGSPRGKKDAATALFNLSIHHENKRRIVEAGAIRPLVELMADPAAGMVDKAVAVLANL  471

Query  663   ATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPP  484
             AT  EGR +IG+  GIP LVEVVE GS +GKENAAAALLQLCTNS R+  +VLQ GA+PP
Sbjct  472   ATFSEGRQAIGEHQGIPALVEVVEAGSQKGKENAAAALLQLCTNSHRHRALVLQEGAIPP  531

Query  483   LVALSQSGTPRAREKAQALLSYF  415
             LVALSQSGTPRA+EK + L S  
Sbjct  532   LVALSQSGTPRAKEKVEDLPSQM  554


 Score =   144 bits (363),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 114/185 (62%), Gaps = 7/185 (4%)
 Frame = -2

Query  2451  ELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELValeklkenaeqaekn  2272
             E +   I   ++   EGS    ++L ++A+ L L+S + +  EL AL K +E A   E  
Sbjct  3     ERVGENIETLLREQREGSRPRRETLERVAEKLHLRSKENIAQELQALTKEREEAGAQEDK  62

Query  2271  eevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCCPLSLELMTDPVIVASGQTYE  2092
              E E I +++ LV  M   L    +  +   ++IPADF CPLS ELM+DPVI+ASGQTYE
Sbjct  63    SEEELIRRLLQLVKQMEGLL----EGAATEGLEIPADFRCPLSGELMSDPVILASGQTYE  118

Query  2091  RNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDPIK---SLNV  1921
             R +I+ W++ G + CPKT Q L+  NLIPNYTVKALIANWCE + + +P P++    LN 
Sbjct  119   RIYIQHWLNEGHSRCPKTHQKLSRRNLIPNYTVKALIANWCETHGVPVPRPVQLNVHLNS  178

Query  1920  NQPSS  1906
              QP S
Sbjct  179   LQPPS  183



>emb|CDY02891.1| BnaC04g25950D [Brassica napus]
Length=737

 Score =   358 bits (919),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 232/291 (80%), Gaps = 1/291 (0%)
 Frame = -2

Query  1251  AEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSED  1072
             +E      KLV+DLK  S  ++  A AE+R L  +N++NR+ I  CGAI+ L++LL+SE+
Sbjct  445   SECSSHTMKLVQDLKDGSSKEKTAAAAEIRHLTINNVENRVHIGRCGAITPLLSLLYSEE  504

Query  1071  MEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIED  892
             +  QE+AVTALLNLSI++ NK+ IA AGAIEPL++VL TG+  AKENSAATLFSLSV++ 
Sbjct  505   VLTQEHAVTALLNLSISEVNKAMIAEAGAIEPLVHVLSTGNDRAKENSAATLFSLSVLQV  564

Query  891   NKIKIGR-SGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELM  715
             N+ +IG+ + A+Q+LV+LLG GT RGKKDAA+ALFNLSI HENK RIVQA AV+HLVEL+
Sbjct  565   NRERIGQCNAAIQALVNLLGKGTFRGKKDAASALFNLSITHENKARIVQAKAVKHLVELL  624

Query  714   DPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCT  535
             DP   MVDKAVA+L+NL+ + EGR +I +EGGIP+LVE V+ GS RGKENAA+ LLQLC 
Sbjct  625   DPELEMVDKAVALLANLSAVGEGRQAIVREGGIPLLVETVDSGSQRGKENAASVLLQLCL  684

Query  534   NSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             NS ++C +VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  685   NSPKFCTLVLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKG  735


 Score =   195 bits (495),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 119/316 (38%), Positives = 185/316 (59%), Gaps = 11/316 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ + ++ LLN+IS + HL + + I  + +         +LKLL+P L  +VD ++  D+
Sbjct  1     MDPVPVRCLLNSISRYLHLVACQTIRYKPIQTCIGNVVHLLKLLKPFLDDVVDCKVPPDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L      L   V++ RE  + W    SK++ V  +E L+ KV+  SL+I  +L+     
Sbjct  61    CLNSACEDLDSVVNQAREFLEDWSPKLSKLFGVFHSELLLEKVQTCSLEINRILLQLSQS  120

Query  2517  LPAESSLTS-----LENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLS  2353
              P  SS+       L+ C+ +I+    E    T+++ +K+ V      +D L  I   + 
Sbjct  121   SPVTSSVQGVEVNLLQRCMQEIECFKQE---RTLSEHMKDTVP---LDTDDLDSIIQMMG  174

Query  2352  LKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQ  2173
             L SNQ+LL E +A+EK +  ++ ++  E++E I+Q+I LV+ + + ++  +  E    V 
Sbjct  175   LISNQDLLKESIAVEKARIRSQTSKSKEKIEQIDQLIDLVSCIREHMLKTEFFEVAKGVS  234

Query  2172  IPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTV  1993
             IP  F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH  LIPNYTV
Sbjct  235   IPPYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLDVCPRTRQVLTHQELIPNYTV  294

Query  1992  KALIANWCEMNNIKLP  1945
             KA+IA+W E N+I LP
Sbjct  295   KAMIASWLEENSINLP  310



>ref|XP_004493781.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Cicer arietinum]
 ref|XP_004493782.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Cicer arietinum]
Length=765

 Score =   358 bits (918),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 183/285 (64%), Positives = 229/285 (80%), Gaps = 0/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V KL++DL+S S + Q IA  ELRLL KHNMDNRI+++ CGAI  L+ LL+S+    QE
Sbjct  479   HVNKLIKDLQSQSNETQAIAAEELRLLTKHNMDNRIIVAQCGAIMHLLPLLYSDMKITQE  538

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN++N++ I  A AIE LI VL+TG+  AKENSAA LFSLSV E+NK KI
Sbjct  539   HAVTALLNLSINEDNRTLIMEAEAIEGLINVLKTGNNGAKENSAAALFSLSVPENNKAKI  598

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             G +GA+++LV+LL +GT RGKKDAATALFNLSI HENK RIV+AGAV+ LV L+DPA GM
Sbjct  599   GCTGAIKALVELLASGTLRGKKDAATALFNLSICHENKARIVEAGAVKFLVMLLDPADGM  658

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGR+ I +E G+P+LVE+VE GS RGKENA++ LLQL  +S ++C
Sbjct  659   VDKAVALLANLSTIPEGRLEIVRERGVPLLVELVESGSQRGKENASSILLQLSLHSRKFC  718

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
              ++L+ GAVPP+VALSQ GT RA+EKAQ LL  FRNQR G  G+G
Sbjct  719   TLILREGAVPPVVALSQFGTLRAKEKAQQLLVLFRNQRDGAPGKG  763


 Score =   186 bits (471),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 186/335 (56%), Gaps = 5/335 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+I   K ++N IS F HL S + +    + K Y     +LK L+P+L  +VD +I  D+
Sbjct  1     MDITSAKCVVNTISRFIHLVSCQTVKLIPLQKNYNNMVGVLKCLKPVLDDVVDYKIPLDK  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L +    L   V+E  E  +      S+++ VL +  ++ K+++ SL I  ++  S   
Sbjct  61    NLYRECEELNMQVNEAMEFIEKRSPKMSRIHNVLLSGKMLIKLQSTSLIICHIINRSSMS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
               + S L +L++ + +++S   +  +  I +A++N  +      + L +I + L L S+ 
Sbjct  121   TSSSSVLANLQHHMQELQSFKKDSTTLYIEEALRNQKDNIKPCYEHLREIIELLKLTSSH  180

Query  2337  ELLIELValeklkenaeqaekneevEY--IEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             ELL E + +EK + N        + E   + QI+ +V  + D     K  E  + V IP+
Sbjct  181   ELLKESIDVEKERLNVNAQVNKTKEELDEVNQIMNIVCILRDYATKSKCPEVKSGVSIPS  240

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
              F CPLSLE+M DPVIVASGQTYER  I+ W+D  L +CPKT Q LTHT+LIPN TVKA+
Sbjct  241   YFLCPLSLEIMLDPVIVASGQTYERGSIQMWLDNELLICPKTHQKLTHTDLIPNSTVKAM  300

Query  1983  IANWCEMNNIKLP---DPIKSLNVNQPSSHVAHVD  1888
             I NWCE NN KLP   +P  S  ++ PS ++ H D
Sbjct  301   ITNWCEENNFKLPSNSNPGNSTKISNPSDNLLHQD  335



>ref|XP_011083032.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
3-like [Sesamum indicum]
Length=770

 Score =   357 bits (916),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 192/313 (61%), Positives = 238/313 (76%), Gaps = 6/313 (2%)
 Frame = -2

Query  1320  RRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNM  1141
             RRPS     R +SSP+     +LA   + V KL+EDLKS+S + Q  A  E+R LAK+NM
Sbjct  462   RRPS-----RTLSSPSEFGSTNLASTSD-VDKLIEDLKSSSTELQSTAAREIRFLAKYNM  515

Query  1140  DNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVL  961
             +NR +I  CGAIS L +LL+S+   +QE+AVTALLNLSIN+  K+ I   GA+EPLI+VL
Sbjct  516   ENRFIIGQCGAISPLTSLLYSDVELIQEHAVTALLNLSINEKIKARIGAEGAVEPLIHVL  575

Query  960   ETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLS  781
               G+  A+EN+AA LFSLS++ + +IKIGRSGAV+ LVDLL +GT RG KDAATALFNLS
Sbjct  576   RIGNAVARENAAAALFSLSLLGEYRIKIGRSGAVKPLVDLLQSGTLRGLKDAATALFNLS  635

Query  780   ILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVE  601
             I  ENK RIVQAGA+++LV LMDPA+ M+DKAVA+L+NL+TI EG  +I +E GIP+LVE
Sbjct  636   IFQENKARIVQAGAIKYLVRLMDPASEMIDKAVALLANLSTITEGCSAIAREXGIPLLVE  695

Query  600   VVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLS  421
             +VE GS RGKENAA+ LLQLC NS RYC  +LQ G VPPLV LS SGTPRA+EKAQ LLS
Sbjct  696   IVETGSQRGKENAASILLQLCINSPRYCRSILQEGVVPPLVTLSLSGTPRAKEKAQQLLS  755

Query  420   YFRNQRHGNAGRG  382
             +FR+QR     RG
Sbjct  756   HFRSQRKSAVVRG  768


 Score =   193 bits (490),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 124/362 (34%), Positives = 201/362 (56%), Gaps = 9/362 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M++  L+ L+N+IS F HL +          + ++    +LK L+ +L  + D +   +E
Sbjct  1     MDLTSLRCLINSISRFSHLVTCRVSKIMPAEEDHRSIASLLKHLKLVLDDVADHKAPPNE  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    L  +V++L++  + W    SK+  VLQ + L+ K++  S+K+  +L      
Sbjct  61    ALIKECKKLDVAVNDLKKFIEKWFPRKSKILCVLQRKPLLLKIQVSSVKLACILCRLFES  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
              P   SL++ + C  + +++    LS  I + ++   EG       L  I + L+L+S Q
Sbjct  121   SPGGLSLSNAQICRQESQNLKLGELSGCIGEILEIQKEGRTPDDGRLMLIVESLNLRSKQ  180

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ELL E +A++K ++ AE ++   +++ I Q + L++ + DC++ ++   +   +QIP  F
Sbjct  181   ELLSEFIAIKKERQKAEYSKITGDLDQISQTVDLISRIRDCMVKLENFIARNGLQIPPYF  240

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLELM DPVIVASGQTYE   IR+W+D GL  CPKT   L H NLIPNYTVKALI 
Sbjct  241   RCPLSLELMLDPVIVASGQTYEGTAIRKWLDHGLVTCPKTGNLLAHKNLIPNYTVKALIT  300

Query  1977  NWCEMNNIKL---PDPIKSLNVNQPSSHVAHVDSGAPRDIHIFSHSRANNST-SPDSAHG  1810
             NWC++N ++L   PD     +V + S H+  +D     D+      R++ S  S +  HG
Sbjct  301   NWCDLNKVELSSNPDNADLCSVQRHSEHMNCLD-----DLQYPPQLRSSTSIPSLEDGHG  355

Query  1809  LD  1804
              +
Sbjct  356   FE  357



>ref|XP_009139209.1| PREDICTED: U-box domain-containing protein 3-like [Brassica rapa]
Length=738

 Score =   355 bits (912),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 181/293 (62%), Positives = 231/293 (79%), Gaps = 1/293 (0%)
 Frame = -2

Query  1257  DLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHS  1078
             + +E      KLV+DLK  S  ++  A AE+R L  +N++NR+ I  CGAI+ L++LL+S
Sbjct  444   EYSECSSHTMKLVQDLKDGSSKEKTAAAAEIRQLTINNVENRVQIGRCGAITPLLSLLYS  503

Query  1077  EDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVI  898
             E+   QE+AVTALLNLSI++ NK+ IA AGA EPL++VL TG+  AKENSAATLFSLSV+
Sbjct  504   EEELTQEHAVTALLNLSISEVNKAMIAEAGATEPLVHVLNTGNDRAKENSAATLFSLSVL  563

Query  897   EDNKIKIGRS-GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVE  721
             + N+ +IG+S  A+Q+LV+LLG GT RGKKDAA+ALFNLSI HENK RIVQA AV++LVE
Sbjct  564   QVNRERIGQSNAAIQALVNLLGKGTFRGKKDAASALFNLSITHENKARIVQAKAVKYLVE  623

Query  720   LMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQL  541
             L+DP   MVDKAVA+L+NL+ + EGR +I +EGGIP+LVE V+ GS RGKENAA+ LLQL
Sbjct  624   LLDPELEMVDKAVALLANLSAVGEGRQAIVREGGIPLLVETVDSGSQRGKENAASVLLQL  683

Query  540   CTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             C NS ++C +VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  684   CLNSPKFCTLVLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKG  736


 Score =   197 bits (502),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 120/316 (38%), Positives = 186/316 (59%), Gaps = 11/316 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ + ++ LLN+IS + HL + + I  + +         +LKLL+P L  +VD ++  D+
Sbjct  1     MDPVPVRCLLNSISRYLHLVACQTIRYKPIQTCIGNVVHLLKLLKPFLDDVVDCKVPPDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L      L   V++ RE  + W    SK++ V  +E L+ KV+  SL+I  +LV     
Sbjct  61    CLNSACEDLDSVVNQAREFLEDWSPKMSKLFGVFHSELLLEKVQTCSLEISRILVQLSQS  120

Query  2517  LPAESSLTS-----LENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLS  2353
              P  SS+       L+ C+ +I+    E    T+++ +K+ V      +D L  I   + 
Sbjct  121   SPVTSSVQGVEVNLLQRCMQEIECFKQE---RTLSEHMKDTVP---LDTDDLDSIIHMMG  174

Query  2352  LKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQ  2173
             L SNQ+LL E +A+EK +  ++ ++  E++E ++Q+I LV+ + + ++  +  E    V 
Sbjct  175   LISNQDLLKESIAVEKARIRSQTSKSKEKMEQMDQLIDLVSCIREHMLKTEFLEVAKGVS  234

Query  2172  IPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTV  1993
             IP  F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH  LIPNYTV
Sbjct  235   IPPYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLDVCPRTRQVLTHQELIPNYTV  294

Query  1992  KALIANWCEMNNIKLP  1945
             KA+IA+W E N+IKLP
Sbjct  295   KAMIASWLEENSIKLP  310



>ref|XP_006290759.1| hypothetical protein CARUB_v10016863mg [Capsella rubella]
 gb|EOA23657.1| hypothetical protein CARUB_v10016863mg [Capsella rubella]
Length=609

 Score =   351 bits (901),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 180/283 (64%), Positives = 227/283 (80%), Gaps = 1/283 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLKS S   +  A AE+R L  ++++NR+    CGAI+ L++LL+SE+   QE+AV
Sbjct  325   KLVEDLKSGSHQVKTAAAAEIRHLTINSIENRVHFGRCGAITPLLSLLYSEEKLSQEHAV  384

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRS  868
             TALLNLSI++ NK+ I  AGA+EPL++VL TG+  AKENSAATLFSLSV+  N+ +IG+S
Sbjct  385   TALLNLSISELNKATIVEAGALEPLVHVLNTGNDRAKENSAATLFSLSVLPVNRERIGQS  444

Query  867   -GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
               A+Q+LV+LLG GT RGKKDAA+ALFNLSI HENK RIVQA AV++LVEL+DP   MVD
Sbjct  445   NAAIQALVNLLGKGTFRGKKDAASALFNLSITHENKARIVQAKAVKYLVELLDPELEMVD  504

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ + EGR +I +EGGIP+LVE V+LGS RGKENAA+ LLQLC NS ++C +
Sbjct  505   KAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCLNSPKFCTL  564

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  565   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKG  607


 Score =   138 bits (347),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 98/145 (68%), Gaps = 0/145 (0%)
 Frame = -2

Query  2379  LTKIADCLSLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMK  2200
             L  I   L L SNQ+LL E +A+EK +  ++ ++  E VE IEQ+I LV  + + ++  +
Sbjct  20    LENIIQMLGLISNQDLLKESIAVEKERIRSQTSKSKENVEQIEQLIELVLCIREHMLKTE  79

Query  2199  QSESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTH  2020
               E    + IP  F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH
Sbjct  80    FLEVAKGISIPPYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLTH  139

Query  2019  TNLIPNYTVKALIANWCEMNNIKLP  1945
               LIPNYTVKA+IA+W E N I LP
Sbjct  140   QELIPNYTVKAMIASWLEANRISLP  164



>emb|CDY64696.1| BnaA04g27690D [Brassica napus]
Length=738

 Score =   354 bits (908),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 181/293 (62%), Positives = 230/293 (78%), Gaps = 1/293 (0%)
 Frame = -2

Query  1257  DLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHS  1078
             + +E      KLV+DLK  S  ++  A AE+R L  +N++NR+ I  CGAI+ L++LL+S
Sbjct  444   EYSECSSHTMKLVQDLKDGSSKEKTAAAAEIRQLTINNVENRVQIGRCGAITPLLSLLYS  503

Query  1077  EDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVI  898
             E+   QE+AVTALLNLSI++ NK+ IA AGA E L++VL TG+  AKENSAATLFSLSV+
Sbjct  504   EEELTQEHAVTALLNLSISEINKAMIAEAGATETLVHVLNTGNDRAKENSAATLFSLSVL  563

Query  897   EDNKIKIGRS-GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVE  721
             + N+ +IG+S  A+Q+LV+LLG GT RGKKDAA+ALFNLSI HENK RIVQA AV+HLVE
Sbjct  564   QVNRERIGQSNAAIQALVNLLGKGTFRGKKDAASALFNLSITHENKARIVQAKAVKHLVE  623

Query  720   LMDPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQL  541
             L+DP   MVDKAVA+L+NL+ + EGR +I +EGGIP+LVE V+ GS RGKENAA+ LLQL
Sbjct  624   LLDPELEMVDKAVALLANLSAVGEGRQAIVREGGIPLLVETVDSGSQRGKENAASVLLQL  683

Query  540   CTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             C NS ++C +VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  684   CLNSPKFCTLVLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKG  736


 Score =   200 bits (508),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 187/316 (59%), Gaps = 11/316 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ +L++ LLN+IS + HL + + I  + +         +LKLL+P L  +VD ++  D+
Sbjct  1     MDPVLVRCLLNSISRYLHLVACQTIRYKPIQTCIGNVVHLLKLLKPFLDDVVDCKVPPDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L      L   V++ RE  + W    SK++ V  +E L+ KV+  SL+I  +LV     
Sbjct  61    CLNSACEDLDSVVNQAREFLEDWSPKMSKLFGVFHSELLLEKVQTCSLEISRILVQLSQS  120

Query  2517  LPAESSLTS-----LENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLS  2353
              P  SS+       L+ C+ +I+    E    T+++ +K+ V      +D L  I   + 
Sbjct  121   SPVTSSVQGVEVNLLQRCMQEIECFKQE---RTLSEHMKDTVP---LDTDDLDSIIHMMG  174

Query  2352  LKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQ  2173
             L SNQ+LL E +A+EK +  ++ ++  E++E ++Q+I LV+ + + ++  +  E    V 
Sbjct  175   LISNQDLLKESIAVEKARIRSQTSKSKEKMEQMDQLIDLVSCIREHMLKTEFLEVAKGVS  234

Query  2172  IPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTV  1993
             IP  F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH  LIPNYTV
Sbjct  235   IPPYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLDVCPRTRQVLTHQELIPNYTV  294

Query  1992  KALIANWCEMNNIKLP  1945
             KA+IA+W E N+IKLP
Sbjct  295   KAMIASWLEENSIKLP  310



>ref|XP_006576943.1| PREDICTED: U-box domain-containing protein 3-like isoform X4 
[Glycine max]
Length=844

 Score =   355 bits (910),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 180/267 (67%), Positives = 218/267 (82%), Gaps = 0/267 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V +L+EDL+S S + Q  A  +LRL  KHNM+NRI +  CGAI  L++LL+SE   +QE
Sbjct  527   HVNELIEDLQSQSNETQTAAAEQLRLCTKHNMENRISVGRCGAIMPLLSLLYSERKIIQE  586

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN+ NK+ I  AGAIEPLI+VL+TG+  AKENSAA LFSLSVI++NK KI
Sbjct  587   HAVTALLNLSINEGNKALIMEAGAIEPLIHVLKTGNDGAKENSAAALFSLSVIDNNKAKI  646

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LV LL +GT RGKKD+ATALFNLSI HENK RIVQAGAV+ LV L+DP   M
Sbjct  647   GRSGAVKALVGLLASGTLRGKKDSATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKM  706

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGR+ I +EGGIP LVE+VE GS RGKENAA+ LLQLC ++ ++C
Sbjct  707   VDKAVALLANLSTIAEGRIEIAREGGIPSLVEIVESGSLRGKENAASILLQLCLHNQKFC  766

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKA  436
              +VLQ GAVPPLVALSQSGTPRA+EK 
Sbjct  767   TLVLQEGAVPPLVALSQSGTPRAKEKC  793


 Score =   212 bits (539),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 188/309 (61%), Gaps = 7/309 (2%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L+N+IS F HL S + +    + K       +LK L+P+L  IVD +I  DE L + 
Sbjct  32    VKCLVNSISRFIHLVSCQAVKPMPLQKNCNNMVCVLKHLKPVLDDIVDFKIPFDENLHRE  91

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L   V+E RE  + W    S+++ VLQ+  L+ K++  S KI  ++V S   L   +
Sbjct  92    CEELDMRVNEAREFIEKWGPKMSRIHSVLQSGELLIKLQNSSYKICHMIVKS---LKGPA  148

Query  2502  SLT---SLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQEL  2332
             S+    +L+  + +++ +  E     I  A++N  +      DSL +I   L + SNQEL
Sbjct  149   SVLVSGNLQQYMQELQCLKKEPAMIYIEDALRNQRDNIEPCYDSLKEIIRLLMI-SNQEL  207

Query  2331  LIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCC  2152
             LIE +A+EK + NAE  +   +++ I QI+ LV  + D ++  ++ E  + V IP  F C
Sbjct  208   LIESIAVEKERSNAEVNKTKGDLDEINQIVNLVCSLRDYVMKFERPEVKSGVSIPPYFRC  267

Query  2151  PLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANW  1972
             PLSLELM+D VIVASGQTYER  I++W+D GLTVCP TRQ L HTNLIPNYTVKA+IANW
Sbjct  268   PLSLELMSDAVIVASGQTYERQSIQKWLDHGLTVCPNTRQILVHTNLIPNYTVKAMIANW  327

Query  1971  CEMNNIKLP  1945
             CE NN+KLP
Sbjct  328   CEENNVKLP  336



>gb|EPS67526.1| hypothetical protein M569_07248, partial [Genlisea aurea]
Length=692

 Score =   350 bits (898),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 178/285 (62%), Positives = 222/285 (78%), Gaps = 5/285 (2%)
 Frame = -2

Query  1221  VEDLKSTSV-----DQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
             VEDL   S+     + Q  A  E+R LAK+NM+NR++I   GAI  L++LL S+  +VQE
Sbjct  407   VEDLVKKSLNGDSSEMQTAAVGEIRSLAKYNMENRVIIGESGAIPPLISLLRSDSEQVQE  466

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN+  KS IA + A+EPLI+VL TG+  A+EN+AA LFS+S++E+ +IKI
Sbjct  467   HAVTALLNLSINEKIKSRIAESNAVEPLIHVLRTGNSRARENAAAALFSISLLEEYRIKI  526

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LVDLL  G+ RGKKDAATALFNLSI HENK RIVQ+GAV+ LV  +DP   M
Sbjct  527   GRSGAVKALVDLLQFGSVRGKKDAATALFNLSIHHENKARIVQSGAVKPLVGFLDPGTEM  586

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+ I EG  ++ +EGGIP+LVE+VE+G+ RGKENAAA LLQLC NS +YC
Sbjct  587   VDKAVALLANLSAIPEGCSAVAREGGIPLLVEIVEIGTPRGKENAAAILLQLCFNSPKYC  646

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
               +L  GAVPPLVALSQSGT RA+EKAQ LLS+FR QR    GRG
Sbjct  647   QTILVEGAVPPLVALSQSGTTRAKEKAQQLLSHFRRQRENGGGRG  691


 Score =   147 bits (372),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 100/306 (33%), Positives = 173/306 (57%), Gaps = 23/306 (8%)
 Frame = -2

Query  2847  NNISSFFHLSSLENINSELV--HKYYQKTEDILKLLQPILSGIVDAEIASDELLQKVFSG  2674
             N+IS F HL +    ++  +   K Y+    +LK L+P+L    +  +   E + +    
Sbjct  12    NSISRFIHLVTCSGGSTSTMPSEKDYRNVVSLLKHLKPLLDEFTNIRLPWTEAVYEECED  71

Query  2673  LGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAESSLT  2494
             L  +V+E RE  + W    SK+  VL+++ ++ K++  S+K+              SS  
Sbjct  72    LDAAVNEAREFLEKWSSKKSKIITVLRSKPVLLKIQMSSVKL--------------SSHI  117

Query  2493  SLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQELLIELVa  2314
               + C+ + +++    LS  + + ++     S   S +L +I D LSL S+ +++ E +A
Sbjct  118   FRQLCLQESQNLKIGQLSELMIEILR-----SQEDSQNLLQIVDSLSLISSPDIVNESIA  172

Query  2313  leklkenaeqaekneevEYIEQIIA--LVTHMHDCLIMMKQSESCTSVQIPADFCCPLSL  2140
             +EK ++  E++++++E +  +  +A  L+  + D ++ +   ++   V  P+ F CPLSL
Sbjct  173   IEKERQLVEESKRDDEDDLSQTSLAADLMARIQDHVVKLDGFKARNGVPFPSYFRCPLSL  232

Query  2139  ELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMN  1960
             ELM DPVIVASGQTYER+ I++W+D GL+ CPKT   L+H NLIPN+TV+ALI NWCE  
Sbjct  233   ELMADPVIVASGQTYERSAIQKWLDHGLSRCPKTGMLLSHRNLIPNFTVRALITNWCEER  292

Query  1959  NIKLPD  1942
              + L +
Sbjct  293   KVTLSE  298



>ref|NP_001078286.1| U-box domain-containing protein 3 [Arabidopsis thaliana]
 gb|AEE79288.1| U-box domain-containing protein 3 [Arabidopsis thaliana]
Length=724

 Score =   351 bits (900),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 179/283 (63%), Positives = 228/283 (81%), Gaps = 1/283 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLKS S   +  A AE+R L  ++++NR+ I  CGAI+ L++LL+SE+   QE+AV
Sbjct  440   KLVEDLKSGSNKVKTAAAAEIRHLTINSIENRVHIGRCGAITPLLSLLYSEEKLTQEHAV  499

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRS  868
             TALLNLSI++ NK+ I   GAIEPL++VL TG+  AKENSAA+LFSLSV++ N+ +IG+S
Sbjct  500   TALLNLSISELNKAMIVEVGAIEPLVHVLNTGNDRAKENSAASLFSLSVLQVNRERIGQS  559

Query  867   -GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
               A+Q+LV+LLG GT RGKKDAA+ALFNLSI H+NK RIVQA AV++LVEL+DP   MVD
Sbjct  560   NAAIQALVNLLGKGTFRGKKDAASALFNLSITHDNKARIVQAKAVKYLVELLDPDLEMVD  619

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ + EGR +I +EGGIP+LVE V+LGS RGKENAA+ LLQLC NS ++C +
Sbjct  620   KAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCLNSPKFCTL  679

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  680   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKG  722


 Score =   178 bits (452),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 107/262 (41%), Positives = 156/262 (60%), Gaps = 2/262 (1%)
 Frame = -2

Query  2727  IVDAEIASDELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKI  2548
             +VD +I SD+ L K    L   V++ RE  + W    SK++ V Q E L+ KV+  SL+I
Sbjct  15    VVDCKIPSDDCLYKGCEDLDSVVNQAREFLEDWSPKLSKLFGVFQCEVLLGKVQTCSLEI  74

Query  2547  VELLVSSDWCLPAESSLTSLENCVLKIKSMDYE-LLSATITKAIKNHVEG-SGASSDSLT  2374
               +L+      P  SS+ S+E CV + +S   E  L   +  A++N  +  +   ++ L 
Sbjct  75    SRILLQLSQSSPVTSSVQSVERCVQETESFKQEGTLMELMENALRNQKDDITSLDNNHLE  134

Query  2373  KIADCLSLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQS  2194
              I   L L SNQ+LL E + +EK +  ++ ++  E++E  EQ+I LV  + + ++  +  
Sbjct  135   SIIQMLGLISNQDLLKESITVEKERIRSQASKSEEDMEQTEQLIELVLCIREHMLKTEFL  194

Query  2193  ESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTN  2014
             E    + IP  F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH  
Sbjct  195   EVAKGISIPPYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLTHQE  254

Query  2013  LIPNYTVKALIANWCEMNNIKL  1948
             LIPNYTVKA+IA+W E N I L
Sbjct  255   LIPNYTVKAMIASWLEANRINL  276


 Score = 67.8 bits (164),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 92/174 (53%), Gaps = 10/174 (6%)
 Frame = -2

Query  1134  RIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLET  955
             RI  SN  AI  LVNLL       +++A +AL NLSI  +NK+ I  A A++ L+ +L+ 
Sbjct  555   RIGQSN-AAIQALVNLLGKGTFRGKKDAASALFNLSITHDNKARIVQAKAVKYLVELLDP  613

Query  954   GSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSIL  775
                E  + + A L +LS + + +  I R G +  LV+ +  G+ RGK++AA+ L  L + 
Sbjct  614   -DLEMVDKAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCL-  671

Query  774   HENKGR----IVQAGAVRHLVELMDPAAGMV-DKAVAVLSNLATIQEGRMSIGQ  628
               N  +    ++Q GA+  LV L         +KA  +LS+    ++ RM  G+
Sbjct  672   --NSPKFCTLVLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKGR  723



>ref|XP_006576940.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Glycine max]
Length=877

 Score =   355 bits (911),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 180/270 (67%), Positives = 220/270 (81%), Gaps = 0/270 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V +L+EDL+S S + Q  A  +LRL  KHNM+NRI +  CGAI  L++LL+SE   +QE
Sbjct  527   HVNELIEDLQSQSNETQTAAAEQLRLCTKHNMENRISVGRCGAIMPLLSLLYSERKIIQE  586

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN+ NK+ I  AGAIEPLI+VL+TG+  AKENSAA LFSLSVI++NK KI
Sbjct  587   HAVTALLNLSINEGNKALIMEAGAIEPLIHVLKTGNDGAKENSAAALFSLSVIDNNKAKI  646

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LV LL +GT RGKKD+ATALFNLSI HENK RIVQAGAV+ LV L+DP   M
Sbjct  647   GRSGAVKALVGLLASGTLRGKKDSATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKM  706

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGR+ I +EGGIP LVE+VE GS RGKENAA+ LLQLC ++ ++C
Sbjct  707   VDKAVALLANLSTIAEGRIEIAREGGIPSLVEIVESGSLRGKENAASILLQLCLHNQKFC  766

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQAL  427
              +VLQ GAVPPLVALSQSGTPRA+EK  ++
Sbjct  767   TLVLQEGAVPPLVALSQSGTPRAKEKENSV  796


 Score =   211 bits (538),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 188/309 (61%), Gaps = 7/309 (2%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L+N+IS F HL S + +    + K       +LK L+P+L  IVD +I  DE L + 
Sbjct  32    VKCLVNSISRFIHLVSCQAVKPMPLQKNCNNMVCVLKHLKPVLDDIVDFKIPFDENLHRE  91

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L   V+E RE  + W    S+++ VLQ+  L+ K++  S KI  ++V S   L   +
Sbjct  92    CEELDMRVNEAREFIEKWGPKMSRIHSVLQSGELLIKLQNSSYKICHMIVKS---LKGPA  148

Query  2502  SLT---SLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQEL  2332
             S+    +L+  + +++ +  E     I  A++N  +      DSL +I   L + SNQEL
Sbjct  149   SVLVSGNLQQYMQELQCLKKEPAMIYIEDALRNQRDNIEPCYDSLKEIIRLLMI-SNQEL  207

Query  2331  LIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCC  2152
             LIE +A+EK + NAE  +   +++ I QI+ LV  + D ++  ++ E  + V IP  F C
Sbjct  208   LIESIAVEKERSNAEVNKTKGDLDEINQIVNLVCSLRDYVMKFERPEVKSGVSIPPYFRC  267

Query  2151  PLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANW  1972
             PLSLELM+D VIVASGQTYER  I++W+D GLTVCP TRQ L HTNLIPNYTVKA+IANW
Sbjct  268   PLSLELMSDAVIVASGQTYERQSIQKWLDHGLTVCPNTRQILVHTNLIPNYTVKAMIANW  327

Query  1971  CEMNNIKLP  1945
             CE NN+KLP
Sbjct  328   CEENNVKLP  336



>ref|XP_006576941.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Glycine max]
Length=857

 Score =   354 bits (909),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 180/270 (67%), Positives = 220/270 (81%), Gaps = 0/270 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V +L+EDL+S S + Q  A  +LRL  KHNM+NRI +  CGAI  L++LL+SE   +QE
Sbjct  507   HVNELIEDLQSQSNETQTAAAEQLRLCTKHNMENRISVGRCGAIMPLLSLLYSERKIIQE  566

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN+ NK+ I  AGAIEPLI+VL+TG+  AKENSAA LFSLSVI++NK KI
Sbjct  567   HAVTALLNLSINEGNKALIMEAGAIEPLIHVLKTGNDGAKENSAAALFSLSVIDNNKAKI  626

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LV LL +GT RGKKD+ATALFNLSI HENK RIVQAGAV+ LV L+DP   M
Sbjct  627   GRSGAVKALVGLLASGTLRGKKDSATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKM  686

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGR+ I +EGGIP LVE+VE GS RGKENAA+ LLQLC ++ ++C
Sbjct  687   VDKAVALLANLSTIAEGRIEIAREGGIPSLVEIVESGSLRGKENAASILLQLCLHNQKFC  746

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQAL  427
              +VLQ GAVPPLVALSQSGTPRA+EK  ++
Sbjct  747   TLVLQEGAVPPLVALSQSGTPRAKEKENSV  776


 Score =   212 bits (540),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 188/309 (61%), Gaps = 7/309 (2%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L+N+IS F HL S + +    + K       +LK L+P+L  IVD +I  DE L + 
Sbjct  12    VKCLVNSISRFIHLVSCQAVKPMPLQKNCNNMVCVLKHLKPVLDDIVDFKIPFDENLHRE  71

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L   V+E RE  + W    S+++ VLQ+  L+ K++  S KI  ++V S   L   +
Sbjct  72    CEELDMRVNEAREFIEKWGPKMSRIHSVLQSGELLIKLQNSSYKICHMIVKS---LKGPA  128

Query  2502  SLT---SLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQEL  2332
             S+    +L+  + +++ +  E     I  A++N  +      DSL +I   L + SNQEL
Sbjct  129   SVLVSGNLQQYMQELQCLKKEPAMIYIEDALRNQRDNIEPCYDSLKEIIRLLMI-SNQEL  187

Query  2331  LIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCC  2152
             LIE +A+EK + NAE  +   +++ I QI+ LV  + D ++  ++ E  + V IP  F C
Sbjct  188   LIESIAVEKERSNAEVNKTKGDLDEINQIVNLVCSLRDYVMKFERPEVKSGVSIPPYFRC  247

Query  2151  PLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANW  1972
             PLSLELM+D VIVASGQTYER  I++W+D GLTVCP TRQ L HTNLIPNYTVKA+IANW
Sbjct  248   PLSLELMSDAVIVASGQTYERQSIQKWLDHGLTVCPNTRQILVHTNLIPNYTVKAMIANW  307

Query  1971  CEMNNIKLP  1945
             CE NN+KLP
Sbjct  308   CEENNVKLP  316



>ref|XP_006576942.1| PREDICTED: U-box domain-containing protein 3-like isoform X3 
[Glycine max]
Length=856

 Score =   354 bits (909),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 180/270 (67%), Positives = 220/270 (81%), Gaps = 0/270 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V +L+EDL+S S + Q  A  +LRL  KHNM+NRI +  CGAI  L++LL+SE   +QE
Sbjct  506   HVNELIEDLQSQSNETQTAAAEQLRLCTKHNMENRISVGRCGAIMPLLSLLYSERKIIQE  565

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN+ NK+ I  AGAIEPLI+VL+TG+  AKENSAA LFSLSVI++NK KI
Sbjct  566   HAVTALLNLSINEGNKALIMEAGAIEPLIHVLKTGNDGAKENSAAALFSLSVIDNNKAKI  625

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LV LL +GT RGKKD+ATALFNLSI HENK RIVQAGAV+ LV L+DP   M
Sbjct  626   GRSGAVKALVGLLASGTLRGKKDSATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKM  685

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGR+ I +EGGIP LVE+VE GS RGKENAA+ LLQLC ++ ++C
Sbjct  686   VDKAVALLANLSTIAEGRIEIAREGGIPSLVEIVESGSLRGKENAASILLQLCLHNQKFC  745

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQAL  427
              +VLQ GAVPPLVALSQSGTPRA+EK  ++
Sbjct  746   TLVLQEGAVPPLVALSQSGTPRAKEKENSV  775


 Score =   212 bits (540),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 188/309 (61%), Gaps = 7/309 (2%)
 Frame = -2

Query  2862  LKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDELLQKV  2683
             +K L+N+IS F HL S + +    + K       +LK L+P+L  IVD +I  DE L + 
Sbjct  11    VKCLVNSISRFIHLVSCQAVKPMPLQKNCNNMVCVLKHLKPVLDDIVDFKIPFDENLHRE  70

Query  2682  FSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWCLPAES  2503
                L   V+E RE  + W    S+++ VLQ+  L+ K++  S KI  ++V S   L   +
Sbjct  71    CEELDMRVNEAREFIEKWGPKMSRIHSVLQSGELLIKLQNSSYKICHMIVKS---LKGPA  127

Query  2502  SLT---SLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQEL  2332
             S+    +L+  + +++ +  E     I  A++N  +      DSL +I   L + SNQEL
Sbjct  128   SVLVSGNLQQYMQELQCLKKEPAMIYIEDALRNQRDNIEPCYDSLKEIIRLLMI-SNQEL  186

Query  2331  LIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADFCC  2152
             LIE +A+EK + NAE  +   +++ I QI+ LV  + D ++  ++ E  + V IP  F C
Sbjct  187   LIESIAVEKERSNAEVNKTKGDLDEINQIVNLVCSLRDYVMKFERPEVKSGVSIPPYFRC  246

Query  2151  PLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANW  1972
             PLSLELM+D VIVASGQTYER  I++W+D GLTVCP TRQ L HTNLIPNYTVKA+IANW
Sbjct  247   PLSLELMSDAVIVASGQTYERQSIQKWLDHGLTVCPNTRQILVHTNLIPNYTVKAMIANW  306

Query  1971  CEMNNIKLP  1945
             CE NN+KLP
Sbjct  307   CEENNVKLP  315



>ref|XP_002878000.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH54259.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=760

 Score =   352 bits (902),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 179/283 (63%), Positives = 229/283 (81%), Gaps = 1/283 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLK+ S   +  A AE+R L  ++++NR+ I  CGAI+ L++LL+SE+   QE+AV
Sbjct  476   KLVEDLKNGSNKVKTAAAAEIRHLTINSIENRVHIGRCGAITPLLSLLYSEEKLTQEHAV  535

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRS  868
             TALLNLSI++ NK+ I  AGAIEPL++VL TG+  AKENSAATLFSLSV++ N+ +IG+S
Sbjct  536   TALLNLSISELNKAMIVEAGAIEPLVHVLNTGNDRAKENSAATLFSLSVLQVNRERIGQS  595

Query  867   -GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
               A+Q+LV+LLG GT RGKKDAA+ALFNLSI H+NK RIVQA A+++LVEL+DP   MVD
Sbjct  596   NAAIQALVNLLGKGTFRGKKDAASALFNLSITHDNKARIVQAKAIKYLVELLDPDLEMVD  655

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ + EGR +I +EGGIP+LVE V+LGS RGKENAA+ LLQLC NS ++C +
Sbjct  656   KAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCLNSPKFCTL  715

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  716   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKG  758


 Score =   185 bits (470),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 186/315 (59%), Gaps = 8/315 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ +  + LLN+IS + HL + + I    +         +LKLL+P+L  +VD +I SD+
Sbjct  1     MDPVPFRCLLNSISRYLHLVACQTIRFIPIQTCIGNMVLLLKLLKPLLDEVVDCKIPSDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    L   +++ RE  + W    SK++ V Q E L+ KV+  SL+I  +L+     
Sbjct  61    CLYKGCEDLDSVINQAREFLEDWSPKLSKLFGVFQCEVLLGKVQTCSLEISRILLQLSQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSG---ASSDS--LTKIADCLS  2353
              P  SS+ S+E CV +I+S   E    T+T+ ++N +       AS D+  L  I   L 
Sbjct  121   SPETSSVQSVERCVQEIESFKQE---GTLTEHMENALRNQKDDIASLDNHHLQSIIQMLG  177

Query  2352  LKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQ  2173
             L SNQ+LL E +A+EK +  ++ ++  E++E  EQ+I LV  + + ++  +  E    + 
Sbjct  178   LISNQDLLKESIAVEKERIRSQASKSKEDMEQTEQLIELVLCIREHMLKTEFLEVAKGIS  237

Query  2172  IPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTV  1993
             IP  F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH  LIPNYTV
Sbjct  238   IPPYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLTHQELIPNYTV  297

Query  1992  KALIANWCEMNNIKL  1948
             KA+IA+W E N I L
Sbjct  298   KAMIASWLEANRINL  312


 Score = 68.9 bits (167),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 90/171 (53%), Gaps = 4/171 (2%)
 Frame = -2

Query  1134  RIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLET  955
             RI  SN  AI  LVNLL       +++A +AL NLSI  +NK+ I  A AI+ L+ +L+ 
Sbjct  591   RIGQSN-AAIQALVNLLGKGTFRGKKDAASALFNLSITHDNKARIVQAKAIKYLVELLDP  649

Query  954   GSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSIL  775
                E  + + A L +LS + + +  I R G +  LV+ +  G+ RGK++AA+ L  L + 
Sbjct  650   -DLEMVDKAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCLN  708

Query  774   HENKGRIV-QAGAVRHLVELMDPAAGMV-DKAVAVLSNLATIQEGRMSIGQ  628
                   +V Q GA+  LV L         +KA  +LS+    ++ RM  G+
Sbjct  709   SPKFCTLVLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKGR  759



>ref|NP_191039.2| U-box domain-containing protein 3 [Arabidopsis thaliana]
 sp|Q8GWV5.2|PUB3_ARATH RecName: Full=U-box domain-containing protein 3; AltName: Full=Plant 
U-box protein 3 [Arabidopsis thaliana]
 gb|AEE79287.1| U-box domain-containing protein 3 [Arabidopsis thaliana]
Length=760

 Score =   350 bits (899),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 179/283 (63%), Positives = 228/283 (81%), Gaps = 1/283 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLKS S   +  A AE+R L  ++++NR+ I  CGAI+ L++LL+SE+   QE+AV
Sbjct  476   KLVEDLKSGSNKVKTAAAAEIRHLTINSIENRVHIGRCGAITPLLSLLYSEEKLTQEHAV  535

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRS  868
             TALLNLSI++ NK+ I   GAIEPL++VL TG+  AKENSAA+LFSLSV++ N+ +IG+S
Sbjct  536   TALLNLSISELNKAMIVEVGAIEPLVHVLNTGNDRAKENSAASLFSLSVLQVNRERIGQS  595

Query  867   -GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
               A+Q+LV+LLG GT RGKKDAA+ALFNLSI H+NK RIVQA AV++LVEL+DP   MVD
Sbjct  596   NAAIQALVNLLGKGTFRGKKDAASALFNLSITHDNKARIVQAKAVKYLVELLDPDLEMVD  655

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ + EGR +I +EGGIP+LVE V+LGS RGKENAA+ LLQLC NS ++C +
Sbjct  656   KAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCLNSPKFCTL  715

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  716   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKG  758


 Score =   184 bits (468),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 122/312 (39%), Positives = 183/312 (59%), Gaps = 2/312 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ + ++ LLN+IS + HL + + I    +         +LKLL+P+L  +VD +I SD+
Sbjct  1     MDPVPVRCLLNSISRYLHLVACQTIRFNPIQTCIGNMVLLLKLLKPLLDEVVDCKIPSDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    L   V++ RE  + W    SK++ V Q E L+ KV+  SL+I  +L+     
Sbjct  61    CLYKGCEDLDSVVNQAREFLEDWSPKLSKLFGVFQCEVLLGKVQTCSLEISRILLQLSQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYE-LLSATITKAIKNHVEG-SGASSDSLTKIADCLSLKS  2344
              P  SS+ S+E CV + +S   E  L   +  A++N  +  +   ++ L  I   L L S
Sbjct  121   SPVTSSVQSVERCVQETESFKQEGTLMELMENALRNQKDDITSLDNNHLESIIQMLGLIS  180

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQ+LL E + +EK +  ++ ++  E++E  EQ+I LV  + + ++  +  E    + IP 
Sbjct  181   NQDLLKESITVEKERIRSQASKSEEDMEQTEQLIELVLCIREHMLKTEFLEVAKGISIPP  240

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
              F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH  LIPNYTVKA+
Sbjct  241   YFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLTHQELIPNYTVKAM  300

Query  1983  IANWCEMNNIKL  1948
             IA+W E N I L
Sbjct  301   IASWLEANRINL  312


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 90/171 (53%), Gaps = 4/171 (2%)
 Frame = -2

Query  1134  RIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLET  955
             RI  SN  AI  LVNLL       +++A +AL NLSI  +NK+ I  A A++ L+ +L+ 
Sbjct  591   RIGQSN-AAIQALVNLLGKGTFRGKKDAASALFNLSITHDNKARIVQAKAVKYLVELLDP  649

Query  954   GSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSIL  775
                E  + + A L +LS + + +  I R G +  LV+ +  G+ RGK++AA+ L  L + 
Sbjct  650   -DLEMVDKAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCLN  708

Query  774   HENKGRIV-QAGAVRHLVELMDPAAGMV-DKAVAVLSNLATIQEGRMSIGQ  628
                   +V Q GA+  LV L         +KA  +LS+    ++ RM  G+
Sbjct  709   SPKFCTLVLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKGR  759



>ref|XP_006403536.1| hypothetical protein EUTSA_v10010139mg [Eutrema salsugineum]
 gb|ESQ44989.1| hypothetical protein EUTSA_v10010139mg [Eutrema salsugineum]
Length=765

 Score =   350 bits (898),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 183/286 (64%), Positives = 229/286 (80%), Gaps = 1/286 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLKS S   +  A AE+R L  +N++NR+ I  CGAI+ L++LL+SE+   QE+AV
Sbjct  473   KLVEDLKSGSTKAKTAAAAEIRRLTINNIENRVHIGRCGAITPLLSLLYSEENLTQEHAV  532

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRS  868
             TA LNLSI++ NK+ IA AGAIEPL++VL TG+  AKENSAATLFSLSV++ N+ +IG+S
Sbjct  533   TAFLNLSISELNKAIIAEAGAIEPLVHVLNTGNDRAKENSAATLFSLSVLQVNRERIGQS  592

Query  867   -GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
               A+Q+LV+LLG GT RGKKDAA+ALFNLSI HENK RIVQA AV++LVEL+DP   MVD
Sbjct  593   NAAIQALVNLLGKGTFRGKKDAASALFNLSITHENKARIVQAKAVKYLVELLDPGFEMVD  652

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ + EGR +I +EGGIP+LVE V+ GS RGKENAA+ LLQLC NS ++C +
Sbjct  653   KAVALLANLSGVGEGRQAIVREGGIPLLVETVDSGSQRGKENAASVLLQLCLNSPKFCTL  712

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG*YC  373
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G  C
Sbjct  713   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDVRMKKGFGC  758


 Score =   177 bits (448),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 118/312 (38%), Positives = 182/312 (58%), Gaps = 5/312 (2%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ + ++ LLN+IS + HL + +      +         +LKLL+P L  +VD +I SD+
Sbjct  1     MDPVPVRCLLNSISRYLHLVACQTRRFSPIQTCIGNVVHLLKLLKPFLDEVVDCKIPSDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L +V   L   V++ RE  + W    SK++ V Q E L+ KV+  SL+I  +LV     
Sbjct  61    CLNRVCEDLDSVVNQAREFLEDWSPKLSKLFGVYQCEVLLEKVQTCSLEIGRILVQ---L  117

Query  2517  LPAESSLTSLENCVLKIKSMDY-ELLSATITKAIKNHVEGSGASSD-SLTKIADCLSLKS  2344
               + S +TS    V +I+S      L+  +  A++N  +      +  L  I   + L S
Sbjct  118   SQSSSPVTSSVQGVEEIESFKQGNRLTDHMENALRNRKDDIVPLDNLHLDNIIQMMGLIS  177

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQ+LL E +A+EK +  ++ ++  E++E I+Q+I LV+ + + ++  +  E    + +P 
Sbjct  178   NQDLLKESIAVEKERIRSQASKSKEKMEQIDQLIDLVSCIREHMLKTEFLEVAKGISVPP  237

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
              F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH  LIPNYTVKA+
Sbjct  238   YFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLGVCPRTRQVLTHQELIPNYTVKAM  297

Query  1983  IANWCEMNNIKL  1948
             IA+W E N+I L
Sbjct  298   IASWLEANSINL  309



>gb|KHN10747.1| U-box domain-containing protein 3 [Glycine soja]
Length=824

 Score =   352 bits (902),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 179/270 (66%), Positives = 218/270 (81%), Gaps = 0/270 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
              V +L+EDL+S S + Q  A  +LRL  KHNM+NRI +  CGAI  L++LL+SE    QE
Sbjct  474   HVNELIEDLQSQSNETQTAAAEQLRLCTKHNMENRISVGRCGAIMPLLSLLYSERKITQE  533

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             +AVTALLNLSIN+ NK+ I  AGAIEPLI+VL+TG+  AKENSAA LF LSVI++NK KI
Sbjct  534   HAVTALLNLSINEGNKALIMEAGAIEPLIHVLKTGNDGAKENSAAALFGLSVIDNNKAKI  593

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGM  697
             GRSGAV++LV LL +GT RGKKD+ATALFNLSI HENK RIVQAGAV+ LV L+DP   M
Sbjct  594   GRSGAVKALVGLLASGTLRGKKDSATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKM  653

Query  696   VDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYC  517
             VDKAVA+L+NL+TI EGR+ I +EGGIP LVE+VE GS RGKENAA+ LLQLC ++ ++C
Sbjct  654   VDKAVALLANLSTIAEGRIEIAREGGIPSLVEIVESGSLRGKENAASILLQLCLHNQKFC  713

Query  516   NMVLQHGAVPPLVALSQSGTPRAREKAQAL  427
              +VLQ GAVPPLVALSQSGTPRA+EK  ++
Sbjct  714   TLVLQEGAVPPLVALSQSGTPRAKEKENSV  743


 Score =   200 bits (508),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 172/275 (63%), Gaps = 7/275 (3%)
 Frame = -2

Query  2760  ILKLLQPILSGIVDAEIASDELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESL  2581
             +LK L+P+L  IVD +I  DE L +    L   V+E RE  + W    S+++ VLQ+  L
Sbjct  13    VLKHLKPVLDDIVDFKIPFDENLHRECEELDMRVNEAREFIEKWGPKMSRIHSVLQSGEL  72

Query  2580  IAKVRAFSLKIVELLVSSDWCLPAESSLT---SLENCVLKIKSMDYELLSATITKAIKNH  2410
             + K++  S KI  ++V S   L   +S+    +L+  + +++ +  E     I  A++N 
Sbjct  73    LIKLQNSSYKICHMIVKS---LKGPASVLVSGNLQQYMQELQCLKKEPAMIYIEDALRNQ  129

Query  2409  VEGSGASSDSLTKIADCLSLKSNQELLIELValeklkenaeqaekneevEYIEQIIALVT  2230
              +      DSL +I   L + SNQELLIE +A+EK + NAE  +   +++ I QI+ LV 
Sbjct  130   RDNIEPCYDSLKEIIRLLMI-SNQELLIESIAVEKERSNAEVNKTKGDLDEINQIVNLVC  188

Query  2229  HMHDCLIMMKQSESCTSVQIPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTV  2050
              + D ++  ++ E  + V IP  F CPLSLELM+D VIVASGQTYER  I++W+D GLTV
Sbjct  189   SLRDYVMKFERPEVKSGVSIPPYFRCPLSLELMSDAVIVASGQTYERQSIQKWLDHGLTV  248

Query  2049  CPKTRQTLTHTNLIPNYTVKALIANWCEMNNIKLP  1945
             CP TRQ L HTNLIPNYTVKA+IANWCE NN+KLP
Sbjct  249   CPNTRQILVHTNLIPNYTVKAMIANWCEENNVKLP  283



>dbj|BAC43212.1| unknown protein [Arabidopsis thaliana]
Length=760

 Score =   350 bits (897),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 178/283 (63%), Positives = 228/283 (81%), Gaps = 1/283 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLKS S   +  A AE+R L  ++++NR+ I  CGAI+ L++LL+SE+   QE+AV
Sbjct  476   KLVEDLKSGSNKVKTAAAAEIRHLTINSIENRVHIGRCGAITPLLSLLYSEEKLTQEHAV  535

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRS  868
             TALLNLSI++ NK+ I   GA+EPL++VL TG+  AKENSAA+LFSLSV++ N+ +IG+S
Sbjct  536   TALLNLSISELNKAMIVEVGAVEPLVHVLNTGNDRAKENSAASLFSLSVLQVNRERIGQS  595

Query  867   -GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
               A+Q+LV+LLG GT RGKKDAA+ALFNLSI H+NK RIVQA AV++LVEL+DP   MVD
Sbjct  596   NAAIQALVNLLGKGTFRGKKDAASALFNLSITHDNKARIVQAKAVKYLVELLDPDLEMVD  655

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ + EGR +I +EGGIP+LVE V+LGS RGKENAA+ LLQLC NS ++C +
Sbjct  656   KAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCLNSPKFCTL  715

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  716   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKG  758


 Score =   184 bits (467),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 122/312 (39%), Positives = 183/312 (59%), Gaps = 2/312 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ + ++ LLN+IS + HL + + I    +         +LKLL+P+L  +VD +I SD+
Sbjct  1     MDPVPVRCLLNSISRYLHLVACQTIRFNPIQTCIGNMVLLLKLLKPLLDEVVDCKIPSDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    L   V++ RE  + W    SK++ V Q E L+ KV+  SL+I  +L+     
Sbjct  61    CLYKGREDLDSVVNQAREFLEDWSPKLSKLFGVFQCEVLLGKVQTCSLEISRILLQLSQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYE-LLSATITKAIKNHVEG-SGASSDSLTKIADCLSLKS  2344
              P  SS+ S+E CV + +S   E  L   +  A++N  +  +   ++ L  I   L L S
Sbjct  121   SPVTSSVQSVERCVQETESFKQEGTLMELMENALRNQKDDITSLDNNHLESIIQMLGLIS  180

Query  2343  NQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPA  2164
             NQ+LL E + +EK +  ++ ++  E++E  EQ+I LV  + + ++  +  E    + IP 
Sbjct  181   NQDLLKESITVEKERIRSQASKSEEDMEQTEQLIELVLCIREHMLKTEFLEVAKGISIPP  240

Query  2163  DFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKAL  1984
              F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH  LIPNYTVKA+
Sbjct  241   YFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLTHQELIPNYTVKAM  300

Query  1983  IANWCEMNNIKL  1948
             IA+W E N I L
Sbjct  301   IASWLEANRINL  312


 Score = 68.2 bits (165),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 90/171 (53%), Gaps = 4/171 (2%)
 Frame = -2

Query  1134  RIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLET  955
             RI  SN  AI  LVNLL       +++A +AL NLSI  +NK+ I  A A++ L+ +L+ 
Sbjct  591   RIGQSN-AAIQALVNLLGKGTFRGKKDAASALFNLSITHDNKARIVQAKAVKYLVELLDP  649

Query  954   GSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSIL  775
                E  + + A L +LS + + +  I R G +  LV+ +  G+ RGK++AA+ L  L + 
Sbjct  650   -DLEMVDKAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCLN  708

Query  774   HENKGRIV-QAGAVRHLVELMDPAAGMV-DKAVAVLSNLATIQEGRMSIGQ  628
                   +V Q GA+  LV L         +KA  +LS+    ++ RM  G+
Sbjct  709   SPKFCTLVLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKGR  759



>ref|XP_006403537.1| hypothetical protein EUTSA_v10010139mg [Eutrema salsugineum]
 gb|ESQ44990.1| hypothetical protein EUTSA_v10010139mg [Eutrema salsugineum]
Length=769

 Score =   350 bits (898),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 183/286 (64%), Positives = 229/286 (80%), Gaps = 1/286 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLKS S   +  A AE+R L  +N++NR+ I  CGAI+ L++LL+SE+   QE+AV
Sbjct  477   KLVEDLKSGSTKAKTAAAAEIRRLTINNIENRVHIGRCGAITPLLSLLYSEENLTQEHAV  536

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRS  868
             TA LNLSI++ NK+ IA AGAIEPL++VL TG+  AKENSAATLFSLSV++ N+ +IG+S
Sbjct  537   TAFLNLSISELNKAIIAEAGAIEPLVHVLNTGNDRAKENSAATLFSLSVLQVNRERIGQS  596

Query  867   -GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
               A+Q+LV+LLG GT RGKKDAA+ALFNLSI HENK RIVQA AV++LVEL+DP   MVD
Sbjct  597   NAAIQALVNLLGKGTFRGKKDAASALFNLSITHENKARIVQAKAVKYLVELLDPGFEMVD  656

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ + EGR +I +EGGIP+LVE V+ GS RGKENAA+ LLQLC NS ++C +
Sbjct  657   KAVALLANLSGVGEGRQAIVREGGIPLLVETVDSGSQRGKENAASVLLQLCLNSPKFCTL  716

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG*YC  373
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G  C
Sbjct  717   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDVRMKKGFGC  762


 Score =   184 bits (468),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 121/313 (39%), Positives = 185/313 (59%), Gaps = 3/313 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ + ++ LLN+IS + HL + +      +         +LKLL+P L  +VD +I SD+
Sbjct  1     MDPVPVRCLLNSISRYLHLVACQTRRFSPIQTCIGNVVHLLKLLKPFLDEVVDCKIPSDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVS-SDW  2521
              L +V   L   V++ RE  + W    SK++ V Q E L+ KV+  SL+I  +LV  S  
Sbjct  61    CLNRVCEDLDSVVNQAREFLEDWSPKLSKLFGVYQCEVLLEKVQTCSLEIGRILVQLSQS  120

Query  2520  CLPAESSLTSLENCVLKIKSMDY-ELLSATITKAIKNHVEGSGASSD-SLTKIADCLSLK  2347
               P  SS+  +E CV +I+S      L+  +  A++N  +      +  L  I   + L 
Sbjct  121   SSPVTSSVQGVERCVQEIESFKQGNRLTDHMENALRNRKDDIVPLDNLHLDNIIQMMGLI  180

Query  2346  SNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIP  2167
             SNQ+LL E +A+EK +  ++ ++  E++E I+Q+I LV+ + + ++  +  E    + +P
Sbjct  181   SNQDLLKESIAVEKERIRSQASKSKEKMEQIDQLIDLVSCIREHMLKTEFLEVAKGISVP  240

Query  2166  ADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKA  1987
               F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH  LIPNYTVKA
Sbjct  241   PYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLGVCPRTRQVLTHQELIPNYTVKA  300

Query  1986  LIANWCEMNNIKL  1948
             +IA+W E N+I L
Sbjct  301   MIASWLEANSINL  313



>ref|XP_006403535.1| hypothetical protein EUTSA_v10010139mg [Eutrema salsugineum]
 gb|ESQ44988.1| hypothetical protein EUTSA_v10010139mg [Eutrema salsugineum]
Length=761

 Score =   349 bits (895),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 182/283 (64%), Positives = 228/283 (81%), Gaps = 1/283 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLKS S   +  A AE+R L  +N++NR+ I  CGAI+ L++LL+SE+   QE+AV
Sbjct  477   KLVEDLKSGSTKAKTAAAAEIRRLTINNIENRVHIGRCGAITPLLSLLYSEENLTQEHAV  536

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRS  868
             TA LNLSI++ NK+ IA AGAIEPL++VL TG+  AKENSAATLFSLSV++ N+ +IG+S
Sbjct  537   TAFLNLSISELNKAIIAEAGAIEPLVHVLNTGNDRAKENSAATLFSLSVLQVNRERIGQS  596

Query  867   -GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
               A+Q+LV+LLG GT RGKKDAA+ALFNLSI HENK RIVQA AV++LVEL+DP   MVD
Sbjct  597   NAAIQALVNLLGKGTFRGKKDAASALFNLSITHENKARIVQAKAVKYLVELLDPGFEMVD  656

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ + EGR +I +EGGIP+LVE V+ GS RGKENAA+ LLQLC NS ++C +
Sbjct  657   KAVALLANLSGVGEGRQAIVREGGIPLLVETVDSGSQRGKENAASVLLQLCLNSPKFCTL  716

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  717   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDVRMKKG  759


 Score =   184 bits (468),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 121/313 (39%), Positives = 185/313 (59%), Gaps = 3/313 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ + ++ LLN+IS + HL + +      +         +LKLL+P L  +VD +I SD+
Sbjct  1     MDPVPVRCLLNSISRYLHLVACQTRRFSPIQTCIGNVVHLLKLLKPFLDEVVDCKIPSDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVS-SDW  2521
              L +V   L   V++ RE  + W    SK++ V Q E L+ KV+  SL+I  +LV  S  
Sbjct  61    CLNRVCEDLDSVVNQAREFLEDWSPKLSKLFGVYQCEVLLEKVQTCSLEIGRILVQLSQS  120

Query  2520  CLPAESSLTSLENCVLKIKSMDY-ELLSATITKAIKNHVEGSGASSD-SLTKIADCLSLK  2347
               P  SS+  +E CV +I+S      L+  +  A++N  +      +  L  I   + L 
Sbjct  121   SSPVTSSVQGVERCVQEIESFKQGNRLTDHMENALRNRKDDIVPLDNLHLDNIIQMMGLI  180

Query  2346  SNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIP  2167
             SNQ+LL E +A+EK +  ++ ++  E++E I+Q+I LV+ + + ++  +  E    + +P
Sbjct  181   SNQDLLKESIAVEKERIRSQASKSKEKMEQIDQLIDLVSCIREHMLKTEFLEVAKGISVP  240

Query  2166  ADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKA  1987
               F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH  LIPNYTVKA
Sbjct  241   PYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLGVCPRTRQVLTHQELIPNYTVKA  300

Query  1986  LIANWCEMNNIKL  1948
             +IA+W E N+I L
Sbjct  301   MIASWLEANSINL  313


 Score = 69.3 bits (168),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 91/171 (53%), Gaps = 4/171 (2%)
 Frame = -2

Query  1134  RIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLET  955
             RI  SN  AI  LVNLL       +++A +AL NLSI   NK+ I  A A++ L+ +L+ 
Sbjct  592   RIGQSN-AAIQALVNLLGKGTFRGKKDAASALFNLSITHENKARIVQAKAVKYLVELLDP  650

Query  954   GSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSIL  775
             G  E  + + A L +LS + + +  I R G +  LV+ + +G+ RGK++AA+ L  L + 
Sbjct  651   GF-EMVDKAVALLANLSGVGEGRQAIVREGGIPLLVETVDSGSQRGKENAASVLLQLCLN  709

Query  774   HENKGRIV-QAGAVRHLVELMDPAAGMV-DKAVAVLSNLATIQEGRMSIGQ  628
                   +V Q GA+  LV L         +KA  +LS+    ++ RM  G+
Sbjct  710   SPKFCTLVLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDVRMKKGR  760



>ref|XP_010427195.1| PREDICTED: U-box domain-containing protein 3 [Camelina sativa]
 ref|XP_010427196.1| PREDICTED: U-box domain-containing protein 3 [Camelina sativa]
Length=757

 Score =   349 bits (895),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 180/283 (64%), Positives = 225/283 (80%), Gaps = 1/283 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLKS S   +  A AE+R L   +++NR+ I  CGAI+ L++LL+SE+   QE+AV
Sbjct  473   KLVEDLKSGSNKVKTAAAAEIRHLTISSIENRVHIGRCGAITPLLSLLYSEEKLTQEHAV  532

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRS  868
             TALLNLSI++ NKS I  AGA+EPL++VL TG+  A+ENSAATLFSLSV+  N+ +IG+S
Sbjct  533   TALLNLSISELNKSTIVEAGALEPLVHVLNTGNDSARENSAATLFSLSVLPVNRERIGQS  592

Query  867   -GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
               A+ +LV LLG GT RGKKDAA+ALFNLSI HENK RIVQA AV++LVEL+DP   MVD
Sbjct  593   NAAIHALVTLLGKGTFRGKKDAASALFNLSITHENKARIVQAKAVKYLVELLDPDLEMVD  652

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ + EGR +I +EGGIP+LVE V+LGS RGKENAA+ LLQLC NS ++C +
Sbjct  653   KAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCLNSPKFCTL  712

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  713   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKG  755


 Score =   184 bits (466),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 125/315 (40%), Positives = 182/315 (58%), Gaps = 8/315 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ + ++ LLN+IS + HL + + I    +         +LKLL+P+L  +VD +I SD+
Sbjct  1     MDPVPVRCLLNSISRYLHLVACQTIRFNPIQTCIGNMVLLLKLLKPLLDEVVDCKIPSDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    L   V++ RE  + W    SK++ V Q E L+ KV+  SL+I  +L+     
Sbjct  61    CLNKGCEDLDAVVNQAREFLEDWSPKLSKLFGVFQCEVLLGKVQICSLEISRILLQLSQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTK-----IADCLS  2353
              P  SS+  +E CV +I+S   E    T+T+ ++N +        SL       I   L 
Sbjct  121   SPETSSVQVVERCVQEIESFKQE---GTLTELMENALRSQKEDITSLDNHHLESIIQMLG  177

Query  2352  LKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQ  2173
             L SNQ+LL E +A+EK +  ++ ++  E VE IEQ+I LV  + + ++  +  E    + 
Sbjct  178   LISNQDLLKESIAVEKERIRSQASKSKENVEQIEQLIELVLCIREHMLKTEFLEVAKGIS  237

Query  2172  IPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTV  1993
             IP  F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH  LIPNYTV
Sbjct  238   IPPYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLTHQELIPNYTV  297

Query  1992  KALIANWCEMNNIKL  1948
             KA+I +W E N I L
Sbjct  298   KAMITSWLEANRINL  312



>ref|XP_010504303.1| PREDICTED: U-box domain-containing protein 3-like [Camelina sativa]
 ref|XP_010504304.1| PREDICTED: U-box domain-containing protein 3-like [Camelina sativa]
Length=752

 Score =   348 bits (894),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 181/283 (64%), Positives = 225/283 (80%), Gaps = 1/283 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLKS S   +  A AE+R L   +++NR+ I  CGAI+ L++LL+SE+   QE+AV
Sbjct  468   KLVEDLKSGSNKVKTAAAAEIRHLTISSIENRVHIGRCGAITPLLSLLYSEEKLTQEHAV  527

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRS  868
             TALLNLSI++ NK+ I  AGA EPL++VL TG+  AKENSAATLFSLSV+  N+ +IG+S
Sbjct  528   TALLNLSISELNKATIVEAGASEPLVHVLNTGNDRAKENSAATLFSLSVLPVNRERIGQS  587

Query  867   -GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
               A+ +LV+LLG GT RGKKDAA+ALFNLSI HENK RIVQA AV++LVEL+DP   MVD
Sbjct  588   NAAIHALVNLLGKGTFRGKKDAASALFNLSITHENKARIVQAKAVKYLVELLDPDLEMVD  647

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ I EGR +I +EGGIP+LVE V+LGS RGKENAA+ LLQLC NS ++C +
Sbjct  648   KAVALLANLSAIGEGRQAILREGGIPLLVETVDLGSQRGKENAASVLLQLCLNSPKFCTL  707

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  708   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKG  750


 Score =   186 bits (472),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/315 (40%), Positives = 185/315 (59%), Gaps = 8/315 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ + ++ LLN+IS + HL + + I    +         +LKLL+P+L  +VD +I SD+
Sbjct  1     MDPVPVRCLLNSISRYLHLVACQTIRFNPIQTCIGNMVLLLKLLKPLLDEVVDCKIPSDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    L   V++ REL + W    SK++ V Q E L+ KV+  SL+I  +L+     
Sbjct  61    CLNKGCEDLDAVVNQARELLEDWSPKLSKLFGVFQCEVLLGKVQTCSLEISRILLQLSQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEG-----SGASSDSLTKIADCLS  2353
              P  SS+  +E CV +I+S   E    T+T+ ++N ++      +   +  L  I   L 
Sbjct  121   SPETSSVQVVERCVQEIESFKQE---GTLTELMENALQNQKDDITSLDNHHLESIIHMLG  177

Query  2352  LKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQ  2173
             L SNQ+LL E +A+EK +  ++ ++  E VE IEQ+I LV  + + ++  +  E    + 
Sbjct  178   LISNQDLLKESIAVEKERVRSQASKSKENVEQIEQLIELVLCIREHMLTTEFLEVAKGIS  237

Query  2172  IPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTV  1993
             IP  F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH  LIPNYTV
Sbjct  238   IPPYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLTHQELIPNYTV  297

Query  1992  KALIANWCEMNNIKL  1948
             KA+I +W E N I L
Sbjct  298   KAMITSWLEANRINL  312



>emb|CDM85478.1| unnamed protein product [Triticum aestivum]
Length=565

 Score =   340 bits (872),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 183/290 (63%), Positives = 223/290 (77%), Gaps = 34/290 (12%)
 Frame = -2

Query  1353  VGTR---LRPPAIWRRPSERLVSRIVSSPTVETRADLAEVKEQVRKLVEDLKSTSVDQQR  1183
             VG R   +RP A     S+R   RI+SS +++++ DL+ ++ Q+        ST+     
Sbjct  247   VGMREQFIRPQA-----SDRGFPRIISSSSMDSQGDLSAIENQL--------STT-----  288

Query  1182  IATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAVTALLNLSINDNNKSA  1003
                          M+NRIVI++CGAI+LLV LLHS D ++QENAVT+LLNLSI+DNNK A
Sbjct  289   -------------MENRIVIADCGAINLLVGLLHSPDAKIQENAVTSLLNLSISDNNKIA  335

Query  1002  IANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRSGAVQSLVDLLGNGTP  823
             I NA AI+PLI+VLETG+PEAKENSAATLFSL + E+NK+ +GRSGA++SLVDLL NGTP
Sbjct  336   IVNAYAIDPLIHVLETGNPEAKENSAATLFSLCITEENKVSVGRSGAIKSLVDLLRNGTP  395

Query  822   RGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVDKAVAVLSNLATIQEGR  643
             RGKKDAA ALFNLSIL ENKGRIVQA AV+HLV+LMDPAAGMVDKAV VL+NLA I EGR
Sbjct  396   RGKKDAAHALFNLSILDENKGRIVQADAVKHLVKLMDPAAGMVDKAVVVLANLALIAEGR  455

Query  642   MSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNMVLQHGA  493
              +IGQ  GIP LV+VVELGSARG+ENA AALLQLC N++R C++VLQ GA
Sbjct  456   TAIGQARGIPALVDVVELGSARGEENAVAALLQLCKNNNRSCSIVLQEGA  505



>ref|XP_010670749.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=567

 Score =   339 bits (870),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 223/289 (77%), Gaps = 1/289 (0%)
 Frame = -2

Query  1266  TRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNL  1087
              ++++  +  +V+ LVE+LKS S +  R AT +LRL  + NMDNRI+I+  G I L++NL
Sbjct  273   VKSNIVGLDAKVKILVENLKSKSNESLREATDQLRLFVQQNMDNRILITYFGGIRLVINL  332

Query  1086  LHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSL  907
             L+S D  +QEN+VT+LL ++IN++N+ AI N  AIEPLIYVL  G+PEA+ENSAATLF L
Sbjct  333   LYSTDPNIQENSVTSLLYMAINNDNRVAITNEDAIEPLIYVLRVGTPEARENSAATLFYL  392

Query  906   SVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHL  727
             S+I +NK++IGRSGA   LV+LL  GT +GK +A  ALFNLSI +EN+ RIVQA  VR L
Sbjct  393   SMIHENKLRIGRSGATVPLVELLRKGTVQGKNNAVIALFNLSISNENRIRIVQADGVRFL  452

Query  726   VELM-DPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAAL  550
             +EL+ DP AG+VDKAVAVL+NL  I EGR +IGQ GGIP+LV ++ELGS R KE AA+AL
Sbjct  453   LELVNDPVAGLVDKAVAVLANLIKIFEGRTAIGQAGGIPVLVNILELGSTRAKETAASAL  512

Query  549   LQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQR  403
             L+LCT S  YC +  Q   +PPL ALS+SGTPRA++KAQ+LLSYFR+Q+
Sbjct  513   LRLCTYSYEYCTVAYQEAVIPPLEALSRSGTPRAKKKAQSLLSYFRSQQ  561


 Score =   230 bits (586),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 142/316 (45%), Positives = 186/316 (59%), Gaps = 41/316 (13%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+LL + LL +IS F  LS+ +N  SE V K YQ T +ILK L+ I    +D  IASD+
Sbjct  1     MEVLLWRNLLRHISLFCSLSAHDNFGSEPVQKCYQITVEILKPLKSIAEISIDTSIASDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L +    L  S++E   LF+ W  L+S++Y                             
Sbjct  61    QLSEALEQLICSIEESTYLFENWHPLASRIYL----------------------------  92

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
                         C+   K+M  E     I++A+K      G     L ++ +CL L+SNQ
Sbjct  93    -----------RCIDNAKNMGCESTFTFISEAMKEVSSSHGELR--LAELPECLDLRSNQ  139

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ++LIE VALEKLKENAE    + +  YI+Q I L+T MH  L++++QS+      IPADF
Sbjct  140   DILIEAVALEKLKENAELTGNDAKTGYIQQFITLLTCMHGRLLVLEQSKIGIPKSIPADF  199

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLE+M DPVIV+SG+TYER +IR+W+D GLTVCP TRQ L H NLIPNYT KALIA
Sbjct  200   ICPLSLEIMRDPVIVSSGKTYERAYIRQWLDRGLTVCPITRQMLLHLNLIPNYTCKALIA  259

Query  1977  NWCEMNNIKLPDPIKS  1930
             NWCEMN +KLPDP+KS
Sbjct  260   NWCEMNKVKLPDPVKS  275



>emb|CDX73449.1| BnaC08g25540D [Brassica napus]
Length=704

 Score =   343 bits (880),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 174/283 (61%), Positives = 223/283 (79%), Gaps = 1/283 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLK+ S  ++  A AE+R L  ++++NR+ I  CGAI+ L++LL+SE+   QE AV
Sbjct  420   KLVEDLKTGSNKEKTAAAAEIRRLTINSVENRVHIGRCGAITPLLSLLYSEEKLTQEQAV  479

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGR-  871
             TALLNLSI++ NK+ I  AGAIEPL++VL TG+   KENSAATLFSLSV++ N+ +IG+ 
Sbjct  480   TALLNLSISEVNKAMIVEAGAIEPLVHVLNTGNDRTKENSAATLFSLSVVQVNRERIGQC  539

Query  870   SGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
             + A+ +LV LLG GT RGKKDAA+ALFNLSI HENK RIVQA AV++LVE++DP   MVD
Sbjct  540   NAAIHALVSLLGKGTLRGKKDAASALFNLSITHENKARIVQAKAVKYLVEMLDPGLEMVD  599

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ + EGR  I + GG+P+LVE V+ GS RGKENAA+ LLQLC NS ++C +
Sbjct  600   KAVALLANLSGVGEGRQEIVRGGGVPLLVETVDSGSGRGKENAASVLLQLCLNSPKFCTL  659

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  660   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRGARMKKG  702


 Score =   176 bits (446),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 167/311 (54%), Gaps = 21/311 (7%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIA-SD  2701
             M+ + ++ LLN+IS + HL + + I    +         +L LL+P L  +VD +    D
Sbjct  1     MDPVPVRCLLNSISRYLHLVACQTIRYNPIQTRIGNVVHLLNLLKPFLDEVVDCKTPPDD  60

Query  2700  ELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             + L      L   V++ RE  +      SK++ V   E L+ KV+  SLKI  +L+    
Sbjct  61    DCLNSACEDLDSVVNQAREFLEDCSPKLSKLFGVFHCELLLEKVQTCSLKITGILLQLSQ  120

Query  2520  CLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSN  2341
                A SS+  +E C+ +I+    E    T+T+ I N +      +D L  I   + L SN
Sbjct  121   ---ASSSVQGVERCMEEIECFKQE---RTLTEHINNALRNQTDDNDDLDSIIQMIGLVSN  174

Query  2340  QELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPAD  2161
             Q+LL E +A+EK +              ++Q+I LV+ + + ++  +  E    V  P  
Sbjct  175   QDLLKESIAVEKEQ--------------MDQLIDLVSCIREHMLKTEFLEVAKGVSTPPY  220

Query  2160  FCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALI  1981
             F CPLS ELM DPVIVASGQT++R  I+ W+D GL VCP+TRQ L+H  LIPNYTVKA+I
Sbjct  221   FRCPLSTELMVDPVIVASGQTFDRTSIKEWLDNGLAVCPRTRQVLSHQELIPNYTVKAMI  280

Query  1980  ANWCEMNNIKL  1948
              +W E NNI L
Sbjct  281   ESWLEANNITL  291



>ref|XP_010670744.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010670745.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010670746.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010670747.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010670748.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=606

 Score =   340 bits (871),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 223/289 (77%), Gaps = 1/289 (0%)
 Frame = -2

Query  1266  TRADLAEVKEQVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNL  1087
              ++++  +  +V+ LVE+LKS S +  R AT +LRL  + NMDNRI+I+  G I L++NL
Sbjct  312   VKSNIVGLDAKVKILVENLKSKSNESLREATDQLRLFVQQNMDNRILITYFGGIRLVINL  371

Query  1086  LHSEDMEVQENAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSL  907
             L+S D  +QEN+VT+LL ++IN++N+ AI N  AIEPLIYVL  G+PEA+ENSAATLF L
Sbjct  372   LYSTDPNIQENSVTSLLYMAINNDNRVAITNEDAIEPLIYVLRVGTPEARENSAATLFYL  431

Query  906   SVIEDNKIKIGRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHL  727
             S+I +NK++IGRSGA   LV+LL  GT +GK +A  ALFNLSI +EN+ RIVQA  VR L
Sbjct  432   SMIHENKLRIGRSGATVPLVELLRKGTVQGKNNAVIALFNLSISNENRIRIVQADGVRFL  491

Query  726   VELM-DPAAGMVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAAL  550
             +EL+ DP AG+VDKAVAVL+NL  I EGR +IGQ GGIP+LV ++ELGS R KE AA+AL
Sbjct  492   LELVNDPVAGLVDKAVAVLANLIKIFEGRTAIGQAGGIPVLVNILELGSTRAKETAASAL  551

Query  549   LQLCTNSSRYCNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQR  403
             L+LCT S  YC +  Q   +PPL ALS+SGTPRA++KAQ+LLSYFR+Q+
Sbjct  552   LRLCTYSYEYCTVAYQEAVIPPLEALSRSGTPRAKKKAQSLLSYFRSQQ  600


 Score =   262 bits (670),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 207/316 (66%), Gaps = 2/316 (1%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             ME+LL + LL +IS F  LS+ +N  SE V K YQ T +ILK L+ I    +D  IASD+
Sbjct  1     MEVLLWRNLLRHISLFCSLSAHDNFGSEPVQKCYQITVEILKPLKSIAEISIDTSIASDD  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L +    L  S++E   LF+ W  L+S++Y V+QA+ L+ +++   L+IV LL      
Sbjct  61    QLSEALEQLICSIEESTYLFENWHPLASRIYLVIQADLLVKRLQTSILEIVRLLRDFPLS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSNQ  2338
             +  E +   LE C+   K+M  E     I++A+K      G     L ++ +CL L+SNQ
Sbjct  121   ISTELNPRYLERCIDNAKNMGCESTFTFISEAMKEVSSSHGELR--LAELPECLDLRSNQ  178

Query  2337  ELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPADF  2158
             ++LIE VALEKLKENAE    + +  YI+Q I L+T MH  L++++QS+      IPADF
Sbjct  179   DILIEAVALEKLKENAELTGNDAKTGYIQQFITLLTCMHGRLLVLEQSKIGIPKSIPADF  238

Query  2157  CCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIA  1978
              CPLSLE+M DPVIV+SG+TYER +IR+W+D GLTVCP TRQ L H NLIPNYT KALIA
Sbjct  239   ICPLSLEIMRDPVIVSSGKTYERAYIRQWLDRGLTVCPITRQMLLHLNLIPNYTCKALIA  298

Query  1977  NWCEMNNIKLPDPIKS  1930
             NWCEMN +KLPDP+KS
Sbjct  299   NWCEMNKVKLPDPVKS  314



>ref|XP_010516017.1| PREDICTED: U-box domain-containing protein 3-like [Camelina sativa]
Length=752

 Score =   343 bits (880),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 178/283 (63%), Positives = 225/283 (80%), Gaps = 1/283 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLKS S   +  A AE+R L   +++NR+ I   GAI+ L++LL+S++   QE+AV
Sbjct  468   KLVEDLKSGSNKAKTAAAAEIRHLTISSIENRVHIGRYGAITPLLSLLYSDEKLTQEHAV  527

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGRS  868
             TALLNLSI++ NK+ I  A A+EPL++VL TG+  AKENSAATLFSLSV+  N+ +IG+S
Sbjct  528   TALLNLSISELNKATIVEAKALEPLVHVLNTGNDRAKENSAATLFSLSVLPVNRERIGQS  587

Query  867   -GAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
               A+Q+LV+LLG GT RGKKDAA+ALFNLSI HENK RIVQA AV++LVEL+DP   MVD
Sbjct  588   NAAIQALVNLLGKGTFRGKKDAASALFNLSITHENKARIVQAKAVKYLVELLDPDLEMVD  647

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ + EGR +I +EGGIP+LVE V+LGS RGKENAA+ LLQLC NS ++C +
Sbjct  648   KAVALLANLSAVGEGRQAIVREGGIPLLVETVDLGSQRGKENAASVLLQLCLNSPKFCTL  707

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  708   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKG  750


 Score =   189 bits (479),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 185/315 (59%), Gaps = 8/315 (3%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ + ++ LLN+IS + HL + + I    +         +LKLL+P+L G+VD +I SD 
Sbjct  1     MDPVPVRCLLNSISRYLHLVACQTIRFNPIQTCIGNMVLLLKLLKPLLDGVVDCKIPSDG  60

Query  2697  LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDWC  2518
              L K    L   V++ REL + W    SK++ V Q E L+ KV+  SL+I  +L+     
Sbjct  61    CLNKGCEDLDSVVNQARELLEDWSPKLSKLFGVFQCEVLLGKVQTCSLEISRILLQLSQS  120

Query  2517  LPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEG-----SGASSDSLTKIADCLS  2353
              P  SS+  +E CV +I+S   E    T+T+ ++N ++      +   +  L  I   L 
Sbjct  121   SPETSSVQVVERCVQEIESFKQE---GTLTELMENALQNQKDDITSLDNHHLESIIQMLG  177

Query  2352  LKSNQELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQ  2173
             L SNQ+LL E +A+EK +  ++ ++  E VE IEQ+I LV  + + ++  +  E    + 
Sbjct  178   LISNQDLLKESIAVEKERIRSQASKSKENVEQIEQLIELVLCIREHMLKTEFLEVAKGIS  237

Query  2172  IPADFCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTV  1993
             IP  F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ LTH  LIPNYTV
Sbjct  238   IPPYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLTHQELIPNYTV  297

Query  1992  KALIANWCEMNNIKL  1948
             KA+I +W E N I L
Sbjct  298   KAMITSWLEANRINL  312



>emb|CDX78262.1| BnaA09g34570D [Brassica napus]
Length=702

 Score =   342 bits (876),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 173/283 (61%), Positives = 223/283 (79%), Gaps = 1/283 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLK+ S  ++  A AE+R L  ++++NR+    CGAI+ L++LL+SE+   QE AV
Sbjct  418   KLVEDLKNGSNKEKTDAAAEIRRLTINSVENRVHFGRCGAITPLLSLLYSEEKLTQEQAV  477

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGR-  871
             TALLNLS+++ NK  I  AGAIEPL++VL+ G+  AKENSAATLFSLSV++ N+ +IG+ 
Sbjct  478   TALLNLSLSEVNKGMIVEAGAIEPLVHVLKAGNDRAKENSAATLFSLSVVQVNRERIGQC  537

Query  870   SGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
             + A+ +LV LLG GT RGKKDAA+ALFNLSI HENK RIVQA AV++LVE++DP   MVD
Sbjct  538   NAAIHALVSLLGKGTLRGKKDAASALFNLSITHENKARIVQAKAVKYLVEMLDPDLEMVD  597

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ + EGR  I +EGG+P+LVE V+ GS RGKENAA+ LLQLC NS ++C +
Sbjct  598   KAVALLANLSGVGEGRQEIVREGGVPLLVETVDSGSGRGKENAASVLLQLCLNSPKFCTL  657

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  658   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKG  700


 Score =   181 bits (460),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 111/311 (36%), Positives = 170/311 (55%), Gaps = 18/311 (6%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIA-SD  2701
             M+ + ++ LLN+IS + HL + + I    +         +LKLL+P L  +VD +    D
Sbjct  1     MDPVPVRCLLNSISRYLHLVACQTIRYSPIQTRIGNVVHLLKLLKPFLVEVVDCKTPPDD  60

Query  2700  ELLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
             + L      L   V++ RE  + W    SK++ V   E L+ KV+  SL+I  +L+    
Sbjct  61    DCLNSGCEDLDSVVNQAREFLEDWSPKLSKLFGVFHCELLLEKVQTCSLEITRILLQFSQ  120

Query  2520  CLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSN  2341
                   SL  +E C+ +I+ +  E    T+T+ + N ++     +D L  I   + L SN
Sbjct  121   SSAVTLSLQGVERCMQEIECVKQE---KTLTEHMNNALQNQTDGNDDLDSIIQMIGLVSN  177

Query  2340  QELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPAD  2161
             Q+LL E +A+EK +              ++Q+I LV+ + + ++  +  E    +  P  
Sbjct  178   QDLLKESIAVEKEQ--------------MDQLIDLVSCIREHMLKTEFLEVAKGISTPPY  223

Query  2160  FCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALI  1981
             F CPLS ELM DPVIVASGQT++R  I++W+D GL VCP+TRQ L+H  LIPNYTVKA+I
Sbjct  224   FRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLSHQELIPNYTVKAMI  283

Query  1980  ANWCEMNNIKL  1948
              +W E NNI L
Sbjct  284   ESWLEANNITL  294



>ref|XP_009116155.1| PREDICTED: U-box domain-containing protein 3 [Brassica rapa]
Length=702

 Score =   341 bits (875),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 173/283 (61%), Positives = 223/283 (79%), Gaps = 1/283 (0%)
 Frame = -2

Query  1227  KLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQENAV  1048
             KLVEDLK+ S  ++  A AE+R L  ++++NR+    CGAI+ L++LL+SE+   QE AV
Sbjct  418   KLVEDLKNGSNKEKTDAAAEIRRLTINSVENRVHFGRCGAITPLLSLLYSEEKLTQEQAV  477

Query  1047  TALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKIGR-  871
             TALLNLS+++ NK  I  AGAIEPL++VL+ G+  AKENSAATLFSLSV++ N+ +IG+ 
Sbjct  478   TALLNLSLSEVNKGMIVEAGAIEPLVHVLKAGNDRAKENSAATLFSLSVVQVNRERIGQC  537

Query  870   SGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELMDPAAGMVD  691
             + A+ +LV LLG GT RGKKDAA+ALFNLSI HENK RIVQA AV++LVE++DP   MVD
Sbjct  538   NAAIHALVSLLGKGTLRGKKDAASALFNLSITHENKARIVQAKAVKYLVEMLDPDLEMVD  597

Query  690   KAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRYCNM  511
             KAVA+L+NL+ + EGR  I +EGG+P+LVE V+ GS RGKENAA+ LLQLC NS ++C +
Sbjct  598   KAVALLANLSGVGEGRQEIVREGGVPLLVETVDSGSGRGKENAASVLLQLCLNSPKFCTL  657

Query  510   VLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG  382
             VLQ GA+PPLVALSQSGT RA+EKAQ LLS+FRNQR     +G
Sbjct  658   VLQEGAIPPLVALSQSGTQRAKEKAQQLLSHFRNQRDARMKKG  700


 Score =   182 bits (461),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 167/311 (54%), Gaps = 18/311 (6%)
 Frame = -2

Query  2877  MEILLLKVLLNNISSFFHLSSLENINSELVHKYYQKTEDILKLLQPILSGIVDAEIASDE  2698
             M+ + ++ LLN+IS + HL +   I    +         +LKLL+P L  +VD +   D+
Sbjct  1     MDPVPVRCLLNSISRYLHLVACHTIRYSPIQTRIGNVVHLLKLLKPFLVEVVDCKTPPDD  60

Query  2697  -LLQKVFSGLGHSVDELRELFQTWQLLSSKVYFVLQAESLIAKVRAFSLKIVELLVSSDW  2521
               L      L   V++ RE  + W    SK++ V   E L+ KV+  SLKI  +L+    
Sbjct  61    GCLNSACEDLDSVVNQAREFLEDWSPKLSKLFGVFHCELLLEKVQTCSLKITGILLQLSQ  120

Query  2520  CLPAESSLTSLENCVLKIKSMDYELLSATITKAIKNHVEGSGASSDSLTKIADCLSLKSN  2341
                   SL  +E C+ +I+    E    T+T+ + N ++     +D L  I   + L SN
Sbjct  121   SSAVTLSLQGVERCMQEIECFKQE---NTLTEHMNNALQNQTDDNDDLDSIIQMIGLVSN  177

Query  2340  QELLIELValeklkenaeqaekneevEYIEQIIALVTHMHDCLIMMKQSESCTSVQIPAD  2161
             Q+LL E +A+EK +              ++Q+I LV+ + + ++  +  E    +  P  
Sbjct  178   QDLLKESIAVEKEQ--------------MDQLIDLVSCIREHMLKTEFLEVAKGISTPPY  223

Query  2160  FCCPLSLELMTDPVIVASGQTYERNFIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALI  1981
             F CPLS ELM DPVIVASGQT++R  I+ W+D GL VCP+TRQ LTH  LIPNYTVKA+I
Sbjct  224   FRCPLSTELMVDPVIVASGQTFDRTSIKTWLDNGLAVCPRTRQVLTHQELIPNYTVKAMI  283

Query  1980  ANWCEMNNIKL  1948
              +W E NNI L
Sbjct  284   ESWLEANNITL  294



>ref|XP_002992508.1| ubiquitin-protein ligase, PUB2 [Selaginella moellendorffii]
 gb|EFJ06446.1| ubiquitin-protein ligase, PUB2 [Selaginella moellendorffii]
Length=768

 Score =   335 bits (858),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 172/285 (60%), Positives = 221/285 (78%), Gaps = 1/285 (0%)
 Frame = -2

Query  1236  QVRKLVEDLKSTSVDQQRIATAELRLLAKHNMDNRIVISNCGAISLLVNLLHSEDMEVQE  1057
             ++R L++DL + S+D QR A AELRLLAK+N ++RI I+N GAI  LV LL S D +VQE
Sbjct  458   KIRSLIQDLDAPSLDMQRTAAAELRLLAKNNAEDRIRIANAGAIKPLVALLSSADPKVQE  517

Query  1056  NAVTALLNLSINDNNKSAIANAGAIEPLIYVLETGSPEAKENSAATLFSLSVIEDNKIKI  877
             ++VT+LLNLS+ND NK  I ++GAI PLI VL  G+PEA++N+AATLFSLSV ++    I
Sbjct  518   DSVTSLLNLSLNDGNKHDIVDSGAIPPLISVLSEGNPEARQNAAATLFSLSVKQEYTALI  577

Query  876   GRSGAVQSLVDLLGNGTPRGKKDAATALFNLSILHENKGRIVQAGAVRHLVELM-DPAAG  700
             G SGA+  LV+LL +GTPRGKKDAATALFNLSI H+NK ++V+AGAV+ L++L+ +P  G
Sbjct  578   GASGAIPPLVELLKSGTPRGKKDAATALFNLSICHDNKNKVVKAGAVKPLIDLICEPRLG  637

Query  699   MVDKAVAVLSNLATIQEGRMSIGQEGGIPILVEVVELGSARGKENAAAALLQLCTNSSRY  520
             MVDKAVAV++NL+T+ EGR +I ++GGIP LVEVVE GS RGKE+AAAALL LC+NS R+
Sbjct  638   MVDKAVAVVTNLSTVSEGRSAIAEDGGIPALVEVVEAGSQRGKEHAAAALLTLCSNSPRH  697

Query  519   CNMVLQHGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGR  385
               M+   G  P L  LSQ+GT R +EKA ALL  FR QR+GN  R
Sbjct  698   RAMIFNEGVTPMLHILSQTGTARGKEKASALLRIFREQRNGNVPR  742


 Score =   148 bits (373),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 82/111 (74%), Gaps = 8/111 (7%)
 Frame = -2

Query  2241  ALVTHMHDCLIMMKQS---ESCTSVQ-----IPADFCCPLSLELMTDPVIVASGQTYERN  2086
             A++  +   L M  Q    E   SVQ     IPADFCCPLS +LM+DPVIVASGQTYER 
Sbjct  208   AVIDKLTSLLSMTTQDPAPEKVDSVQQQNIPIPADFCCPLSQQLMSDPVIVASGQTYERA  267

Query  2085  FIRRWIDLGLTVCPKTRQTLTHTNLIPNYTVKALIANWCEMNNIKLPDPIK  1933
             +I++W+D G   CPKT+Q ++HTNLIPNYTVKALIANWCEM+N+ LP+P K
Sbjct  268   YIQQWVDRGNRTCPKTQQVISHTNLIPNYTVKALIANWCEMHNVPLPEPPK  318



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10461777769924