BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21119_g1_i2 len=875 path=[3494:0-110 96:111-874]

Length=875
                                                                      Score     E

gb|KDO79815.1|  hypothetical protein CISIN_1g0138151mg                  335   1e-111   
gb|KHG27993.1|  hypothetical protein F383_15727                         350   3e-110   
gb|KDO79817.1|  hypothetical protein CISIN_1g025504mg                   331   6e-110   
emb|CDP08148.1|  unnamed protein product                                333   1e-109   
ref|XP_007012125.1|  Exostosin family protein, putative isoform 2       345   7e-109   
ref|XP_007012124.1|  Exostosin family protein, putative isoform 1       345   9e-109   
ref|XP_006476045.1|  PREDICTED: probable glycosyltransferase At5g...    341   2e-108   
ref|XP_006476044.1|  PREDICTED: probable glycosyltransferase At5g...    340   2e-108   
gb|KDO79818.1|  hypothetical protein CISIN_1g025504mg                   325   4e-108   
ref|XP_010049105.1|  PREDICTED: probable glycosyltransferase At3g...    339   1e-107   
ref|XP_010668347.1|  PREDICTED: probable glycosyltransferase At3g...    336   2e-107   
gb|KHN18173.1|  Putative glycosyltransferase                            329   4e-107   
ref|XP_006450684.1|  hypothetical protein CICLE_v10007698mg             337   4e-107   
ref|XP_004291184.1|  PREDICTED: probable glycosyltransferase At5g...    337   4e-107   
ref|XP_011081791.1|  PREDICTED: probable glycosyltransferase At5g...    337   7e-107   
ref|XP_011081790.1|  PREDICTED: probable glycosyltransferase At5g...    337   7e-107   
ref|XP_007225154.1|  hypothetical protein PRUPE_ppa002395mg             337   9e-107   
gb|KEH36060.1|  exostosin family protein                                333   2e-106   
ref|XP_004498468.1|  PREDICTED: probable glycosyltransferase At5g...    333   4e-106   
ref|XP_009618890.1|  PREDICTED: probable glycosyltransferase At5g...    332   4e-106   
ref|XP_011019807.1|  PREDICTED: probable glycosyltransferase At5g...    337   5e-106   
ref|XP_008220074.1|  PREDICTED: probable glycosyltransferase At3g...    335   5e-106   
ref|XP_004501161.1|  PREDICTED: probable glycosyltransferase At5g...    332   6e-106   
ref|XP_006476046.1|  PREDICTED: probable glycosyltransferase At5g...    332   2e-105   
gb|KHN06669.1|  Putative glycosyltransferase                            324   2e-105   
ref|XP_003527840.1|  PREDICTED: probable glycosyltransferase At5g...    332   3e-105   
ref|XP_003527839.1|  PREDICTED: probable glycosyltransferase At5g...    332   3e-105   
ref|XP_009618889.1|  PREDICTED: probable glycosyltransferase At5g...    332   4e-105   
ref|XP_011091069.1|  PREDICTED: probable glycosyltransferase At5g...    333   4e-105   
ref|XP_004148905.1|  PREDICTED: probable glycosyltransferase At5g...    332   5e-105   
ref|XP_009765195.1|  PREDICTED: probable glycosyltransferase At5g...    331   8e-105   
ref|XP_008393870.1|  PREDICTED: probable glycosyltransferase At5g...    331   1e-104   
ref|XP_002324801.2|  hypothetical protein POPTR_0018s00290g             332   1e-104   Populus trichocarpa [western balsam poplar]
ref|XP_009367458.1|  PREDICTED: probable glycosyltransferase At5g...    331   1e-104   
ref|XP_009367457.1|  PREDICTED: probable glycosyltransferase At5g...    331   1e-104   
ref|XP_009796848.1|  PREDICTED: probable glycosyltransferase At3g...    331   1e-104   
gb|KHG03637.1|  hypothetical protein F383_28279                         330   1e-104   
ref|XP_008451363.1|  PREDICTED: probable glycosyltransferase At5g...    331   2e-104   
ref|XP_002309547.2|  hypothetical protein POPTR_0006s25540g             331   2e-104   Populus trichocarpa [western balsam poplar]
ref|XP_010102388.1|  putative glycosyltransferase                       330   2e-104   
ref|XP_011004724.1|  PREDICTED: probable glycosyltransferase At5g...    331   3e-104   
ref|XP_010254024.1|  PREDICTED: probable glycosyltransferase At3g...    331   3e-104   
gb|KDP34147.1|  hypothetical protein JCGZ_07718                         332   3e-104   
ref|XP_010254018.1|  PREDICTED: probable glycosyltransferase At3g...    331   3e-104   
ref|XP_007161493.1|  hypothetical protein PHAVU_001G073700g             329   4e-104   
ref|XP_003550126.1|  PREDICTED: probable glycosyltransferase At5g...    329   4e-104   
ref|XP_006359775.1|  PREDICTED: probable glycosyltransferase At5g...    328   5e-104   
ref|XP_007137217.1|  hypothetical protein PHAVU_009G109300g             328   9e-104   
ref|XP_008357412.1|  PREDICTED: probable glycosyltransferase At5g...    328   1e-103   
ref|XP_002281263.1|  PREDICTED: probable glycosyltransferase At5g...    328   1e-103   Vitis vinifera
ref|XP_002516500.1|  catalytic, putative                                321   2e-103   Ricinus communis
ref|XP_006359765.1|  PREDICTED: probable glycosyltransferase At3g...    327   2e-103   
ref|XP_008357411.1|  PREDICTED: probable glycosyltransferase At5g...    328   2e-103   
ref|XP_011019621.1|  PREDICTED: probable glycosyltransferase At5g...    327   5e-103   
ref|XP_004245171.1|  PREDICTED: probable glycosyltransferase At3g...    324   2e-102   
gb|EYU29276.1|  hypothetical protein MIMGU_mgv1a021626mg                321   2e-102   
ref|XP_004245169.1|  PREDICTED: probable glycosyltransferase At3g...    324   2e-102   
ref|XP_008347627.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    322   3e-102   
ref|XP_009618892.1|  PREDICTED: probable glycosyltransferase At3g...    324   5e-102   
dbj|BAC42936.1|  unknown protein                                        310   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002309546.2|  hypothetical protein POPTR_0006s25530g             323   1e-101   Populus trichocarpa [western balsam poplar]
gb|AES58630.2|  exostosin family protein                                319   6e-101   
ref|XP_009782188.1|  PREDICTED: probable glycosyltransferase At5g...    320   6e-101   
ref|XP_006353481.1|  PREDICTED: probable glycosyltransferase At5g...    321   7e-101   
ref|XP_009782187.1|  PREDICTED: probable glycosyltransferase At5g...    321   1e-100   
ref|XP_010536232.1|  PREDICTED: probable glycosyltransferase At3g...    317   3e-100   
gb|KEH24072.1|  exostosin family protein                                314   4e-100   
gb|EYU20438.1|  hypothetical protein MIMGU_mgv1a003254mg                317   4e-100   
gb|KDP34148.1|  hypothetical protein JCGZ_07719                         317   5e-100   
ref|XP_010259884.1|  PREDICTED: probable glycosyltransferase At3g...    319   5e-100   
ref|XP_010536229.1|  PREDICTED: probable glycosyltransferase At3g...    318   6e-100   
ref|XP_010259882.1|  PREDICTED: probable glycosyltransferase At3g...    319   6e-100   
ref|XP_006412431.1|  hypothetical protein EUTSA_v10024793mg             315   9e-100   
ref|XP_010420781.1|  PREDICTED: probable glycosyltransferase At5g...    308   9e-100   
gb|KHN10197.1|  Putative glycosyltransferase                            310   1e-99    
ref|XP_010420780.1|  PREDICTED: probable glycosyltransferase At5g...    308   1e-99    
emb|CDY45017.1|  BnaA08g12020D                                          315   1e-99    
ref|XP_010546494.1|  PREDICTED: probable glycosyltransferase At3g...    316   1e-99    
ref|XP_009609995.1|  PREDICTED: probable glycosyltransferase At3g...    318   1e-99    
ref|XP_010546487.1|  PREDICTED: probable glycosyltransferase At3g...    316   1e-99    
ref|XP_010546495.1|  PREDICTED: probable glycosyltransferase At3g...    316   1e-99    
ref|XP_010546493.1|  PREDICTED: probable glycosyltransferase At3g...    316   2e-99    
ref|XP_006578228.1|  PREDICTED: probable glycosyltransferase At5g...    311   2e-99    
ref|XP_009108830.1|  PREDICTED: probable glycosyltransferase At5g...    315   3e-99    
ref|XP_011081795.1|  PREDICTED: probable glycosyltransferase At3g...    316   3e-99    
ref|XP_011081796.1|  PREDICTED: probable glycosyltransferase At3g...    316   3e-99    
ref|NP_195005.1|  Exostosin family protein                              314   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869243.1|  exostosin family protein                           314   5e-99    
ref|XP_007137218.1|  hypothetical protein PHAVU_009G109400g             315   6e-99    
ref|XP_011081793.1|  PREDICTED: probable glycosyltransferase At3g...    316   7e-99    
ref|XP_003523741.1|  PREDICTED: probable glycosyltransferase At5g...    314   9e-99    
gb|EYU20439.1|  hypothetical protein MIMGU_mgv1a003679mg                313   1e-98    
ref|XP_010451075.1|  PREDICTED: probable glycosyltransferase At5g...    313   1e-98    
ref|XP_004503465.1|  PREDICTED: probable glycosyltransferase At5g...    313   1e-98    
ref|XP_004245168.1|  PREDICTED: probable glycosyltransferase At3g...    311   2e-98    
emb|CDP03281.1|  unnamed protein product                                315   2e-98    
ref|XP_008462761.1|  PREDICTED: probable glycosyltransferase At5g...    314   2e-98    
ref|XP_006287301.1|  hypothetical protein CARUB_v10000494mg             313   3e-98    
ref|XP_004148727.1|  PREDICTED: probable glycosyltransferase At5g...    314   3e-98    
gb|KDO66501.1|  hypothetical protein CISIN_1g005796mg                   314   4e-98    
ref|XP_009352528.1|  PREDICTED: probable glycosyltransferase At3g...    309   4e-98    
gb|AET05220.2|  exostosin family protein                                312   4e-98    
ref|XP_006451253.1|  hypothetical protein CICLE_v10007651mg             314   5e-98    
emb|CDY49323.1|  BnaC03g66910D                                          311   5e-98    
ref|XP_010313735.1|  PREDICTED: probable glycosyltransferase At3g...    311   7e-98    
ref|XP_010437853.1|  PREDICTED: probable glycosyltransferase At5g...    310   7e-98    
ref|XP_010432662.1|  PREDICTED: probable glycosyltransferase At5g...    311   7e-98    
ref|XP_003630744.1|  Xylogalacturonan beta-1,3-xylosyltransferase       313   8e-98    
ref|XP_006283300.1|  hypothetical protein CARUB_v10004339mg             312   1e-97    
ref|XP_004287457.1|  PREDICTED: probable glycosyltransferase At3g...    313   1e-97    
ref|XP_010263183.1|  PREDICTED: probable glycosyltransferase At5g...    312   1e-97    
gb|KDP33723.1|  hypothetical protein JCGZ_07294                         308   1e-97    
ref|NP_197468.2|  Exostosin family protein                              310   2e-97    Arabidopsis thaliana [mouse-ear cress]
emb|CDX87077.1|  BnaC09g03920D                                          310   2e-97    
ref|XP_004251626.1|  PREDICTED: probable glycosyltransferase At3g...    312   2e-97    
ref|XP_010047709.1|  PREDICTED: probable glycosyltransferase At5g...    312   3e-97    
ref|XP_009352527.1|  PREDICTED: probable glycosyltransferase At3g...    311   4e-97    
ref|XP_007204617.1|  hypothetical protein PRUPE_ppa002387mg             311   4e-97    
ref|XP_011093625.1|  PREDICTED: probable glycosyltransferase At3g...    311   4e-97    
ref|XP_008242549.1|  PREDICTED: probable glycosyltransferase At3g...    311   5e-97    
ref|XP_006359763.1|  PREDICTED: probable glycosyltransferase At5g...    309   5e-97    
ref|XP_010493042.1|  PREDICTED: probable glycosyltransferase At3g...    310   5e-97    
emb|CDP08149.1|  unnamed protein product                                309   6e-97    
ref|NP_197954.1|  Exostosin family protein                              310   7e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002514248.1|  catalytic, putative                                311   9e-97    Ricinus communis
emb|CDY19793.1|  BnaA09g04460D                                          309   9e-97    
ref|XP_009120864.1|  PREDICTED: probable glycosyltransferase At3g...    308   1e-96    
ref|XP_010421440.1|  PREDICTED: probable glycosyltransferase At3g...    309   1e-96    
ref|XP_009111678.1|  PREDICTED: probable glycosyltransferase At5g...    308   1e-96    
emb|CDX92511.1|  BnaA10g15500D                                          308   1e-96    
ref|XP_002871898.1|  exostosin family protein                           308   1e-96    
gb|EYU27286.1|  hypothetical protein MIMGU_mgv1a002540mg                310   1e-96    
emb|CDY58974.1|  BnaC09g38020D                                          308   2e-96    
ref|XP_010493838.1|  PREDICTED: probable glycosyltransferase At3g...    309   2e-96    
ref|XP_010454924.1|  PREDICTED: probable glycosyltransferase At3g...    308   2e-96    
ref|XP_006400529.1|  hypothetical protein EUTSA_v10013011mg             308   2e-96    
ref|XP_006287237.1|  hypothetical protein CARUB_v10000423mg             308   5e-96    
ref|XP_010249593.1|  PREDICTED: probable glycosyltransferase At5g...    308   8e-96    
ref|XP_010095377.1|  putative glycosyltransferase                       308   8e-96    
ref|XP_002280595.2|  PREDICTED: probable glycosyltransferase At5g...    307   1e-95    Vitis vinifera
ref|XP_002514249.1|  catalytic, putative                                297   1e-95    Ricinus communis
gb|KDP33724.1|  hypothetical protein JCGZ_07295                         308   1e-95    
ref|XP_006451252.1|  hypothetical protein CICLE_v10007703mg             306   2e-95    
ref|XP_010656275.1|  PREDICTED: probable glycosyltransferase At3g...    308   2e-95    
ref|XP_011048349.1|  PREDICTED: probable glycosyltransferase At3g...    306   2e-95    
ref|XP_002324437.2|  hypothetical protein POPTR_0018s09240g             306   2e-95    Populus trichocarpa [western balsam poplar]
ref|XP_011048342.1|  PREDICTED: probable glycosyltransferase At3g...    307   2e-95    
ref|XP_011048346.1|  PREDICTED: probable glycosyltransferase At3g...    306   2e-95    
ref|XP_002283936.2|  PREDICTED: probable glycosyltransferase At3g...    308   3e-95    Vitis vinifera
emb|CDX80541.1|  BnaC07g29030D                                          305   5e-95    
emb|CDP03282.1|  unnamed protein product                                306   6e-95    
ref|XP_003524401.1|  PREDICTED: probable glycosyltransferase At5g...    305   6e-95    
ref|XP_009793599.1|  PREDICTED: probable glycosyltransferase At3g...    302   7e-95    
ref|XP_010254014.1|  PREDICTED: probable glycosyltransferase At3g...    305   7e-95    
gb|KHN41660.1|  Putative glycosyltransferase                            305   8e-95    
ref|XP_004501160.1|  PREDICTED: probable glycosyltransferase At5g...    302   9e-95    
gb|KEH36061.1|  glycosyltransferase plant-like protein                  303   1e-94    
ref|XP_010454251.1|  PREDICTED: probable glycosyltransferase At3g...    303   2e-94    
ref|XP_006356532.1|  PREDICTED: probable glycosyltransferase At5g...    302   2e-94    
ref|XP_007160303.1|  hypothetical protein PHAVU_002G310300g             304   2e-94    
ref|XP_010535964.1|  PREDICTED: probable glycosyltransferase At3g...    304   2e-94    
ref|XP_010688286.1|  PREDICTED: probable glycosyltransferase At5g...    301   4e-94    
ref|XP_008337502.1|  PREDICTED: probable glycosyltransferase At3g...    303   4e-94    
ref|XP_007013074.1|  Exostosin family protein                           302   5e-94    
ref|XP_008805667.1|  PREDICTED: probable glycosyltransferase At3g...    304   5e-94    
ref|XP_002324438.2|  hypothetical protein POPTR_0018s09250g             303   7e-94    Populus trichocarpa [western balsam poplar]
ref|XP_006394831.1|  hypothetical protein EUTSA_v10003790mg             301   2e-93    
ref|XP_007013073.1|  Exostosin family protein                           303   2e-93    
ref|XP_009389960.1|  PREDICTED: probable glycosyltransferase At3g...    301   3e-93    
ref|XP_004241893.1|  PREDICTED: probable glycosyltransferase At3g...    298   3e-93    
ref|XP_009389958.1|  PREDICTED: probable glycosyltransferase At3g...    301   4e-93    
ref|XP_010688287.1|  PREDICTED: probable glycosyltransferase At3g...    299   7e-93    
emb|CDX88200.1|  BnaA06g27910D                                          299   8e-93    
ref|XP_009151104.1|  PREDICTED: probable glycosyltransferase At3g...    300   8e-93    
ref|XP_008362949.1|  PREDICTED: probable glycosyltransferase At3g...    299   1e-92    
ref|XP_010495150.1|  PREDICTED: probable glycosyltransferase At5g...    283   6e-92    
ref|XP_010925918.1|  PREDICTED: probable glycosyltransferase At5g...    299   7e-92    
emb|CAN76867.1|  hypothetical protein VITISV_012309                     309   1e-91    Vitis vinifera
ref|XP_010419736.1|  PREDICTED: probable glycosyltransferase At3g...    293   2e-91    
ref|XP_006282582.1|  hypothetical protein CARUB_v10004511mg             293   3e-91    
ref|XP_010535968.1|  PREDICTED: probable glycosyltransferase At3g...    293   3e-91    
gb|KHG01319.1|  hypothetical protein F383_23550                         295   5e-91    
ref|XP_007204228.1|  hypothetical protein PRUPE_ppa002755mg             295   5e-91    
gb|KFK34883.1|  hypothetical protein AALP_AA5G205800                    288   5e-91    
ref|XP_004150756.1|  PREDICTED: probable glycosyltransferase At3g...    285   9e-91    
ref|XP_010491897.1|  PREDICTED: probable glycosyltransferase At3g...    291   1e-90    
ref|XP_008242550.1|  PREDICTED: probable glycosyltransferase At3g...    293   2e-90    
ref|XP_006286421.1|  hypothetical protein CARUB_v10003248mg             290   5e-90    
ref|XP_010435540.1|  PREDICTED: probable glycosyltransferase At3g...    289   7e-90    
ref|XP_010435539.1|  PREDICTED: probable glycosyltransferase At3g...    289   7e-90    
ref|XP_002873524.1|  exostosin family protein                           289   8e-90    
gb|KFK34884.1|  hypothetical protein AALP_AA5G205800                    289   9e-90    
ref|XP_009139701.1|  PREDICTED: probable glycosyltransferase At3g...    289   9e-90    
emb|CDY53533.1|  BnaCnng25370D                                          288   2e-89    
emb|CDX74602.1|  BnaA04g07870D                                          288   3e-89    
ref|XP_010440808.1|  PREDICTED: probable glycosyltransferase At3g...    288   3e-89    
ref|XP_004163851.1|  PREDICTED: probable glycosyltransferase At3g...    281   5e-89    
ref|XP_003638181.1|  hypothetical protein MTR_121s0013                  287   5e-89    
ref|XP_004287456.1|  PREDICTED: probable glycosyltransferase At5g...    288   6e-89    
ref|XP_010450462.1|  PREDICTED: probable glycosyltransferase At3g...    286   1e-88    
ref|XP_008465462.1|  PREDICTED: probable glycosyltransferase At3g...    287   3e-88    
ref|XP_008362948.1|  PREDICTED: probable glycosyltransferase At3g...    288   3e-88    
ref|XP_010095378.1|  putative glycosyltransferase                       287   4e-88    
ref|XP_002870514.1|  hypothetical protein ARALYDRAFT_915839             284   6e-88    
ref|XP_009121930.1|  PREDICTED: probable glycosyltransferase At3g...    283   1e-87    
ref|NP_196722.1|  Exostosin family protein                              283   1e-87    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42362.1|  unknown protein                                        283   1e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519887.1|  PREDICTED: probable glycosyltransferase At5g...    283   2e-87    
gb|EYU30729.1|  hypothetical protein MIMGU_mgv1a006113mg                280   2e-87    
emb|CDX97126.1|  BnaC09g44990D                                          282   3e-87    
ref|XP_006399668.1|  hypothetical protein EUTSA_v10013187mg             282   4e-87    
ref|XP_004498470.1|  PREDICTED: probable glycosyltransferase At5g...    281   1e-86    
dbj|BAB08970.1|  unnamed protein product                                281   1e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011078274.1|  PREDICTED: probable glycosyltransferase At3g...    283   2e-86    
ref|XP_010047718.1|  PREDICTED: probable glycosyltransferase At3g...    281   3e-86    
ref|XP_010047716.1|  PREDICTED: probable glycosyltransferase At3g...    282   5e-86    
ref|XP_006573464.1|  PREDICTED: probable glycosyltransferase At3g...    278   4e-85    
ref|XP_007152901.1|  hypothetical protein PHAVU_004G169700g             278   8e-85    
ref|XP_010688285.1|  PREDICTED: probable glycosyltransferase At5g...    276   2e-84    
ref|XP_010688284.1|  PREDICTED: probable glycosyltransferase At5g...    276   8e-84    
ref|XP_004967954.1|  PREDICTED: probable glycosyltransferase At5g...    273   2e-83    
ref|XP_006837291.1|  hypothetical protein AMTR_s00111p00027680          273   8e-83    
gb|EEC69788.1|  hypothetical protein OsI_00072                          270   2e-82    Oryza sativa Indica Group [Indian rice]
ref|XP_002457517.1|  hypothetical protein SORBIDRAFT_03g008610          268   3e-82    Sorghum bicolor [broomcorn]
ref|XP_008655546.1|  PREDICTED: probable glycosyltransferase At5g...    265   4e-82    
ref|NP_001041784.1|  Os01g0107700                                       269   4e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008655545.1|  PREDICTED: probable glycosyltransferase At5g...    265   4e-82    
ref|XP_010230336.1|  PREDICTED: probable glycosyltransferase At5g...    268   5e-82    
ref|XP_008655544.1|  PREDICTED: probable glycosyltransferase At5g...    265   9e-82    
ref|XP_006853629.1|  hypothetical protein AMTR_s00056p00069610          257   1e-81    
gb|AFW79782.1|  putative homeodomain-like transcription factor su...    265   8e-81    
ref|XP_003588379.1|  Exostosin-2                                        265   9e-81    
ref|XP_008655541.1|  PREDICTED: probable glycosyltransferase At5g...    266   1e-80    
ref|XP_008655540.1|  PREDICTED: probable glycosyltransferase At3g...    266   1e-80    
emb|CDM80206.1|  unnamed protein product                                265   1e-80    
ref|XP_008655539.1|  PREDICTED: probable glycosyltransferase At3g...    266   1e-80    
ref|XP_006645431.1|  PREDICTED: probable glycosyltransferase At3g...    268   3e-80    
ref|XP_010646853.1|  PREDICTED: probable glycosyltransferase At5g...    263   7e-80    
ref|XP_004172570.1|  PREDICTED: probable glycosyltransferase At5g...    257   9e-80    
ref|XP_010264376.1|  PREDICTED: probable glycosyltransferase At5g...    261   1e-79    
ref|XP_010264375.1|  PREDICTED: probable glycosyltransferase At5g...    262   1e-79    
emb|CBI23466.3|  unnamed protein product                                263   1e-79    
gb|EMT33304.1|  Exostosin-1                                             263   2e-79    
ref|XP_008437051.1|  PREDICTED: probable glycosyltransferase At5g...    261   3e-79    
ref|XP_008787956.1|  PREDICTED: probable glycosyltransferase At5g...    261   4e-79    
ref|XP_009410556.1|  PREDICTED: probable glycosyltransferase At5g...    262   4e-79    
ref|XP_004152424.1|  PREDICTED: probable glycosyltransferase At5g...    259   4e-79    
ref|XP_010940042.1|  PREDICTED: probable glycosyltransferase At5g...    262   5e-79    
ref|XP_006405956.1|  hypothetical protein EUTSA_v10027719mg             259   1e-78    
ref|XP_001781687.1|  predicted protein                                  254   2e-78    
gb|KGN50275.1|  hypothetical protein Csa_5G165200                       259   2e-78    
dbj|BAK00152.1|  predicted protein                                      260   2e-78    
ref|XP_010053501.1|  PREDICTED: probable glycosyltransferase At5g...    259   4e-78    
gb|KCW77809.1|  hypothetical protein EUGRSUZ_D02098                     258   5e-78    
ref|XP_010104876.1|  putative glycosyltransferase                       258   5e-78    
ref|XP_010258845.1|  PREDICTED: probable glycosyltransferase At5g...    256   1e-77    
ref|XP_010258844.1|  PREDICTED: probable glycosyltransferase At5g...    256   2e-77    
gb|AHL38601.1|  glycosyltransferase                                     256   3e-77    
ref|XP_009404619.1|  PREDICTED: probable glycosyltransferase At5g...    249   5e-77    
ref|NP_198516.1|  Exostosin family protein                              255   6e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009410544.1|  PREDICTED: probable glycosyltransferase At3g...    256   1e-76    
ref|XP_011081309.1|  PREDICTED: probable glycosyltransferase At5g...    254   1e-76    
ref|XP_009410535.1|  PREDICTED: probable glycosyltransferase At3g...    256   1e-76    
gb|EYU19306.1|  hypothetical protein MIMGU_mgv1a009615mg                248   2e-76    
emb|CDY54752.1|  BnaAnng13460D                                          249   4e-76    
ref|XP_011070139.1|  PREDICTED: probable glycosyltransferase At5g...    250   5e-76    
ref|XP_011031920.1|  PREDICTED: probable glycosyltransferase At3g...    253   6e-76    
ref|XP_007209874.1|  hypothetical protein PRUPE_ppa003859mg             252   1e-75    
ref|XP_002303362.2|  hypothetical protein POPTR_0003s07660g             251   2e-75    Populus trichocarpa [western balsam poplar]
ref|XP_010542216.1|  PREDICTED: probable glycosyltransferase At5g...    251   3e-75    
ref|XP_009145556.1|  PREDICTED: probable glycosyltransferase At5g...    251   3e-75    
ref|XP_007039785.1|  Exostosin family protein isoform 2                 249   3e-75    
emb|CDY62513.1|  BnaC01g41810D                                          250   5e-75    
ref|XP_002530666.1|  catalytic, putative                                249   1e-74    Ricinus communis
ref|XP_007039784.1|  Exostosin family protein isoform 1                 249   1e-74    
ref|XP_004244561.1|  PREDICTED: probable glycosyltransferase At5g...    249   1e-74    
ref|XP_003550913.1|  PREDICTED: probable glycosyltransferase At5g...    249   1e-74    
ref|XP_002967425.1|  glycosyltransferase-like protein                   244   2e-74    
ref|XP_002960288.1|  glycosylransferase-like protein                    244   2e-74    
ref|XP_009783538.1|  PREDICTED: probable glycosyltransferase At5g...    248   2e-74    
ref|NP_567512.2|  Exostosin family protein                              248   2e-74    
ref|XP_002870133.1|  exostosin family protein                           248   3e-74    
ref|XP_006414308.1|  hypothetical protein EUTSA_v10024835mg             248   3e-74    
ref|XP_004508934.1|  PREDICTED: probable glycosyltransferase At5g...    244   1e-73    
ref|XP_006358342.1|  PREDICTED: probable glycosyltransferase At5g...    246   1e-73    
ref|XP_004299415.1|  PREDICTED: probable glycosyltransferase At5g...    246   1e-73    
ref|XP_009405809.1|  PREDICTED: probable glycosyltransferase At5g...    242   2e-73    
ref|XP_010434775.1|  PREDICTED: probable glycosyltransferase At5g...    245   3e-73    
gb|EYU18554.1|  hypothetical protein MIMGU_mgv1a023926mg                239   4e-73    
ref|XP_010440106.1|  PREDICTED: probable glycosyltransferase At5g...    245   5e-73    
emb|CDP09990.1|  unnamed protein product                                245   6e-73    
gb|ABF70053.1|  exostosin family protein                                246   6e-73    
ref|XP_004508932.1|  PREDICTED: probable glycosyltransferase At5g...    244   6e-73    
ref|XP_009594914.1|  PREDICTED: probable glycosyltransferase At5g...    244   7e-73    
ref|XP_009389352.1|  PREDICTED: probable glycosyltransferase At5g...    244   9e-73    
ref|XP_006477154.1|  PREDICTED: probable glycosyltransferase At5g...    243   2e-72    
gb|KDO61387.1|  hypothetical protein CISIN_1g009454mg                   243   2e-72    
ref|XP_008238441.1|  PREDICTED: probable glycosyltransferase At5g...    244   2e-72    
ref|XP_006440272.1|  hypothetical protein CICLE_v10019663mg             243   2e-72    
ref|XP_006477151.1|  PREDICTED: probable glycosyltransferase At5g...    243   2e-72    
ref|XP_006286253.1|  hypothetical protein CARUB_v10007826mg             243   2e-72    
emb|CAB10449.1|  limonene cyclase like protein                          250   4e-72    
ref|XP_007155684.1|  hypothetical protein PHAVU_003G222300g             242   9e-72    
gb|ABF70140.1|  exostosin family protein                                241   1e-71    
ref|XP_004969280.1|  PREDICTED: probable glycosyltransferase At5g...    236   3e-71    
tpg|DAA58381.1|  TPA: hypothetical protein ZEAMMB73_758303              238   4e-71    
ref|XP_010667032.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    240   4e-71    
ref|XP_008776324.1|  PREDICTED: probable glycosyltransferase At5g...    239   4e-71    
ref|XP_003608691.1|  hypothetical protein MTR_4g100730                  239   5e-71    
ref|XP_010924229.1|  PREDICTED: probable glycosyltransferase At5g...    239   7e-71    
ref|XP_008675295.1|  PREDICTED: probable glycosyltransferase At5g...    238   7e-71    
dbj|BAK04795.1|  predicted protein                                      233   1e-70    
ref|XP_009761144.1|  PREDICTED: probable glycosyltransferase At5g...    238   1e-70    
emb|CBI20855.3|  unnamed protein product                                240   2e-70    
gb|EPS69343.1|  hypothetical protein M569_05421                         238   2e-70    
ref|XP_002516499.1|  catalytic, putative                                239   5e-70    
ref|NP_001043679.1|  Os01g0640600                                       236   6e-70    
ref|XP_010325495.1|  PREDICTED: probable glycosyltransferase At5g...    234   6e-70    
gb|EEC71161.1|  hypothetical protein OsI_03019                          236   7e-70    
emb|CDM83500.1|  unnamed protein product                                235   1e-69    
ref|XP_010325494.1|  PREDICTED: probable glycosyltransferase At5g...    236   2e-69    
ref|XP_006355510.1|  PREDICTED: probable glycosyltransferase At5g...    234   4e-69    
ref|XP_006644419.1|  PREDICTED: probable glycosyltransferase At5g...    234   5e-69    
ref|XP_002981280.1|  glycosyltransferase-like protein                   229   6e-69    
ref|XP_002969667.1|  glycosyltransferase-like protein                   229   1e-68    
ref|XP_002456034.1|  hypothetical protein SORBIDRAFT_03g029210          233   1e-68    
ref|XP_010233470.1|  PREDICTED: probable glycosyltransferase At5g...    233   1e-68    
gb|EEE55063.1|  hypothetical protein OsJ_02778                          226   3e-66    
ref|XP_002964241.1|  xylosyltransferase-like protein                    221   3e-66    
gb|EAY90353.1|  hypothetical protein OsI_11935                          216   1e-65    
ref|XP_002989572.1|  xylosyltransferase-like protein                    220   1e-65    
ref|XP_006582516.1|  PREDICTED: probable glycosyltransferase At5g...    219   3e-65    
gb|KHN09672.1|  Putative glycosyltransferase                            219   9e-65    
gb|KDP39895.1|  hypothetical protein JCGZ_03426                         216   5e-64    
ref|XP_001767347.1|  predicted protein                                  216   7e-64    
ref|NP_001190743.1|  Exostosin family protein                           222   8e-64    
ref|XP_007213443.1|  hypothetical protein PRUPE_ppa025338mg             210   3e-63    
ref|XP_010098868.1|  putative glycosyltransferase                       217   5e-63    
emb|CBI28483.3|  unnamed protein product                                215   7e-63    
gb|KEH35655.1|  exostosin family protein                                217   1e-62    
ref|XP_004503012.1|  PREDICTED: probable glycosyltransferase At5g...    216   2e-62    
ref|XP_007137813.1|  hypothetical protein PHAVU_009G157700g             216   2e-62    
ref|XP_002264076.2|  PREDICTED: probable glycosyltransferase At5g...    216   3e-62    
gb|AFK34982.1|  unknown                                                 208   3e-62    
ref|XP_006853631.1|  hypothetical protein AMTR_s00056p00070250          217   7e-62    
ref|XP_007049438.1|  Catalytic, putative                                215   1e-61    
ref|XP_004513029.1|  PREDICTED: probable glycosyltransferase At3g...    218   1e-61    
ref|XP_008394205.1|  PREDICTED: probable glycosyltransferase At5g...    214   2e-61    
gb|KCW48746.1|  hypothetical protein EUGRSUZ_K02385                     209   2e-61    
ref|XP_002524592.1|  catalytic, putative                                211   2e-61    
ref|XP_007027565.1|  Exostosin family protein, putative                 214   2e-61    
ref|XP_011085648.1|  PREDICTED: probable glycosyltransferase At5g...    212   3e-61    
ref|XP_009587618.1|  PREDICTED: probable glycosyltransferase At5g...    213   4e-61    
gb|KEH24081.1|  glycosyltransferase                                     210   6e-61    
gb|EYU42789.1|  hypothetical protein MIMGU_mgv1a009597mg                208   7e-61    
ref|XP_008675296.1|  PREDICTED: probable glycosyltransferase At5g...    211   1e-60    
gb|KHN45704.1|  Putative glycosyltransferase                            207   1e-60    
ref|XP_010039048.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    208   1e-60    
ref|XP_004289488.1|  PREDICTED: probable glycosyltransferase At5g...    209   2e-60    
ref|XP_010252860.1|  PREDICTED: probable glycosyltransferase At3g...    211   2e-60    
ref|XP_009379539.1|  PREDICTED: probable glycosyltransferase At5g...    211   2e-60    
ref|XP_007213348.1|  hypothetical protein PRUPE_ppa1027150mg            207   3e-60    
ref|XP_008227724.1|  PREDICTED: probable glycosyltransferase At3g...    211   3e-60    
ref|XP_010039055.1|  PREDICTED: probable glycosyltransferase At5g...    212   4e-60    
ref|XP_010243080.1|  PREDICTED: probable glycosyltransferase At5g...    212   4e-60    
ref|XP_010243073.1|  PREDICTED: probable glycosyltransferase At5g...    212   5e-60    
ref|XP_010039041.1|  PREDICTED: probable glycosyltransferase At5g...    211   6e-60    
ref|XP_001783154.1|  predicted protein                                  205   8e-60    
ref|XP_003555678.1|  PREDICTED: probable glycosyltransferase At3g...    209   1e-59    
ref|XP_004494122.1|  PREDICTED: probable glycosyltransferase At5g...    209   1e-59    
ref|XP_003553575.1|  PREDICTED: probable glycosyltransferase At5g...    209   1e-59    
gb|KHN15414.1|  Putative glycosyltransferase                            209   1e-59    
gb|KHN02275.1|  Putative glycosyltransferase                            209   1e-59    
ref|XP_010096417.1|  putative glycosyltransferase                       201   1e-59    
ref|XP_006357695.1|  PREDICTED: probable glycosyltransferase At5g...    208   2e-59    
ref|XP_008227680.1|  PREDICTED: probable glycosyltransferase At5g...    209   2e-59    
ref|XP_007162830.1|  hypothetical protein PHAVU_001G184500g             209   2e-59    
ref|XP_003537031.2|  PREDICTED: probable glycosyltransferase At5g...    208   2e-59    
ref|XP_008229804.1|  PREDICTED: probable glycosyltransferase At3g...    207   3e-59    
gb|KCW48767.1|  hypothetical protein EUGRSUZ_K02411                     203   4e-59    
ref|XP_009631064.1|  PREDICTED: probable glycosyltransferase At5g...    206   5e-59    
gb|KHN15834.1|  Putative glycosyltransferase                            207   5e-59    
ref|XP_009379540.1|  PREDICTED: probable glycosyltransferase At5g...    208   5e-59    
ref|XP_008227726.1|  PREDICTED: probable glycosyltransferase At5g...    207   7e-59    
ref|XP_004303053.1|  PREDICTED: probable glycosyltransferase At5g...    208   7e-59    
ref|XP_009782027.1|  PREDICTED: probable glycosyltransferase At5g...    207   9e-59    
gb|AAU04753.1|  EXO                                                     202   1e-58    
emb|CBI30213.3|  unnamed protein product                                202   1e-58    
ref|XP_009622709.1|  PREDICTED: probable glycosyltransferase At5g...    207   1e-58    
ref|XP_007202112.1|  hypothetical protein PRUPE_ppa006842mg             203   1e-58    
ref|XP_007216463.1|  hypothetical protein PRUPE_ppa024503mg             206   1e-58    
ref|XP_009782026.1|  PREDICTED: probable glycosyltransferase At5g...    206   1e-58    
ref|XP_004305861.1|  PREDICTED: probable glycosyltransferase At3g...    205   1e-58    
ref|XP_009782024.1|  PREDICTED: probable glycosyltransferase At5g...    207   2e-58    
ref|XP_002528630.1|  catalytic, putative                                207   2e-58    
gb|EPS64188.1|  hypothetical protein M569_10593                         203   2e-58    
ref|XP_002320537.2|  hypothetical protein POPTR_0014s16900g             205   2e-58    
ref|XP_006354423.1|  PREDICTED: probable glycosyltransferase At5g...    206   2e-58    
ref|XP_009782025.1|  PREDICTED: probable glycosyltransferase At5g...    207   2e-58    
ref|XP_008359607.1|  PREDICTED: probable glycosyltransferase At5g...    206   2e-58    
ref|XP_011009816.1|  PREDICTED: probable glycosyltransferase At3g...    205   3e-58    
ref|XP_009774931.1|  PREDICTED: probable glycosyltransferase At5g...    204   3e-58    
ref|XP_009774930.1|  PREDICTED: probable glycosyltransferase At5g...    204   4e-58    
gb|KHG09514.1|  hypothetical protein F383_01906                         204   4e-58    
ref|XP_008392545.1|  PREDICTED: probable glycosyltransferase At5g...    206   4e-58    
gb|KGN52623.1|  hypothetical protein Csa_5G647450                       205   4e-58    
ref|XP_010683939.1|  PREDICTED: probable glycosyltransferase At5g...    206   5e-58    
emb|CDX79391.1|  BnaC06g19120D                                          197   5e-58    
ref|XP_010248410.1|  PREDICTED: probable glycosyltransferase At5g...    207   5e-58    
ref|XP_003521429.1|  PREDICTED: probable glycosyltransferase At5g...    205   7e-58    
ref|XP_010242926.1|  PREDICTED: probable glycosyltransferase At5g...    205   7e-58    
gb|AGV54221.1|  glycosyltransferase                                     204   7e-58    
gb|KHN18714.1|  Putative glycosyltransferase                            205   8e-58    
ref|XP_007145275.1|  hypothetical protein PHAVU_007G225300g             204   8e-58    
ref|XP_008796633.1|  PREDICTED: probable glycosyltransferase At5g...    204   8e-58    
ref|XP_002524591.1|  catalytic, putative                                204   8e-58    
emb|CDP08577.1|  unnamed protein product                                204   9e-58    
gb|AGV54450.1|  glycosyltransferase                                     204   9e-58    
ref|XP_004243882.1|  PREDICTED: probable glycosyltransferase At5g...    204   1e-57    
ref|XP_003542567.1|  PREDICTED: probable glycosyltransferase At5g...    204   1e-57    
ref|XP_008381668.1|  PREDICTED: probable glycosyltransferase At5g...    204   1e-57    
ref|XP_009375632.1|  PREDICTED: probable glycosyltransferase At5g...    204   1e-57    
gb|EYU41561.1|  hypothetical protein MIMGU_mgv1a004154mg                204   1e-57    
ref|XP_008241335.1|  PREDICTED: probable glycosyltransferase At5g...    204   2e-57    
ref|XP_008459522.1|  PREDICTED: probable glycosyltransferase At5g...    204   2e-57    
ref|XP_011009813.1|  PREDICTED: probable glycosyltransferase At5g...    200   2e-57    
emb|CDP15733.1|  unnamed protein product                                202   3e-57    
ref|XP_011100587.1|  PREDICTED: probable glycosyltransferase At3g...    204   3e-57    
gb|EMT25526.1|  Exostosin-1                                             202   3e-57    
ref|XP_002284018.2|  PREDICTED: probable glycosyltransferase At5g...    203   3e-57    
ref|XP_008342266.1|  PREDICTED: probable glycosyltransferase At3g...    202   3e-57    
ref|XP_009340969.1|  PREDICTED: probable glycosyltransferase At5g...    203   3e-57    
ref|XP_001769276.1|  predicted protein                                  200   4e-57    
gb|KHN24379.1|  Putative glycosyltransferase                            202   5e-57    
ref|XP_006339310.1|  PREDICTED: probable glycosyltransferase At5g...    200   6e-57    
gb|KHG04052.1|  hypothetical protein F383_28592                         202   6e-57    
ref|XP_009361503.1|  PREDICTED: probable glycosyltransferase At3g...    202   6e-57    
ref|XP_010657501.1|  PREDICTED: probable glycosyltransferase At3g...    199   6e-57    
ref|XP_004239536.1|  PREDICTED: probable glycosyltransferase At5g...    202   7e-57    
gb|KDP29231.1|  hypothetical protein JCGZ_16620                         201   7e-57    
ref|XP_002324871.2|  exostosin family protein                           197   8e-57    
ref|XP_002320538.2|  hypothetical protein POPTR_0014s16920g             200   9e-57    
ref|XP_006381337.1|  hypothetical protein POPTR_0006s11930g             201   9e-57    
ref|XP_010246563.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    201   1e-56    
ref|XP_002264111.3|  PREDICTED: probable glycosyltransferase At3g...    200   1e-56    
ref|XP_010068733.1|  PREDICTED: probable glycosyltransferase At5g...    201   1e-56    
ref|XP_009379541.1|  PREDICTED: probable glycosyltransferase At5g...    201   1e-56    
ref|XP_004502077.1|  PREDICTED: probable glycosyltransferase At3g...    200   1e-56    
ref|XP_011009812.1|  PREDICTED: probable glycosyltransferase At5g...    201   2e-56    
ref|XP_003541440.1|  PREDICTED: probable glycosyltransferase At5g...    200   2e-56    
ref|XP_003535253.1|  PREDICTED: probable glycosyltransferase At5g...    201   2e-56    
ref|XP_010048370.1|  PREDICTED: probable glycosyltransferase At3g...    201   2e-56    
ref|XP_009122667.1|  PREDICTED: probable glycosyltransferase At5g...    200   2e-56    
ref|XP_011018855.1|  PREDICTED: probable glycosyltransferase At5g...    201   2e-56    
ref|XP_010543482.1|  PREDICTED: probable glycosyltransferase At5g...    200   2e-56    
ref|XP_009779883.1|  PREDICTED: probable glycosyltransferase At5g...    201   2e-56    
ref|XP_010933454.1|  PREDICTED: probable glycosyltransferase At5g...    201   3e-56    
ref|XP_007011817.1|  Exostosin family protein                           199   3e-56    
ref|XP_004292405.1|  PREDICTED: probable glycosyltransferase At5g...    201   3e-56    
emb|CDY42006.1|  BnaC04g00840D                                          200   3e-56    
dbj|BAB08605.1|  unnamed protein product                                197   3e-56    
ref|XP_011094446.1|  PREDICTED: probable glycosyltransferase At5g...    201   4e-56    
gb|KEH35171.1|  exostosin family protein                                198   4e-56    
ref|XP_004497579.1|  PREDICTED: probable glycosyltransferase At5g...    200   4e-56    
gb|KCW89058.1|  hypothetical protein EUGRSUZ_A01384                     201   4e-56    
ref|XP_010923285.1|  PREDICTED: probable glycosyltransferase At5g...    200   5e-56    
ref|XP_007027562.1|  Exostosin family protein                           201   5e-56    
ref|XP_010683540.1|  PREDICTED: probable glycosyltransferase At3g...    197   8e-56    
ref|XP_006469477.1|  PREDICTED: probable glycosyltransferase At5g...    199   8e-56    
ref|XP_006447859.1|  hypothetical protein CICLE_v10017948mg             199   8e-56    
ref|XP_006398838.1|  hypothetical protein EUTSA_v10016080mg             199   9e-56    
ref|XP_004249790.2|  PREDICTED: probable glycosyltransferase At5g...    197   1e-55    
gb|KCW80354.1|  hypothetical protein EUGRSUZ_C01719                     194   1e-55    
gb|KDP33570.1|  hypothetical protein JCGZ_07141                         198   1e-55    
gb|AES60658.2|  exostosin family protein                                198   2e-55    
gb|AES71688.2|  exostosin family protein                                196   2e-55    
ref|XP_003601437.1|  hypothetical protein MTR_3g080690                  196   2e-55    
emb|CDY11270.1|  BnaA03g01060D                                          195   2e-55    
ref|XP_006845223.1|  hypothetical protein AMTR_s00005p00255230          195   2e-55    
ref|XP_011036587.1|  PREDICTED: probable glycosyltransferase At5g...    197   2e-55    
ref|NP_001031828.1|  Exostosin family protein                           198   2e-55    
gb|KEH24082.1|  glycosyltransferase                                     195   2e-55    
ref|XP_010456387.1|  PREDICTED: probable glycosyltransferase At5g...    196   2e-55    
ref|XP_007200373.1|  hypothetical protein PRUPE_ppa008342mg             193   3e-55    
emb|CBI28482.3|  unnamed protein product                                200   3e-55    
ref|XP_003590407.1|  hypothetical protein MTR_1g061760                  197   3e-55    
ref|XP_010683539.1|  PREDICTED: probable glycosyltransferase At3g...    197   3e-55    
gb|EMT30821.1|  Exostosin-2                                             198   4e-55    
ref|XP_010247793.1|  PREDICTED: probable glycosyltransferase At5g...    199   4e-55    
emb|CDX80888.1|  BnaC03g01420D                                          197   6e-55    
ref|XP_009617934.1|  PREDICTED: probable glycosyltransferase At5g...    197   7e-55    
ref|XP_009617933.1|  PREDICTED: probable glycosyltransferase At5g...    197   7e-55    
gb|AGZ15405.1|  limonene cyclase-like protein                           196   7e-55    
ref|XP_010050741.1|  PREDICTED: probable glycosyltransferase At5g...    196   7e-55    
ref|XP_008337161.1|  PREDICTED: probable glycosyltransferase At5g...    187   7e-55    
ref|XP_004156325.1|  PREDICTED: probable glycosyltransferase At5g...    196   8e-55    
ref|XP_010423660.1|  PREDICTED: probable glycosyltransferase At5g...    196   8e-55    
ref|XP_010228257.1|  PREDICTED: probable glycosyltransferase At5g...    197   1e-54    
emb|CDP15333.1|  unnamed protein product                                194   1e-54    
ref|XP_010228256.1|  PREDICTED: probable glycosyltransferase At5g...    196   1e-54    



>gb|KDO79815.1| hypothetical protein CISIN_1g0138151mg, partial [Citrus sinensis]
Length=269

 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 180/228 (79%), Gaps = 16/228 (7%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  MANCIR+LC SD++EG   GKDV+LPETYV S +NP ++IGG P S+R  LA
Sbjct  37   APAETRIIMANCIRALCNSDVKEGFVFGKDVALPETYVLSPQNPLRAIGGKPASQRSILA  96

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----------------DKKDYLVHMKSSK  424
            FFAG+MHGY+RP LL HWENKDPDMKIFG M                 K DY+ HMKSSK
Sbjct  97   FFAGRMHGYLRPILLHHWENKDPDMKIFGQMPMVKGKGKGKGKGKRKGKMDYIQHMKSSK  156

Query  425  YCICARGYEVNSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNI  604
            YCICA+GYEVNSPRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLKNI
Sbjct  157  YCICAKGYEVNSPRVVEAIFYECVPVIISDNFVPPFFEILNWESFAVFVLEKDIPNLKNI  216

Query  605  LMSIPENTYREMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            L+SI E  YR MQ RVK+VQ+HFLWHP P +YDIFHM+LHSIWY RVF
Sbjct  217  LLSISEKRYRRMQMRVKKVQQHFLWHPQPVKYDIFHMLLHSIWYNRVF  264



>gb|KHG27993.1| hypothetical protein F383_15727 [Gossypium arboreum]
Length=840

 Score =   350 bits (897),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 181/217 (83%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMANCIR+LC SD+REG   GKDVSLPETYV + + P + +GG PPSKRP LA
Sbjct  620  APSETRNHMANCIRALCNSDVREGYVFGKDVSLPETYVRNPQKPLRDLGGNPPSKRPILA  679

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LL+ W NKDPDMKIFG M     K +Y+ HMKSSKYC+C RGYEVNS
Sbjct  680  FFAGSMHGYLRPILLEQWGNKDPDMKIFGKMPNVKGKMNYIRHMKSSKYCLCPRGYEVNS  739

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE LNWESF+VF+LEKDI NLK IL+SIP+  YR+M
Sbjct  740  PRVVEAIFYECVPVIISDNFVPPFFEVLNWESFSVFILEKDIPNLKKILLSIPDKRYRQM  799

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RVK++Q+HFLWHP P++YDIFHMILHS+WY RVF+
Sbjct  800  QLRVKKIQQHFLWHPKPEKYDIFHMILHSVWYNRVFQ  836



>gb|KDO79817.1| hypothetical protein CISIN_1g025504mg [Citrus sinensis]
Length=252

 Score =   331 bits (848),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/222 (72%), Positives = 177/222 (80%), Gaps = 10/222 (5%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  MANCIR+LC SD+++G   GKDVSLPET V S +NP  +IGG P S+R  LA
Sbjct  26   APAETRIIMANCIRALCNSDVKQGFVFGKDVSLPETNVLSPQNPLWAIGGKPASQRSILA  85

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----------DKKDYLVHMKSSKYCICAR  442
            FFAG MHGY+RP LL HWENKDPDMKIFG M           K DY+ HMKSSKYCICA+
Sbjct  86   FFAGSMHGYLRPILLHHWENKDPDMKIFGQMPKAKGRGKRKGKTDYIQHMKSSKYCICAK  145

Query  443  GYEVNSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPE  622
            GYEV+SPRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFVLE+DI NLKNIL+SI E
Sbjct  146  GYEVHSPRVVEAIFYECVPVIISDNFVPPFFEILNWESFAVFVLERDIPNLKNILLSISE  205

Query  623  NTYREMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
              YR+MQ  VK+VQ+HFLWHP P +YDIFHMILHSIWY RVF
Sbjct  206  KRYRKMQMMVKKVQQHFLWHPRPVKYDIFHMILHSIWYNRVF  247



>emb|CDP08148.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 179/217 (82%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  MA+CIR+LC SD++EG Q GKDVSL ETYV   ++P + +GG PPSKR  LA
Sbjct  113  APAETRKIMAHCIRALCNSDIKEGFQFGKDVSLAETYVRIPQHPLRQVGGRPPSKRKILA  172

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LL+HWENKDPDMKIFG + K      Y+ HM+SSKYCICARGYEVNS
Sbjct  173  FFAGNMHGYLRPILLEHWENKDPDMKIFGQLPKVKGQMSYIQHMQSSKYCICARGYEVNS  232

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFETL WESFA+FV EKDI NLKNIL+SIP+  Y +M
Sbjct  233  PRVVEAIFYECVPVIISDNFVPPFFETLKWESFAIFVPEKDIPNLKNILLSIPKKRYLQM  292

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RVK VQ+HFLWHP P +YDIFHMILHSIWYTRVF+
Sbjct  293  QKRVKLVQQHFLWHPRPVKYDIFHMILHSIWYTRVFQ  329



>ref|XP_007012125.1| Exostosin family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY29744.1| Exostosin family protein, putative isoform 2 [Theobroma cacao]
Length=788

 Score =   345 bits (885),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 179/217 (82%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMANCIR+LC SD+REG   GKDVSLPETYV + + P + +GG PPSKR  LA
Sbjct  568  APSETRKHMANCIRALCNSDIREGYIFGKDVSLPETYVRNPQKPLRDLGGKPPSKRSILA  627

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LL+ W NKDPDMKIFG M     K +Y+ HMKSSKYC+C RGYEVNS
Sbjct  628  FFAGSMHGYLRPILLEQWGNKDPDMKIFGKMPNVKGKMNYIQHMKSSKYCLCPRGYEVNS  687

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI Y CVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLK IL+SIPE  +R+M
Sbjct  688  PRVVEAIFYGCVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPNLKKILLSIPEKRFRQM  747

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RVK++Q+HFLWHP P++YDIFHMILHS+WY RVF+
Sbjct  748  QLRVKKIQQHFLWHPRPEKYDIFHMILHSVWYNRVFQ  784



>ref|XP_007012124.1| Exostosin family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY29743.1| Exostosin family protein, putative isoform 1 [Theobroma cacao]
Length=802

 Score =   345 bits (885),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 179/217 (82%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMANCIR+LC SD+REG   GKDVSLPETYV + + P + +GG PPSKR  LA
Sbjct  582  APSETRKHMANCIRALCNSDIREGYIFGKDVSLPETYVRNPQKPLRDLGGKPPSKRSILA  641

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LL+ W NKDPDMKIFG M     K +Y+ HMKSSKYC+C RGYEVNS
Sbjct  642  FFAGSMHGYLRPILLEQWGNKDPDMKIFGKMPNVKGKMNYIQHMKSSKYCLCPRGYEVNS  701

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI Y CVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLK IL+SIPE  +R+M
Sbjct  702  PRVVEAIFYGCVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPNLKKILLSIPEKRFRQM  761

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RVK++Q+HFLWHP P++YDIFHMILHS+WY RVF+
Sbjct  762  QLRVKKIQQHFLWHPRPEKYDIFHMILHSVWYNRVFQ  798



>ref|XP_006476045.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X2 [Citrus sinensis]
Length=663

 Score =   341 bits (874),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 180/228 (79%), Gaps = 16/228 (7%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  MANCIR+LC SD++EG   GKDV+LPETYV S +NP ++IGG P S+R  LA
Sbjct  431  APAETRIIMANCIRALCNSDVKEGFVFGKDVALPETYVLSPQNPLRAIGGKPASQRSILA  490

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----------------DKKDYLVHMKSSK  424
            FFAG+MHGY+RP LL HWENKDPDMKIFG M                 K DY+ HMKSSK
Sbjct  491  FFAGRMHGYLRPILLHHWENKDPDMKIFGQMPMVKGKGKGKGKGKRKGKMDYIQHMKSSK  550

Query  425  YCICARGYEVNSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNI  604
            YCICA+GYEVNSPRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLKNI
Sbjct  551  YCICAKGYEVNSPRVVEAIFYECVPVIISDNFVPPFFEILNWESFAVFVLEKDIPNLKNI  610

Query  605  LMSIPENTYREMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            L+SI E  YR MQ RVK+VQ+HFLWHP P +YDIFHM+LHSIWY RVF
Sbjct  611  LLSISEKRYRRMQMRVKKVQQHFLWHPQPVKYDIFHMLLHSIWYNRVF  658



>ref|XP_006476044.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X1 [Citrus sinensis]
Length=670

 Score =   340 bits (873),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 180/228 (79%), Gaps = 16/228 (7%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  MANCIR+LC SD++EG   GKDV+LPETYV S +NP ++IGG P S+R  LA
Sbjct  438  APAETRIIMANCIRALCNSDVKEGFVFGKDVALPETYVLSPQNPLRAIGGKPASQRSILA  497

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----------------DKKDYLVHMKSSK  424
            FFAG+MHGY+RP LL HWENKDPDMKIFG M                 K DY+ HMKSSK
Sbjct  498  FFAGRMHGYLRPILLHHWENKDPDMKIFGQMPMVKGKGKGKGKGKRKGKMDYIQHMKSSK  557

Query  425  YCICARGYEVNSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNI  604
            YCICA+GYEVNSPRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLKNI
Sbjct  558  YCICAKGYEVNSPRVVEAIFYECVPVIISDNFVPPFFEILNWESFAVFVLEKDIPNLKNI  617

Query  605  LMSIPENTYREMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            L+SI E  YR MQ RVK+VQ+HFLWHP P +YDIFHM+LHSIWY RVF
Sbjct  618  LLSISEKRYRRMQMRVKKVQQHFLWHPQPVKYDIFHMLLHSIWYNRVF  665



>gb|KDO79818.1| hypothetical protein CISIN_1g025504mg [Citrus sinensis]
Length=219

 Score =   325 bits (832),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 173/214 (81%), Gaps = 10/214 (5%)
 Frame = +2

Query  137  MANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHG  316
            MANCIR+LC SD+++G   GKDVSLPET V S +NP  +IGG P S+R  LAFFAG MHG
Sbjct  1    MANCIRALCNSDVKQGFVFGKDVSLPETNVLSPQNPLWAIGGKPASQRSILAFFAGSMHG  60

Query  317  YVRPTLLQHWENKDPDMKIFGTM----------DKKDYLVHMKSSKYCICARGYEVNSPR  466
            Y+RP LL HWENKDPDMKIFG M           K DY+ HMKSSKYCICA+GYEV+SPR
Sbjct  61   YLRPILLHHWENKDPDMKIFGQMPKAKGRGKRKGKTDYIQHMKSSKYCICAKGYEVHSPR  120

Query  467  VVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQT  646
            VVEAI YECVPVIISDNFVPPFFE LNWESFAVFVLE+DI NLKNIL+SI E  YR+MQ 
Sbjct  121  VVEAIFYECVPVIISDNFVPPFFEILNWESFAVFVLERDIPNLKNILLSISEKRYRKMQM  180

Query  647  RVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
             VK+VQ+HFLWHP P +YDIFHMILHSIWY RVF
Sbjct  181  MVKKVQQHFLWHPRPVKYDIFHMILHSIWYNRVF  214



>ref|XP_010049105.1| PREDICTED: probable glycosyltransferase At3g07620 [Eucalyptus 
grandis]
 gb|KCW81567.1| hypothetical protein EUGRSUZ_C02925 [Eucalyptus grandis]
Length=692

 Score =   339 bits (870),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 182/217 (84%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  MA+CIR+LC +D++EG   GKDVSLPETYV S++ P +++GG PPS+R  LA
Sbjct  472  APSETRRIMASCIRALCNADVKEGFVFGKDVSLPETYVRSAQKPLRNVGGKPPSQRSILA  531

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LLQHW NKDPDM+IFG M       +Y+ HM+SSKYCICA+GYEVNS
Sbjct  532  FFAGNMHGYVRPILLQHWGNKDPDMRIFGPMPHTKGNMNYIQHMRSSKYCICAKGYEVNS  591

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFETLNWESFAVFVLEKDI NLK+IL+SIPE  +R+M
Sbjct  592  PRVVEAIFYECVPVIISDNFVPPFFETLNWESFAVFVLEKDIPNLKDILLSIPEKRFRQM  651

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RVK+VQ+HFLWH  P +YDIFHMILHSIW+ RVF+
Sbjct  652  QMRVKKVQQHFLWHRKPVKYDIFHMILHSIWFNRVFQ  688



>ref|XP_010668347.1| PREDICTED: probable glycosyltransferase At3g07620 [Beta vulgaris 
subsp. vulgaris]
Length=587

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 179/218 (82%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  MANCIR+LC +D++E  Q GKDVSLPET+V  +RNP + IGG PPSKR  LA
Sbjct  366  APSETRRSMANCIRALCNADVKEHFQFGKDVSLPETFVRKARNPLKDIGGKPPSKRQTLA  425

Query  293  FFAGQMHGYVRPTLLQHW-ENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LLQHW  N DPDM+IFG +    D K+Y+ +MKSSKYCIC RGYEVN
Sbjct  426  FYAGNMHGYLRPILLQHWGNNNDPDMQIFGKLPRSKDNKNYINYMKSSKYCICPRGYEVN  485

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNF+PPFFETLNWESFAVFV EKDI NLKNIL+SIPE T+  
Sbjct  486  SPRVVEAIFYECVPVIISDNFIPPFFETLNWESFAVFVAEKDIPNLKNILLSIPEKTFFR  545

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            M  RVK+VQ+HFLWHP P +YD+FHMILHSIWY RVF+
Sbjct  546  MHMRVKKVQQHFLWHPKPVKYDLFHMILHSIWYNRVFQ  583



>gb|KHN18173.1| Putative glycosyltransferase [Glycine soja]
Length=396

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 180/216 (83%), Gaps = 4/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMA C+R+LC +D++EG  LGKD+SLPETYV +++ P ++IGG   SKR  LA
Sbjct  176  APTETRQHMARCLRALCNADVKEGFVLGKDISLPETYVRNAQKPTRNIGGNRVSKRKTLA  235

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LLQHWENKDP MKIFG + K    ++Y+ +MKSSKYCICA+GYEVNS
Sbjct  236  FFAGGMHGYVRPILLQHWENKDPAMKIFGILPKSKGNRNYIQYMKSSKYCICAKGYEVNS  295

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVI+SDNFVPPFFE LNWESFAVFVLEKDI NLKNIL+SIP+  Y +M
Sbjct  296  PRVVEAILYECVPVILSDNFVPPFFEMLNWESFAVFVLEKDIPNLKNILLSIPQKRYLQM  355

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            Q  V++VQ+HFLWH SP +YDIFHM+LHSIWY RVF
Sbjct  356  QMMVRKVQQHFLWHRSPVKYDIFHMVLHSIWYNRVF  391



>ref|XP_006450684.1| hypothetical protein CICLE_v10007698mg [Citrus clementina]
 gb|ESR63924.1| hypothetical protein CICLE_v10007698mg [Citrus clementina]
Length=652

 Score =   337 bits (863),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 161/222 (73%), Positives = 177/222 (80%), Gaps = 10/222 (5%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  MANCIR+LC SD+++G   GKDVSLPET V S +NP  +IGG P S+R  LA
Sbjct  426  APAETRIIMANCIRALCNSDVKQGFVFGKDVSLPETNVLSPQNPLWAIGGKPASQRSILA  485

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----------DKKDYLVHMKSSKYCICAR  442
            FFAG MHGY+RP LL HWENKDPDMKIFG M           K DY+ HMKSSKYCICA+
Sbjct  486  FFAGSMHGYLRPILLHHWENKDPDMKIFGQMPKAKGRGKRKGKMDYIQHMKSSKYCICAK  545

Query  443  GYEVNSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPE  622
            GYEV+SPRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLKNIL+SI E
Sbjct  546  GYEVHSPRVVEAIFYECVPVIISDNFVPPFFEILNWESFAVFVLEKDIPNLKNILLSISE  605

Query  623  NTYREMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
              YR+MQ  VK+VQ+HFLWHP P +YDIFHMILHSIWY RVF
Sbjct  606  KRYRKMQMMVKKVQQHFLWHPRPVKYDIFHMILHSIWYNRVF  647



>ref|XP_004291184.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=662

 Score =   337 bits (864),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 179/215 (83%), Gaps = 4/215 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+ +M  CIRSLC +D++EG   GKDVSLPETYV ++RNP + +GG  PSKR  LA
Sbjct  442  APAETKEYMDKCIRSLCNADMKEGFVFGKDVSLPETYVQNARNPLRDLGGNRPSKRTTLA  501

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG +HGYVRP LLQHWENKDPDMKIFG + K    K+Y+ HMKSSKYCICA+GYEVNS
Sbjct  502  FFAGSLHGYVRPILLQHWENKDPDMKIFGKLPKIKGNKNYVRHMKSSKYCICAKGYEVNS  561

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE L WESFAVFVLEKDI NLK+IL+SIP+  Y +M
Sbjct  562  PRVVEAIFYECVPVIISDNFVPPFFEVLKWESFAVFVLEKDIPNLKSILLSIPKKRYLQM  621

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            Q RVKRVQ+HFLWH  P++YDIFHMILHSIWY R+
Sbjct  622  QMRVKRVQQHFLWHAKPEKYDIFHMILHSIWYNRL  656



>ref|XP_011081791.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X2 
[Sesamum indicum]
 ref|XP_011081792.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X2 
[Sesamum indicum]
Length=683

 Score =   337 bits (864),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 180/218 (83%), Gaps = 4/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  MANCIR+LC +D+REG Q GKD SLPET+V S RNP + +GG PPSKR  LA
Sbjct  463  APAETRQIMANCIRALCNADVREGFQFGKDASLPETFVQSPRNPLRQLGGKPPSKRSILA  522

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LL++WENKDPD+KIFG + K      Y  +MKSSKYCICA+G+EVNS
Sbjct  523  FFAGNMHGYLRPILLKYWENKDPDVKIFGPIPKVKGQMSYAQYMKSSKYCICAKGFEVNS  582

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFETLNWESFAVFV EKDI NLKNIL+SI +  Y EM
Sbjct  583  PRVVEAIFYECVPVIISDNFVPPFFETLNWESFAVFVSEKDIPNLKNILLSISKKRYLEM  642

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            Q RVK+VQ+HFLWHP P +YD+FHMILHSIWY RVF+T
Sbjct  643  QQRVKQVQQHFLWHPRPVKYDVFHMILHSIWYNRVFQT  680



>ref|XP_011081790.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Sesamum indicum]
Length=702

 Score =   337 bits (865),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 180/218 (83%), Gaps = 4/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  MANCIR+LC +D+REG Q GKD SLPET+V S RNP + +GG PPSKR  LA
Sbjct  482  APAETRQIMANCIRALCNADVREGFQFGKDASLPETFVQSPRNPLRQLGGKPPSKRSILA  541

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LL++WENKDPD+KIFG + K      Y  +MKSSKYCICA+G+EVNS
Sbjct  542  FFAGNMHGYLRPILLKYWENKDPDVKIFGPIPKVKGQMSYAQYMKSSKYCICAKGFEVNS  601

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFETLNWESFAVFV EKDI NLKNIL+SI +  Y EM
Sbjct  602  PRVVEAIFYECVPVIISDNFVPPFFETLNWESFAVFVSEKDIPNLKNILLSISKKRYLEM  661

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            Q RVK+VQ+HFLWHP P +YD+FHMILHSIWY RVF+T
Sbjct  662  QQRVKQVQQHFLWHPRPVKYDVFHMILHSIWYNRVFQT  699



>ref|XP_007225154.1| hypothetical protein PRUPE_ppa002395mg [Prunus persica]
 gb|EMJ26353.1| hypothetical protein PRUPE_ppa002395mg [Prunus persica]
Length=678

 Score =   337 bits (863),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 180/215 (84%), Gaps = 4/215 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+ +MA CIR+LC SD++EG   GKDVSLPETY+ + +NP + +GG  PSKR  LA
Sbjct  458  APSETKKYMATCIRALCNSDIKEGFVFGKDVSLPETYIKNDKNPLRDLGGNRPSKRSILA  517

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LLQHWE+KDPDMKIFG + K    K+Y+ +M+SSKYCICA+GYEVNS
Sbjct  518  FFAGSMHGYLRPILLQHWEDKDPDMKIFGKLPKVKGNKNYVRYMQSSKYCICAKGYEVNS  577

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLKNIL+SIP+  Y +M
Sbjct  578  PRVVEAIFYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPNLKNILLSIPKKKYLQM  637

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            Q RVK+VQ+HFLWH  P++YDIFHMILHSIWY R+
Sbjct  638  QMRVKKVQKHFLWHAKPEKYDIFHMILHSIWYNRL  672



>gb|KEH36060.1| exostosin family protein [Medicago truncatula]
Length=596

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 178/216 (82%), Gaps = 4/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  M+ CIRSLC +D +EG  LGKDVSLPETYV ++ NP + +GG P SKR  LA
Sbjct  376  APSETKQRMSKCIRSLCNADAKEGFVLGKDVSLPETYVRNAENPTRDLGGRPVSKRKTLA  435

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LLQHWENKDPDMKIFG + K    ++Y+ +MK SKYCIC +GYEVNS
Sbjct  436  FFAGGMHGYVRPILLQHWENKDPDMKIFGMLPKSKGNRNYIQYMKRSKYCICPKGYEVNS  495

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLK+IL+SIP+  Y +M
Sbjct  496  PRVVEAIIYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPNLKSILVSIPKKRYLQM  555

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            Q RVK+VQ+HFLWH SP +YDIFHMILHSIWY RVF
Sbjct  556  QMRVKKVQQHFLWHKSPVKYDIFHMILHSIWYNRVF  591



>ref|XP_004498468.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X1 [Cicer arietinum]
 ref|XP_004498469.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X2 [Cicer arietinum]
Length=612

 Score =   333 bits (854),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/219 (71%), Positives = 178/219 (81%), Gaps = 4/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+ H+ANCIRSLC +D++EG   GKD SLPETYV +++NP + +GG   SKR  LA
Sbjct  393  APSETKLHLANCIRSLCNADVKEGFVFGKDASLPETYVRNAQNPTRDLGGNSGSKRTTLA  452

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKK----DYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LLQHWENKDPDMKIFG + K     +Y+ +MKSSKYCICA+GYEVNS
Sbjct  453  FFAGSMHGYLRPILLQHWENKDPDMKIFGKLPKSKGNSNYIQYMKSSKYCICAKGYEVNS  512

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE L+WESFAVFVLEKDI NLKNIL+SIPE  Y  +
Sbjct  513  PRVVEAIFYECVPVIISDNFVPPFFEVLDWESFAVFVLEKDIPNLKNILLSIPEKRYLRL  572

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRTV  757
              RVK+VQ+HFLWH +P +YDIFHMILHSIWY RVF   
Sbjct  573  LMRVKKVQQHFLWHKNPVKYDIFHMILHSIWYNRVFSAT  611



>ref|XP_009618890.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana tomentosiformis]
Length=568

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 178/213 (84%), Gaps = 1/213 (0%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A EETR+ MANCI+S C +DL+EG +LGKD SLPET +  S +P +S+GG  PS+R +LA
Sbjct  354  APEETRHEMANCIKSFCNADLKEGFKLGKDASLPETNI-GSADPSRSLGGKRPSQREFLA  412

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVV  472
            FFAG MHGYVRP LL++W+NKDP+MKIFG M K DY+ HMKSS+YCICARGYEVNSPRVV
Sbjct  413  FFAGSMHGYVRPILLKYWQNKDPNMKIFGQMRKTDYIQHMKSSRYCICARGYEVNSPRVV  472

Query  473  EAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRV  652
            EAISYECVPVIISDNFVPPF ETLNWESFAVFV EKDI NLK+IL SIP   Y ++   V
Sbjct  473  EAISYECVPVIISDNFVPPFLETLNWESFAVFVQEKDIPNLKSILESIPLRRYLKLYNNV  532

Query  653  KRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            K+VQ+HFLWH  P +YDIFHMILHSIWY RVF+
Sbjct  533  KKVQQHFLWHSEPVKYDIFHMILHSIWYNRVFQ  565



>ref|XP_011019807.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
Length=757

 Score =   337 bits (863),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 174/219 (79%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMANCIR+LC SD +E    GKD SLPETYV +  NP + +GG P SKR  LA
Sbjct  535  APSETRQHMANCIRALCNSDAKEDFVFGKDASLPETYVLTPENPLRDLGGKPASKRSILA  594

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM------DKKDYLVHMKSSKYCICARGYEV  454
            FFAG MHGY+RP LLQHWENKDPDMKIFG +       K +Y  +MKSSKYCICA+GYEV
Sbjct  595  FFAGSMHGYLRPILLQHWENKDPDMKIFGRLPKVKGRGKMNYARYMKSSKYCICAKGYEV  654

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI YECVPVIISDNFVPPF E LNWESFAVFVLEKDI NLK IL+SIP   YR
Sbjct  655  NSPRVVEAIFYECVPVIISDNFVPPFLEVLNWESFAVFVLEKDIPNLKKILLSIPAKKYR  714

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
             MQTRVKRVQ+HFLWH  P +YD+FHMILHSIWY RVF+
Sbjct  715  RMQTRVKRVQQHFLWHARPVKYDVFHMILHSIWYNRVFQ  753



>ref|XP_008220074.1| PREDICTED: probable glycosyltransferase At3g07620 [Prunus mume]
Length=677

 Score =   335 bits (858),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 179/215 (83%), Gaps = 4/215 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+ +MA CIR+LC SD++EG   GKDVSLPETY+ + +NP + +GG  PSKR  LA
Sbjct  457  APSETKKYMATCIRALCNSDIKEGFVFGKDVSLPETYIKNDKNPLRDLGGNRPSKRSILA  516

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP L QHWE+KDPDMKIFG + K    K+Y+ +M+SSKYCICA+GYEVNS
Sbjct  517  FFAGSMHGYVRPILWQHWEDKDPDMKIFGKLPKAKGNKNYVHYMQSSKYCICAKGYEVNS  576

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLKNIL+SIP+  Y +M
Sbjct  577  PRVVEAIFYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPNLKNILLSIPKKKYLQM  636

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            Q RVK+VQ+HFLWH  P++YDIFHMILHSIWY R+
Sbjct  637  QMRVKKVQKHFLWHAKPEKYDIFHMILHSIWYNRL  671



>ref|XP_004501161.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=605

 Score =   332 bits (852),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 179/216 (83%), Gaps = 4/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  MA C+RSLC +D++EG  LGKDVSLPETYV +++NP + +GG   SKR  LA
Sbjct  385  APSETKQRMAKCLRSLCNADVKEGFVLGKDVSLPETYVRNAKNPTRDLGGNQVSKRETLA  444

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            F+AG MHGYVRP LLQHWENKDPDMKIFG M K    ++Y+ +MK SKYC+C +GYEVNS
Sbjct  445  FYAGGMHGYVRPILLQHWENKDPDMKIFGMMPKSKGNRNYIQYMKRSKYCVCPKGYEVNS  504

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISD+FVPPFFE LNWESFAVFVLEKDI NLK+IL+SIPE  Y +M
Sbjct  505  PRVVEAIVYECVPVIISDDFVPPFFEVLNWESFAVFVLEKDIPNLKSILVSIPEKRYLQM  564

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            Q RVK+VQ+HFLWH SP +YDIFHMILHSIWY RVF
Sbjct  565  QMRVKKVQQHFLWHRSPVKYDIFHMILHSIWYNRVF  600



>ref|XP_006476046.1| PREDICTED: probable glycosyltransferase At5g03795-like [Citrus 
sinensis]
Length=653

 Score =   332 bits (852),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/222 (72%), Positives = 176/222 (79%), Gaps = 10/222 (5%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  MANCIR+LC SD+++G   GKDVSLPET V S +NP  +IGG P S+R  LA
Sbjct  427  APAETRIIMANCIRALCNSDVKQGFVFGKDVSLPETNVLSPQNPLWAIGGKPASQRSILA  486

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----------DKKDYLVHMKSSKYCICAR  442
            FFAG MHGY+RP LL HWENKDPDMKIFG M           K DY+ HMKSSKYCICA+
Sbjct  487  FFAGSMHGYLRPILLHHWENKDPDMKIFGQMPKAKGRGKRKGKTDYIQHMKSSKYCICAK  546

Query  443  GYEVNSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPE  622
            GYEV+SPRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFVLE+DI NLKNIL+SI E
Sbjct  547  GYEVHSPRVVEAIFYECVPVIISDNFVPPFFEILNWESFAVFVLERDIPNLKNILLSISE  606

Query  623  NTYREMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
              Y +MQ  VK+VQ+HFLWHP P +YDIFHMILHSIWY RVF
Sbjct  607  KRYLKMQMMVKKVQQHFLWHPRPVKYDIFHMILHSIWYNRVF  648



>gb|KHN06669.1| Putative glycosyltransferase [Glycine soja]
Length=396

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 174/216 (81%), Gaps = 4/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  MANCIRSLC +D++EG   GKD SLPETYV  ++ P + + G   SKR  LA
Sbjct  176  APGETKVDMANCIRSLCNADVKEGFVFGKDASLPETYVRDAKIPTKDLSGNSASKRTTLA  235

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LLQHWENKDPDMKIFG + K    ++Y+ +MKSSKYCICA+GYEVNS
Sbjct  236  FFAGSMHGYVRPILLQHWENKDPDMKIFGRLPKSKGNRNYIQYMKSSKYCICAKGYEVNS  295

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPF E LNWESFAV VLEKDI NLKNIL+SIPE  Y  +
Sbjct  296  PRVVEAIFYECVPVIISDNFVPPFLEVLNWESFAVIVLEKDIPNLKNILLSIPEKQYLRL  355

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            Q RVK+VQ+HFLWH +P +YDIFHMILHS+WY RVF
Sbjct  356  QMRVKKVQQHFLWHKNPVKYDIFHMILHSVWYNRVF  391



>ref|XP_003527840.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X1 [Glycine max]
 ref|XP_006581449.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X2 [Glycine max]
 gb|KHN18172.1| Putative glycosyltransferase [Glycine soja]
Length=633

 Score =   332 bits (850),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 179/217 (82%), Gaps = 5/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+ HMA C+R+LC +D+++G   GKD+SLPET V S RNP +SIGG   SKR  LA
Sbjct  412  APAETKQHMAKCLRALCNADVKQGFVFGKDMSLPETVVRSPRNPTRSIGGNQVSKRKTLA  471

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAGQMHGYVRP LLQHWENKDPDMKIFG + K    ++Y+ +MKSSKYCICA+GYEVNS
Sbjct  472  FFAGQMHGYVRPILLQHWENKDPDMKIFGRLPKSKGNRNYIQYMKSSKYCICAKGYEVNS  531

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVI+SDNFVPPFFE LNWESFAVFVLEKDI NLKNIL+SIP   Y +M
Sbjct  532  PRVVEAILYECVPVILSDNFVPPFFEMLNWESFAVFVLEKDIPNLKNILLSIPRKRYLQM  591

Query  641  QTRVKRVQRHFLWH-PSPQRYDIFHMILHSIWYTRVF  748
            Q  V++VQ+HFLWH  SP +YDIFHMILHSIWY RVF
Sbjct  592  QMMVRKVQQHFLWHNKSPVKYDIFHMILHSIWYNRVF  628



>ref|XP_003527839.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X1 [Glycine max]
 ref|XP_006581450.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X2 [Glycine max]
Length=637

 Score =   332 bits (850),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 180/216 (83%), Gaps = 4/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMA C+R+LC +D++EG  LGKD+SLPETYV +++ P ++IGG   SKR  LA
Sbjct  417  APTETRQHMARCLRALCNADVKEGFVLGKDISLPETYVRNAQKPTRNIGGNRVSKRKTLA  476

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LLQHWENKDP MKIFG + K    ++Y+ +MKSSKYCICA+GYEVNS
Sbjct  477  FFAGGMHGYVRPILLQHWENKDPAMKIFGILPKSKGNRNYIQYMKSSKYCICAKGYEVNS  536

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVI+SDNFVPPFFE LNWESFAVFVLEKDI NLKNIL+SIP+  Y +M
Sbjct  537  PRVVEAILYECVPVILSDNFVPPFFEMLNWESFAVFVLEKDIPNLKNILLSIPQKRYLQM  596

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            Q  V++VQ+HFLWH SP +YDIFHM+LHSIWY RVF
Sbjct  597  QMMVRKVQQHFLWHRSPVKYDIFHMVLHSIWYNRVF  632



>ref|XP_009618889.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nicotiana tomentosiformis]
Length=661

 Score =   332 bits (851),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 178/213 (84%), Gaps = 1/213 (0%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A EETR+ MANCI+S C +DL+EG +LGKD SLPET +  S +P +S+GG  PS+R +LA
Sbjct  447  APEETRHEMANCIKSFCNADLKEGFKLGKDASLPETNI-GSADPSRSLGGKRPSQREFLA  505

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVV  472
            FFAG MHGYVRP LL++W+NKDP+MKIFG M K DY+ HMKSS+YCICARGYEVNSPRVV
Sbjct  506  FFAGSMHGYVRPILLKYWQNKDPNMKIFGQMRKTDYIQHMKSSRYCICARGYEVNSPRVV  565

Query  473  EAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRV  652
            EAISYECVPVIISDNFVPPF ETLNWESFAVFV EKDI NLK+IL SIP   Y ++   V
Sbjct  566  EAISYECVPVIISDNFVPPFLETLNWESFAVFVQEKDIPNLKSILESIPLRRYLKLYNNV  625

Query  653  KRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            K+VQ+HFLWH  P +YDIFHMILHSIWY RVF+
Sbjct  626  KKVQQHFLWHSEPVKYDIFHMILHSIWYNRVFQ  658



>ref|XP_011091069.1| PREDICTED: probable glycosyltransferase At5g11130 [Sesamum indicum]
Length=692

 Score =   333 bits (853),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = +2

Query  122  ETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFA  301
            ET+  MANCIR+LC +D++EG QLGKDVSLPETY+ S +NP + IGG PPS R  LAFFA
Sbjct  477  ETKRLMANCIRALCNADVKEGFQLGKDVSLPETYIQSPQNPMKQIGGNPPSGRKILAFFA  536

Query  302  GQMHGYVRPTLLQHWENKDPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVVEAI  481
            G+MHGYVRP LL++WENKDPDMKIFG M   +Y+ HMK+SKYCICA+GYEVNSPRVVEAI
Sbjct  537  GKMHGYVRPILLKYWENKDPDMKIFGRMQAGNYVWHMKNSKYCICAKGYEVNSPRVVEAI  596

Query  482  SYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRV  661
             Y CVPVI+SDNFVPPFF+ LNWESFAVFVLEKDI NLKNIL+SI E  Y  MQ RV++V
Sbjct  597  IYGCVPVILSDNFVPPFFDVLNWESFAVFVLEKDIPNLKNILVSISERRYVVMQHRVEQV  656

Query  662  QRHFLWHPSPQRYDIFHMILHSIWYTRVFRTV  757
            ++HFLWH  P +YDIFHMILHS+WY RV R+ 
Sbjct  657  RQHFLWHNVPVKYDIFHMILHSVWYNRVLRSA  688



>ref|XP_004148905.1| PREDICTED: probable glycosyltransferase At5g25310-like [Cucumis 
sativus]
 ref|XP_004168762.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At5g25310-like [Cucumis sativus]
 gb|KGN44816.1| hypothetical protein Csa_7G389480 [Cucumis sativus]
Length=684

 Score =   332 bits (852),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 178/217 (82%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MA CIR+LC SD++EG   GKDVSLPET+V  +RNP + +GG P SKRP LA
Sbjct  463  APAETRKYMAKCIRALCNSDVKEGFVFGKDVSLPETFVRVARNPLRDVGGNPSSKRPILA  522

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+R TLL++WE KDPDMKI G M K    K+YL HMK+SKYCICA+GYEVNS
Sbjct  523  FFAGSMHGYLRSTLLEYWERKDPDMKISGPMPKVKGSKNYLWHMKNSKYCICAKGYEVNS  582

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVE+I YECVPVIISDNFVPP FE LNWESFAVFV EKDI NLK IL+SIPE  YREM
Sbjct  583  PRVVESILYECVPVIISDNFVPPLFEVLNWESFAVFVAEKDIPNLKKILLSIPEKRYREM  642

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RVK++Q HFLWH  PQ+YD+FHMILHSIWY R+++
Sbjct  643  QMRVKKLQPHFLWHAKPQKYDMFHMILHSIWYNRLYQ  679



>ref|XP_009765195.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
 ref|XP_009765196.1| PREDICTED: probable glycosyltransferase At5g03795 [Nicotiana 
sylvestris]
Length=659

 Score =   331 bits (848),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 178/213 (84%), Gaps = 1/213 (0%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A EETR+ MANCI+S C +DL+EG +LGKD  LPET +  S +P +S+GG  PS+R +LA
Sbjct  445  APEETRHEMANCIKSFCNADLKEGFKLGKDAPLPETNI-GSADPSRSLGGKRPSQREFLA  503

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVV  472
            FFAG MHGYVRP LL++W+NKDP+MKIFG M K DY+ HMKSS+YCICARGYEVNSPRVV
Sbjct  504  FFAGSMHGYVRPILLKYWQNKDPNMKIFGRMRKTDYIQHMKSSRYCICARGYEVNSPRVV  563

Query  473  EAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRV  652
            EAISYECVPVIISDNF+PPF ETLNWESFAVF+ EKDI NLK+IL SIP   Y ++   V
Sbjct  564  EAISYECVPVIISDNFIPPFLETLNWESFAVFIQEKDIPNLKSILESIPLRRYVKLYHNV  623

Query  653  KRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            K+VQ+HFLWHP P +YDIFHMILHSIWY RVF+
Sbjct  624  KKVQQHFLWHPEPVKYDIFHMILHSIWYNRVFQ  656



>ref|XP_008393870.1| PREDICTED: probable glycosyltransferase At5g03795 [Malus domestica]
Length=676

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 178/215 (83%), Gaps = 4/215 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  MA CIR+LC +D++EG   GKDVSLPETY+ + + P + +GG  PSKRP LA
Sbjct  456  APTETKEIMAMCIRALCNADVKEGFVFGKDVSLPETYIKNDKKPLRDLGGNHPSKRPILA  515

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LLQHWENKDPDM+IFG + K    K+Y+  M+SSKYCICA+GYEVNS
Sbjct  516  FFAGNMHGYVRPILLQHWENKDPDMQIFGRLPKGKGNKNYIRRMQSSKYCICAKGYEVNS  575

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE L WESFAVFVLEKDI NLKNIL+SIP+  Y +M
Sbjct  576  PRVVEAIFYECVPVIISDNFVPPFFEVLKWESFAVFVLEKDIPNLKNILLSIPKKKYLQM  635

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            QTRVK+VQ+HFLWH  P++YDIFHMILH+IWY R+
Sbjct  636  QTRVKKVQQHFLWHAKPEKYDIFHMILHNIWYNRL  670



>ref|XP_002324801.2| hypothetical protein POPTR_0018s00290g [Populus trichocarpa]
 gb|EEF03366.2| hypothetical protein POPTR_0018s00290g [Populus trichocarpa]
Length=707

 Score =   332 bits (851),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/219 (71%), Positives = 176/219 (80%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMANCIR+LC SD + G   GKD +LPET V + +N  + +GG P SKR  LA
Sbjct  485  APTETRQHMANCIRALCNSDAKGGFVFGKDAALPETTVRTPQNLLRDLGGKPASKRSILA  544

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM------DKKDYLVHMKSSKYCICARGYEV  454
            FFAG MHGY+RP LLQHW NKDPD+K+FG +       K +Y  +MKSSKYCICA+G+EV
Sbjct  545  FFAGSMHGYLRPILLQHWGNKDPDVKVFGKLPKVKGRGKMNYPQYMKSSKYCICAKGFEV  604

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLKNIL+SIPEN YR
Sbjct  605  NSPRVVEAIFYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPNLKNILLSIPENKYR  664

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            EMQ RVK+VQ+HFLWH  P +YDIFHMILHS+WY RVF+
Sbjct  665  EMQMRVKKVQQHFLWHARPVKYDIFHMILHSVWYNRVFQ  703



>ref|XP_009367458.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Pyrus x bretschneideri]
Length=669

 Score =   331 bits (848),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 178/215 (83%), Gaps = 4/215 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  MA CIR+LC +D++EG   GKDVSLPETY+ + + P + +GG  PSKRP LA
Sbjct  449  APTETKEIMAMCIRALCNADVKEGFVFGKDVSLPETYIKNDKKPLRDLGGNHPSKRPILA  508

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LLQHWENKDPDM+IFG + K    K+Y+  M+SSKYCICA+GYEVNS
Sbjct  509  FFAGNMHGYVRPILLQHWENKDPDMQIFGRLPKGKGNKNYIRRMQSSKYCICAKGYEVNS  568

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE L WESFAVFVLEKDI NLKNIL+SIP+  Y +M
Sbjct  569  PRVVEAIFYECVPVIISDNFVPPFFEVLKWESFAVFVLEKDIPNLKNILLSIPKKKYLQM  628

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            QTRVK+VQ+HFLWH  P++YDIFHMILH+IWY R+
Sbjct  629  QTRVKKVQQHFLWHAKPEKYDIFHMILHNIWYNRL  663



>ref|XP_009367457.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Pyrus x bretschneideri]
Length=676

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 178/215 (83%), Gaps = 4/215 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  MA CIR+LC +D++EG   GKDVSLPETY+ + + P + +GG  PSKRP LA
Sbjct  456  APTETKEIMAMCIRALCNADVKEGFVFGKDVSLPETYIKNDKKPLRDLGGNHPSKRPILA  515

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LLQHWENKDPDM+IFG + K    K+Y+  M+SSKYCICA+GYEVNS
Sbjct  516  FFAGNMHGYVRPILLQHWENKDPDMQIFGRLPKGKGNKNYIRRMQSSKYCICAKGYEVNS  575

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE L WESFAVFVLEKDI NLKNIL+SIP+  Y +M
Sbjct  576  PRVVEAIFYECVPVIISDNFVPPFFEVLKWESFAVFVLEKDIPNLKNILLSIPKKKYLQM  635

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            QTRVK+VQ+HFLWH  P++YDIFHMILH+IWY R+
Sbjct  636  QTRVKKVQQHFLWHAKPEKYDIFHMILHNIWYNRL  670



>ref|XP_009796848.1| PREDICTED: probable glycosyltransferase At3g07620 [Nicotiana 
sylvestris]
 ref|XP_009796849.1| PREDICTED: probable glycosyltransferase At3g07620 [Nicotiana 
sylvestris]
 ref|XP_009796850.1| PREDICTED: probable glycosyltransferase At3g07620 [Nicotiana 
sylvestris]
 ref|XP_009796851.1| PREDICTED: probable glycosyltransferase At3g07620 [Nicotiana 
sylvestris]
Length=672

 Score =   331 bits (848),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 177/212 (83%), Gaps = 0/212 (0%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A +ET+  MANCIR+LC +D++EG Q GKDVSLPETYV  ++NP + IGG   S+R  LA
Sbjct  456  APQETKRIMANCIRALCNADIKEGFQFGKDVSLPETYVRVAKNPLREIGGKRLSQRRTLA  515

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVV  472
            FFAG MHGY+RP LL +WENKDPDMKIFG +    Y+ +MKSSKYCICA+GYEVNSPRVV
Sbjct  516  FFAGNMHGYLRPILLNYWENKDPDMKIFGKISTGSYVQYMKSSKYCICAKGYEVNSPRVV  575

Query  473  EAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRV  652
            EAI YECVPVIISDNFVPPFFETLNWE+FA+FV EKDI  LK+IL+SIPE TYREMQ RV
Sbjct  576  EAIFYECVPVIISDNFVPPFFETLNWEAFAIFVPEKDIPKLKDILVSIPEKTYREMQRRV  635

Query  653  KRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            K VQRHFLWH  P +YD+F+MILHSIW+ RVF
Sbjct  636  KMVQRHFLWHVKPVKYDVFNMILHSIWHNRVF  667



>gb|KHG03637.1| hypothetical protein F383_28279 [Gossypium arboreum]
Length=644

 Score =   330 bits (846),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 173/217 (80%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+ +MANCIR+LC SD+REG   GKDVSLPET + + + P + +GG PPSKR  LA
Sbjct  423  ATSETKEYMANCIRALCNSDIREGYIFGKDVSLPETTIRNPQRPLRDLGGEPPSKRSILA  482

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LLQ W NKDPDMKIFGTM     K +Y  HMK SKYCIC RGYEVNS
Sbjct  483  FFAGGMHGYLRPILLQQWGNKDPDMKIFGTMHNGKGKLNYAQHMKRSKYCICPRGYEVNS  542

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE LNW+S AVFVLEKDI NLK IL+SIP+  YR+M
Sbjct  543  PRVVEAIFYECVPVIISDNFVPPFFEVLNWDSLAVFVLEKDIANLKKILLSIPDERYRQM  602

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q  VK+ Q+HFLWHP P +YDIFHMILHS+WY RV +
Sbjct  603  QLSVKKAQQHFLWHPRPVKYDIFHMILHSVWYNRVLQ  639



>ref|XP_008451363.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
 ref|XP_008451364.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
 ref|XP_008451365.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
Length=680

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 177/217 (82%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MA CIR+LC SD++EG   GKDVSLPET+V  +RNP + +GG P SKRP LA
Sbjct  459  APAETRKYMAKCIRALCNSDVKEGFVFGKDVSLPETFVRIARNPLRDVGGNPSSKRPILA  518

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+R  LL++WE KDPDMKI G M K    K+YL HMK+SKYCICA+GYEVNS
Sbjct  519  FFAGSMHGYLRSILLEYWEGKDPDMKISGRMPKVKGSKNYLWHMKNSKYCICAKGYEVNS  578

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVE+I YECVPVIISDNFVPP FE LNWESFAVFV EKDI NLK IL+SIPE  YREM
Sbjct  579  PRVVESILYECVPVIISDNFVPPLFEVLNWESFAVFVAEKDIPNLKKILLSIPEKRYREM  638

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RVK++Q HFLWH  PQ+YD+FHMILHSIWY R+++
Sbjct  639  QMRVKKLQPHFLWHAKPQKYDMFHMILHSIWYNRLYQ  675



>ref|XP_002309547.2| hypothetical protein POPTR_0006s25540g [Populus trichocarpa]
 gb|EEE93070.2| hypothetical protein POPTR_0006s25540g [Populus trichocarpa]
Length=705

 Score =   331 bits (849),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 172/219 (79%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMANCIR+LC SD +E    GKD SLPETYV +  NP + +GG   SKR  LA
Sbjct  483  APSETRQHMANCIRALCNSDAKEDFVYGKDASLPETYVLTQENPLRDLGGNRASKRSILA  542

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM------DKKDYLVHMKSSKYCICARGYEV  454
            FFAG MHGY+RP LLQHWENKDPDMKIFG +       K +Y  +MKSSKYCICA+GYEV
Sbjct  543  FFAGSMHGYLRPILLQHWENKDPDMKIFGRLPKVKGRGKMNYARYMKSSKYCICAKGYEV  602

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI YECVPVIISDNFVPPF E LNWESFAVFVLEKDI NLK IL+SIP   YR
Sbjct  603  NSPRVVEAIFYECVPVIISDNFVPPFLEVLNWESFAVFVLEKDIPNLKKILLSIPAKKYR  662

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
             MQ RVKRVQ+HFLWH  P +YD+FHMILHSIWY RVF+
Sbjct  663  RMQMRVKRVQQHFLWHARPVKYDVFHMILHSIWYNRVFQ  701



>ref|XP_010102388.1| putative glycosyltransferase [Morus notabilis]
 gb|EXB93373.1| putative glycosyltransferase [Morus notabilis]
Length=683

 Score =   330 bits (847),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 179/215 (83%), Gaps = 4/215 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+ MA CIR+LC SD++EG   GKDVSLPETY++  +NP + +GG P  KR  LA
Sbjct  463  APAETRHIMATCIRALCNSDVKEGFVFGKDVSLPETYIHLPKNPLRDLGGKPLRKRSTLA  522

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LLQHWENKDPDMKIFG + K    ++Y+  MK+SKYCICA+G+EVNS
Sbjct  523  FFAGSMHGYLRPILLQHWENKDPDMKIFGRLPKSKNNRNYVNFMKTSKYCICAKGFEVNS  582

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI +ECVPVIISD+FVPPFFE LNWESFAVFVLEKDI NLK IL+SIPE  YR+M
Sbjct  583  PRVVEAIFFECVPVIISDDFVPPFFEILNWESFAVFVLEKDIPNLKKILLSIPEKRYRQM  642

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            Q RVK+VQ+HFLWH  P++YDIFHMILHS+WY+R+
Sbjct  643  QMRVKKVQKHFLWHSKPEKYDIFHMILHSVWYSRL  677



>ref|XP_011004724.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
 ref|XP_011004725.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
 ref|XP_011004726.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
Length=707

 Score =   331 bits (848),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 177/219 (81%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMANCIR+LC SD + G   GKD +LPET V + +N  + +GG P S+R  LA
Sbjct  485  APSETRQHMANCIRALCNSDAKGGFVFGKDAALPETTVRTPQNLLRDLGGKPASQRSILA  544

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM------DKKDYLVHMKSSKYCICARGYEV  454
            FFAG+MHGY+RP LLQHW NKDPD+K+FG +       K +Y  +MKSSKYCICA+G+EV
Sbjct  545  FFAGRMHGYLRPILLQHWGNKDPDVKVFGKLPKVKGRGKMNYPQYMKSSKYCICAKGFEV  604

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLKNIL+SIPEN YR
Sbjct  605  NSPRVVEAIFYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPNLKNILLSIPENKYR  664

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            EMQ RVK+VQ+HFLWH  P +YDIFHMILHS+WY RVF+
Sbjct  665  EMQMRVKKVQQHFLWHARPVKYDIFHMILHSVWYNRVFQ  703



>ref|XP_010254024.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Nelumbo nucifera]
Length=700

 Score =   331 bits (848),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 177/218 (81%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMA CI++LC +D+    ++GKDVSLPETYV   R+P + +GG P SKR  LA
Sbjct  480  APSETRQHMALCIKALCNADVSGDFKIGKDVSLPETYVRVPRDPLRDLGGKPLSKRSILA  539

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGYVRP LL++WENKDPDMKIFG M      K +Y+ HMKSSKYCICA+GYEVN
Sbjct  540  FFAGSMHGYVRPILLKYWENKDPDMKIFGRMGRSGKSKMNYIQHMKSSKYCICAKGYEVN  599

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE L+WE+F+VFVLEKDI NLKNIL+SIPE  YR 
Sbjct  600  SPRVVEAIFYECVPVIISDNFVPPFFEVLDWEAFSVFVLEKDIPNLKNILLSIPEEKYRR  659

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q  VK+ QRHFLWH +P +YDIFHMILHS+WY RVF+
Sbjct  660  LQLGVKKAQRHFLWHTTPVKYDIFHMILHSVWYNRVFQ  697



>gb|KDP34147.1| hypothetical protein JCGZ_07718 [Jatropha curcas]
Length=742

 Score =   332 bits (850),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 177/217 (82%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  M+NCIR+LC +D+REG   GKDVSLPET V   +NP + +GG PPS+R  LA
Sbjct  524  APSETRKVMSNCIRALCNADVREGFVFGKDVSLPETNVRMPQNPLRDLGGRPPSQRSILA  583

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKK----DYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LL+HW NKDPDMKI G M K     +Y+ HMKSSKYCICARG+EVNS
Sbjct  584  FFAGSMHGYLRPILLKHWANKDPDMKILGRMPKAKRKMNYVQHMKSSKYCICARGFEVNS  643

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PR+VEAI YECVPVIISDN+VPPFFE LNWESFAVF+LEKDI NLKNIL+SIPE  +R+M
Sbjct  644  PRIVEAIMYECVPVIISDNYVPPFFEVLNWESFAVFILEKDIPNLKNILLSIPEKRFRQM  703

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RVK+VQ+HFLWH  P +YD+FHMILHS+WY RV +
Sbjct  704  QMRVKKVQQHFLWHARPVKYDLFHMILHSVWYNRVMQ  740



>ref|XP_010254018.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Nelumbo nucifera]
 ref|XP_010254019.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Nelumbo nucifera]
 ref|XP_010254020.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Nelumbo nucifera]
 ref|XP_010254021.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Nelumbo nucifera]
 ref|XP_010254022.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Nelumbo nucifera]
 ref|XP_010254023.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Nelumbo nucifera]
Length=703

 Score =   331 bits (848),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 177/218 (81%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMA CI++LC +D+    ++GKDVSLPETYV   R+P + +GG P SKR  LA
Sbjct  483  APSETRQHMALCIKALCNADVSGDFKIGKDVSLPETYVRVPRDPLRDLGGKPLSKRSILA  542

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGYVRP LL++WENKDPDMKIFG M      K +Y+ HMKSSKYCICA+GYEVN
Sbjct  543  FFAGSMHGYVRPILLKYWENKDPDMKIFGRMGRSGKSKMNYIQHMKSSKYCICAKGYEVN  602

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE L+WE+F+VFVLEKDI NLKNIL+SIPE  YR 
Sbjct  603  SPRVVEAIFYECVPVIISDNFVPPFFEVLDWEAFSVFVLEKDIPNLKNILLSIPEEKYRR  662

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q  VK+ QRHFLWH +P +YDIFHMILHS+WY RVF+
Sbjct  663  LQLGVKKAQRHFLWHTTPVKYDIFHMILHSVWYNRVFQ  700



>ref|XP_007161493.1| hypothetical protein PHAVU_001G073700g [Phaseolus vulgaris]
 gb|ESW33487.1| hypothetical protein PHAVU_001G073700g [Phaseolus vulgaris]
Length=646

 Score =   329 bits (843),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 174/216 (81%), Gaps = 4/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  MA CIR+LC +D++EG   GKD SLPETYV +++ P +  GG   SKR  LA
Sbjct  426  APGETKVDMAKCIRALCNADVKEGFVFGKDASLPETYVRNAQIPTKDFGGNSASKRTTLA  485

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LLQHWENKDPDMKIFG + K    K+Y+ +MK+SKYCICA+GYEVNS
Sbjct  486  FFAGSMHGYVRPILLQHWENKDPDMKIFGRLPKSKGNKNYIQYMKTSKYCICAKGYEVNS  545

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE LNWESFAV VLEKDI NLKNIL+SIPE  Y  +
Sbjct  546  PRVVEAIFYECVPVIISDNFVPPFFEVLNWESFAVIVLEKDIPNLKNILLSIPEKEYLRL  605

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            Q RVK+VQ HFLWH +P RYDIFHMILHSIWY R+F
Sbjct  606  QMRVKKVQHHFLWHKNPVRYDIFHMILHSIWYNRIF  641



>ref|XP_003550126.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Glycine max]
 ref|XP_006601068.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Glycine max]
 ref|XP_006601069.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X3 
[Glycine max]
 ref|XP_006601070.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X4 
[Glycine max]
Length=645

 Score =   329 bits (843),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 174/216 (81%), Gaps = 4/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  MANCIRSLC +D++EG   GKD SLPETYV  ++ P + + G   SKR  LA
Sbjct  425  APGETKVDMANCIRSLCNADVKEGFVFGKDASLPETYVRDAKIPTKDLSGNSASKRTTLA  484

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LLQHWENKDPDMKIFG + K    ++Y+ +MKSSKYCICA+GYEVNS
Sbjct  485  FFAGSMHGYVRPILLQHWENKDPDMKIFGRLPKSKGNRNYIQYMKSSKYCICAKGYEVNS  544

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPF E LNWESFAV VLEKDI NLKNIL+SIPE  Y  +
Sbjct  545  PRVVEAIFYECVPVIISDNFVPPFLEVLNWESFAVIVLEKDIPNLKNILLSIPEKQYLRL  604

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            Q RVK+VQ+HFLWH +P +YDIFHMILHS+WY RVF
Sbjct  605  QMRVKKVQQHFLWHKNPVKYDIFHMILHSVWYNRVF  640



>ref|XP_006359775.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=643

 Score =   328 bits (842),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 177/213 (83%), Gaps = 1/213 (0%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A EETR  MANCI+SLC +DLREG + GKD SLPET + S+ NP +S+GG  PS+R +LA
Sbjct  429  APEETRREMANCIKSLCNADLREGFKFGKDASLPETNIVST-NPSRSLGGNRPSQRKFLA  487

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVV  472
            FFAG MHGYVRP LL+HW+NKDP MKIFG MD  DY++HMKSSKYCICARG+EVNSPRVV
Sbjct  488  FFAGSMHGYVRPILLKHWQNKDPMMKIFGRMDNHDYILHMKSSKYCICARGHEVNSPRVV  547

Query  473  EAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRV  652
            E+ISY+CVPVIISDNFVPPF ETLNWE+FAVFV EKDI NLK+IL SIP   Y ++   V
Sbjct  548  ESISYQCVPVIISDNFVPPFLETLNWETFAVFVQEKDIPNLKSILESIPLRRYLKLYNNV  607

Query  653  KRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
             +VQ+HFLWHP P +YD F+MILHSIWY RVF+
Sbjct  608  MKVQQHFLWHPEPVKYDTFYMILHSIWYNRVFQ  640



>ref|XP_007137217.1| hypothetical protein PHAVU_009G109300g [Phaseolus vulgaris]
 gb|ESW09211.1| hypothetical protein PHAVU_009G109300g [Phaseolus vulgaris]
Length=637

 Score =   328 bits (840),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 182/216 (84%), Gaps = 4/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A +ET+  MA C+R+LC +D++EG  LGKDVSLPETYV +++ P ++IGG   SKR  LA
Sbjct  417  APKETKKDMARCLRALCNADVKEGFVLGKDVSLPETYVRNAQRPTRNIGGNRVSKRKTLA  476

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LLQHWENKDPDMKIFGT+ +    ++Y+ +MKSSKYCICA+GYEVNS
Sbjct  477  FFAGGMHGYLRPILLQHWENKDPDMKIFGTLPRSKGNRNYIQYMKSSKYCICAKGYEVNS  536

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI +ECVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLK+IL+SIP+  Y +M
Sbjct  537  PRVVEAIFFECVPVIISDNFVPPFFEMLNWESFAVFVLEKDIPNLKSILLSIPQKRYLQM  596

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            Q  V++VQ+HFLWH +P +YDIFHMILHSIW+ RVF
Sbjct  597  QMMVRKVQQHFLWHRNPVKYDIFHMILHSIWFNRVF  632



>ref|XP_008357412.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Malus domestica]
Length=654

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 176/215 (82%), Gaps = 4/215 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  MA CIR+LC +D++EG  +GKDVSLPETY+ + + P + +GG  PSKR  LA
Sbjct  434  APSETKKIMAKCIRALCNADVKEGFVVGKDVSLPETYIKNDKKPLRDLGGNRPSKRSILA  493

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LLQHWENKDPDM+IFG +      K+Y+ HM+SSKYCICA+GYEVNS
Sbjct  494  FFAGSMHGYVRPILLQHWENKDPDMQIFGQLPEGKGNKNYVRHMQSSKYCICAKGYEVNS  553

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE L WESFAVFVLEKDI NLKNIL+SIP+  Y +M
Sbjct  554  PRVVEAIFYECVPVIISDNFVPPFFEVLQWESFAVFVLEKDIPNLKNILLSIPKKRYLQM  613

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            Q RV+RVQ+HFLWH  P++YDIFHM LH+IWY R+
Sbjct  614  QMRVRRVQQHFLWHAKPEKYDIFHMTLHNIWYNRL  648



>ref|XP_002281263.1| PREDICTED: probable glycosyltransferase At5g03795 [Vitis vinifera]
Length=675

 Score =   328 bits (842),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 178/218 (82%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET   MAN IR+LC SD+REG +LGKDVSLPET V   +NP + +GG PPS+R  LA
Sbjct  448  APSETLKLMANSIRALCNSDIREGFKLGKDVSLPETCVRIPQNPLRQLGGKPPSQRRILA  507

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKK-----DYLVHMKSSKYCICARGYEVN  457
            FFAG MHGYVRP LL++WENKDPDMKI+G M K      +Y+ HMKSSKYCICA+GYEVN
Sbjct  508  FFAGSMHGYVRPILLKYWENKDPDMKIYGRMPKAKKGTMNYIQHMKSSKYCICAKGYEVN  567

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFF  LNWESFAVF+LEKDI NLK+IL+SIPE +Y E
Sbjct  568  SPRVVEAIFYECVPVIISDNFVPPFFGVLNWESFAVFILEKDIPNLKSILLSIPEKSYLE  627

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q RVK+VQ+HFLWH  P +YD+FHMILHS+WY RV +
Sbjct  628  IQMRVKQVQQHFLWHAKPVKYDVFHMILHSVWYNRVLQ  665



>ref|XP_002516500.1| catalytic, putative [Ricinus communis]
 gb|EEF45841.1| catalytic, putative [Ricinus communis]
Length=456

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 181/218 (83%), Gaps = 4/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  M NCIR+LC +D+  G ++GKDVSLPETYV S++NP +++ G PPS+RP LA
Sbjct  236  APAETRGRMLNCIRALCNADIDVGFRIGKDVSLPETYVRSAQNPLKNLDGNPPSQRPILA  295

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG +HG+VRP LL++WENKDP+MKIFG M +     +Y+  MKSSKYCIC RG+EVNS
Sbjct  296  FFAGNVHGFVRPILLEYWENKDPEMKIFGPMPRVKGNTNYIQLMKSSKYCICPRGHEVNS  355

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PR+VE+I YECVPVIISDN+VPPFFE L+WESFAVFVLEKDI NLK IL+SIPE TY EM
Sbjct  356  PRIVESIFYECVPVIISDNYVPPFFEVLDWESFAVFVLEKDIPNLKKILLSIPEETYVEM  415

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
              RVK+VQ+HFLWH  P+++D+FHMILHS+WY RVF+T
Sbjct  416  HKRVKKVQQHFLWHSEPEKHDLFHMILHSVWYNRVFQT  453



>ref|XP_006359765.1| PREDICTED: probable glycosyltransferase At3g07620-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006359766.1| PREDICTED: probable glycosyltransferase At3g07620-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006359767.1| PREDICTED: probable glycosyltransferase At3g07620-like isoform 
X3 [Solanum tuberosum]
Length=669

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  MANCIR+LC +D++EG Q GKDVSLPETY+ + +NP + IGG   SKR  LA
Sbjct  453  APAETKRIMANCIRALCNADIKEGFQFGKDVSLPETYIRAEKNPLREIGGKRLSKRRTLA  512

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVV  472
            FFAG MHGY+RP LL +WENKDPDMKIFG + K  Y+ +MKSSKYCICA+GYEVNSPRVV
Sbjct  513  FFAGNMHGYLRPILLNNWENKDPDMKIFGKISKVSYVQYMKSSKYCICAKGYEVNSPRVV  572

Query  473  EAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRV  652
            EAI YECVPVIISDNF+PPFFETLNWE+FA+FV EKDI  LK+IL+SIP+  YREMQ RV
Sbjct  573  EAIFYECVPVIISDNFIPPFFETLNWEAFAIFVPEKDIPKLKDILVSIPDRRYREMQRRV  632

Query  653  KRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            K VQ+HFLWH  P +YDIF+MILHSIW+ RVF
Sbjct  633  KLVQQHFLWHVKPVKYDIFNMILHSIWHNRVF  664



>ref|XP_008357411.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Malus domestica]
Length=675

 Score =   328 bits (840),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 176/215 (82%), Gaps = 4/215 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  MA CIR+LC +D++EG  +GKDVSLPETY+ + + P + +GG  PSKR  LA
Sbjct  455  APSETKKIMAKCIRALCNADVKEGFVVGKDVSLPETYIKNDKKPLRDLGGNRPSKRSILA  514

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LLQHWENKDPDM+IFG +      K+Y+ HM+SSKYCICA+GYEVNS
Sbjct  515  FFAGSMHGYVRPILLQHWENKDPDMQIFGQLPEGKGNKNYVRHMQSSKYCICAKGYEVNS  574

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE L WESFAVFVLEKDI NLKNIL+SIP+  Y +M
Sbjct  575  PRVVEAIFYECVPVIISDNFVPPFFEVLQWESFAVFVLEKDIPNLKNILLSIPKKRYLQM  634

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            Q RV+RVQ+HFLWH  P++YDIFHM LH+IWY R+
Sbjct  635  QMRVRRVQQHFLWHAKPEKYDIFHMTLHNIWYNRL  669



>ref|XP_011019621.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
 ref|XP_011019622.1| PREDICTED: probable glycosyltransferase At5g03795 [Populus euphratica]
Length=665

 Score =   327 bits (837),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 176/217 (81%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  + NCIR+LC +D+  G  +GKDVSLPETYV S++NP +++ G PPS+RP LA
Sbjct  445  APAETRGPLLNCIRALCNADIEVGFSIGKDVSLPETYVRSAQNPLKNLEGNPPSQRPILA  504

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LL +W NKDPDMKIFG M       +Y+ HMK+SK+CIC RG+EVNS
Sbjct  505  FFAGNMHGYVRPVLLDYWGNKDPDMKIFGPMPHVKGNANYIQHMKNSKFCICPRGHEVNS  564

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PR+VEAI YECVPVIISDNFVPPFFE L+WESFAV VLEKDI NLKNIL+SIPE  Y EM
Sbjct  565  PRIVEAIFYECVPVIISDNFVPPFFEVLDWESFAVIVLEKDIPNLKNILVSIPEEKYIEM  624

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
              RVK+VQ+HFLWH  P++YD+FHMILHS+WY R+FR
Sbjct  625  HKRVKKVQQHFLWHSKPEKYDLFHMILHSVWYNRIFR  661



>ref|XP_004245171.1| PREDICTED: probable glycosyltransferase At3g07620 [Solanum lycopersicum]
 ref|XP_010325096.1| PREDICTED: probable glycosyltransferase At3g07620 [Solanum lycopersicum]
 ref|XP_010325097.1| PREDICTED: probable glycosyltransferase At3g07620 [Solanum lycopersicum]
Length=636

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 176/213 (83%), Gaps = 1/213 (0%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A EETR  MANCI+SLC +DLREG + GKD SLPET + SS NP +S+GG  PS+R +LA
Sbjct  422  APEETRREMANCIKSLCNADLREGFKFGKDASLPETNIVSS-NPSRSLGGNRPSQRKFLA  480

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVV  472
            FFAG MHGYVRP LL++W++KDP MKI+G MD  DY++HMKSSKYCICARG+EVNSPRVV
Sbjct  481  FFAGNMHGYVRPILLKYWQDKDPTMKIYGRMDNHDYILHMKSSKYCICARGHEVNSPRVV  540

Query  473  EAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRV  652
            E+ISY+CVPVIISDNFVPPF ETLNWE+FAVFV EKDI NLK+IL SIP   Y  +   V
Sbjct  541  ESISYQCVPVIISDNFVPPFLETLNWETFAVFVQEKDIPNLKSILESIPLRRYLNLYNNV  600

Query  653  KRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
             +VQ+HFLWHP P +YD F+MILHSIWY RVF+
Sbjct  601  MKVQQHFLWHPQPVKYDTFYMILHSIWYNRVFQ  633



>gb|EYU29276.1| hypothetical protein MIMGU_mgv1a021626mg [Erythranthe guttata]
Length=522

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  MANCIR+LC SD++EG +LG DVSLPET V S + P   IGG PPS R  LA
Sbjct  307  APIETRKLMANCIRALCNSDIKEGFRLGNDVSLPETKVPSPQKPLAKIGGAPPSDRKILA  366

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVV  472
            FFAG+MHGY+RP LL++WENKDPDMKIFG + K  Y  HMK+SKYCICA+GYEVNSPRVV
Sbjct  367  FFAGKMHGYLRPILLKYWENKDPDMKIFGRLKKDSYAWHMKNSKYCICAKGYEVNSPRVV  426

Query  473  EAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRV  652
            EA+   CVPVI+SDNFVPPFFE L+WESFAVFVLEKDI NLKNIL+SI E+ Y EMQ RV
Sbjct  427  EALVNGCVPVILSDNFVPPFFEILDWESFAVFVLEKDIPNLKNILVSISESRYVEMQRRV  486

Query  653  KRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
             +V++HFLWH +P +YD+FHM+LHSIWY RV R
Sbjct  487  TQVRQHFLWHSTPLKYDLFHMVLHSIWYNRVMR  519



>ref|XP_004245169.1| PREDICTED: probable glycosyltransferase At3g07620 [Solanum lycopersicum]
 ref|XP_004245170.1| PREDICTED: probable glycosyltransferase At3g07620 [Solanum lycopersicum]
 ref|XP_010325092.1| PREDICTED: probable glycosyltransferase At3g07620 [Solanum lycopersicum]
 ref|XP_010325093.1| PREDICTED: probable glycosyltransferase At3g07620 [Solanum lycopersicum]
 ref|XP_010325094.1| PREDICTED: probable glycosyltransferase At3g07620 [Solanum lycopersicum]
 ref|XP_010325095.1| PREDICTED: probable glycosyltransferase At3g07620 [Solanum lycopersicum]
Length=647

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  MANCIR+LC +D++EG Q GKDVSLPETY+   +NP + IGG   SKR  LA
Sbjct  431  APAETKRIMANCIRALCNADIKEGFQFGKDVSLPETYIRVEKNPLREIGGKRLSKRRILA  490

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVV  472
            FFAG MHGY+RP LL +WENKDPDMKIFG + K  Y+ +MKSSKYCICA+GYEVNSPRVV
Sbjct  491  FFAGNMHGYLRPILLNNWENKDPDMKIFGKISKVSYVQYMKSSKYCICAKGYEVNSPRVV  550

Query  473  EAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRV  652
            EAI YECVPVIISDNF+PPFFETLNWE+FA+FV EKDI  LK++L+SIP+  YREMQ RV
Sbjct  551  EAIFYECVPVIISDNFIPPFFETLNWEAFAIFVPEKDIPKLKDLLLSIPDRRYREMQRRV  610

Query  653  KRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            K VQ+HFLWH  P +YDIF+MILHSIW+ RVF
Sbjct  611  KLVQQHFLWHVKPVKYDIFNMILHSIWHNRVF  642



>ref|XP_008347627.1| PREDICTED: LOW QUALITY PROTEIN: probable glycosyltransferase 
At5g03795, partial [Malus domestica]
Length=596

 Score =   322 bits (826),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 174/205 (85%), Gaps = 4/205 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+ +MA CIR+LC +D+++G   GKDVSLPETYV++++NP ++IGG  PSKRP LA
Sbjct  392  APTETKKYMARCIRALCNADVKQGFVFGKDVSLPETYVHTAKNPLRNIGGNRPSKRPILA  451

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAGQ+HGYVRP LLQHWENKDPDMKIFG + K    K+Y  HM+SSKYCICA+GYEVNS
Sbjct  452  FFAGQLHGYVRPILLQHWENKDPDMKIFGRLPKGKGNKNYAHHMQSSKYCICAKGYEVNS  511

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE LNW+SFAVF LEKDI NLKNIL+SIPEN Y +M
Sbjct  512  PRVVEAIFYECVPVIISDNFVPPFFEVLNWDSFAVFXLEKDIPNLKNILVSIPENRYLQM  571

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHM  715
            Q RV++VQ+HFLWH  P++YD FHM
Sbjct  572  QMRVRKVQQHFLWHAKPEKYDTFHM  596



>ref|XP_009618892.1| PREDICTED: probable glycosyltransferase At3g07620 [Nicotiana 
tomentosiformis]
 ref|XP_009618893.1| PREDICTED: probable glycosyltransferase At3g07620 [Nicotiana 
tomentosiformis]
 ref|XP_009618894.1| PREDICTED: probable glycosyltransferase At3g07620 [Nicotiana 
tomentosiformis]
 ref|XP_009618895.1| PREDICTED: probable glycosyltransferase At3g07620 [Nicotiana 
tomentosiformis]
Length=676

 Score =   324 bits (831),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A +ET+  MANCIR+LC +D++EG Q GKD SLPETYV  ++NP + IGG   S+R  LA
Sbjct  460  APQETKRIMANCIRALCNADIKEGFQFGKDASLPETYVRVAKNPLREIGGKRLSQRRTLA  519

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVV  472
            FFAG MHGY+RP LL +WENKDPDMKIFG +    Y+ +MKSSKYCICA+GYEVNSPRVV
Sbjct  520  FFAGNMHGYLRPILLNYWENKDPDMKIFGKISTVSYVQYMKSSKYCICAKGYEVNSPRVV  579

Query  473  EAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRV  652
            EAI YECVPVIISDNFVPPFFETLNWE+FA+FV EKDI  LK+IL+SIPE  YREMQ RV
Sbjct  580  EAIFYECVPVIISDNFVPPFFETLNWEAFAIFVPEKDIPKLKDILVSIPEKRYREMQRRV  639

Query  653  KRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            K VQ+HFLWH  P +YD+F+MILHSIW+ RVF
Sbjct  640  KMVQQHFLWHVKPVKYDVFNMILHSIWHNRVF  671



>dbj|BAC42936.1| unknown protein [Arabidopsis thaliana]
Length=270

 Score =   310 bits (794),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 174/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MA CIR+LC SD+ EG   GKDV+LPET +   R P +++GG P S+R  LA
Sbjct  52   APSETRQYMAKCIRALCNSDVSEGFVFGKDVALPETTILVPRRPLRALGGKPVSQRQILA  111

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LLQ+W  N+DPDMKIF  +     KK Y+ +MKSSKYCIC +G+EVN
Sbjct  112  FFAGGMHGYLRPLLLQNWGGNRDPDMKIFSEIPKSKGKKSYMEYMKSSKYCICPKGHEVN  171

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEA+ YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI +LKNIL+SI E  YRE
Sbjct  172  SPRVVEALFYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPDLKNILVSITEERYRE  231

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ RVK VQ+HFLWH  P+R+DIFHMILHSIWY RVF+
Sbjct  232  MQMRVKMVQKHFLWHSKPERFDIFHMILHSIWYNRVFQ  269



>ref|XP_002309546.2| hypothetical protein POPTR_0006s25530g [Populus trichocarpa]
 gb|EEE93069.2| hypothetical protein POPTR_0006s25530g [Populus trichocarpa]
Length=663

 Score =   323 bits (827),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 174/217 (80%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  + NCIR+LC +D+  G  +GKDVSLPETYV S++NP +++ G PPS+RP LA
Sbjct  443  APAETRGPLLNCIRALCNADIEVGFSIGKDVSLPETYVRSAQNPLKNLEGNPPSQRPILA  502

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LL +W NKDPDMKIFG M       +Y+ HMKSSK+CIC RG+EVNS
Sbjct  503  FFAGNMHGYVRPVLLDYWGNKDPDMKIFGPMPHVKGNTNYIQHMKSSKFCICPRGHEVNS  562

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PR+VEAI  ECVPVIISDNFVPPFFE L+WESFAV VLEKDI NLKNIL+SI E  Y EM
Sbjct  563  PRIVEAIFLECVPVIISDNFVPPFFEVLDWESFAVIVLEKDIPNLKNILVSISEEKYIEM  622

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
              RVK+VQ+HFLWH  P++YD+FHMILHS+WY R+FR
Sbjct  623  HKRVKKVQQHFLWHSKPEKYDLFHMILHSVWYNRIFR  659



>gb|AES58630.2| exostosin family protein [Medicago truncatula]
Length=588

 Score =   319 bits (817),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 174/220 (79%), Gaps = 4/220 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  +ANCIRSLC +D++EG   GKD SLPETYV +++ P + +GG   SK+  LA
Sbjct  369  APSETKLRLANCIRSLCNADVKEGFVFGKDASLPETYVRNAQIPTRDLGGNSFSKKTTLA  428

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LL+HWENKDPDMKIFG +       +Y+ +MKSSKYCICA+GYEVNS
Sbjct  429  FFAGSMHGYVRPILLKHWENKDPDMKIFGKLPNSKGNSNYIHYMKSSKYCICAKGYEVNS  488

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE L+WESF+V VLEKDI NLKNIL+SIPE  Y  M
Sbjct  489  PRVVEAIFYECVPVIISDNFVPPFFEVLDWESFSVIVLEKDIPNLKNILLSIPEKRYLSM  548

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRTVQ  760
              RVK+VQ+HFLW+ +P +YDIFHMILHSIWY RVF    
Sbjct  549  LMRVKKVQKHFLWNKNPVKYDIFHMILHSIWYNRVFSATS  588



>ref|XP_009782188.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nicotiana sylvestris]
Length=637

 Score =   320 bits (821),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 178/216 (82%), Gaps = 5/216 (2%)
 Frame = +2

Query  122  ETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFA  301
            ETR+HM +CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LAF+A
Sbjct  419  ETRHHMEHCIKALCNADVTAGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRKILAFYA  478

Query  302  GQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPR  466
            G MHGY+RP LL+HW++KDPDM+IFG M      K +Y+ HMKSSK+CIC +GYEVNSPR
Sbjct  479  GNMHGYLRPILLEHWKDKDPDMEIFGPMPTGVASKMNYIQHMKSSKFCICPKGYEVNSPR  538

Query  467  VVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQT  646
            VVEAI YECVPVIISDNFVPPFFE LNWE+F++ + EKDI NLK+IL++IPE  Y +MQ 
Sbjct  539  VVEAIFYECVPVIISDNFVPPFFEVLNWEAFSLIIAEKDIPNLKSILVAIPEKKYLDMQL  598

Query  647  RVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
             V++VQRHFLWH  P ++D+FHM LHSIWY RVF+T
Sbjct  599  AVRKVQRHFLWHAKPAKFDLFHMTLHSIWYNRVFQT  634



>ref|XP_006353481.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006353482.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X2 [Solanum tuberosum]
Length=674

 Score =   321 bits (823),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 178/216 (82%), Gaps = 5/216 (2%)
 Frame = +2

Query  122  ETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFA  301
            ETR+HM +CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LAF+A
Sbjct  456  ETRHHMEHCIKALCNADVTLGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRKVLAFYA  515

Query  302  GQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPR  466
            G MHGY+RP LL+HW++KDPDM+IFG M      K +Y+ HMKSSK+CIC +GYEVNSPR
Sbjct  516  GNMHGYLRPILLEHWKDKDPDMEIFGPMPSGVASKMNYIQHMKSSKFCICPKGYEVNSPR  575

Query  467  VVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQT  646
            VVEAI YECVPVIISDNFVPPFF  LNW++F++ + EKDI NLK+IL+SIPEN Y EMQ 
Sbjct  576  VVEAIFYECVPVIISDNFVPPFFGVLNWDTFSLILAEKDIPNLKSILLSIPENKYLEMQL  635

Query  647  RVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
             V++VQRHFLWH  P +YD+FHM LHSIWY RVF+T
Sbjct  636  AVRKVQRHFLWHAKPVKYDLFHMTLHSIWYNRVFQT  671



>ref|XP_009782187.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X1 
[Nicotiana sylvestris]
Length=692

 Score =   321 bits (823),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 178/216 (82%), Gaps = 5/216 (2%)
 Frame = +2

Query  122  ETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFA  301
            ETR+HM +CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LAF+A
Sbjct  474  ETRHHMEHCIKALCNADVTAGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRKILAFYA  533

Query  302  GQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPR  466
            G MHGY+RP LL+HW++KDPDM+IFG M      K +Y+ HMKSSK+CIC +GYEVNSPR
Sbjct  534  GNMHGYLRPILLEHWKDKDPDMEIFGPMPTGVASKMNYIQHMKSSKFCICPKGYEVNSPR  593

Query  467  VVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQT  646
            VVEAI YECVPVIISDNFVPPFFE LNWE+F++ + EKDI NLK+IL++IPE  Y +MQ 
Sbjct  594  VVEAIFYECVPVIISDNFVPPFFEVLNWEAFSLIIAEKDIPNLKSILVAIPEKKYLDMQL  653

Query  647  RVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
             V++VQRHFLWH  P ++D+FHM LHSIWY RVF+T
Sbjct  654  AVRKVQRHFLWHAKPAKFDLFHMTLHSIWYNRVFQT  689



>ref|XP_010536232.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Tarenaya hassleriana]
Length=596

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 178/219 (81%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MANCIR++C SD++EG   GKD SLPET+V   R P + +GG P S+RP LA
Sbjct  375  APTETRKYMANCIRAMCNSDVKEGFVFGKDASLPETFVRDLRKPLKDLGGKPASRRPTLA  434

Query  293  FFAGQM-HGYVRPTLLQHW-ENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEV  454
            FFAG+  HGY+RP LL +W +NKDPDMKIFG + +    K+Y+  MK+SKYCICA+GYEV
Sbjct  435  FFAGKPDHGYLRPILLSYWGDNKDPDMKIFGKLPRSKGNKNYIQLMKTSKYCICAKGYEV  494

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVE+I YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLK IL SIPE  YR
Sbjct  495  NSPRVVESIFYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPNLKKILTSIPEKRYR  554

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +MQ RVK+VQ+HFLWH  P++YD+FHMILHS+W+ RVF+
Sbjct  555  QMQMRVKKVQKHFLWHSKPEKYDMFHMILHSVWFNRVFQ  593



>gb|KEH24072.1| exostosin family protein [Medicago truncatula]
Length=487

 Score =   314 bits (804),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 171/216 (79%), Gaps = 4/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET   M  CIRSLC +DL+E   LGKD SLPETYV +++ P + +GG   SKR  LA
Sbjct  267  APSETNERMTKCIRSLCNADLKESFVLGKDTSLPETYVRNAQIPTRGLGGKSVSKRKTLA  326

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LLQHW NKDPDMKIFG + K    K+Y+ +MK SKYCIC +GYEVNS
Sbjct  327  FFAGGMHGYVRPILLQHWGNKDPDMKIFGELPKSKGNKNYIQYMKGSKYCICPKGYEVNS  386

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE LNW+SFAVFV EKDI NLK+IL+SIP   Y +M
Sbjct  387  PRVVEAIMYECVPVIISDNFVPPFFEVLNWKSFAVFVSEKDIPNLKSILLSIPVKKYLQM  446

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            + RVK+VQ+HFLWH SP +YDI+HM+LHSIWY RVF
Sbjct  447  RMRVKKVQQHFLWHRSPVKYDIYHMVLHSIWYNRVF  482



>gb|EYU20438.1| hypothetical protein MIMGU_mgv1a003254mg [Erythranthe guttata]
Length=597

 Score =   317 bits (812),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 175/217 (81%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  MANCIR++C +D+ EG + GKDVSLPET + S +N  + +GG PPS+R  LA
Sbjct  379  APAETKGVMANCIRAMCNADIGEGFKFGKDVSLPETSIRSPQNLLRELGGKPPSQRKILA  438

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKK----DYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LL++WENKDPDMKIFG + K      Y  +MKSSKYCICA+G+EVNS
Sbjct  439  FFAGNMHGYLRPILLKYWENKDPDMKIFGRIRKSKGEMSYAQYMKSSKYCICAKGFEVNS  498

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI +ECVPVI+SDNFVPPFFETL WESFAVFV+EKDI NLKNIL +IP+  Y EM
Sbjct  499  PRVVEAIFFECVPVIVSDNFVPPFFETLKWESFAVFVMEKDIPNLKNILSAIPKRRYVEM  558

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RVK VQ+HFLWH  P +YD+FHMILHSIWY RVF+
Sbjct  559  QRRVKMVQQHFLWHSKPVKYDVFHMILHSIWYNRVFQ  595



>gb|KDP34148.1| hypothetical protein JCGZ_07719 [Jatropha curcas]
Length=607

 Score =   317 bits (813),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 172/217 (79%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  M N +R+LC +D+  G  +GKDVSLPETYV S++NP +++ G PPS+RP LA
Sbjct  387  APAETRGRMLNSVRALCNADIEVGFSIGKDVSLPETYVRSAQNPLKNLEGNPPSQRPILA  446

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG +HGYVRP LL+HWEN+DPDMKIFG M       +Y+ +MKSSKYCIC RG+EVNS
Sbjct  447  FFAGNVHGYVRPILLEHWENRDPDMKIFGPMPHVKGNTNYIQYMKSSKYCICPRGHEVNS  506

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PR+VEAI YECVPVIISDN+VPPFFE L+WESFAVFVLE+DI  LK IL+SI E  Y EM
Sbjct  507  PRIVEAIFYECVPVIISDNYVPPFFEVLDWESFAVFVLEEDIPKLKTILLSISEERYVEM  566

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
              RVK VQ HFLWH  P +YD+FHMILHS+WY RVFR
Sbjct  567  HKRVKMVQHHFLWHSEPVKYDLFHMILHSVWYNRVFR  603



>ref|XP_010259884.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Nelumbo nucifera]
Length=680

 Score =   319 bits (818),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 175/214 (82%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            TR+HM+ CIR+LC +++  G Q+GKDVSLP T V S +NP + +GG PPS+RP LAFFAG
Sbjct  466  TRHHMSKCIRALCNTNIARGFQIGKDVSLPVTSVRSMKNPLRYLGGKPPSERPTLAFFAG  525

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP LLQ+WENKDP+MKIFG M      K +Y+ HM+SSKYCICARGYEV++PRV
Sbjct  526  SMHGYLRPILLQYWENKDPEMKIFGPMPRDIEGKMNYIEHMRSSKYCICARGYEVHTPRV  585

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI YECVPVIISDN+VPPFFE L+WE+FAVF+ EKDI NLKNIL+SIPE  Y  MQ R
Sbjct  586  VEAIFYECVPVIISDNYVPPFFEVLDWEAFAVFIAEKDIPNLKNILLSIPEEVYLAMQLR  645

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            VK+VQ+HFLWH  P +YDIFHM LHSIW  R+++
Sbjct  646  VKKVQQHFLWHSKPVKYDIFHMTLHSIWSNRIYQ  679



>ref|XP_010536229.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Tarenaya hassleriana]
 ref|XP_010536230.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Tarenaya hassleriana]
 ref|XP_010536231.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Tarenaya hassleriana]
Length=640

 Score =   318 bits (814),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 178/219 (81%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MANCIR++C SD++EG   GKD SLPET+V   R P + +GG P S+RP LA
Sbjct  419  APTETRKYMANCIRAMCNSDVKEGFVFGKDASLPETFVRDLRKPLKDLGGKPASRRPTLA  478

Query  293  FFAGQM-HGYVRPTLLQHW-ENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEV  454
            FFAG+  HGY+RP LL +W +NKDPDMKIFG + +    K+Y+  MK+SKYCICA+GYEV
Sbjct  479  FFAGKPDHGYLRPILLSYWGDNKDPDMKIFGKLPRSKGNKNYIQLMKTSKYCICAKGYEV  538

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVE+I YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLK IL SIPE  YR
Sbjct  539  NSPRVVESIFYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPNLKKILTSIPEKRYR  598

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +MQ RVK+VQ+HFLWH  P++YD+FHMILHS+W+ RVF+
Sbjct  599  QMQMRVKKVQKHFLWHSKPEKYDMFHMILHSVWFNRVFQ  637



>ref|XP_010259882.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Nelumbo nucifera]
 ref|XP_010259883.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Nelumbo nucifera]
Length=698

 Score =   319 bits (818),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 175/214 (82%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            TR+HM+ CIR+LC +++  G Q+GKDVSLP T V S +NP + +GG PPS+RP LAFFAG
Sbjct  484  TRHHMSKCIRALCNTNIARGFQIGKDVSLPVTSVRSMKNPLRYLGGKPPSERPTLAFFAG  543

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP LLQ+WENKDP+MKIFG M      K +Y+ HM+SSKYCICARGYEV++PRV
Sbjct  544  SMHGYLRPILLQYWENKDPEMKIFGPMPRDIEGKMNYIEHMRSSKYCICARGYEVHTPRV  603

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI YECVPVIISDN+VPPFFE L+WE+FAVF+ EKDI NLKNIL+SIPE  Y  MQ R
Sbjct  604  VEAIFYECVPVIISDNYVPPFFEVLDWEAFAVFIAEKDIPNLKNILLSIPEEVYLAMQLR  663

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            VK+VQ+HFLWH  P +YDIFHM LHSIW  R+++
Sbjct  664  VKKVQQHFLWHSKPVKYDIFHMTLHSIWSNRIYQ  697



>ref|XP_006412431.1| hypothetical protein EUTSA_v10024793mg [Eutrema salsugineum]
 gb|ESQ53884.1| hypothetical protein EUTSA_v10024793mg [Eutrema salsugineum]
Length=566

 Score =   315 bits (808),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 177/219 (81%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MANCIR+LC SD+ EG   GKDV+LPET +   R P +++GG P S+R  LA
Sbjct  348  APSETRQYMANCIRALCNSDVSEGFVFGKDVALPETTILVPRRPLRALGGKPSSQRQILA  407

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LLQ+W  N+DPDMKIF  +     KK Y+ +MKSSKYCIC +G+EVN
Sbjct  408  FFAGGMHGYLRPRLLQNWGGNRDPDMKIFSEIPKSKGKKSYMEYMKSSKYCICPKGHEVN  467

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEA+ YECVPVIISDNFVPPFFE LNWESFAVFVLE+D+ +LKNIL+SI E+ YRE
Sbjct  468  SPRVVEALFYECVPVIISDNFVPPFFEVLNWESFAVFVLERDVPDLKNILVSITEDRYRE  527

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ RVK VQ+HFLWH  P+R+DIF+MILHSIWY RVF+T
Sbjct  528  MQMRVKMVQKHFLWHSRPERFDIFYMILHSIWYNRVFQT  566



>ref|XP_010420781.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Camelina sativa]
Length=334

 Score =   308 bits (788),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 175/219 (80%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+D+SLPETYV +++NP + +GG PPS+R  LA
Sbjct  113  APYETRHHMEHCIKALCNADVTAGFKIGRDISLPETYVRAAKNPLRDLGGKPPSQRRTLA  172

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+R  LLQHW++KDP+MKIFG M      K +Y+ HMKSSKYCIC +G+EVN
Sbjct  173  FYAGSMHGYLRAILLQHWKDKDPEMKIFGRMPFGVASKMNYIEHMKSSKYCICPKGFEVN  232

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVIISDNFVPPFFE L+W +F+V V EKDI  LK+IL SIPE  Y +
Sbjct  233  SPRVVESIFYECVPVIISDNFVPPFFEVLDWSAFSVIVAEKDIPRLKDILSSIPEEKYVK  292

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ  V++ QRHFLWH  PQRYD+FHM+LHSIWY RVF+ 
Sbjct  293  MQMAVRKAQRHFLWHAKPQRYDLFHMVLHSIWYNRVFQA  331



>gb|KHN10197.1| Putative glycosyltransferase [Glycine soja]
Length=396

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 173/216 (80%), Gaps = 4/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  M +CIR+LC +D+  G ++GKDVSLPETY+ SS NP ++IGG PPSKRP LA
Sbjct  176  APAETRGRMLSCIRALCNADIEVGFKIGKDVSLPETYIRSSENPVKNIGGDPPSKRPILA  235

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG +HGYVRP LL+HWENK+PDMKI G +       +Y+  MKSSK+CICARG+EVNS
Sbjct  236  FFAGGLHGYVRPILLKHWENKEPDMKISGPLPHVRGNVNYIQLMKSSKFCICARGHEVNS  295

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI +EC+PVIISDNF+PPFFE LNWESFAVFV E++I NL+NIL+SI E  Y EM
Sbjct  296  PRVVEAIFHECIPVIISDNFIPPFFEILNWESFAVFVKEEEIPNLRNILLSISEERYLEM  355

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
              R K+VQ HFLWH  P +YD+FHM+LHSIWY R+F
Sbjct  356  HKRAKKVQEHFLWHAEPVKYDLFHMLLHSIWYNRLF  391



>ref|XP_010420780.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Camelina sativa]
Length=357

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 175/219 (80%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+D+SLPETYV +++NP + +GG PPS+R  LA
Sbjct  136  APYETRHHMEHCIKALCNADVTAGFKIGRDISLPETYVRAAKNPLRDLGGKPPSQRRTLA  195

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+R  LLQHW++KDP+MKIFG M      K +Y+ HMKSSKYCIC +G+EVN
Sbjct  196  FYAGSMHGYLRAILLQHWKDKDPEMKIFGRMPFGVASKMNYIEHMKSSKYCICPKGFEVN  255

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVIISDNFVPPFFE L+W +F+V V EKDI  LK+IL SIPE  Y +
Sbjct  256  SPRVVESIFYECVPVIISDNFVPPFFEVLDWSAFSVIVAEKDIPRLKDILSSIPEEKYVK  315

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ  V++ QRHFLWH  PQRYD+FHM+LHSIWY RVF+ 
Sbjct  316  MQMAVRKAQRHFLWHAKPQRYDLFHMVLHSIWYNRVFQA  354



>emb|CDY45017.1| BnaA08g12020D [Brassica napus]
Length=564

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 174/220 (79%), Gaps = 6/220 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MANCIR+LC SD+ EG   GKDV+LPET +   R P +++GG P S+R  LA
Sbjct  345  APSETRQYMANCIRALCNSDVSEGFVFGKDVALPETTILVPRRPLRALGGKPASQRHILA  404

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTMDK-----KDYLVHMKSSKYCICARGYEV  454
            FFAG MHGY+RP LLQ W  N+DPDMKIF  + K     K Y+  MKSSKYCIC +G+EV
Sbjct  405  FFAGGMHGYLRPLLLQTWGGNRDPDMKIFSEIPKSKGKNKSYMEFMKSSKYCICPKGHEV  464

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEA+ YECVPVIISDNFVPPFFE +NWESFAVFVLEKDI +LKNIL+SI E  YR
Sbjct  465  NSPRVVEALFYECVPVIISDNFVPPFFEVINWESFAVFVLEKDIPDLKNILVSISEERYR  524

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            EMQ RVK VQ+HFLWH  P+R+DIFHMILHSIWY RVF+T
Sbjct  525  EMQMRVKMVQKHFLWHSKPERFDIFHMILHSIWYNRVFQT  564



>ref|XP_010546494.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X3 
[Tarenaya hassleriana]
Length=603

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 174/219 (79%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +M NCIR+LC SD+ EG   GKDV+LPET +   R P +++GG PP++RP LA
Sbjct  385  APSETRRYMGNCIRALCNSDVTEGFVFGKDVALPETTILFPRRPLRAVGGKPPTQRPILA  444

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY RP L++ W  +KDPDMKIF  M    D K Y+ +MKSSKYCIC RGYEVN
Sbjct  445  FFAGGMHGYFRPLLVKRWGGSKDPDMKIFSQMSKGKDMKRYIQYMKSSKYCICPRGYEVN  504

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFV+EKD+ +LK IL SIP+  YR+
Sbjct  505  SPRVVEAIFYECVPVIISDNFVPPFFEALNWESFAVFVMEKDVGDLKRILQSIPDEKYRK  564

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ RVK VQ+HFLWH  P++YDIFHMILHS+W+ RVF++
Sbjct  565  MQMRVKMVQKHFLWHAKPEKYDIFHMILHSVWFNRVFQS  603



>ref|XP_009609995.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009609996.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Nicotiana tomentosiformis]
Length=697

 Score =   318 bits (816),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 176/216 (81%), Gaps = 5/216 (2%)
 Frame = +2

Query  122  ETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFA  301
            ETR+HM +CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LAF+A
Sbjct  479  ETRHHMEHCIKALCNADVTVGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRKILAFYA  538

Query  302  GQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPR  466
            G MHGY+RP LL+HW++KDPDM+IFG M      K +Y+ HMKSSK+CIC +GYEVNSPR
Sbjct  539  GNMHGYLRPILLEHWKDKDPDMQIFGPMPSGVASKMNYIQHMKSSKFCICPKGYEVNSPR  598

Query  467  VVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQT  646
            VVEAI YECVPVIISDNFVPP FE LNW++F++ + EKDI NLK IL++IPE  Y +MQ 
Sbjct  599  VVEAIFYECVPVIISDNFVPPLFEVLNWDAFSLIIAEKDIPNLKTILLAIPEKKYLDMQL  658

Query  647  RVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
             V++VQRHFLWH  P +YD+FHM LHSIWY RVF+T
Sbjct  659  AVRKVQRHFLWHAKPAKYDLFHMTLHSIWYNRVFQT  694



>ref|XP_010546487.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Tarenaya hassleriana]
 ref|XP_010546488.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Tarenaya hassleriana]
 ref|XP_010546489.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Tarenaya hassleriana]
 ref|XP_010546490.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Tarenaya hassleriana]
 ref|XP_010546491.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Tarenaya hassleriana]
Length=605

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 174/219 (79%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +M NCIR+LC SD+ EG   GKDV+LPET +   R P +++GG PP++RP LA
Sbjct  387  APSETRRYMGNCIRALCNSDVTEGFVFGKDVALPETTILFPRRPLRAVGGKPPTQRPILA  446

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY RP L++ W  +KDPDMKIF  M    D K Y+ +MKSSKYCIC RGYEVN
Sbjct  447  FFAGGMHGYFRPLLVKRWGGSKDPDMKIFSQMSKGKDMKRYIQYMKSSKYCICPRGYEVN  506

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFV+EKD+ +LK IL SIP+  YR+
Sbjct  507  SPRVVEAIFYECVPVIISDNFVPPFFEALNWESFAVFVMEKDVGDLKRILQSIPDEKYRK  566

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ RVK VQ+HFLWH  P++YDIFHMILHS+W+ RVF++
Sbjct  567  MQMRVKMVQKHFLWHAKPEKYDIFHMILHSVWFNRVFQS  605



>ref|XP_010546495.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X4 
[Tarenaya hassleriana]
Length=602

 Score =   316 bits (809),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 174/219 (79%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +M NCIR+LC SD+ EG   GKDV+LPET +   R P +++GG PP++RP LA
Sbjct  384  APSETRRYMGNCIRALCNSDVTEGFVFGKDVALPETTILFPRRPLRAVGGKPPTQRPILA  443

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY RP L++ W  +KDPDMKIF  M    D K Y+ +MKSSKYCIC RGYEVN
Sbjct  444  FFAGGMHGYFRPLLVKRWGGSKDPDMKIFSQMSKGKDMKRYIQYMKSSKYCICPRGYEVN  503

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFV+EKD+ +LK IL SIP+  YR+
Sbjct  504  SPRVVEAIFYECVPVIISDNFVPPFFEALNWESFAVFVMEKDVGDLKRILQSIPDEKYRK  563

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ RVK VQ+HFLWH  P++YDIFHMILHS+W+ RVF++
Sbjct  564  MQMRVKMVQKHFLWHAKPEKYDIFHMILHSVWFNRVFQS  602



>ref|XP_010546493.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Tarenaya hassleriana]
Length=604

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 174/219 (79%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +M NCIR+LC SD+ EG   GKDV+LPET +   R P +++GG PP++RP LA
Sbjct  386  APSETRRYMGNCIRALCNSDVTEGFVFGKDVALPETTILFPRRPLRAVGGKPPTQRPILA  445

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY RP L++ W  +KDPDMKIF  M    D K Y+ +MKSSKYCIC RGYEVN
Sbjct  446  FFAGGMHGYFRPLLVKRWGGSKDPDMKIFSQMSKGKDMKRYIQYMKSSKYCICPRGYEVN  505

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE LNWESFAVFV+EKD+ +LK IL SIP+  YR+
Sbjct  506  SPRVVEAIFYECVPVIISDNFVPPFFEALNWESFAVFVMEKDVGDLKRILQSIPDEKYRK  565

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ RVK VQ+HFLWH  P++YDIFHMILHS+W+ RVF++
Sbjct  566  MQMRVKMVQKHFLWHAKPEKYDIFHMILHSVWFNRVFQS  604



>ref|XP_006578228.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X2 [Glycine max]
Length=473

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 173/216 (80%), Gaps = 4/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  M +CIR+LC +D+  G ++GKDVSLPETY+ SS NP ++IGG PPSKRP LA
Sbjct  253  APAETRGRMLSCIRALCNADIEVGFKIGKDVSLPETYIRSSENPVKNIGGDPPSKRPILA  312

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG +HGYVRP LL+HWENK+PDMKI G +       +Y+  MKSSK+CICARG+EVNS
Sbjct  313  FFAGGLHGYVRPILLKHWENKEPDMKISGPLPHVRGNVNYIQLMKSSKFCICARGHEVNS  372

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI +EC+PVIISDNF+PPFFE LNWESFAVFV E++I NL+NIL+SI E  Y EM
Sbjct  373  PRVVEAIFHECIPVIISDNFIPPFFEILNWESFAVFVKEEEIPNLRNILLSISEERYLEM  432

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
              R K+VQ HFLWH  P +YD+FHM+LHSIWY R+F
Sbjct  433  HKRAKKVQEHFLWHAEPVKYDLFHMLLHSIWYNRLF  468



>ref|XP_009108830.1| PREDICTED: probable glycosyltransferase At5g03795 [Brassica rapa]
Length=620

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 174/220 (79%), Gaps = 6/220 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MANCIR+LC SD+ EG   GKDV+LPET +   R P +++GG P S+R  LA
Sbjct  401  APSETRQYMANCIRALCNSDVSEGFVFGKDVALPETTILVPRRPLRALGGKPISQRHILA  460

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTMDK-----KDYLVHMKSSKYCICARGYEV  454
            FFAG MHGY+RP LLQ W  N+DPDMKIF  + K     K Y+  MKSSKYCIC +G+EV
Sbjct  461  FFAGGMHGYLRPLLLQTWGGNRDPDMKIFSEIPKSKGKNKSYMEFMKSSKYCICPKGHEV  520

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEA+ YECVPVIISDNFVPPFFE +NWESFAVFVLEKDI +LKNIL+SI E  YR
Sbjct  521  NSPRVVEALFYECVPVIISDNFVPPFFEVINWESFAVFVLEKDIPDLKNILLSISEERYR  580

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            EMQ RVK VQ+HFLWH  P+R+DIFHMILHSIWY RVF+T
Sbjct  581  EMQMRVKMVQKHFLWHSKPERFDIFHMILHSIWYNRVFQT  620



>ref|XP_011081795.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Sesamum indicum]
Length=642

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 177/217 (82%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET   M NCIR+LC +D++ G Q GKDVSLPE YV ++ NP +++GG PPS+R  LA
Sbjct  422  APAETSRIMKNCIRALCNADVKGGFQFGKDVSLPEIYVRNASNPLKNLGGKPPSQRRILA  481

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LL +WENKDPDMKIFG +     +  Y+ +MKSSKYCI A+GYE  +
Sbjct  482  FFAGHMHGYLRPILLNYWENKDPDMKIFGKLRVEKGQMTYIQYMKSSKYCISAKGYEPYT  541

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDN++PPFFETLNWESFAVF+LEKDI NLKNILMSIPE+ Y +M
Sbjct  542  PRVVEAIFYECVPVIISDNYIPPFFETLNWESFAVFILEKDIPNLKNILMSIPEHRYIKM  601

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RV+++Q+HFLWH  P +YD+FHMILHSIW+T++F+
Sbjct  602  QKRVRQIQKHFLWHSKPVKYDVFHMILHSIWWTKIFQ  638



>ref|XP_011081796.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X3 
[Sesamum indicum]
Length=640

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 177/217 (82%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET   M NCIR+LC +D++ G Q GKDVSLPE YV ++ NP +++GG PPS+R  LA
Sbjct  420  APAETSRIMKNCIRALCNADVKGGFQFGKDVSLPEIYVRNASNPLKNLGGKPPSQRRILA  479

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LL +WENKDPDMKIFG +     +  Y+ +MKSSKYCI A+GYE  +
Sbjct  480  FFAGHMHGYLRPILLNYWENKDPDMKIFGKLRVEKGQMTYIQYMKSSKYCISAKGYEPYT  539

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDN++PPFFETLNWESFAVF+LEKDI NLKNILMSIPE+ Y +M
Sbjct  540  PRVVEAIFYECVPVIISDNYIPPFFETLNWESFAVFILEKDIPNLKNILMSIPEHRYIKM  599

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RV+++Q+HFLWH  P +YD+FHMILHSIW+T++F+
Sbjct  600  QKRVRQIQKHFLWHSKPVKYDVFHMILHSIWWTKIFQ  636



>ref|NP_195005.1| Exostosin family protein [Arabidopsis thaliana]
 emb|CAA18582.1| putative protein [Arabidopsis thaliana]
 emb|CAB79996.1| putative protein [Arabidopsis thaliana]
 gb|AEE86119.1| Exostosin family protein [Arabidopsis thaliana]
 gb|AHL38666.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=593

 Score =   314 bits (805),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 174/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MA CIR+LC SD+ EG   GKDV+LPET +   R P +++GG P S+R  LA
Sbjct  375  APSETRQYMAKCIRALCNSDVSEGFVFGKDVALPETTILVPRRPLRALGGKPVSQRQILA  434

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LLQ+W  N+DPDMKIF  +     KK Y+ +MKSSKYCIC +G+EVN
Sbjct  435  FFAGGMHGYLRPLLLQNWGGNRDPDMKIFSEIPKSKGKKSYMEYMKSSKYCICPKGHEVN  494

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEA+ YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI +LKNIL+SI E  YRE
Sbjct  495  SPRVVEALFYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPDLKNILVSITEERYRE  554

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ RVK VQ+HFLWH  P+R+DIFHMILHSIWY RVF+
Sbjct  555  MQMRVKMVQKHFLWHSKPERFDIFHMILHSIWYNRVFQ  592



>ref|XP_002869243.1| exostosin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45502.1| exostosin family protein [Arabidopsis lyrata subsp. lyrata]
Length=583

 Score =   314 bits (804),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 176/219 (80%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MA CIR+LC SD+ EG   GKDV+LPET +   R P +++GG P S+R  LA
Sbjct  365  APSETRQYMAKCIRALCNSDVSEGFVFGKDVALPETTILVPRRPLRALGGKPVSQRQILA  424

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LL++W  N+DPDMKIF  +     KK Y+ +MKSSK+CIC +G+EVN
Sbjct  425  FFAGGMHGYLRPLLLRNWGGNRDPDMKIFSEIPKSKGKKSYMEYMKSSKFCICPKGHEVN  484

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEA+ YECVPVIISDNFVPPFFE LNWE+FAVFVLEKDI +LKNIL+SI E  YRE
Sbjct  485  SPRVVEALFYECVPVIISDNFVPPFFEVLNWEAFAVFVLEKDIPDLKNILVSITEERYRE  544

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQTRVK VQ+HFLWH  P+R+DIFHMILHSIWY RVF++
Sbjct  545  MQTRVKMVQKHFLWHSKPERFDIFHMILHSIWYNRVFQS  583



>ref|XP_007137218.1| hypothetical protein PHAVU_009G109400g [Phaseolus vulgaris]
 gb|ESW09212.1| hypothetical protein PHAVU_009G109400g [Phaseolus vulgaris]
Length=619

 Score =   315 bits (806),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 175/220 (80%), Gaps = 4/220 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  M +CIR+LC +D+  G ++GKDVSLPETY+ SS NP ++IGG PPS++P LA
Sbjct  399  APAETRGRMLSCIRALCNADIEVGFKIGKDVSLPETYIRSSENPVKNIGGNPPSQKPILA  458

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG +HGYVRP LL HWENK+PDM I  T+      ++Y+  MKSSK+CICARG+EVNS
Sbjct  459  FFAGGLHGYVRPILLNHWENKEPDMIISETLPHVRGNRNYIQFMKSSKFCICARGHEVNS  518

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI +EC+PVIISDNF+PP FE LNWESFAVFV E+DI NL+NIL+SI E  Y EM
Sbjct  519  PRVVEAIFHECIPVIISDNFIPPLFEILNWESFAVFVAEEDIPNLRNILLSISEERYLEM  578

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRTVQ  760
              RVK+VQ HF+WH  P +YD+FHM+LHSIWY R+F+T Q
Sbjct  579  HKRVKKVQEHFIWHAEPVKYDLFHMLLHSIWYNRLFQTNQ  618



>ref|XP_011081793.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Sesamum indicum]
 ref|XP_011081794.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Sesamum indicum]
Length=678

 Score =   316 bits (810),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 177/217 (82%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET   M NCIR+LC +D++ G Q GKDVSLPE YV ++ NP +++GG PPS+R  LA
Sbjct  458  APAETSRIMKNCIRALCNADVKGGFQFGKDVSLPEIYVRNASNPLKNLGGKPPSQRRILA  517

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LL +WENKDPDMKIFG +     +  Y+ +MKSSKYCI A+GYE  +
Sbjct  518  FFAGHMHGYLRPILLNYWENKDPDMKIFGKLRVEKGQMTYIQYMKSSKYCISAKGYEPYT  577

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDN++PPFFETLNWESFAVF+LEKDI NLKNILMSIPE+ Y +M
Sbjct  578  PRVVEAIFYECVPVIISDNYIPPFFETLNWESFAVFILEKDIPNLKNILMSIPEHRYIKM  637

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RV+++Q+HFLWH  P +YD+FHMILHSIW+T++F+
Sbjct  638  QKRVRQIQKHFLWHSKPVKYDVFHMILHSIWWTKIFQ  674



>ref|XP_003523741.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X1 [Glycine max]
Length=619

 Score =   314 bits (805),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 173/216 (80%), Gaps = 4/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  M +CIR+LC +D+  G ++GKDVSLPETY+ SS NP ++IGG PPSKRP LA
Sbjct  399  APAETRGRMLSCIRALCNADIEVGFKIGKDVSLPETYIRSSENPVKNIGGDPPSKRPILA  458

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG +HGYVRP LL+HWENK+PDMKI G +       +Y+  MKSSK+CICARG+EVNS
Sbjct  459  FFAGGLHGYVRPILLKHWENKEPDMKISGPLPHVRGNVNYIQLMKSSKFCICARGHEVNS  518

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI +EC+PVIISDNF+PPFFE LNWESFAVFV E++I NL+NIL+SI E  Y EM
Sbjct  519  PRVVEAIFHECIPVIISDNFIPPFFEILNWESFAVFVKEEEIPNLRNILLSISEERYLEM  578

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
              R K+VQ HFLWH  P +YD+FHM+LHSIWY R+F
Sbjct  579  HKRAKKVQEHFLWHAEPVKYDLFHMLLHSIWYNRLF  614



>gb|EYU20439.1| hypothetical protein MIMGU_mgv1a003679mg [Erythranthe guttata]
Length=570

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 170/217 (78%), Gaps = 4/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET   M NCIR+LC +D+ EG    KDVS+PETYV    NP + IGG PPS+R  LA
Sbjct  350  APAETSRIMKNCIRALCNADVSEGFHFSKDVSIPETYVRHPTNPLKDIGGKPPSQRKILA  409

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMD----KKDYLVHMKSSKYCICARGYEVNS  460
            FFAG++HGY+RP LL HWENKDPDMKI G +        Y+ +MKSSKYCI A+GYE  +
Sbjct  410  FFAGKLHGYLRPILLNHWENKDPDMKISGKLQGLKGNLTYIEYMKSSKYCISAKGYEAYT  469

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFETLNWESFAVFV+EKDI NLKNIL++IP+  Y EM
Sbjct  470  PRVVEAIFYECVPVIISDNFVPPFFETLNWESFAVFVMEKDIPNLKNILLAIPKKRYVEM  529

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RV+ VQ+HFLWH SP +YD+FHMILHS+WY RVF+
Sbjct  530  QERVRGVQKHFLWHRSPVKYDVFHMILHSVWYNRVFQ  566



>ref|XP_010451075.1| PREDICTED: probable glycosyltransferase At5g25310 [Camelina sativa]
Length=610

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 175/219 (80%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MA CIR+LC SD+ EG   GKDV+LPET +   R P +++GG P S+R  LA
Sbjct  392  APSETRQYMAKCIRALCNSDVSEGFVFGKDVALPETTILVPRRPLRALGGKPVSQRQILA  451

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LLQ+W  N+DPDMKIF  +     KK Y+ +MKS+KYCIC +G+EVN
Sbjct  452  FFAGGMHGYLRPLLLQNWGGNRDPDMKIFSEIPKSKGKKSYMEYMKSTKYCICPKGHEVN  511

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEA+ YECVPVIISDNFVPPFFE LNWESFAVFVLE+DI +LKNIL+SI E  YRE
Sbjct  512  SPRVVEALFYECVPVIISDNFVPPFFEVLNWESFAVFVLERDIPDLKNILLSITEERYRE  571

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ RVK VQ+HFLWH  P+R+DIFHMILHSIWY RVF++
Sbjct  572  MQKRVKMVQKHFLWHSKPERFDIFHMILHSIWYNRVFQS  610



>ref|XP_004503465.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X1 [Cicer arietinum]
 ref|XP_004503466.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X2 [Cicer arietinum]
 ref|XP_004503467.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X3 [Cicer arietinum]
Length=596

 Score =   313 bits (802),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 174/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC SD+ +G ++G+DVSLPETY+ S RNPQ+ IGG PP +R  LA
Sbjct  375  APYETRHHMEYCIKALCNSDVTQGYKIGRDVSLPETYIRSVRNPQRDIGGKPPHQRTILA  434

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL+HW++KDP+MKIFG M      K +Y+ HMK+SKYCIC RGYEVN
Sbjct  435  FYAGNMHGYLRPILLKHWKDKDPNMKIFGPMPHGIASKMNYIQHMKNSKYCICPRGYEVN  494

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPP FE LNW++F++ + EKDI NLK IL+S+PE  Y  
Sbjct  495  SPRVVEAIFYECVPVIISDNFVPPLFEVLNWDAFSLILAEKDIPNLKQILLSVPEKKYLN  554

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q  V+RVQ+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  555  LQLGVRRVQKHFLWHTKPLKYDLFHMTLHSIWYNRVFQ  592



>ref|XP_004245168.1| PREDICTED: probable glycosyltransferase At3g07620 [Solanum lycopersicum]
Length=548

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = +2

Query  137  MANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHG  316
            M+NCIRSLC +DLR G QLGKDVSLP+  +  S NP   +GG P SKR  LAFFAG MHG
Sbjct  340  MSNCIRSLCNADLRGGFQLGKDVSLPQPNIRLSTNPLAELGGKPASKRRTLAFFAGHMHG  399

Query  317  YVRPTLLQHWENKDPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVVEAISYECV  496
            Y+RP LL+HWEN+DPDMKI+G + K  YL +MKSSKYCICARG +VNSPRVVEAI Y C+
Sbjct  400  YLRPVLLKHWENRDPDMKIYGGITKASYLRYMKSSKYCICARGSQVNSPRVVEAIYYGCI  459

Query  497  PVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQRHFL  676
            PVI+SDN+VPP FETLNWESFAVFV EKDI NLKNIL+SIP+  Y++M  RVK+VQ++FL
Sbjct  460  PVILSDNYVPPLFETLNWESFAVFVQEKDIPNLKNILLSIPDKKYKQMHGRVKQVQQYFL  519

Query  677  WHPSPQRYDIFHMILHSIWYTRVF  748
            W+  P +YD+FHMILHS+W+ RVF
Sbjct  520  WNIKPSKYDVFHMILHSVWHNRVF  543



>emb|CDP03281.1| unnamed protein product [Coffea canephora]
Length=689

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 175/215 (81%), Gaps = 5/215 (2%)
 Frame = +2

Query  122  ETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFA  301
            ETR+HM +C+++LC +D+  G ++G+DVSLPETYV S+RNP + +GG P S+R  +AF+A
Sbjct  471  ETRHHMEHCMKALCNADVTLGFKIGRDVSLPETYVRSARNPLRDLGGKPASERHTVAFYA  530

Query  302  GQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPR  466
            G MHGY+RP LL+HW++KDPDMKIFG M      K +Y+ HMKSSKYCIC RGYEVNSPR
Sbjct  531  GNMHGYLRPILLKHWKDKDPDMKIFGPMPPGVASKMNYIQHMKSSKYCICPRGYEVNSPR  590

Query  467  VVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQT  646
            VVEAI YECVPVIISDNFVPPFFE LNW +F+V + EKDI NLK IL+SIPE  Y EMQ+
Sbjct  591  VVEAIFYECVPVIISDNFVPPFFEVLNWSAFSVILAEKDIPNLKEILLSIPEAKYLEMQS  650

Query  647  RVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
             V++VQ+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  651  GVRKVQQHFLWHAKPVKYDLFHMTLHSIWYNRVFQ  685



>ref|XP_008462761.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
Length=664

 Score =   314 bits (805),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 179/218 (82%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG P S+R  LA
Sbjct  443  APYETRHHMEHCIKALCNADVTVGFKIGRDVSLPETYVRSARNPLRDLGGKPASQRHILA  502

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGYVRP LL++W++K+PDMKIFG M      K +Y+ HMKSSKYCIC +GYEVN
Sbjct  503  FYAGNMHGYVRPILLKYWKDKNPDMKIFGPMPPGVASKMNYIQHMKSSKYCICPKGYEVN  562

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE L+WE+F+V V EKDI NL++IL+SIP++ Y E
Sbjct  563  SPRVVEAIFYECVPVIISDNFVPPFFEVLDWEAFSVIVAEKDIPNLQDILLSIPKDRYLE  622

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ RV++VQ+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  623  MQLRVRKVQKHFLWHAKPLKYDLFHMTLHSIWYNRVFQ  660



>ref|XP_006287301.1| hypothetical protein CARUB_v10000494mg [Capsella rubella]
 gb|EOA20199.1| hypothetical protein CARUB_v10000494mg [Capsella rubella]
Length=613

 Score =   313 bits (801),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 174/216 (81%), Gaps = 5/216 (2%)
 Frame = +2

Query  122  ETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFA  301
            ETR+HM +CI++LC +D+  G ++G+D+SLPETYV +++NPQ+ +GG PPS+R  LAF+A
Sbjct  395  ETRHHMEHCIKALCNADVTAGFKIGRDISLPETYVRAAKNPQRDLGGKPPSQRRTLAFYA  454

Query  302  GQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPR  466
            G MHGY+R  LLQHW++KDP+MKIFG M      K +Y+  MKSSKYCIC +GYEVNSPR
Sbjct  455  GSMHGYLRAILLQHWKDKDPEMKIFGRMPLGVASKMNYIEQMKSSKYCICPKGYEVNSPR  514

Query  467  VVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQT  646
            VVE+I YECVPVIISDNFVPPFFE L+W +F+V + EKDI  LK+IL SIPE  Y +MQ 
Sbjct  515  VVESIFYECVPVIISDNFVPPFFEVLDWSAFSVIIAEKDIPRLKDILSSIPEEKYVKMQM  574

Query  647  RVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
             V++ QRHFLWH  PQRYD+FHM+LHSIWY RVF+ 
Sbjct  575  AVRKAQRHFLWHAKPQRYDLFHMVLHSIWYNRVFQA  610



>ref|XP_004148727.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cucumis 
sativus]
 ref|XP_004161331.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cucumis 
sativus]
 gb|KGN65348.1| hypothetical protein Csa_1G364960 [Cucumis sativus]
Length=664

 Score =   314 bits (805),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 179/218 (82%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG P S+R  LA
Sbjct  443  APYETRHHMEHCIKALCNADVTVGFKIGRDVSLPETYVRSARNPLRDLGGKPASQRHILA  502

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGYVRP LL++W++K+PDMKIFG M      K +Y+ HMKSSKYCIC +GYEVN
Sbjct  503  FYAGNMHGYVRPILLKYWKDKNPDMKIFGPMPPGVASKMNYIQHMKSSKYCICPKGYEVN  562

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE L+WE+F+V V EKDI NL++IL+SIP++ Y E
Sbjct  563  SPRVVEAIFYECVPVIISDNFVPPFFEVLDWEAFSVIVAEKDIPNLQDILLSIPKDRYLE  622

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ RV++VQ+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  623  MQLRVRKVQKHFLWHAKPLKYDLFHMTLHSIWYNRVFQ  660



>gb|KDO66501.1| hypothetical protein CISIN_1g005796mg [Citrus sinensis]
 gb|KDO66502.1| hypothetical protein CISIN_1g005796mg [Citrus sinensis]
Length=677

 Score =   314 bits (804),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 179/218 (82%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G +LG+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  456  APYETRHHMEHCIKALCNADVTAGFKLGRDVSLPETYVRSARNPLRDLGGKPPSQRHILA  515

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG +HGY+RP LL++W++KDPDMKIFG M      K +Y+ HMKSSKYCIC +GYEVN
Sbjct  516  FYAGNLHGYLRPILLKYWKDKDPDMKIFGPMPPGVASKMNYIQHMKSSKYCICPKGYEVN  575

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVIISDNFVPPF+E LNWE+F+V + E++I NLK+IL+SIPE  Y E
Sbjct  576  SPRVVESIFYECVPVIISDNFVPPFYEVLNWEAFSVIIAEENIPNLKDILLSIPEKKYFE  635

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  V+++QRHFLWH  P++YD+FHM LHSIWY RV++
Sbjct  636  MQFAVRKLQRHFLWHAKPEKYDLFHMTLHSIWYNRVYQ  673



>ref|XP_009352528.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Pyrus x bretschneideri]
Length=507

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 174/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC +DL  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  286  APYETRHHMELCIKALCNADLTSGFKIGRDVSLPETYVRSARNPLRDLGGKPPSRREILA  345

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL+HW++KDPDMKIFG M      K +Y+ HM+ SKYCIC +G+EVN
Sbjct  346  FYAGNMHGYLRPILLEHWKDKDPDMKIFGPMPPGVASKMNYIHHMQDSKYCICPKGFEVN  405

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE L+W +F+V + EKDI  LK IL+SIPE  Y +
Sbjct  406  SPRVVEAIFYECVPVIISDNFVPPFFEVLDWGAFSVILAEKDIPKLKEILVSIPEEKYLQ  465

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q  V+++Q+HFLWHP P +YD+FHM LHSIWY RVF+
Sbjct  466  LQLGVRKIQKHFLWHPKPLKYDLFHMTLHSIWYNRVFQ  503



>gb|AET05220.2| exostosin family protein [Medicago truncatula]
Length=614

 Score =   312 bits (800),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 173/218 (79%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC SD+ +G ++G+DVSLPET V S RNPQ+ +GG PP +R  LA
Sbjct  391  APYETRHHMEYCIKALCNSDVTQGFKIGRDVSLPETMVRSVRNPQRDLGGKPPQQRSILA  450

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+R  LL+HW+ KDPDMKIFG M      K +Y+ HMKSSKYCIC +GYEVN
Sbjct  451  FYAGNMHGYLRSILLKHWKEKDPDMKIFGPMPHGVAHKMNYIEHMKSSKYCICPKGYEVN  510

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE LNW+SF++ + EKDI NLK IL+S+PE  Y +
Sbjct  511  SPRVVEAIFYECVPVIISDNFVPPFFEVLNWDSFSLILAEKDIPNLKQILLSVPEEKYLK  570

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q  V+RVQ+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  571  LQLGVRRVQKHFLWHTKPLKYDLFHMTLHSIWYNRVFQ  608



>ref|XP_006451253.1| hypothetical protein CICLE_v10007651mg [Citrus clementina]
 ref|XP_006494321.1| PREDICTED: probable glycosyltransferase At5g03795-like [Citrus 
sinensis]
 gb|ESR64493.1| hypothetical protein CICLE_v10007651mg [Citrus clementina]
Length=677

 Score =   314 bits (804),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 179/218 (82%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G +LG+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  456  APYETRHHMEHCIKALCNADVTAGFKLGRDVSLPETYVRSARNPLRDLGGKPPSQRHILA  515

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG +HGY+RP LL++W++KDPDMKIFG M      K +Y+ HMKSSKYCIC +GYEVN
Sbjct  516  FYAGNLHGYLRPILLKYWKDKDPDMKIFGPMPPGVASKMNYIQHMKSSKYCICPKGYEVN  575

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVIISDNFVPPF+E LNWE+F+V + E++I NLK+IL+SIPE  Y E
Sbjct  576  SPRVVESIFYECVPVIISDNFVPPFYEVLNWEAFSVIIAEENIPNLKDILLSIPEKKYFE  635

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  V+++QRHFLWH  P++YD+FHM LHSIWY RV++
Sbjct  636  MQFAVRKLQRHFLWHAKPEKYDLFHMTLHSIWYNRVYQ  673



>emb|CDY49323.1| BnaC03g66910D [Brassica napus]
Length=568

 Score =   311 bits (796),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 173/220 (79%), Gaps = 6/220 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +M+N IR+LC SD+ EG   GKDV+LPET +   R P +++GG P S+R  LA
Sbjct  349  APSETRQYMSNSIRALCNSDVSEGFVFGKDVALPETTILVPRRPLRALGGKPASQRHILA  408

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTMDK-----KDYLVHMKSSKYCICARGYEV  454
            FFAG MHGY+RP LLQ W  N+DPDMKIF  + K     K Y+  MKSSKYCIC +G+EV
Sbjct  409  FFAGGMHGYLRPLLLQTWGGNRDPDMKIFSEIPKSKGKNKSYMEFMKSSKYCICPKGHEV  468

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEA+ YECVPVIISDNFVPPFFE +NWESFAVFVLEKDI +LKNIL+SI E  YR
Sbjct  469  NSPRVVEALFYECVPVIISDNFVPPFFEVINWESFAVFVLEKDIPDLKNILLSISEERYR  528

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            EMQ RVK VQ+HFLWH  P+R+DIFHMILHSIWY RVF+T
Sbjct  529  EMQMRVKMVQKHFLWHSKPERFDIFHMILHSIWYNRVFQT  568



>ref|XP_010313735.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Solanum lycopersicum]
Length=586

 Score =   311 bits (796),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 175/216 (81%), Gaps = 5/216 (2%)
 Frame = +2

Query  122  ETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFA  301
            ETR+HM +CI++LC +D+  G ++G+DVSL ETYV S+RNP + +GG P S+R  LAF+A
Sbjct  368  ETRHHMEHCIKALCNADVTLGFKIGRDVSLAETYVRSARNPLRDLGGKPASQRKVLAFYA  427

Query  302  GQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPR  466
            G MHGY+RP LL+HW++KDPDM+IFG M      K +Y+ HMKSSK+CIC +GYEVNSPR
Sbjct  428  GNMHGYLRPILLEHWKDKDPDMEIFGPMPSGVASKMNYIQHMKSSKFCICPKGYEVNSPR  487

Query  467  VVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQT  646
            VVEAI YECVPVIISDNFVPPFF  LNW++F++ + EKDI NLK+IL+SIPE  Y +MQ 
Sbjct  488  VVEAIFYECVPVIISDNFVPPFFGVLNWDTFSLILAEKDIPNLKSILLSIPEKKYLDMQL  547

Query  647  RVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
             +++VQRHFLWH  P +YD+FHM LHSIWY RVF+T
Sbjct  548  AIRKVQRHFLWHAKPVKYDLFHMTLHSIWYNRVFQT  583



>ref|XP_010437853.1| PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa]
Length=569

 Score =   310 bits (795),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 172/219 (79%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MA CIR+LC SD+ EG   GKDV+LPET +   R P +++GG P S+R  LA
Sbjct  351  APSETRQYMAKCIRALCNSDVSEGFVFGKDVALPETTILVPRRPLRALGGKPVSQRQILA  410

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LLQ W  N+DPDMKIF  +     KK Y+  MKS+KYCIC +G+EVN
Sbjct  411  FFAGGMHGYLRPLLLQSWGGNRDPDMKIFSEIPKSKGKKSYMECMKSTKYCICPKGHEVN  470

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEA+ YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI +LKNIL+SI E  YRE
Sbjct  471  SPRVVEALFYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPDLKNILLSITEERYRE  530

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            M  RVK VQ+HFLWH  P+R+DIFHMILHSIWY RVF++
Sbjct  531  MHKRVKMVQKHFLWHSKPERFDIFHMILHSIWYNRVFQS  569



>ref|XP_010432662.1| PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa]
 ref|XP_010432663.1| PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa]
 ref|XP_010432664.1| PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa]
Length=579

 Score =   311 bits (796),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 173/219 (79%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MA CIR+LC SD+ EG  LGKDV+LPET +   R P  ++GG P S+R  LA
Sbjct  361  APSETRQYMAKCIRALCNSDVSEGFVLGKDVALPETTILVPRRPLGALGGKPVSQRQILA  420

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LLQ W  N+DPDMKIF  +     KK Y+ +MKS+KYCIC +G+EVN
Sbjct  421  FFAGGMHGYLRPLLLQSWGGNRDPDMKIFSEIPKSKGKKSYMEYMKSTKYCICPKGHEVN  480

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEA+ YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI +LKNIL+SI E  YRE
Sbjct  481  SPRVVEALFYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPDLKNILLSITEERYRE  540

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            M  RVK VQ+HFLWH  P+R+DIFHMIL+SIWY RVF++
Sbjct  541  MHKRVKMVQKHFLWHSKPERFDIFHMILNSIWYNRVFQS  579



>ref|XP_003630744.1| Xylogalacturonan beta-1,3-xylosyltransferase [Medicago truncatula]
Length=653

 Score =   313 bits (801),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 173/218 (79%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC SD+ +G ++G+DVSLPET V S RNPQ+ +GG PP +R  LA
Sbjct  430  APYETRHHMEYCIKALCNSDVTQGFKIGRDVSLPETMVRSVRNPQRDLGGKPPQQRSILA  489

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+R  LL+HW+ KDPDMKIFG M      K +Y+ HMKSSKYCIC +GYEVN
Sbjct  490  FYAGNMHGYLRSILLKHWKEKDPDMKIFGPMPHGVAHKMNYIEHMKSSKYCICPKGYEVN  549

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE LNW+SF++ + EKDI NLK IL+S+PE  Y +
Sbjct  550  SPRVVEAIFYECVPVIISDNFVPPFFEVLNWDSFSLILAEKDIPNLKQILLSVPEEKYLK  609

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q  V+RVQ+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  610  LQLGVRRVQKHFLWHTKPLKYDLFHMTLHSIWYNRVFQ  647



>ref|XP_006283300.1| hypothetical protein CARUB_v10004339mg, partial [Capsella rubella]
 gb|EOA16198.1| hypothetical protein CARUB_v10004339mg, partial [Capsella rubella]
Length=645

 Score =   312 bits (800),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 175/219 (80%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR +MA CIR+LC SD+ EG   GKDV+LPET +   R P +++GG P S+R  LA
Sbjct  427  APSETRQYMAKCIRALCNSDVSEGFVFGKDVALPETTILVPRRPLRALGGKPISQRQILA  486

Query  293  FFAGQMHGYVRPTLLQHWE-NKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LLQ+W  N+DPDMKIF  +     KK Y+ +MKS+KYCIC +G+EVN
Sbjct  487  FFAGGMHGYLRPLLLQNWGGNRDPDMKIFSEIPKSKGKKSYMEYMKSTKYCICPKGHEVN  546

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEA+ YECVPVIISDNFVPPFFE LNWESFAVFVLEKDI +LKNIL+SI +  YRE
Sbjct  547  SPRVVEALFYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPDLKNILVSITDERYRE  606

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ RVK VQ+HFLWH  P+R+DIFHMILHSIWY RVF++
Sbjct  607  MQMRVKMVQKHFLWHSKPERFDIFHMILHSIWYNRVFQS  645



>ref|XP_004287457.1| PREDICTED: probable glycosyltransferase At3g07620-like [Fragaria 
vesca subsp. vesca]
Length=686

 Score =   313 bits (802),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 176/218 (81%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC +D+ +G ++G+D+SLPETYV S+RNP + +GG   S+R  L 
Sbjct  466  APYETRHHMERCIKALCNADVTQGFKIGRDISLPETYVRSARNPLRDLGGKRASERQVLT  525

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL++W++KDPDMKIFG M      K +Y+ HMKSSKYC+C +GYEVN
Sbjct  526  FYAGNMHGYLRPILLKYWKDKDPDMKIFGPMPPGVASKMNYIEHMKSSKYCLCPKGYEVN  585

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YEC+PVIISDNFVPPFFE LNWE+F++ + EKDI NLKNIL+SIP+  Y +
Sbjct  586  SPRVVEAIFYECIPVIISDNFVPPFFEVLNWEAFSLILAEKDIPNLKNILLSIPDEKYLQ  645

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  VKRVQ+HFLWHP P +YD+FHM LHSIWY R+F+
Sbjct  646  MQLAVKRVQKHFLWHPKPLKYDLFHMTLHSIWYNRLFQ  683



>ref|XP_010263183.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=656

 Score =   312 bits (800),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 173/218 (79%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A + TR HM NCIR+LC S++  G ++GKDVS P T+V +S +P    GG  PS+RP LA
Sbjct  435  APKITRQHMGNCIRALCNSNVASGFKVGKDVSFPVTFVGNSTDPLGDRGGKSPSERPILA  494

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKKD-----YLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LLQ+WENKDP+MKIFG M + D     Y+ HMKSSKYCICARG+EV+
Sbjct  495  FFAGNMHGYLRPILLQYWENKDPEMKIFGPMPQDDEGKMSYIQHMKSSKYCICARGFEVH  554

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            +PRVVEAI YECVPVI+SDN+VPPFFE L+WE+FAVF+ EKDI NLKNIL+SIPE  Y  
Sbjct  555  TPRVVEAIFYECVPVILSDNYVPPFFEVLDWEAFAVFIPEKDIPNLKNILLSIPEEVYLA  614

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ RVK+VQ+HFLWH  P +YDIFHM LHSIW  R++R
Sbjct  615  MQLRVKKVQQHFLWHSQPVKYDIFHMTLHSIWSNRMYR  652



>gb|KDP33723.1| hypothetical protein JCGZ_07294 [Jatropha curcas]
Length=501

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 175/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A++ TR HM NCIR LC +++ +G ++GKD +LP TY+ S+ NP + +GG PPS+RP LA
Sbjct  280  ASQITRQHMKNCIRVLCNANVGKGFKIGKDTTLPVTYIRSAENPLKDLGGRPPSERPILA  339

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDKKD-----YLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LLQ WENK+ DMKIFG M +       Y  +MKSSKYCICARGYEV+
Sbjct  340  FFAGGMHGYLRPILLQFWENKESDMKIFGPMPRDTEGKWLYREYMKSSKYCICARGYEVH  399

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            +PR+VEAI YECVPVIISD++VPPFFE LNWE+FAVFV EKDI NL+NIL+SIP+  Y  
Sbjct  400  TPRIVEAILYECVPVIISDSYVPPFFEVLNWEAFAVFVQEKDIPNLRNILLSIPKEKYFM  459

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q+ VK VQ+HFLWH +P +YDIFHMILHS+WY R+F+
Sbjct  460  LQSSVKMVQQHFLWHKNPVKYDIFHMILHSVWYNRIFQ  497



>ref|NP_197468.2| Exostosin family protein [Arabidopsis thaliana]
 gb|AED92736.1| Exostosin family protein [Arabidopsis thaliana]
 gb|AHL38619.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=610

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 176/219 (80%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+D+SLPETYV +++NP + +GG PPS+R  LA
Sbjct  389  APYETRHHMEHCIKALCNADVTAGFKIGRDISLPETYVRAAKNPLRDLGGKPPSQRRTLA  448

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+R  LLQHW++KDPDMKIFG M      K +Y+  MKSSKYCIC +GYEVN
Sbjct  449  FYAGSMHGYLRQILLQHWKDKDPDMKIFGRMPFGVASKMNYIEQMKSSKYCICPKGYEVN  508

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVIISDNFVPPFFE L+W +F+V V EKDI  LK+IL+SIPE+ Y +
Sbjct  509  SPRVVESIFYECVPVIISDNFVPPFFEVLDWSAFSVIVAEKDIPRLKDILLSIPEDKYVK  568

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ  V++ QRHFLWH  P++YD+FHM+LHSIWY RVF+ 
Sbjct  569  MQMAVRKAQRHFLWHAKPEKYDLFHMVLHSIWYNRVFQA  607



>emb|CDX87077.1| BnaC09g03920D [Brassica napus]
Length=607

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 172/219 (79%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR H +  IR+LC SD++EG   GKD SLPETYV   + P  +IGG   SKRP LA
Sbjct  386  APSETRKHFSKTIRALCNSDVKEGFVFGKDTSLPETYVRDPKKPLSNIGGKSASKRPTLA  445

Query  293  FFAGQM-HGYVRPTLLQHW-ENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEV  454
            FFAGQ  HGYVRP LL +W  NKDPD+KIFG + +    K+YL  MK SKYCICA+GYEV
Sbjct  446  FFAGQPDHGYVRPILLSYWGNNKDPDLKIFGKLPRSKGNKNYLQFMKRSKYCICAKGYEV  505

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI Y+CVPVIISDNFVPPFFE LNWESFAVFVLEKDI NLK ILMSI E  Y+
Sbjct  506  NSPRVVEAIFYDCVPVIISDNFVPPFFEALNWESFAVFVLEKDIPNLKKILMSISERRYK  565

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            ++Q RVKRVQ+HFLWH  P++YD+FHMILHS+W+ RVF+
Sbjct  566  QLQMRVKRVQKHFLWHVKPEKYDMFHMILHSVWFNRVFQ  604



>ref|XP_004251626.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Solanum lycopersicum]
 ref|XP_010313733.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Solanum lycopersicum]
 ref|XP_010313734.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Solanum lycopersicum]
Length=674

 Score =   312 bits (799),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 175/216 (81%), Gaps = 5/216 (2%)
 Frame = +2

Query  122  ETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFA  301
            ETR+HM +CI++LC +D+  G ++G+DVSL ETYV S+RNP + +GG P S+R  LAF+A
Sbjct  456  ETRHHMEHCIKALCNADVTLGFKIGRDVSLAETYVRSARNPLRDLGGKPASQRKVLAFYA  515

Query  302  GQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPR  466
            G MHGY+RP LL+HW++KDPDM+IFG M      K +Y+ HMKSSK+CIC +GYEVNSPR
Sbjct  516  GNMHGYLRPILLEHWKDKDPDMEIFGPMPSGVASKMNYIQHMKSSKFCICPKGYEVNSPR  575

Query  467  VVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQT  646
            VVEAI YECVPVIISDNFVPPFF  LNW++F++ + EKDI NLK+IL+SIPE  Y +MQ 
Sbjct  576  VVEAIFYECVPVIISDNFVPPFFGVLNWDTFSLILAEKDIPNLKSILLSIPEKKYLDMQL  635

Query  647  RVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
             +++VQRHFLWH  P +YD+FHM LHSIWY RVF+T
Sbjct  636  AIRKVQRHFLWHAKPVKYDLFHMTLHSIWYNRVFQT  671



>ref|XP_010047709.1| PREDICTED: probable glycosyltransferase At5g25310 [Eucalyptus 
grandis]
 ref|XP_010047710.1| PREDICTED: probable glycosyltransferase At5g25310 [Eucalyptus 
grandis]
 ref|XP_010047711.1| PREDICTED: probable glycosyltransferase At5g25310 [Eucalyptus 
grandis]
 ref|XP_010047713.1| PREDICTED: probable glycosyltransferase At5g25310 [Eucalyptus 
grandis]
 ref|XP_010047714.1| PREDICTED: probable glycosyltransferase At5g25310 [Eucalyptus 
grandis]
 ref|XP_010047715.1| PREDICTED: probable glycosyltransferase At5g25310 [Eucalyptus 
grandis]
 gb|KCW79660.1| hypothetical protein EUGRSUZ_C01012 [Eucalyptus grandis]
 gb|KCW79661.1| hypothetical protein EUGRSUZ_C01012 [Eucalyptus grandis]
Length=696

 Score =   312 bits (800),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 174/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  475  APYETRHHMERCIKALCNADVTAGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRRILA  534

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG  HGY+R  LL+HW++KDPDMKIFG M      K  Y+ +MKSSKYCIC +GYEVN
Sbjct  535  FYAGNNHGYLRTILLKHWKDKDPDMKIFGPMPPGVASKMSYIRYMKSSKYCICPKGYEVN  594

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE L+W +F++ + EKDI NLKN L+SIPE  YRE
Sbjct  595  SPRVVEAIFYECVPVIISDNFVPPFFEVLDWGAFSIILAEKDIPNLKNTLLSIPEEKYRE  654

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ RV++VQRHFLWH  P +YD+F+M LHSIWY RVF+
Sbjct  655  MQLRVRKVQRHFLWHAKPVKYDLFYMTLHSIWYNRVFQ  692



>ref|XP_009352527.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Pyrus x bretschneideri]
Length=661

 Score =   311 bits (797),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 174/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC +DL  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  440  APYETRHHMELCIKALCNADLTSGFKIGRDVSLPETYVRSARNPLRDLGGKPPSRREILA  499

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL+HW++KDPDMKIFG M      K +Y+ HM+ SKYCIC +G+EVN
Sbjct  500  FYAGNMHGYLRPILLEHWKDKDPDMKIFGPMPPGVASKMNYIHHMQDSKYCICPKGFEVN  559

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE L+W +F+V + EKDI  LK IL+SIPE  Y +
Sbjct  560  SPRVVEAIFYECVPVIISDNFVPPFFEVLDWGAFSVILAEKDIPKLKEILVSIPEEKYLQ  619

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q  V+++Q+HFLWHP P +YD+FHM LHSIWY RVF+
Sbjct  620  LQLGVRKIQKHFLWHPKPLKYDLFHMTLHSIWYNRVFQ  657



>ref|XP_007204617.1| hypothetical protein PRUPE_ppa002387mg [Prunus persica]
 gb|EMJ05816.1| hypothetical protein PRUPE_ppa002387mg [Prunus persica]
Length=678

 Score =   311 bits (798),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 175/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  C+++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  457  APYETRHHMERCMKALCNADVTGGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRQILA  516

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL++W+++DPDMKIFG M      K +Y+ HMKSSKYCIC +GYEVN
Sbjct  517  FYAGNMHGYLRPILLEYWKDRDPDMKIFGPMPPGVASKMNYIQHMKSSKYCICPKGYEVN  576

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE LNW +F+V + E+DI NLK IL+SIPE  Y +
Sbjct  577  SPRVVEAIFYECVPVIISDNFVPPFFEVLNWGAFSVILAERDIPNLKEILLSIPEEKYLQ  636

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  V++VQ+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  637  MQRGVRKVQKHFLWHARPLKYDLFHMTLHSIWYNRVFQ  674



>ref|XP_011093625.1| PREDICTED: probable glycosyltransferase At3g07620 [Sesamum indicum]
Length=691

 Score =   311 bits (798),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 176/218 (81%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  470  APYETRHHMEHCIKALCNADVTMGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRHILA  529

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL++W +K+PDMKI G M      K +Y+ HMKSSKYCIC +GYEVN
Sbjct  530  FYAGNMHGYLRPILLKYWRDKEPDMKILGPMPPGVASKMNYIYHMKSSKYCICPKGYEVN  589

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE LNW++F+V + EKDI NL++IL+SIPE  Y +
Sbjct  590  SPRVVEAIFYECVPVIISDNFVPPFFEVLNWDAFSVIIAEKDIPNLRSILVSIPEEKYMD  649

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  V++VQ+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  650  MQLGVRKVQQHFLWHAKPVKYDLFHMTLHSIWYNRVFQ  687



>ref|XP_008242549.1| PREDICTED: probable glycosyltransferase At3g07620 [Prunus mume]
Length=678

 Score =   311 bits (798),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 175/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  C+++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  457  APYETRHHMERCMKALCNADVTSGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRQILA  516

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL++W++KDPDMKIFG M      K +Y+ HMKSSKYCIC +GYEVN
Sbjct  517  FYAGNMHGYLRPILLEYWKDKDPDMKIFGPMPPGVASKMNYIQHMKSSKYCICPKGYEVN  576

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE L+W +F+V + E+DI NLK IL+SIPE  Y +
Sbjct  577  SPRVVEAIFYECVPVIISDNFVPPFFEVLDWGAFSVILAERDIPNLKEILLSIPEEKYIQ  636

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  V++VQ+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  637  MQRGVRKVQKHFLWHAKPLKYDLFHMTLHSIWYNRVFQ  674



>ref|XP_006359763.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006359764.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X2 [Solanum tuberosum]
Length=607

 Score =   309 bits (792),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 165/204 (81%), Gaps = 0/204 (0%)
 Frame = +2

Query  137  MANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHG  316
            M+NCIRSLC +DLR G Q GKDVSLP+  +    NP   +GG P SKR  LAFFAG MHG
Sbjct  399  MSNCIRSLCNADLRGGFQFGKDVSLPQPNIRLRTNPLAELGGKPASKRRTLAFFAGHMHG  458

Query  317  YVRPTLLQHWENKDPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVVEAISYECV  496
            Y+RP LL+HWEN+DPDM+I+G + K  YL +MKSSKYCICARG +VNSPRVVEAI Y C+
Sbjct  459  YLRPILLKHWENRDPDMRIYGGITKASYLRYMKSSKYCICARGSQVNSPRVVEAIYYGCI  518

Query  497  PVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQRHFL  676
            PVI+SDN+VPP FETLNWESFAVFV EKDI NLKNIL+SI +  Y++M  RVK+VQ+HFL
Sbjct  519  PVILSDNYVPPLFETLNWESFAVFVQEKDIPNLKNILLSISDKKYKQMHGRVKQVQQHFL  578

Query  677  WHPSPQRYDIFHMILHSIWYTRVF  748
            WH  P +YD+FHMILHS+W+ RVF
Sbjct  579  WHIKPSKYDVFHMILHSVWHNRVF  602



>ref|XP_010493042.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=611

 Score =   310 bits (793),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 173/216 (80%), Gaps = 5/216 (2%)
 Frame = +2

Query  122  ETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFA  301
            ETR+HM +CI++LC +D+  G ++G+D+SLPETYV +++NP + +GG PPS+R  LAF+A
Sbjct  393  ETRHHMEHCIKALCNADVTAGFKIGRDISLPETYVRAAKNPLRDLGGKPPSQRRTLAFYA  452

Query  302  GQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPR  466
            G MHGY+R  LLQHW++KDP+MKIFG M      K +Y+ HMKSSKYCIC +G+EVNSPR
Sbjct  453  GSMHGYLRAILLQHWKDKDPEMKIFGRMPFGVASKMNYIEHMKSSKYCICPKGFEVNSPR  512

Query  467  VVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQT  646
            VVE+I YECVPVIISDNFVPPFFE L+W +F+V V EKDI  LK IL SIPE  Y +MQ 
Sbjct  513  VVESIFYECVPVIISDNFVPPFFEVLDWSAFSVIVAEKDIPRLKYILSSIPEERYVKMQM  572

Query  647  RVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
             V++ QRHFLWH  PQRYD+FHM+LHSIWY RVF+ 
Sbjct  573  AVRKAQRHFLWHAKPQRYDLFHMVLHSIWYNRVFQA  608



>emb|CDP08149.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   309 bits (792),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 171/217 (79%), Gaps = 5/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  M +C+R+LC +D+  G ++GKDV+LP  YV S++NP + IGG PPS+RP LA
Sbjct  388  APAETRGPMLSCLRALCNADINVGFEIGKDVALPTVYVRSAQNPLKDIGGKPPSQRPILA  447

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHG VRP LL  W  KDPDM+IFG M      K+Y+ HMKSSKYCICA+GY V+S
Sbjct  448  FFAGYMHGNVRPLLLDCW-GKDPDMRIFGRMPHVKGNKNYIEHMKSSKYCICAKGYAVHS  506

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVE+I YECVPVIISDN+VPPFFE LNWESFAVFVLEKDI  LK+IL+SI E  Y EM
Sbjct  507  PRVVESIFYECVPVIISDNYVPPFFEVLNWESFAVFVLEKDIPKLKDILLSISEEKYLEM  566

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q RVK VQ+HFLWH  P +YD+FHMILHS+WY RVFR
Sbjct  567  QKRVKEVQKHFLWHADPVKYDMFHMILHSVWYNRVFR  603



>ref|NP_197954.1| Exostosin family protein [Arabidopsis thaliana]
 dbj|BAF00988.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93491.1| Exostosin family protein [Arabidopsis thaliana]
 gb|AHL38605.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=654

 Score =   310 bits (794),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 173/219 (79%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMA  IR+LC SD++EG   GKD SLPET+V   + P  ++GG   ++RP LA
Sbjct  433  APSETRKHMAKSIRALCNSDVKEGFVFGKDTSLPETFVRDPKKPLSNMGGKSANQRPILA  492

Query  293  FFAGQM-HGYVRPTLLQHW-ENKDPDMKIFG----TMDKKDYLVHMKSSKYCICARGYEV  454
            FFAG+  HGY+RP LL +W  NKDPD+KIFG    T   K+YL  MK+SKYCICA+G+EV
Sbjct  493  FFAGKPDHGYLRPILLSYWGNNKDPDLKIFGKLPRTKGNKNYLQFMKTSKYCICAKGFEV  552

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI Y+CVPVIISDNFVPPFFE LNWESFA+F+ EKDI NLK ILMSIPE+ YR
Sbjct  553  NSPRVVEAIFYDCVPVIISDNFVPPFFEVLNWESFAIFIPEKDIPNLKKILMSIPESRYR  612

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
             MQ RVK+VQ+HFLWH  P++YD+FHMILHSIWY RVF+
Sbjct  613  SMQMRVKKVQKHFLWHAKPEKYDMFHMILHSIWYNRVFQ  651



>ref|XP_002514248.1| catalytic, putative [Ricinus communis]
 gb|EEF48202.1| catalytic, putative [Ricinus communis]
Length=676

 Score =   311 bits (796),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 176/218 (81%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+D+SLPETYV S+RNP + +GG PPS+R  LA
Sbjct  455  APYETRHHMEHCIKALCNADVTAGFKIGRDISLPETYVRSARNPLRDLGGKPPSQRHILA  514

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL++W++KDP MKIFG M      K +Y+ HMKSSKYCIC +GYEVN
Sbjct  515  FYAGSMHGYLRPILLKYWKDKDPSMKIFGPMPPGVASKMNYIQHMKSSKYCICPKGYEVN  574

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE  NW +F++ + EKDI NLK IL+SIPE  Y E
Sbjct  575  SPRVVEAIFYECVPVIISDNFVPPFFEVFNWGAFSLILAEKDIPNLKEILLSIPEEKYLE  634

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  V++VQ+HFLWHPSP +YD+F+M LH+IWY RV++
Sbjct  635  MQLGVRKVQKHFLWHPSPMKYDLFYMTLHAIWYNRVYQ  672



>emb|CDY19793.1| BnaA09g04460D [Brassica napus]
Length=618

 Score =   309 bits (791),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 172/219 (79%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR H +N IR+LC SD++EG   GKD SLPETYV   + P  +IGG   SKRP LA
Sbjct  397  APSETRKHFSNSIRALCNSDVKEGFVFGKDTSLPETYVRDPKKPLSNIGGKSASKRPTLA  456

Query  293  FFAGQM-HGYVRPTLLQHW-ENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEV  454
            FFAGQ  HGYVRP LL +W  NKDPD+KIFG + +    K+Y   MK+SKYCICA+GYEV
Sbjct  457  FFAGQPDHGYVRPILLSYWANNKDPDLKIFGKLPRSKGNKNYRQFMKTSKYCICAKGYEV  516

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI Y+CVPVIISDNFVPPFFE L WESFAVFVLEKDI NLK ILMSI E  Y+
Sbjct  517  NSPRVVEAIFYDCVPVIISDNFVPPFFEALKWESFAVFVLEKDIPNLKKILMSISERRYK  576

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            ++Q RVKRVQ+HFLWH  P++YD+FHMILHSIW+ RVF+
Sbjct  577  QLQMRVKRVQKHFLWHVKPEKYDMFHMILHSIWFNRVFQ  615



>ref|XP_009120864.1| PREDICTED: probable glycosyltransferase At3g07620 [Brassica rapa]
Length=586

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 174/219 (79%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+D+SLPETYV +++NP + +GG PPS+R  LA
Sbjct  365  APYETRHHMEHCIKALCNADVTAGFKIGRDISLPETYVRAAKNPLRDLGGKPPSQRRILA  424

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+R  LLQHW++KDPDM+I+G M      K +Y+  MKSSKYC+C +GYEVN
Sbjct  425  FYAGSMHGYLRTILLQHWKDKDPDMRIYGRMPLGVASKMNYIEQMKSSKYCLCPKGYEVN  484

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVIISDNFVPPFFE L+W +F+V V EKDI  LK ILMSIPE  Y +
Sbjct  485  SPRVVESIFYECVPVIISDNFVPPFFEVLDWSAFSVIVAEKDIPRLKEILMSIPEEKYVK  544

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ  V++ QRHFLWH  P+RYD+FHM+LHSIWY RVF+ 
Sbjct  545  MQMAVRKAQRHFLWHAKPERYDLFHMVLHSIWYNRVFQV  583



>ref|XP_010421440.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
 ref|XP_010421442.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=630

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 172/219 (79%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMA  IR+LC SD++EG   G+D SLPET+V   + P  +IGG   +KRP LA
Sbjct  409  APSETRTHMAKSIRALCNSDVKEGFVFGRDTSLPETFVRDPKKPLSNIGGKSATKRPILA  468

Query  293  FFAGQM-HGYVRPTLLQHW-ENKDPDMKIFG----TMDKKDYLVHMKSSKYCICARGYEV  454
            FFAG+  HGY+RP LL +W  NKDPD+KIFG    T   K+YL  MK+SKYCICA+G+EV
Sbjct  469  FFAGKPDHGYLRPILLSYWGNNKDPDLKIFGKLPRTKGNKNYLQFMKTSKYCICAKGFEV  528

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI Y+CVPVIISDNFVPPFFE LNWESFAVFV E+DI NLK ILMSIPE  YR
Sbjct  529  NSPRVVEAIFYDCVPVIISDNFVPPFFEVLNWESFAVFVPERDIPNLKKILMSIPERRYR  588

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
             MQ RVK+VQ+HFLWH  P++YD+FHMILHSIW+ RVF+
Sbjct  589  SMQMRVKKVQKHFLWHVKPEKYDMFHMILHSIWFNRVFQ  627



>ref|XP_009111678.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Brassica rapa]
Length=616

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 172/219 (79%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR H +N IR+LC SD++EG   GKD SLPETYV   + P  +IGG   SKRP LA
Sbjct  395  APSETRKHFSNSIRALCNSDVKEGFVFGKDTSLPETYVRDPKKPLSNIGGKSASKRPTLA  454

Query  293  FFAGQM-HGYVRPTLLQHW-ENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEV  454
            FFAGQ  HGYVRP LL +W  NKDPD+KIFG + +    K+Y   MK+SKYCICA+GYEV
Sbjct  455  FFAGQPDHGYVRPILLSYWANNKDPDLKIFGKLPRSKGNKNYRQFMKTSKYCICAKGYEV  514

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI Y+CVPVIISDNFVPPFFE L WESFAVFVLEKDI NLK ILMSI E  Y+
Sbjct  515  NSPRVVEAIFYDCVPVIISDNFVPPFFEVLKWESFAVFVLEKDIPNLKKILMSISERRYK  574

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            ++Q RVKRVQ+HFLWH  P++YD+FHMILHSIW+ RVF+
Sbjct  575  QLQMRVKRVQKHFLWHVKPEKYDMFHMILHSIWFNRVFQ  613



>emb|CDX92511.1| BnaA10g15500D [Brassica napus]
Length=586

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 174/219 (79%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+D+SLPETYV +++NP + +GG PPS+R  LA
Sbjct  365  APYETRHHMEHCIKALCNADVTAGFKIGRDISLPETYVRAAKNPLRDLGGKPPSQRRILA  424

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+R  LLQHW++KDPDM+I+G M      K +Y+  MKSSKYC+C +GYEVN
Sbjct  425  FYAGSMHGYLRTILLQHWKDKDPDMRIYGRMPLGVASKMNYIDQMKSSKYCLCPKGYEVN  484

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVIISDNFVPPFFE L+W +F+V V EKDI  LK ILMSIPE  Y +
Sbjct  485  SPRVVESIFYECVPVIISDNFVPPFFEVLDWSAFSVIVAEKDIPRLKEILMSIPEEKYVK  544

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ  V++ QRHFLWH  P+RYD+FHM+LHSIWY RVF+ 
Sbjct  545  MQMAVRKAQRHFLWHAKPERYDLFHMVLHSIWYNRVFQV  583



>ref|XP_002871898.1| exostosin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48157.1| exostosin family protein [Arabidopsis lyrata subsp. lyrata]
Length=610

 Score =   308 bits (790),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 174/219 (79%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+D+SLPETYV +++NP + +GG PPS+R  LA
Sbjct  389  APYETRHHMEHCIKALCNADVTAGFKIGRDISLPETYVRAAKNPLRDLGGKPPSQRRTLA  448

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+R  LLQHW++KDPDMKIFG M      K +Y+  MKSSKYCIC +GYEVN
Sbjct  449  FYAGSMHGYLRQILLQHWKDKDPDMKIFGRMPFGVASKMNYIEQMKSSKYCICPKGYEVN  508

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVIISDNFVPPFFE L+W +F+V V EKDI  LK+IL SIPE  Y +
Sbjct  509  SPRVVESIFYECVPVIISDNFVPPFFEVLDWSAFSVIVAEKDIPRLKDILSSIPEEKYVK  568

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ  V++ QRHFLWH  P++YD+FHM+LHSIWY RVF+ 
Sbjct  569  MQMAVRKAQRHFLWHAKPEKYDLFHMVLHSIWYNRVFQV  607



>gb|EYU27286.1| hypothetical protein MIMGU_mgv1a002540mg [Erythranthe guttata]
Length=661

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 172/218 (79%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  440  APYETRHHMEHCIKALCNADVTGGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRSTLA  499

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LL HW +KDP MKI G M      K +Y+  MK+SKYCIC +GYEVN
Sbjct  500  FFAGNMHGYLRPILLNHWTDKDPRMKILGPMPPGVASKMNYIHQMKNSKYCICPKGYEVN  559

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPR+VE+I YECVPVIISDNFVPPFFE LNW++F+V + EKDI NLK IL+SIPE  Y +
Sbjct  560  SPRIVESIFYECVPVIISDNFVPPFFEVLNWDAFSVIIAEKDIPNLKTILVSIPEKKYLD  619

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  V++VQ+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  620  MQLNVRKVQKHFLWHAKPLKYDLFHMTLHSIWYNRVFQ  657



>emb|CDY58974.1| BnaC09g38020D [Brassica napus]
Length=593

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 174/219 (79%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+D+SLPETYV +++NP + +GG PPS+R  LA
Sbjct  372  APYETRHHMEHCIKALCNADVTAGFKIGRDISLPETYVRAAKNPLRDLGGKPPSQRRILA  431

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+R  LLQHW++KDPDM+I+G M      K +Y+  MKSSKYC+C +GYEVN
Sbjct  432  FYAGSMHGYLRTILLQHWKDKDPDMRIYGRMPLGVASKMNYIDQMKSSKYCLCPKGYEVN  491

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVIISDNFVPPFFE L+W +F+V V EKDI  LK ILMSIPE  Y +
Sbjct  492  SPRVVESIFYECVPVIISDNFVPPFFEVLDWSAFSVIVAEKDIPRLKEILMSIPEEKYVK  551

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ  V++ QRHFLWH  P+RYD+FHM+LHSIWY RVF+ 
Sbjct  552  MQMAVRKAQRHFLWHAEPERYDLFHMVLHSIWYNRVFQV  590



>ref|XP_010493838.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
 ref|XP_010493839.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=649

 Score =   309 bits (792),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 172/219 (79%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMA  IR+LC SD++EG   G+D SLPET+V   + P  +IGG   ++RP LA
Sbjct  428  APSETRTHMAKSIRALCNSDVKEGFVFGRDTSLPETFVRDPKKPLSNIGGKSATQRPILA  487

Query  293  FFAGQM-HGYVRPTLLQHW-ENKDPDMKIFG----TMDKKDYLVHMKSSKYCICARGYEV  454
            FFAG+  HGY+RP LL +W  NKDPD+KIFG    T   K+YL  MK+SKYCICA+G+EV
Sbjct  488  FFAGKPDHGYLRPILLSYWGNNKDPDLKIFGKLPRTKGNKNYLQFMKTSKYCICAKGFEV  547

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI Y+CVPVIISDNFVPPFFE LNWESFAVFV EKDI NLK ILMSIPE  YR
Sbjct  548  NSPRVVEAIFYDCVPVIISDNFVPPFFEVLNWESFAVFVPEKDIPNLKKILMSIPERRYR  607

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
             MQ RVK+VQ+HFLWH  P++YD+FHMILHSIW+ RVF+
Sbjct  608  SMQMRVKKVQKHFLWHVKPEKYDMFHMILHSIWFNRVFQ  646



>ref|XP_010454924.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=624

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 172/219 (79%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMA  IR+LC SD++EG   G+D SLPET+V   + P  +IGG   ++RP LA
Sbjct  403  APSETRTHMAKSIRALCNSDVKEGFVFGRDTSLPETFVRDPKKPLSNIGGKSATQRPILA  462

Query  293  FFAGQM-HGYVRPTLLQHW-ENKDPDMKIFG----TMDKKDYLVHMKSSKYCICARGYEV  454
            FFAG+  HGY+RP LL +W  NKDPD+KIFG    T   K+YL  MK+SKYCICA+G+EV
Sbjct  463  FFAGKPDHGYLRPILLSYWGNNKDPDLKIFGKLPRTKGNKNYLQFMKTSKYCICAKGFEV  522

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI Y+CVPVIISDNFVPPFFE LNWESFAVFV EKDI NLK ILMSIPE  YR
Sbjct  523  NSPRVVEAIFYDCVPVIISDNFVPPFFEVLNWESFAVFVPEKDIPNLKKILMSIPERRYR  582

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
             MQ RVK+VQ+HFLWH  P++YD+FHMILHSIW+ RVF+
Sbjct  583  SMQMRVKKVQKHFLWHVKPEKYDMFHMILHSIWFNRVFQ  621



>ref|XP_006400529.1| hypothetical protein EUTSA_v10013011mg [Eutrema salsugineum]
 gb|ESQ41982.1| hypothetical protein EUTSA_v10013011mg [Eutrema salsugineum]
Length=606

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 174/219 (79%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+D+SLPETYV +++NP + +GG PPS+R  LA
Sbjct  385  APYETRHHMEHCIKALCNADITAGFKIGRDISLPETYVRAAKNPLRDLGGKPPSQRRTLA  444

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LLQHW++KDP+MKIFG M      K +Y+  MK+SK+CIC +GYEVN
Sbjct  445  FYAGSMHGYLRPILLQHWKDKDPEMKIFGRMPLGVASKMNYIEQMKNSKFCICPKGYEVN  504

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVIISDNFVPPFFE L+W  F+V V EKDI  LK+IL SIPE  Y +
Sbjct  505  SPRVVESIFYECVPVIISDNFVPPFFEVLDWSMFSVIVAEKDIPRLKDILSSIPEEKYVK  564

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ  V++ QRHFLWH  P+RYD+FHM+LHSIWY RVF+ 
Sbjct  565  MQMAVRKAQRHFLWHAKPERYDLFHMVLHSIWYNRVFQA  603



>ref|XP_006287237.1| hypothetical protein CARUB_v10000423mg [Capsella rubella]
 gb|EOA20135.1| hypothetical protein CARUB_v10000423mg [Capsella rubella]
Length=649

 Score =   308 bits (789),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 172/219 (79%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR HMA  IR+LC SD++EG   GKD SLPET+V   + P  ++GG   +KRP LA
Sbjct  428  APSETRKHMAKSIRALCNSDVKEGFVFGKDTSLPETFVRDPKKPLSNMGGKSATKRPILA  487

Query  293  FFAGQM-HGYVRPTLLQHW-ENKDPDMKIFG----TMDKKDYLVHMKSSKYCICARGYEV  454
            FFAG+  HGY+RP LL +W  NKDPD+KIFG    T   K+YL  MK+SKYCICA+G+EV
Sbjct  488  FFAGKPDHGYLRPILLSYWGNNKDPDLKIFGKLPRTKGNKNYLQFMKTSKYCICAKGFEV  547

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI Y+CVPVIISDNFVPPFFE LNWESFA+FV EKDI NLK ILMSIPE  Y+
Sbjct  548  NSPRVVEAIFYDCVPVIISDNFVPPFFEVLNWESFAIFVPEKDIPNLKKILMSIPERRYK  607

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
             MQ RVK+VQ+HFLWH  P++YD+FHMILHSIW+ RVF+
Sbjct  608  SMQMRVKKVQKHFLWHVKPEKYDMFHMILHSIWFNRVFQ  646



>ref|XP_010249593.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
 ref|XP_010249594.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
 ref|XP_010249595.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
 ref|XP_010249596.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
 ref|XP_010249598.1| PREDICTED: probable glycosyltransferase At5g03795 [Nelumbo nucifera]
Length=669

 Score =   308 bits (788),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 173/218 (79%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC +D+  G ++G+DVSLPETYV S++NPQ+ IGG P S+R  LA
Sbjct  448  APYETRHHMERCIKALCNADVTTGFKIGRDVSLPETYVRSAKNPQRDIGGKPVSERKILA  507

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG +HGY+RP LL++WEN+DPDMKI G M      K +Y+ HMKSSKYCIC RGYEVN
Sbjct  508  FYAGNIHGYLRPILLKYWENRDPDMKILGPMPSGVASKMNYIQHMKSSKYCICPRGYEVN  567

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE L+WE+F+V + EKDI NLK+IL+SI    Y  
Sbjct  568  SPRVVEAIFYECVPVIISDNFVPPFFEVLDWEAFSVILPEKDIPNLKDILLSISHKKYLA  627

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  VK+VQRHFLWH  P +YD+F+M LHSIW+ RVF+
Sbjct  628  MQLNVKKVQRHFLWHTKPLKYDLFYMTLHSIWFNRVFQ  665



>ref|XP_010095377.1| putative glycosyltransferase [Morus notabilis]
 gb|EXB59796.1| putative glycosyltransferase [Morus notabilis]
Length=669

 Score =   308 bits (788),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 174/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  C+++LC +D+  G ++G+DVS PETYV S+RNP + +GG PPS+R  LA
Sbjct  448  APYETRHHMERCMKALCNADVTSGFKIGRDVSFPETYVRSARNPLRDLGGKPPSRRHVLA  507

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG +HGY+RP LL++W++KDPDMKIFG M     +K +Y+ HMKSSKYCIC +GYEVN
Sbjct  508  FYAGNIHGYLRPILLKYWKDKDPDMKIFGPMPPGVANKMNYIQHMKSSKYCICPKGYEVN  567

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVIISDNFVPPFFE LNWE+F++ + EKDI  LK IL+SIP+  Y E
Sbjct  568  SPRVVESIFYECVPVIISDNFVPPFFEVLNWEAFSIVLAEKDIPKLKEILLSIPKEKYLE  627

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  V++ Q+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  628  MQLAVRKAQKHFLWHAKPMKYDLFHMTLHSIWYNRVFQ  665



>ref|XP_002280595.2| PREDICTED: probable glycosyltransferase At5g03795 [Vitis vinifera]
 emb|CBI28021.3| unnamed protein product [Vitis vinifera]
Length=665

 Score =   307 bits (787),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 171/214 (80%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            TR    N IR+LC S++  G ++GKD +LP TY+  S +P + +GG PPS+RP LAFFAG
Sbjct  448  TRQCSWNSIRALCNSNIASGFKIGKDTTLPVTYIRKSEDPLKYLGGKPPSQRPILAFFAG  507

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTMDKKD-----YLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP LLQ+WENK+ D+KIFG M + D     Y  HMKSSKYCICARGYEV++PRV
Sbjct  508  SMHGYLRPILLQYWENKEQDIKIFGPMSRDDGGKSRYRDHMKSSKYCICARGYEVHTPRV  567

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI YECVPVIISDN+VPPFFE LNWE+FAVF+LEKD+ NL+NIL+SIPE  Y +MQ R
Sbjct  568  VEAIFYECVPVIISDNYVPPFFEILNWEAFAVFILEKDVPNLRNILLSIPEEKYLQMQMR  627

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            VK VQ+HFLWH  P +YD+FHMILHS+WY RVF+
Sbjct  628  VKMVQQHFLWHKKPVKYDLFHMILHSVWYNRVFQ  661



>ref|XP_002514249.1| catalytic, putative [Ricinus communis]
 gb|EEF48203.1| catalytic, putative [Ricinus communis]
Length=334

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 174/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A+  TR +M NCIR LC +++ +G ++GKD +LP TY+ S+ NP + +GG  PS+R  LA
Sbjct  113  ASRITRKYMQNCIRVLCNANVAKGFKIGKDTTLPVTYIRSAENPLKDVGGKHPSERYTLA  172

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP L+Q WENK+ DMKIFG M      K+ Y  +MKSSKYCICARGYEV+
Sbjct  173  FFAGGMHGYLRPILVQFWENKESDMKIFGPMPRDIEGKRLYREYMKSSKYCICARGYEVH  232

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            +PR+VEAI YECVPVIISDN+VPPFFE LNWE+F+VFV EKDI NL++IL+SIPE  Y E
Sbjct  233  TPRIVEAILYECVPVIISDNYVPPFFEVLNWEAFSVFVQEKDIPNLRSILLSIPEEKYLE  292

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ RVK VQ+HFLWH +P +YD+FHMILHS+W+ R+F+
Sbjct  293  MQLRVKMVQQHFLWHKNPVKYDLFHMILHSVWHNRIFQ  330



>gb|KDP33724.1| hypothetical protein JCGZ_07295 [Jatropha curcas]
Length=697

 Score =   308 bits (789),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 176/219 (80%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  476  APYETRHHMEHCIKALCNADVTVGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRHILA  535

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP L+ HW++KDP MKIFG M      K +Y+ HMKSSKYCIC RGYEVN
Sbjct  536  FYAGNMHGYLRPILVSHWKDKDPSMKIFGPMPPGVASKMNYIQHMKSSKYCICPRGYEVN  595

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVIISDNFVPPFF+ L+W +F+V + EKDI NLK IL+SIP+  Y +
Sbjct  596  SPRVVESIFYECVPVIISDNFVPPFFDVLDWSAFSVILSEKDIPNLKEILLSIPKEKYLQ  655

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ  V++VQRHFLWHP+P +YD+F+M LHSIWY RV++ 
Sbjct  656  MQLGVRKVQRHFLWHPNPVKYDLFYMTLHSIWYNRVYQV  694



>ref|XP_006451252.1| hypothetical protein CICLE_v10007703mg [Citrus clementina]
 ref|XP_006494322.1| PREDICTED: probable glycosyltransferase At3g07620-like isoform 
X1 [Citrus sinensis]
 gb|ESR64492.1| hypothetical protein CICLE_v10007703mg [Citrus clementina]
 gb|KDO66500.1| hypothetical protein CISIN_1g006399mg [Citrus sinensis]
Length=647

 Score =   306 bits (785),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 169/215 (79%), Gaps = 5/215 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T  H+ NCI++LC +D+ +G ++G D SLP TY+ S+  P  ++GG PP KR  LAFFAG
Sbjct  430  TGQHLRNCIKALCNADVSKGFKIGMDTSLPVTYIRSAEAPLDNLGGNPPLKRSTLAFFAG  489

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
            +MHGY+RP LL  WENK  DMKIFG M      K+ Y  HMKSSKYCICARGYEV++PRV
Sbjct  490  RMHGYLRPILLNFWENKVDDMKIFGPMPHDVEGKRIYREHMKSSKYCICARGYEVHTPRV  549

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI YECVPVIISDN+VPPFFE LNWE+F+VFV EKDI NL+NIL+SIPE  Y  MQ+R
Sbjct  550  VEAIFYECVPVIISDNYVPPFFEVLNWEAFSVFVQEKDIPNLRNILLSIPEERYLAMQSR  609

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            VK VQ+HFLWH  P++YDIFHM+LHSIWY R+F T
Sbjct  610  VKMVQKHFLWHKKPKKYDIFHMVLHSIWYNRLFNT  644



>ref|XP_010656275.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Vitis vinifera]
Length=691

 Score =   308 bits (788),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 176/219 (80%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  470  APYETRHHMEQCIKALCNADVTAGFKIGRDVSLPETYVRSARNPLRDLGGKPPSERHILA  529

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL++W++KDPDMKI+G M      K +Y+ HMKSSK+CIC +GYEVN
Sbjct  530  FYAGNMHGYLRPILLKYWKDKDPDMKIYGPMPPGVASKMNYIQHMKSSKFCICPKGYEVN  589

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFF+ L+W +F++ + EKDI NLK++L+SIP + Y +
Sbjct  590  SPRVVEAIFYECVPVIISDNFVPPFFDVLDWGAFSIILAEKDIPNLKDVLLSIPNDKYLQ  649

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ  V++VQ+HFLWH  P +YD+FHM LHSIWY RVF+ 
Sbjct  650  MQLGVRKVQKHFLWHAKPLKYDLFHMTLHSIWYNRVFQV  688



>ref|XP_011048349.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Populus euphratica]
Length=642

 Score =   306 bits (784),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 174/217 (80%), Gaps = 5/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A++ TR+HM NCIR LC S++ +G ++GKD +LP TY+ S+ NP + +GG  PS+RP LA
Sbjct  421  ASQMTRHHMRNCIRVLCNSNVAKGFKIGKDTTLPVTYIRSAENPLKELGGKSPSERPILA  480

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LL++WENK+PDMKI G M      K+ Y  +MK SKYCICARGYEV+
Sbjct  481  FFAGNMHGYLRPILLEYWENKEPDMKILGPMSRDIAGKRRYREYMKRSKYCICARGYEVH  540

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            +PRVVE+I YECVPVI+SDN+VPP FE LNWE+F+VF+ EKDI NL+NIL+SIP+  Y  
Sbjct  541  TPRVVESIFYECVPVIVSDNYVPPLFEVLNWEAFSVFIKEKDIPNLRNILLSIPQEKYVA  600

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            MQ  VK+VQ+HFLWH  P +YD+FHMILHS+W++RVF
Sbjct  601  MQLGVKKVQQHFLWHKKPLKYDLFHMILHSVWHSRVF  637



>ref|XP_002324437.2| hypothetical protein POPTR_0018s09240g [Populus trichocarpa]
 gb|EEF03002.2| hypothetical protein POPTR_0018s09240g [Populus trichocarpa]
Length=642

 Score =   306 bits (784),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 174/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A++ TR+HM NCIR LC S++ +G ++GKD +LP TY+ S  NP + +GG  PS+RP LA
Sbjct  421  ASQMTRHHMRNCIRVLCNSNVAKGFKIGKDTTLPVTYIRSVENPLKELGGKSPSERPILA  480

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LL++WENK+PDMKI G M      K+ Y  +MK SKYCICARGYEV+
Sbjct  481  FFAGNMHGYLRPILLEYWENKEPDMKILGPMSRDIAGKRRYREYMKRSKYCICARGYEVH  540

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            +PRVVE+I YECVPVIISDN+VPP FE LNWE+F+VF+ EKDI NL+NIL+SIP+  Y  
Sbjct  541  TPRVVESIFYECVPVIISDNYVPPLFEVLNWEAFSVFIQEKDIPNLRNILLSIPQEKYVA  600

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  VK+VQ+HFLWH  P +YD+FHMILHS+W++RVF+
Sbjct  601  MQLGVKKVQQHFLWHKKPVKYDLFHMILHSVWHSRVFQ  638



>ref|XP_011048342.1| PREDICTED: probable glycosyltransferase At3g07620 [Populus euphratica]
 ref|XP_011048344.1| PREDICTED: probable glycosyltransferase At3g07620 [Populus euphratica]
 ref|XP_011048345.1| PREDICTED: probable glycosyltransferase At3g07620 [Populus euphratica]
Length=682

 Score =   307 bits (787),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 175/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  461  APYETRHHMEHCIKALCNADVTAGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRNILA  520

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL++W++KDPDMKIFG M      K +Y+ HM+ SKYCIC +GYEVN
Sbjct  521  FYAGNMHGYLRPILLKYWKDKDPDMKIFGPMPPGVASKMNYIQHMQRSKYCICPKGYEVN  580

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFF+ L+W +F++ + EKDI NLK IL+SIP+  Y +
Sbjct  581  SPRVVEAIFYECVPVIISDNFVPPFFDVLDWGAFSLILAEKDISNLKEILLSIPKEKYLQ  640

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  V++ QRHFLWH SP +YD+FHM LHSIWY RV++
Sbjct  641  MQLGVRKAQRHFLWHASPLKYDLFHMTLHSIWYNRVYQ  678



>ref|XP_011048346.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Populus euphratica]
 ref|XP_011048347.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Populus euphratica]
 ref|XP_011048348.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Populus euphratica]
Length=643

 Score =   306 bits (784),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 174/217 (80%), Gaps = 5/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A++ TR+HM NCIR LC S++ +G ++GKD +LP TY+ S+ NP + +GG  PS+RP LA
Sbjct  422  ASQMTRHHMRNCIRVLCNSNVAKGFKIGKDTTLPVTYIRSAENPLKELGGKSPSERPILA  481

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LL++WENK+PDMKI G M      K+ Y  +MK SKYCICARGYEV+
Sbjct  482  FFAGNMHGYLRPILLEYWENKEPDMKILGPMSRDIAGKRRYREYMKRSKYCICARGYEVH  541

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            +PRVVE+I YECVPVI+SDN+VPP FE LNWE+F+VF+ EKDI NL+NIL+SIP+  Y  
Sbjct  542  TPRVVESIFYECVPVIVSDNYVPPLFEVLNWEAFSVFIKEKDIPNLRNILLSIPQEKYVA  601

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            MQ  VK+VQ+HFLWH  P +YD+FHMILHS+W++RVF
Sbjct  602  MQLGVKKVQQHFLWHKKPLKYDLFHMILHSVWHSRVF  638



>ref|XP_002283936.2| PREDICTED: probable glycosyltransferase At3g42180 isoform X1 
[Vitis vinifera]
Length=738

 Score =   308 bits (790),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 176/218 (81%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  517  APYETRHHMEQCIKALCNADVTAGFKIGRDVSLPETYVRSARNPLRDLGGKPPSERHILA  576

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL++W++KDPDMKI+G M      K +Y+ HMKSSK+CIC +GYEVN
Sbjct  577  FYAGNMHGYLRPILLKYWKDKDPDMKIYGPMPPGVASKMNYIQHMKSSKFCICPKGYEVN  636

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFF+ L+W +F++ + EKDI NLK++L+SIP + Y +
Sbjct  637  SPRVVEAIFYECVPVIISDNFVPPFFDVLDWGAFSIILAEKDIPNLKDVLLSIPNDKYLQ  696

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  V++VQ+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  697  MQLGVRKVQKHFLWHAKPLKYDLFHMTLHSIWYNRVFQ  734



>emb|CDX80541.1| BnaC07g29030D [Brassica napus]
Length=638

 Score =   305 bits (781),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 171/219 (78%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR H A  IR+LC SD++EG   GKD SLPET+V   + P  +IGG   S+RP LA
Sbjct  417  APSETRNHFAKSIRALCNSDVKEGFVFGKDTSLPETFVRDPKKPLSNIGGKSASQRPTLA  476

Query  293  FFAGQM-HGYVRPTLLQHW-ENKDPDMKIFG----TMDKKDYLVHMKSSKYCICARGYEV  454
            FFAG+  HGY+RP LL +W  NKDPD+KIFG    T   K+YL  MK+SKYCICA+G+EV
Sbjct  477  FFAGKPDHGYLRPILLSYWGNNKDPDLKIFGRLPRTKGNKNYLQFMKTSKYCICAKGFEV  536

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI Y+CVPVIISDNFVPPFFE LNWESFA+FV EKDI NLK ILMS+ E  YR
Sbjct  537  NSPRVVEAIFYDCVPVIISDNFVPPFFEVLNWESFALFVAEKDIPNLKKILMSVSERRYR  596

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +MQ RVKRVQ+HFLWH  P++YD+FHMILHS+W+ RVF+
Sbjct  597  QMQMRVKRVQKHFLWHVQPEKYDMFHMILHSVWFNRVFQ  635



>emb|CDP03282.1| unnamed protein product [Coffea canephora]
Length=672

 Score =   306 bits (783),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 173/214 (81%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            TR  M +CIR+LC S++  G ++GKDVSLP TY+ S+ NP + +GG  PS+RP LAFFAG
Sbjct  456  TRNSMGSCIRALCNSNIARGFEIGKDVSLPVTYILSAENPLKDLGGNQPSERPTLAFFAG  515

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP LLQ+W++K+PDMKIFG M      K+ Y   MKSSKYCICARGYEV++PRV
Sbjct  516  GMHGYLRPILLQYWKDKEPDMKIFGPMPRDPDGKQRYREFMKSSKYCICARGYEVHTPRV  575

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            +E+I YEC+PVIISDN+VPPFFE L+WESFAVFVLE+DI NL+NIL+SIPE  Y EMQ R
Sbjct  576  IESIYYECIPVIISDNYVPPFFEILDWESFAVFVLEQDIPNLRNILLSIPEKKYIEMQNR  635

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +K VQR FLWH  P +YD+F+MILHSIWY RVF+
Sbjct  636  LKMVQRQFLWHKVPVKYDLFYMILHSIWYNRVFQ  669



>ref|XP_003524401.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X1 [Glycine max]
 ref|XP_006580477.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X2 [Glycine max]
 ref|XP_006580478.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X3 [Glycine max]
Length=643

 Score =   305 bits (781),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 173/218 (79%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC +D+ +G ++G+DVSLPE YV S R+PQ+ +GG PP +RP LA
Sbjct  422  APYETRHHMEYCIKALCNADVTQGFKIGRDVSLPEAYVRSVRDPQRDLGGKPPHQRPILA  481

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL+HW++KDPDMKI+G M      K +Y+ HMK+SKYCIC +GYEVN
Sbjct  482  FYAGNMHGYLRPILLKHWKDKDPDMKIYGPMPHGAASKMNYINHMKNSKYCICPKGYEVN  541

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE LNW++F++ + EKDI NLK IL+S+ +  Y +
Sbjct  542  SPRVVEAIFYECVPVIISDNFVPPFFEVLNWDAFSIILAEKDIPNLKQILLSVSQEKYLK  601

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q  V++ Q+HF WH  P +YD+FHM LHSIWY RVF+
Sbjct  602  LQLGVRKAQKHFFWHVKPLKYDLFHMTLHSIWYNRVFQ  639



>ref|XP_009793599.1| PREDICTED: probable glycosyltransferase At3g07620 [Nicotiana 
sylvestris]
Length=558

 Score =   302 bits (774),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 170/215 (79%), Gaps = 5/215 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            TR  M  CIR+LC S++  G ++GKDVSLP TYV S+ NP   +GG PPS RP LAFFAG
Sbjct  341  TRKSMETCIRALCNSNIAGGFKIGKDVSLPVTYVRSAENPLNDLGGNPPSARPVLAFFAG  400

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             +HGY+RP LLQHW +++PDM IFG M      K +Y   MKSSKYCICARGYEV++PRV
Sbjct  401  GIHGYLRPILLQHWSDREPDMMIFGPMPRDTEGKAEYRKLMKSSKYCICARGYEVHTPRV  460

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE+I Y+CVPVIISDN+VPPFFE  +WESF+VFVLEKD+ +L+NIL+SIPE  Y EMQ R
Sbjct  461  VESIHYDCVPVIISDNYVPPFFEVFDWESFSVFVLEKDVPDLRNILLSIPEEKYMEMQHR  520

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            +K VQ++FLWH SP +YD+FHMILHSIWY RVF+ 
Sbjct  521  LKIVQQYFLWHKSPVKYDLFHMILHSIWYNRVFQV  555



>ref|XP_010254014.1| PREDICTED: probable glycosyltransferase At3g07620 [Nelumbo nucifera]
 ref|XP_010254016.1| PREDICTED: probable glycosyltransferase At3g07620 [Nelumbo nucifera]
 ref|XP_010254017.1| PREDICTED: probable glycosyltransferase At3g07620 [Nelumbo nucifera]
Length=668

 Score =   305 bits (782),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 174/218 (80%), Gaps = 6/218 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC +D+  G ++G+DVSLPETYV  +RNP + +GG PPS+R  LA
Sbjct  448  APYETRHHMERCIKALCNADVAGGFKIGRDVSLPETYVRFARNPLRDVGGKPPSERTILA  507

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LLQ+WE KDPDMKIFG +      K +Y+ HMKSSKYCICA+GYEVN
Sbjct  508  FFAGNMHGYLRPILLQYWE-KDPDMKIFGPLPHGVARKMNYIQHMKSSKYCICAKGYEVN  566

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPR+VEAI YECVPVIISDNF+PPFFE L+W++F+V + EKDI NLK+IL SIPE  Y  
Sbjct  567  SPRIVEAIFYECVPVIISDNFIPPFFEVLDWDAFSVILPEKDIPNLKDILRSIPEEKYLA  626

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  V++VQ+HFLWH  P +YD+F+M LHSIW+ RVF+
Sbjct  627  MQLGVRKVQKHFLWHSKPMKYDLFYMTLHSIWFNRVFQ  664



>gb|KHN41660.1| Putative glycosyltransferase [Glycine soja]
Length=643

 Score =   305 bits (780),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 173/218 (79%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC +D+ +G ++G+DVSLPE YV S R+PQ+ +GG PP +RP LA
Sbjct  422  APYETRHHMEYCIKALCNADVTQGFKIGRDVSLPEAYVRSVRDPQRDLGGKPPHQRPILA  481

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL+HW++KDPDMKI+G M      K +Y+ HMK+SKYCIC +GYEVN
Sbjct  482  FYAGNMHGYLRPILLKHWKDKDPDMKIYGPMPHGVTSKMNYINHMKNSKYCICPKGYEVN  541

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE LNW++F++ + EKDI NLK IL+S+ +  Y +
Sbjct  542  SPRVVEAIFYECVPVIISDNFVPPFFEVLNWDAFSIILAEKDIPNLKQILLSVSQEKYLK  601

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q  V++ Q+HF WH  P +YD+FHM LHSIWY RVF+
Sbjct  602  LQLGVRKAQKHFFWHVKPLKYDLFHMTLHSIWYNRVFQ  639



>ref|XP_004501160.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cicer 
arietinum]
Length=557

 Score =   302 bits (773),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 170/216 (79%), Gaps = 4/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  M NCIR+LC +D+  G ++GKDVSLPETY+ S+ NP +++GG PPS+RP LA
Sbjct  339  APAETRGRMLNCIRALCNADIEVGFKIGKDVSLPETYIRSAENPVKNLGGNPPSQRPILA  398

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG +HGYVRP LL++WENK+PDMKI G +       +Y+  MKSSK+CICARG+EVNS
Sbjct  399  FFAGGLHGYVRPVLLKYWENKEPDMKISGPLPHVKGNTNYIELMKSSKFCICARGHEVNS  458

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI +EC+PVIISDNF+PP FE LNWESFAVF+ EK I  L+++L+SI E  Y EM
Sbjct  459  PRVVEAIFHECIPVIISDNFIPPLFEVLNWESFAVFIKEKHIAYLRDVLLSISEERYLEM  518

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
              RVK VQ HF+WH  P +YD+FHM+LHSIWY R+F
Sbjct  519  HKRVKMVQEHFIWHHEPVKYDLFHMLLHSIWYNRIF  554



>gb|KEH36061.1| glycosyltransferase plant-like protein [Medicago truncatula]
Length=591

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 170/218 (78%), Gaps = 4/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  M NCIR+LC +D   G ++GKDVSLPETY+ S  N  +++GG PPS+RP LA
Sbjct  373  APAETRGRMLNCIRALCNADTEVGFKIGKDVSLPETYIRSIENTVKNLGGNPPSERPILA  432

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG +HGYVRP LL+ WENK+PDMKI G +       +Y+  M+SSK+CICARG+EVNS
Sbjct  433  FFAGGLHGYVRPMLLKLWENKEPDMKISGPLPHVKGNANYIELMRSSKFCICARGHEVNS  492

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI +EC+PVIISDNF+PP FE LNWESFAVF+ E+ I  L++IL+SIPE  Y EM
Sbjct  493  PRVVEAIFHECIPVIISDNFIPPLFEVLNWESFAVFIEERHIAYLRDILLSIPEEKYLEM  552

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            Q RVK+VQ HFLWH  P +YD+FHM+LHSIWY R+F T
Sbjct  553  QKRVKKVQEHFLWHNEPVKYDLFHMLLHSIWYNRLFYT  590



>ref|XP_010454251.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=607

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 174/223 (78%), Gaps = 9/223 (4%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+D+SLPETYV +++NP + +GG PPS+R  LA
Sbjct  382  APYETRHHMEHCIKALCNADVTAGFKIGRDISLPETYVRAAKNPLRDLGGKPPSQRRTLA  441

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+R  LLQHW++KDP+MKIFG M      K +Y+ HMKSSKYCIC +G+EVN
Sbjct  442  FYAGSMHGYLRTILLQHWKDKDPEMKIFGRMPFGVASKMNYIEHMKSSKYCICPKGFEVN  501

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAV----FVLEKDILNLKNILMSIPEN  625
            SPRVVE+I YECVPVIISDNFVPPFFE L+W +F +     + EKDI  LK+IL SIPE 
Sbjct  502  SPRVVESIFYECVPVIISDNFVPPFFEVLDWSAFLIGARSIIPEKDIPRLKDILSSIPEE  561

Query  626  TYREMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
             Y +MQ  V++ QRHFLWH  PQRYD+FHM+LHSIWY RVF+ 
Sbjct  562  KYVKMQMAVRKAQRHFLWHAKPQRYDLFHMVLHSIWYNRVFQA  604



>ref|XP_006356532.1| PREDICTED: probable glycosyltransferase At5g03795-like [Solanum 
tuberosum]
Length=572

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 171/215 (80%), Gaps = 5/215 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            TR +M  C+R LC S++  G ++GKDVSLP TYV S+ +P + +GG PPS RP LAFFAG
Sbjct  355  TRKNMETCVRVLCNSNIAGGFKIGKDVSLPVTYVRSAEDPLKDLGGNPPSARPVLAFFAG  414

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             +HGY+RP LLQHW  K+PDMKIFG M      K  Y   MKSSKYCICA+GYEV++PRV
Sbjct  415  GIHGYLRPILLQHWSEKEPDMKIFGPMPRDPEGKAKYRELMKSSKYCICAKGYEVHTPRV  474

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE+I YECVPVIISDN+VPPFFE L+WESF+VFVLEKD+ +L+NIL+SIPE  Y +MQ R
Sbjct  475  VESIHYECVPVIISDNYVPPFFEVLDWESFSVFVLEKDVPDLRNILLSIPEEQYMKMQHR  534

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            +K VQ++FLWH +P +YD+FHMILHSIWY RVF+ 
Sbjct  535  LKIVQQYFLWHKNPVKYDLFHMILHSIWYNRVFQV  569



>ref|XP_007160303.1| hypothetical protein PHAVU_002G310300g [Phaseolus vulgaris]
 ref|XP_007160304.1| hypothetical protein PHAVU_002G310300g [Phaseolus vulgaris]
 gb|ESW32297.1| hypothetical protein PHAVU_002G310300g [Phaseolus vulgaris]
 gb|ESW32298.1| hypothetical protein PHAVU_002G310300g [Phaseolus vulgaris]
Length=648

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 173/218 (79%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC +D+ +G ++G+DVSLPE YV S R+PQ+ +GG PP +RP LA
Sbjct  427  APYETRHHMEYCIKALCNADVTQGFKIGRDVSLPEAYVRSVRDPQRDLGGKPPHQRPILA  486

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL+HW++KDPDMKI+G M      K +Y+ HMK+SKYCIC +GYEVN
Sbjct  487  FYAGNMHGYLRPILLKHWKDKDPDMKIYGPMPHGVASKMNYIHHMKNSKYCICPKGYEVN  546

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE LNW++F++ + EKDI NLK IL+S+ +  Y +
Sbjct  547  SPRVVEAIFYECVPVIISDNFVPPFFEVLNWDAFSIILAEKDIPNLKQILLSVSQEKYLK  606

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q  V++ Q+HF WH  P +YD+FHM LHSIWY RVF+
Sbjct  607  LQLGVRKAQKHFFWHVKPLKYDLFHMTLHSIWYNRVFQ  644



>ref|XP_010535964.1| PREDICTED: probable glycosyltransferase At3g07620 [Tarenaya hassleriana]
 ref|XP_010535965.1| PREDICTED: probable glycosyltransferase At3g07620 [Tarenaya hassleriana]
 ref|XP_010535966.1| PREDICTED: probable glycosyltransferase At3g07620 [Tarenaya hassleriana]
 ref|XP_010535967.1| PREDICTED: probable glycosyltransferase At3g07620 [Tarenaya hassleriana]
Length=643

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 173/216 (80%), Gaps = 5/216 (2%)
 Frame = +2

Query  122  ETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFA  301
            ETR+HM +CI++LC +D+  G ++G+DVSLPETYV +++NP + +GG PPS+R  LAF+A
Sbjct  425  ETRHHMEHCIKALCNADVTAGFKIGRDVSLPETYVRAAKNPLRDLGGKPPSQRRILAFYA  484

Query  302  GQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPR  466
            G MHGY+R  LL HW+++DP+MKIFG M      K +Y+ HMKSSKYCIC +GYEVNSPR
Sbjct  485  GSMHGYLRQILLNHWKDRDPEMKIFGRMPRGFESKMNYIDHMKSSKYCICPKGYEVNSPR  544

Query  467  VVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQT  646
            VVE+I YEC+PVIISDNFVPPFFE L+W++F++ + EKDI  LK IL SIPE  Y  MQT
Sbjct  545  VVESIFYECIPVIISDNFVPPFFEVLDWDAFSLVLAEKDIPRLKEILTSIPEEKYLRMQT  604

Query  647  RVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
             V++ QRHFLWH  P+++D+FHM+LHSIWY R+F+ 
Sbjct  605  AVRKAQRHFLWHAKPEKHDLFHMVLHSIWYNRMFQA  640



>ref|XP_010688286.1| PREDICTED: probable glycosyltransferase At5g03795 [Beta vulgaris 
subsp. vulgaris]
Length=600

 Score =   301 bits (772),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 170/212 (80%), Gaps = 5/212 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            TR HM++CIR LC +++  G  +GKDVS+P TY+ S  +P + IGG PPS+R  LAFFAG
Sbjct  383  TRDHMSSCIRGLCNANVARGFSVGKDVSVPVTYIRSGNDPTRDIGGKPPSERNILAFFAG  442

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
            Q+HGY+RP LLQ+WENK PDMKI G M      K  Y  +MKSSKYCICARGY V++PRV
Sbjct  443  QLHGYLRPLLLQYWENKVPDMKILGPMQRDVQSKAVYRDYMKSSKYCICARGYGVHTPRV  502

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE+I YEC+PVIISDN+VPPFFE L+WE+FAVFVLEKDI NL+NIL+SI E  Y +MQ +
Sbjct  503  VESIFYECIPVIISDNYVPPFFEVLDWETFAVFVLEKDIPNLRNILLSISEARYLDMQQK  562

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            ++ VQRHF+WH +P++YD+FHMILHSIWY RV
Sbjct  563  IRMVQRHFIWHKTPEKYDLFHMILHSIWYNRV  594



>ref|XP_008337502.1| PREDICTED: probable glycosyltransferase At3g07620 [Malus domestica]
Length=661

 Score =   303 bits (777),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 172/218 (79%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC +DL  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  440  APYETRHHMELCIKALCNADLTSGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQREILA  499

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL++W++KDPDMKIFG M      K  Y+ HM+ SKYCIC +G+EVN
Sbjct  500  FYAGNMHGYLRPILLEYWKDKDPDMKIFGPMPPGVASKMKYIHHMQDSKYCICPKGFEVN  559

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE L+W +F++ + EKDI  LK IL+SIPE  Y +
Sbjct  560  SPRVVEAIFYECVPVIISDNFVPPFFEVLDWGAFSLILAEKDIPKLKEILVSIPEEKYLQ  619

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q  V++VQ+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  620  LQLGVRKVQKHFLWHVKPLKYDLFHMTLHSIWYNRVFQ  657



>ref|XP_007013074.1| Exostosin family protein [Theobroma cacao]
 gb|EOY30693.1| Exostosin family protein [Theobroma cacao]
Length=641

 Score =   302 bits (774),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 168/210 (80%), Gaps = 5/210 (2%)
 Frame = +2

Query  134  HMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMH  313
            H+ +C+R LC ++  +  ++GKD +LP TY+ S+  P +++GG PPS+R +LAFFAG MH
Sbjct  427  HLRSCLRVLCNANAAKDFKIGKDTTLPVTYIRSAEAPLENLGGKPPSERNFLAFFAGGMH  486

Query  314  GYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRVVEA  478
            GY+RP LLQ+W+NK+PDMKIFG M      K+ Y  HMKSSKYCICARGYEV++PRVVEA
Sbjct  487  GYLRPILLQYWQNKEPDMKIFGPMPRDIEGKRTYREHMKSSKYCICARGYEVHTPRVVEA  546

Query  479  ISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKR  658
            I YECVPVIISDN+VPPFFE LNWE+FAVFV EKDI NL+NIL+SIPE  Y EM +R K 
Sbjct  547  IYYECVPVIISDNYVPPFFEVLNWEAFAVFVQEKDIPNLRNILLSIPEEKYLEMHSRAKL  606

Query  659  VQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            VQ+HFLWH  P +YD+FHMILHS+WY RV 
Sbjct  607  VQQHFLWHKKPVKYDLFHMILHSVWYNRVL  636



>ref|XP_008805667.1| PREDICTED: probable glycosyltransferase At3g07620 [Phoenix dactylifera]
 ref|XP_008805745.1| PREDICTED: probable glycosyltransferase At3g07620 [Phoenix dactylifera]
Length=711

 Score =   304 bits (779),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 167/217 (77%), Gaps = 5/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+ M   IR+LC +DLREG +LGKDVSLPETYV S+RNP + +GG P  +RP LA
Sbjct  490  APYETRHSMERSIRALCNADLREGFRLGKDVSLPETYVRSARNPLRDLGGKPADQRPILA  549

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG +HG +RP LL HWENKDPDMKIFG M      K  Y+ +MK+SKYCIC RGYEVN
Sbjct  550  FFAGNLHGRLRPVLLDHWENKDPDMKIFGPMPPGVESKMTYIQYMKTSKYCICPRGYEVN  609

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVI+SDN+VPPFFE LNWE+F+V + E+D+  LK +L+SIP   Y  
Sbjct  610  SPRVVESIFYECVPVIVSDNYVPPFFEVLNWEAFSVIIPEEDVPRLKEVLLSIPREKYLS  669

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            +Q  V++VQ+HFLWH  P +YD FHMILHSIW  RVF
Sbjct  670  LQMGVRKVQQHFLWHSKPVKYDAFHMILHSIWLNRVF  706



>ref|XP_002324438.2| hypothetical protein POPTR_0018s09250g [Populus trichocarpa]
 gb|EEF03003.2| hypothetical protein POPTR_0018s09250g [Populus trichocarpa]
Length=682

 Score =   303 bits (776),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 174/218 (80%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+DVS PETYV S+RNP + +GG PPS+R  LA
Sbjct  461  APYETRHHMEHCIKALCNADVTAGFKIGRDVSFPETYVRSARNPLRDLGGKPPSQRNILA  520

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL++W++KDPDMKIFG M      K +Y+ HM+ SKYCIC +GYEVN
Sbjct  521  FYAGNMHGYLRPILLKYWKDKDPDMKIFGPMPPGVASKMNYIHHMQRSKYCICPKGYEVN  580

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFF+ L+W +F++ + EKDI NLK IL+SIP+  Y +
Sbjct  581  SPRVVEAIFYECVPVIISDNFVPPFFDVLDWGAFSLILAEKDISNLKEILLSIPKEKYLQ  640

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  V++ QRHFLWH SP +YD+F+M LHSIWY RV++
Sbjct  641  MQLGVRKAQRHFLWHASPMKYDLFYMTLHSIWYNRVYQ  678



>ref|XP_006394831.1| hypothetical protein EUTSA_v10003790mg [Eutrema salsugineum]
 ref|XP_006394832.1| hypothetical protein EUTSA_v10003790mg [Eutrema salsugineum]
 gb|ESQ32117.1| hypothetical protein EUTSA_v10003790mg [Eutrema salsugineum]
 gb|ESQ32118.1| hypothetical protein EUTSA_v10003790mg [Eutrema salsugineum]
Length=652

 Score =   301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 171/219 (78%), Gaps = 6/219 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR H +  IR+LC SD++EG   GKD SLPET+V   + P  S+GG   S+RP LA
Sbjct  431  APSETRKHFSKSIRALCNSDVKEGFVFGKDTSLPETFVRDPKKPLSSLGGKSASQRPILA  490

Query  293  FFAGQ-MHGYVRPTLLQHW-ENKDPDMKIFG----TMDKKDYLVHMKSSKYCICARGYEV  454
            FFAG+  HGY+RP LL +W  NKDPD+KIFG    T   K+YL  MK+SKYCICA+GYEV
Sbjct  491  FFAGKPEHGYLRPILLSYWGNNKDPDLKIFGKLPRTKGNKNYLQFMKTSKYCICAKGYEV  550

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI Y+CVPVIISDNFVPPFFE LNWESFA+FV EKDI NLK ILMSI E  Y+
Sbjct  551  NSPRVVEAIFYDCVPVIISDNFVPPFFEVLNWESFALFVPEKDIPNLKKILMSISERRYK  610

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +MQ RVK+VQ+HFLWH  P+++D+FHMILHS+W+ RVF+
Sbjct  611  QMQMRVKKVQKHFLWHVKPEKFDMFHMILHSVWFNRVFQ  649



>ref|XP_007013073.1| Exostosin family protein [Theobroma cacao]
 gb|EOY30692.1| Exostosin family protein [Theobroma cacao]
Length=736

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 176/218 (81%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM +CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  515  APYETRHHMEHCIKALCNADVTVGFKIGRDVSLPETYVRSARNPLRDLGGKPPSQRHILA  574

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL++W++KD DMKIFG M      K +Y+ +MKSSKYCIC +GYEVN
Sbjct  575  FYAGNMHGYLRPILLKYWKDKDDDMKIFGPMPPGVSSKMNYIQYMKSSKYCICPKGYEVN  634

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE L+W +F++ + EK+I NLK+IL+SIP+  Y  
Sbjct  635  SPRVVEAIFYECVPVIISDNFVPPFFEVLDWGAFSIILAEKNIPNLKDILLSIPKERYLA  694

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q  V++VQRHFLWH  P++YD+FHM LHSIWY RV++
Sbjct  695  LQLGVRKVQRHFLWHARPEKYDLFHMTLHSIWYNRVYQ  732



>ref|XP_009389960.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Musa acuminata subsp. malaccensis]
Length=679

 Score =   301 bits (772),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 169/217 (78%), Gaps = 5/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+ M + IR+LC +DL EG ++GKDVSLPET V S +NP + +GG P S+R  LA
Sbjct  458  APYETRHTMDSSIRALCNADLHEGFRVGKDVSLPETLVLSPKNPLRELGGNPASERSILA  517

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHG +RP LLQHWENKDPDMKIFG M     +KK Y+  MK+SKYCIC RGYEVN
Sbjct  518  FFAGNMHGKLRPILLQHWENKDPDMKIFGPMPPGVNNKKTYIQFMKTSKYCICPRGYEVN  577

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPR+VE+I YECVPVIISDN+VPP FE LNWE+F+V V E D+  LK ILMSIP N Y  
Sbjct  578  SPRIVESIFYECVPVIISDNYVPPLFEVLNWEAFSVIVPEADVPRLKEILMSIPLNKYLL  637

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            +Q  V++VQ+HFLWH +P +YD+FHMILHSIW+ RVF
Sbjct  638  LQKGVRKVQKHFLWHNTPVKYDLFHMILHSIWFNRVF  674



>ref|XP_004241893.1| PREDICTED: probable glycosyltransferase At3g07620 [Solanum lycopersicum]
Length=572

 Score =   298 bits (764),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 168/219 (77%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A   TR +M  C+R LC S++  G ++GKDVSLP TYV S+ +P +  GG PPS RP LA
Sbjct  351  ALRLTRKNMETCVRVLCNSNIAGGFKIGKDVSLPVTYVRSAEDPLKDFGGNPPSARPVLA  410

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG +HGY+RP LLQHW  K+PDMKIFG M      K  Y   MKSSKYCICARGYEV+
Sbjct  411  FFAGGIHGYLRPILLQHWSEKEPDMKIFGPMPRDPEGKAKYRDLMKSSKYCICARGYEVH  470

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            +PRVVE+I  ECVPVIISDN+VPPFFE  +WESF+VFVLEKD+ +L+NIL+SIPE  Y +
Sbjct  471  TPRVVESIHSECVPVIISDNYVPPFFEVFDWESFSVFVLEKDVTDLRNILLSIPEEKYMK  530

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            MQ R+K VQ++FLWH SP RYD+FHMILHSIWY RV + 
Sbjct  531  MQRRLKIVQQYFLWHRSPVRYDLFHMILHSIWYNRVLQV  569



>ref|XP_009389958.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009389959.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=695

 Score =   301 bits (772),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 169/217 (78%), Gaps = 5/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+ M + IR+LC +DL EG ++GKDVSLPET V S +NP + +GG P S+R  LA
Sbjct  474  APYETRHTMDSSIRALCNADLHEGFRVGKDVSLPETLVLSPKNPLRELGGNPASERSILA  533

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHG +RP LLQHWENKDPDMKIFG M     +KK Y+  MK+SKYCIC RGYEVN
Sbjct  534  FFAGNMHGKLRPILLQHWENKDPDMKIFGPMPPGVNNKKTYIQFMKTSKYCICPRGYEVN  593

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPR+VE+I YECVPVIISDN+VPP FE LNWE+F+V V E D+  LK ILMSIP N Y  
Sbjct  594  SPRIVESIFYECVPVIISDNYVPPLFEVLNWEAFSVIVPEADVPRLKEILMSIPLNKYLL  653

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            +Q  V++VQ+HFLWH +P +YD+FHMILHSIW+ RVF
Sbjct  654  LQKGVRKVQKHFLWHNTPVKYDLFHMILHSIWFNRVF  690



>ref|XP_010688287.1| PREDICTED: probable glycosyltransferase At3g07620 [Beta vulgaris 
subsp. vulgaris]
Length=626

 Score =   299 bits (766),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 171/218 (78%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM N I++LC +D   G ++G+DVSLPET+V  +RNP + IGG  PSKR  LA
Sbjct  405  APYETRHHMENSIKALCNADATIGFKIGRDVSLPETFVRYARNPLRDIGGKLPSKRNILA  464

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            F+AG  HGY+RPTLL HW++KDPDM+I+G +      + +YL HMKSSKYCIC +G+EVN
Sbjct  465  FYAGNNHGYLRPTLLNHWKDKDPDMRIYGLLPVNVSRRMNYLQHMKSSKYCICPKGHEVN  524

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPR+VEAI YECVPVIISDNFVPPFFE LNWE+F+V V EKDI  LK IL+SIP   Y +
Sbjct  525  SPRIVEAIFYECVPVIISDNFVPPFFELLNWEAFSVIVSEKDIPKLKEILVSIPMEKYIK  584

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            MQ  V++VQRHFLWH  P +YD+FHM LHSIWY+RVF+
Sbjct  585  MQLAVRKVQRHFLWHARPVKYDLFHMTLHSIWYSRVFQ  622



>emb|CDX88200.1| BnaA06g27910D [Brassica napus]
Length=637

 Score =   299 bits (766),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 168/217 (77%), Gaps = 6/217 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR   A  IR+LC SD++EG   GKD SLPET+V   + P  SIGG   S+RP LA
Sbjct  416  APSETRNVFAKSIRALCNSDVKEGFVFGKDTSLPETFVRDPKKPLSSIGGKSASQRPTLA  475

Query  293  FFAGQM-HGYVRPTLLQHW-ENKDPDMKIFG----TMDKKDYLVHMKSSKYCICARGYEV  454
            FFAG+  HGY+RP LL +W  NKDPD+KIFG    T   K+YL  MK+SKYCICA+G+EV
Sbjct  476  FFAGKPDHGYLRPILLSYWGNNKDPDLKIFGKLPRTKGNKNYLQFMKTSKYCICAKGFEV  535

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI Y+CVPVIISDNFVPPFFE LNWE+FA+FV EKDI NLK ILMS+ E  YR
Sbjct  536  NSPRVVEAIFYDCVPVIISDNFVPPFFEVLNWEAFALFVAEKDIPNLKKILMSVSERRYR  595

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +MQ RVKRVQ+HFLWH  P++YD+FHMILHS+W+ RV
Sbjct  596  QMQMRVKRVQKHFLWHVQPEKYDMFHMILHSVWFNRV  632



>ref|XP_009151104.1| PREDICTED: probable glycosyltransferase At3g07620 [Brassica rapa]
Length=679

 Score =   300 bits (769),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 168/217 (77%), Gaps = 6/217 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR   A  IR+LC SD++EG   GKD SLPET+V   + P  SIGG   S+RP LA
Sbjct  458  APSETRNVFAKSIRALCNSDVKEGFVFGKDTSLPETFVRDPKKPLSSIGGKSASQRPTLA  517

Query  293  FFAGQM-HGYVRPTLLQHW-ENKDPDMKIFG----TMDKKDYLVHMKSSKYCICARGYEV  454
            FFAG+  HGY+RP LL +W  NKDPD+KIFG    T   K+YL  MK+SKYCICA+G+EV
Sbjct  518  FFAGKPDHGYLRPILLSYWGNNKDPDLKIFGKLPRTKGNKNYLQFMKTSKYCICAKGFEV  577

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPRVVEAI Y+CVPVIISDNFVPPFFE LNWE+FA+FV EKDI NLK ILMS+ E  YR
Sbjct  578  NSPRVVEAIFYDCVPVIISDNFVPPFFEVLNWEAFALFVAEKDIPNLKKILMSVSERRYR  637

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +MQ RVKRVQ+HFLWH  P++YD+FHMILHS+W+ RV
Sbjct  638  QMQMRVKRVQKHFLWHVQPEKYDMFHMILHSVWFNRV  674



>ref|XP_008362949.1| PREDICTED: probable glycosyltransferase At3g07620 [Malus domestica]
Length=665

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 169/218 (78%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR+HM  CI++LC +D   G ++ +DVSLPETYV S RNP   +GG PPS+R  LA
Sbjct  444  APYETRHHMERCIKALCNADPTSGFKIARDVSLPETYVRSERNPLVDLGGKPPSZRKILA  503

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVN  457
            F+AG MHGY+RP LL++W++KDPDMKIFG M      K +Y+ HM+SSKYCIC +GYEVN
Sbjct  504  FYAGNMHGYLRPILLEYWKDKDPDMKIFGPMPPGVARKLNYIHHMQSSKYCICPKGYEVN  563

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVEAI YECVPVIISDNFVPPFFE L+W +F+V + E+DI  LK  L+SIPE  Y +
Sbjct  564  SPRVVEAIFYECVPVIISDNFVPPFFEVLDWGAFSVILAEQDIPKLKEJLVSIPEEKYLQ  623

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +Q  V++VQ+HFLWH  P +YD+FHM LHSIWY RVF+
Sbjct  624  LQLGVRKVQKHFLWHAKPLKYDLFHMTLHSIWYNRVFQ  661



>ref|XP_010495150.1| PREDICTED: probable glycosyltransferase At5g03795 [Camelina sativa]
Length=208

 Score =   283 bits (725),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 161/206 (78%), Gaps = 2/206 (1%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGYV  322
            NCIRSLC +D+     +GKDVSLPET V SS+NP   IGG  PSKR  LAFFAG +HGYV
Sbjct  2    NCIRSLCNADVGVDFVVGKDVSLPETKVSSSQNPNGKIGGNRPSKRTILAFFAGNLHGYV  61

Query  323  RPTLLQHWENK-DPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRVVEAISYECVP  499
            RP LL HW ++ +PDMKIF  +D K Y+ +MK S+YC+CA+GYEVNSPRVVE+I Y CVP
Sbjct  62   RPILLNHWSSRPEPDMKIFNRVDHKSYIRYMKRSRYCVCAKGYEVNSPRVVESILYGCVP  121

Query  500  VIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQRHFLW  679
            VIISDNFVPPF E LNWESFAVFV EK+I NL+ IL+SIP   Y EMQ RV +VQ+HF+W
Sbjct  122  VIISDNFVPPFLEILNWESFAVFVPEKEIPNLRKILVSIPVRRYVEMQKRVSKVQKHFMW  181

Query  680  HPS-PQRYDIFHMILHSIWYTRVFRT  754
            H   P RYD+FH ILHS+WY RVF+T
Sbjct  182  HDGEPVRYDLFHTILHSVWYNRVFQT  207



>ref|XP_010925918.1| PREDICTED: probable glycosyltransferase At5g03795 [Elaeis guineensis]
Length=710

 Score =   299 bits (765),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 166/217 (76%), Gaps = 5/217 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET + M + IR+LC +DL EG +LGKDVSLPE YV S+RNP + +GG P  +RP LA
Sbjct  489  APYETGHAMEHSIRTLCNADLHEGFRLGKDVSLPEIYVRSARNPLRDLGGKPADQRPILA  548

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHG +RP LL+HWENKDPDMKIFG M      K  Y+ +MK+SKYCIC RGYEVN
Sbjct  549  FFAGNMHGRLRPVLLEHWENKDPDMKIFGPMPRGVESKMTYIRYMKTSKYCICPRGYEVN  608

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRVVE+I YECVPVIISDN+VPP FE LNWE+F+V + E+D+  LK IL+SIP   Y  
Sbjct  609  SPRVVESIFYECVPVIISDNYVPPLFEVLNWEAFSVIIPEEDVPRLKEILLSIPREKYLS  668

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            +Q  V++VQ+HFLWH  P +YD FHMILHSIW+ RVF
Sbjct  669  LQMGVRKVQQHFLWHVKPVKYDAFHMILHSIWFNRVF  705



>emb|CAN76867.1| hypothetical protein VITISV_012309 [Vitis vinifera]
Length=1908

 Score =   309 bits (791),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 177/220 (80%), Gaps = 5/220 (2%)
 Frame = +2

Query  113   AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
             A  ETR+HM  CI++LC +D+  G ++G+DVSLPETYV S+RNP + +GG PPS+R  LA
Sbjct  1173  APYETRHHMEQCIKALCNADVTAGFKIGRDVSLPETYVRSARNPLRDLGGKPPSERHILA  1232

Query  293   FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
             F+AG MHGY+RP LL++W++KDPDMKI+G M      K +Y+ HMKSSK+CIC +GYEVN
Sbjct  1233  FYAGNMHGYLRPILLKYWKDKDPDMKIYGPMPPGVASKMNYIQHMKSSKFCICPKGYEVN  1292

Query  458   SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
             SPRVVEAI YECVPVIISDNFVPPFF+ L+W +F++ + EKDI NLK++L+SIP   Y +
Sbjct  1293  SPRVVEAIFYECVPVIISDNFVPPFFDVLDWGAFSIILAEKDIPNLKDVLLSIPNEKYLQ  1352

Query  638   MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRTV  757
             MQ  V++VQ+HFLWH  P +YD+FHM LHSIWY RVF++V
Sbjct  1353  MQLGVRKVQKHFLWHAKPLKYDLFHMTLHSIWYNRVFQSV  1392


 Score =   307 bits (786),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 171/214 (80%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            TR    N IR+LC S++  G ++GKD +LP TY+  S +P + +GG PPS+RP LAFFAG
Sbjct  496  TRQCSWNSIRALCNSNIASGFKIGKDTTLPVTYIRKSEDPLKYLGGKPPSQRPILAFFAG  555

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTMDKKD-----YLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP LLQ+WENK+ D+KIFG M + D     Y  HMKSSKYCICARGYEV++PRV
Sbjct  556  SMHGYLRPILLQYWENKEQDIKIFGPMSRDDGGKSRYRDHMKSSKYCICARGYEVHTPRV  615

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI YECVPVIISDN+VPPFFE LNWE+FAVF+LEKD+ NL+NIL+SIPE  Y +MQ R
Sbjct  616  VEAIFYECVPVIISDNYVPPFFEILNWEAFAVFILEKDVPNLRNILLSIPEEKYLQMQMR  675

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            VK VQ+HFLWH  P +YD+FHMILHS+WY RVF+
Sbjct  676  VKMVQQHFLWHKKPVKYDLFHMILHSVWYNRVFQ  709



>ref|XP_010419736.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
 ref|XP_010419737.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=546

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 166/216 (77%), Gaps = 2/216 (1%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR    NCIRSLC +D+     +GKDVSLPET V SS+NP   IGG  PSKR  LA
Sbjct  330  APAETRGPYMNCIRSLCNADVGVDFVVGKDVSLPETKVSSSQNPNGKIGGNRPSKRTILA  389

Query  293  FFAGQMHGYVRPTLLQHWENK-DPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRV  469
            FFAG +HGYVRP LL HW ++ +PDMKIF  +D K Y+ +MK SK+C+CA+GYEVNSPRV
Sbjct  390  FFAGNLHGYVRPILLNHWSSRPEPDMKIFNRVDHKSYIRYMKRSKFCVCAKGYEVNSPRV  449

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE+I Y CVPVIISDNFVPPF E LNWESFAVFV EK+I NL+ IL+SIP   Y EMQ R
Sbjct  450  VESILYGCVPVIISDNFVPPFLEILNWESFAVFVPEKEIPNLRKILISIPVRRYVEMQKR  509

Query  650  VKRVQRHFLWHPS-PQRYDIFHMILHSIWYTRVFRT  754
            V +VQ+HF+WH   P RYD+FHMILHS+WY RVF+T
Sbjct  510  VSKVQKHFMWHDGEPVRYDLFHMILHSVWYNRVFQT  545



>ref|XP_006282582.1| hypothetical protein CARUB_v10004511mg [Capsella rubella]
 gb|EOA15480.1| hypothetical protein CARUB_v10004511mg [Capsella rubella]
Length=553

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 168/214 (79%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T+  M N +R+LC S++ +G ++G D +LP TY+ S+++P + +GG  PS+R  LAFFAG
Sbjct  336  TKKSMKNSVRALCNSNVAQGFRIGTDTALPVTYIRSAQSPLEYLGGKTPSERKILAFFAG  395

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP L+Q WENK+PDMKIFG M      KK Y  +MKSS+YCICARGYEV++PRV
Sbjct  396  SMHGYLRPILVQLWENKEPDMKIFGPMPRDPESKKKYREYMKSSRYCICARGYEVHTPRV  455

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI  ECVPVII+DN+VPPFFE LNWE FAVFV EKDI NL+NIL+SIPE  Y  MQ R
Sbjct  456  VEAIINECVPVIIADNYVPPFFEVLNWEEFAVFVEEKDIPNLRNILLSIPEERYIGMQAR  515

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            VK VQ+HFLWH  P ++D+FHM+LHSIWY+RV R
Sbjct  516  VKAVQQHFLWHKKPVKFDLFHMVLHSIWYSRVHR  549



>ref|XP_010535968.1| PREDICTED: probable glycosyltransferase At3g07620 [Tarenaya hassleriana]
 ref|XP_010535969.1| PREDICTED: probable glycosyltransferase At3g07620 [Tarenaya hassleriana]
 ref|XP_010535970.1| PREDICTED: probable glycosyltransferase At3g07620 [Tarenaya hassleriana]
 ref|XP_010535971.1| PREDICTED: probable glycosyltransferase At3g07620 [Tarenaya hassleriana]
 ref|XP_010535972.1| PREDICTED: probable glycosyltransferase At3g07620 [Tarenaya hassleriana]
 ref|XP_010535973.1| PREDICTED: probable glycosyltransferase At3g07620 [Tarenaya hassleriana]
Length=566

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 169/213 (79%), Gaps = 5/213 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T+  M N IRSLC +++ +G ++ KD SLP TY+ S+  P + +GG P S+R  LAFFAG
Sbjct  349  TKKPMKNTIRSLCNANIAQGFRIWKDTSLPVTYIRSAEAPLEYVGGKPRSERQILAFFAG  408

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP LL++WENK+PDMKIFG M      KK Y  +MK S+YCICARGYEV++PRV
Sbjct  409  SMHGYLRPILLRYWENKEPDMKIFGPMPRDPESKKQYREYMKGSRYCICARGYEVHTPRV  468

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI++ECVPVIISDN+VPPFFE LNWE+F+VFV EKD+ NL+NIL+SIPE  Y +MQ R
Sbjct  469  VEAIAHECVPVIISDNYVPPFFEVLNWETFSVFVEEKDVPNLRNILLSIPEEKYLKMQAR  528

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
            VK VQ+HFLWH  P +YD+FH+ILHSIWY RV+
Sbjct  529  VKMVQKHFLWHKKPVKYDLFHLILHSIWYNRVY  561



>gb|KHG01319.1| hypothetical protein F383_23550 [Gossypium arboreum]
Length=634

 Score =   295 bits (754),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 163/206 (79%), Gaps = 5/206 (2%)
 Frame = +2

Query  146  CIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGYVR  325
             IR+LC S+  +G ++GKD +LP TY+ S   P +++GG PPS+R  LAFFAG MHGY+R
Sbjct  424  SIRALCNSNAAKGFEIGKDTTLPVTYIRSMEAPLENLGGKPPSERNLLAFFAGGMHGYLR  483

Query  326  PTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRVVEAISYE  490
            P LLQ+W+NK+ DMKIFG M      K+ Y  HMKSSKYCICA+GYEV++PRVVE+I YE
Sbjct  484  PILLQYWQNKESDMKIFGPMPRDVEGKRKYREHMKSSKYCICAKGYEVHTPRVVESIYYE  543

Query  491  CVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQRH  670
            CVPVIISDN+VPPFFE LNWE+FA+ V EKDI +L+NIL+SIPE  Y EM  RVK VQRH
Sbjct  544  CVPVIISDNYVPPFFEVLNWEAFAILVQEKDIPSLRNILLSIPEEKYLEMHARVKLVQRH  603

Query  671  FLWHPSPQRYDIFHMILHSIWYTRVF  748
            FLWH  P +YD+FHMILHS+WY RVF
Sbjct  604  FLWHKRPVKYDLFHMILHSVWYNRVF  629



>ref|XP_007204228.1| hypothetical protein PRUPE_ppa002755mg [Prunus persica]
 gb|EMJ05427.1| hypothetical protein PRUPE_ppa002755mg [Prunus persica]
Length=636

 Score =   295 bits (754),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 166/218 (76%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A + T+  M NCIRSLC +++    ++GKD SLP TY+ S  NP Q +GG P S+R  LA
Sbjct  415  APKLTKQCMKNCIRSLCNANVGRDFKIGKDTSLPVTYIRSVENPLQDLGGKPASERSILA  474

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LL +WENK+PDMKIFG M      KK Y  +MKSSKYCICARGYEV+
Sbjct  475  FFAGGMHGYLRPILLHYWENKEPDMKIFGPMPHDIESKKIYREYMKSSKYCICARGYEVH  534

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            +PRVVEAI YECVPVIISDN++PPFFE  NWE+FAVFV EKDI NL++IL+SIPE  Y  
Sbjct  535  TPRVVEAIFYECVPVIISDNYMPPFFEVFNWEAFAVFVQEKDIPNLRDILLSIPEEKYLT  594

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            M + VK VQ+HF WH  P +YD+FHMILHS+WY RV +
Sbjct  595  MMSSVKMVQQHFFWHKKPVKYDLFHMILHSVWYNRVLQ  632



>gb|KFK34883.1| hypothetical protein AALP_AA5G205800 [Arabis alpina]
Length=428

 Score =   288 bits (738),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 166/215 (77%), Gaps = 5/215 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T+ HM N +R+LC S++ +G ++G D +LP TY+ SS++P +  GG   S+R  LAFFAG
Sbjct  211  TKKHMKNSVRALCNSNVAQGFRIGIDTALPVTYIRSSKSPLEYRGGKNASERKILAFFAG  270

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP L+Q WENK+PDMKI G M      KK Y  +MKSSKYCICARGYEV++PRV
Sbjct  271  SMHGYLRPILVQLWENKEPDMKILGPMPRDPESKKQYREYMKSSKYCICARGYEVHTPRV  330

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI  ECVPVII+DN+VPPFFE LNWE FAVFV EKDI NL+NIL+ IPE  Y  MQ +
Sbjct  331  VEAIINECVPVIIADNYVPPFFEVLNWEEFAVFVEEKDIANLRNILLLIPEERYIGMQAK  390

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            VK VQ+HFLWH +P ++D+FHMILHSIWY RV+R 
Sbjct  391  VKMVQQHFLWHKNPVKFDLFHMILHSIWYNRVYRV  425



>ref|XP_004150756.1| PREDICTED: probable glycosyltransferase At3g07620-like [Cucumis 
sativus]
Length=341

 Score =   285 bits (729),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 166/218 (76%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A + T+  + NCIR+LC ++     ++GKD SLP T+V+S+ +    IGG PPS+R  LA
Sbjct  120  APKLTKRLVKNCIRALCNANGAGDFEIGKDTSLPVTFVHSTEDLITKIGGKPPSERTTLA  179

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LL +WENK+PDM I G M      K  Y+  MKSSKYCICARGY+V+
Sbjct  180  FFAGSMHGYLRPILLHYWENKEPDMMIVGPMPNSIEGKNAYMEQMKSSKYCICARGYQVH  239

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRV+EAI  EC+PVIISDN+VPP FE LNWESF+VFV E++I NL++IL+SIPE  YR 
Sbjct  240  SPRVIEAILNECIPVIISDNYVPPLFEVLNWESFSVFVKEREIPNLRDILLSIPEENYRA  299

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            M +RVK VQ+HFLWH  P +YD FHMILHSIWYTRVF+
Sbjct  300  MHSRVKMVQQHFLWHEKPAKYDAFHMILHSIWYTRVFQ  337



>ref|XP_010491897.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
 ref|XP_010491898.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
 ref|XP_010491899.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=547

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 165/216 (76%), Gaps = 2/216 (1%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR    NCIRSLC +D+     +GKDVSLPET V SS+NP   IGG  PSKR  LA
Sbjct  331  APAETRGPYMNCIRSLCNADVGVDFVVGKDVSLPETKVSSSQNPNGKIGGNRPSKRTILA  390

Query  293  FFAGQMHGYVRPTLLQHWENK-DPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRV  469
            FFAG +HGYVRP LL HW ++ +PDMKIF  +D K Y+ +MK S+YC+CA+GYEVNSPRV
Sbjct  391  FFAGNLHGYVRPILLNHWSSRPEPDMKIFNRVDHKSYIRYMKRSRYCVCAKGYEVNSPRV  450

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE+I Y CVPVIISDNFVPPF E LNWESFAVFV EK+I NL+ IL+SIP   Y EMQ R
Sbjct  451  VESILYGCVPVIISDNFVPPFLEILNWESFAVFVPEKEIPNLRKILVSIPVRRYVEMQKR  510

Query  650  VKRVQRHFLWHPS-PQRYDIFHMILHSIWYTRVFRT  754
            V +VQ+HF+WH   P RYD+FH ILHS+WY RVF+T
Sbjct  511  VSKVQKHFMWHDGEPVRYDLFHTILHSVWYNRVFQT  546



>ref|XP_008242550.1| PREDICTED: probable glycosyltransferase At3g07620 [Prunus mume]
Length=624

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 166/218 (76%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A + T+  M NCIRSLC +++    ++GKD SLP TY+ S  NP Q +GG P S+R  LA
Sbjct  403  APKLTKQCMKNCIRSLCNANVGRDFKIGKDTSLPVTYIRSVENPLQDLGGKPASERSILA  462

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LL +WENK+PDMKIFG M      K+ Y  +MKSSKYCICARGYEV+
Sbjct  463  FFAGGMHGYLRPILLHYWENKEPDMKIFGPMPHDIESKRIYREYMKSSKYCICARGYEVH  522

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            +PRVVEAI YECVPVIISDN++PPFFE  NWE+FAVFV EKDI NL++IL+SIPE  Y  
Sbjct  523  TPRVVEAIFYECVPVIISDNYMPPFFEVFNWEAFAVFVQEKDIPNLRDILLSIPEEKYLT  582

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            M + VK VQ+HF WH  P +YD+FHMILHS+WY RV +
Sbjct  583  MMSSVKMVQQHFFWHKKPVKYDLFHMILHSVWYNRVLQ  620



>ref|XP_006286421.1| hypothetical protein CARUB_v10003248mg [Capsella rubella]
 gb|EOA19319.1| hypothetical protein CARUB_v10003248mg [Capsella rubella]
Length=573

 Score =   290 bits (743),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 165/216 (76%), Gaps = 2/216 (1%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR    NCIRSLC +D+     +GKDVSLPET V S++NP   IGG  PSKR  LA
Sbjct  357  APAETRGPYMNCIRSLCNADVGVDFVVGKDVSLPETKVSSAQNPNGKIGGNRPSKRTILA  416

Query  293  FFAGQMHGYVRPTLLQHWENK-DPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRV  469
            FFAG +HGYVRP LL HW ++ +PDMKIF  +D K Y+ +MK S++C+CA+GYEVNSPRV
Sbjct  417  FFAGNLHGYVRPILLNHWSSRPEPDMKIFNRIDHKSYIRYMKRSRFCVCAKGYEVNSPRV  476

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE+I Y CVPVIISDNFVPPF E LNWESFAVFV EK+I NL+ IL+SIP   Y EM  R
Sbjct  477  VESILYGCVPVIISDNFVPPFLEILNWESFAVFVPEKEIPNLRKILVSIPVRRYVEMHKR  536

Query  650  VKRVQRHFLWHPS-PQRYDIFHMILHSIWYTRVFRT  754
            V +VQ+HF+WH   P RYDIFHMILHS+WY RVF+T
Sbjct  537  VSKVQKHFMWHDDEPVRYDIFHMILHSVWYNRVFQT  572



>ref|XP_010435540.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Camelina sativa]
Length=553

 Score =   289 bits (740),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 166/214 (78%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T+  M N +R+LC S++ +G ++G D +LP TY+ S+ +P + +GG  PS+R  LAFFAG
Sbjct  336  TKKTMRNSVRALCNSNVAQGFRIGSDTALPVTYIRSAESPLEYLGGKTPSERKILAFFAG  395

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP L++ WENK+PDMKIFG M      KK Y  +MKSS+YCICARGYEV++PRV
Sbjct  396  SMHGYLRPRLVKLWENKEPDMKIFGPMPRDPESKKQYREYMKSSRYCICARGYEVHTPRV  455

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI  ECVPVII+DN+VPPFFE LNWE FAVFV EKDI NL+NIL+SIPE  Y  MQ R
Sbjct  456  VEAIMNECVPVIIADNYVPPFFEVLNWEEFAVFVEEKDIPNLRNILLSIPEERYIGMQAR  515

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            VK VQ+HFLWH  P + D+FHMILHSIWY+RV R
Sbjct  516  VKAVQQHFLWHKKPVKLDLFHMILHSIWYSRVHR  549



>ref|XP_010435539.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Camelina sativa]
Length=554

 Score =   289 bits (740),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 166/214 (78%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T+  M N +R+LC S++ +G ++G D +LP TY+ S+ +P + +GG  PS+R  LAFFAG
Sbjct  337  TKKTMRNSVRALCNSNVAQGFRIGSDTALPVTYIRSAESPLEYLGGKTPSERKILAFFAG  396

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP L++ WENK+PDMKIFG M      KK Y  +MKSS+YCICARGYEV++PRV
Sbjct  397  SMHGYLRPRLVKLWENKEPDMKIFGPMPRDPESKKQYREYMKSSRYCICARGYEVHTPRV  456

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI  ECVPVII+DN+VPPFFE LNWE FAVFV EKDI NL+NIL+SIPE  Y  MQ R
Sbjct  457  VEAIMNECVPVIIADNYVPPFFEVLNWEEFAVFVEEKDIPNLRNILLSIPEERYIGMQAR  516

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            VK VQ+HFLWH  P + D+FHMILHSIWY+RV R
Sbjct  517  VKAVQQHFLWHKKPVKLDLFHMILHSIWYSRVHR  550



>ref|XP_002873524.1| exostosin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49783.1| exostosin family protein [Arabidopsis lyrata subsp. lyrata]
Length=546

 Score =   289 bits (739),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 166/216 (77%), Gaps = 2/216 (1%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR    NCIRSLC +D+     +GKDVSLPET + SS+NP  +IGG  PSKR  LA
Sbjct  330  APAETRGPYINCIRSLCNADVGVDFVVGKDVSLPETKISSSQNPNGNIGGNRPSKRTILA  389

Query  293  FFAGQMHGYVRPTLLQHWENK-DPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRV  469
            FFAG +HGYVRP LL  W ++ +PDMKIF  +D K Y+ +MK S++C+CA+GYEVNSPRV
Sbjct  390  FFAGNLHGYVRPILLNQWSSRPEPDMKIFNRIDHKSYIRYMKRSRFCVCAKGYEVNSPRV  449

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE++ Y CVPVIISDNFVPPF E LNWESFAVFV EK+I NL+ IL+SIP   Y EMQ R
Sbjct  450  VESVLYGCVPVIISDNFVPPFLEILNWESFAVFVPEKEIPNLRKILISIPVRRYVEMQKR  509

Query  650  VKRVQRHFLWHPS-PQRYDIFHMILHSIWYTRVFRT  754
            V +VQ+HF+WH   P RYD+FHMILHS+WY RVF+T
Sbjct  510  VMKVQKHFMWHDGEPVRYDVFHMILHSVWYNRVFQT  545



>gb|KFK34884.1| hypothetical protein AALP_AA5G205800 [Arabis alpina]
Length=554

 Score =   289 bits (740),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 166/215 (77%), Gaps = 5/215 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T+ HM N +R+LC S++ +G ++G D +LP TY+ SS++P +  GG   S+R  LAFFAG
Sbjct  337  TKKHMKNSVRALCNSNVAQGFRIGIDTALPVTYIRSSKSPLEYRGGKNASERKILAFFAG  396

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP L+Q WENK+PDMKI G M      KK Y  +MKSSKYCICARGYEV++PRV
Sbjct  397  SMHGYLRPILVQLWENKEPDMKILGPMPRDPESKKQYREYMKSSKYCICARGYEVHTPRV  456

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI  ECVPVII+DN+VPPFFE LNWE FAVFV EKDI NL+NIL+ IPE  Y  MQ +
Sbjct  457  VEAIINECVPVIIADNYVPPFFEVLNWEEFAVFVEEKDIANLRNILLLIPEERYIGMQAK  516

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            VK VQ+HFLWH +P ++D+FHMILHSIWY RV+R 
Sbjct  517  VKMVQQHFLWHKNPVKFDLFHMILHSIWYNRVYRV  551



>ref|XP_009139701.1| PREDICTED: probable glycosyltransferase At3g07620 [Brassica rapa]
 ref|XP_009139702.1| PREDICTED: probable glycosyltransferase At3g07620 [Brassica rapa]
Length=541

 Score =   289 bits (739),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 167/215 (78%), Gaps = 5/215 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T+ HM+N +R+LC S++ +G ++G D +LP TY+ S+ +P +  GG  PS+R  LAFFAG
Sbjct  321  TKKHMSNSVRALCNSNVAQGFRIGIDTALPVTYIRSAESPIEYRGGKTPSERKILAFFAG  380

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP L+Q WENK PDMKIFG M      KK Y  +MKSS+YCICARGYEV++PRV
Sbjct  381  SMHGYLRPILVQLWENKSPDMKIFGPMPRDPQGKKQYREYMKSSRYCICARGYEVHTPRV  440

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI  ECVPVII+DN+VPPFFE LNWE FAVFV EKDI NL+NIL+SIPE  Y  MQ R
Sbjct  441  VEAIINECVPVIIADNYVPPFFEVLNWEEFAVFVEEKDIQNLRNILVSIPEERYIGMQAR  500

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            VK VQ+HFLWH  P ++D+FHMILHS+W++R+ R 
Sbjct  501  VKTVQQHFLWHKKPVKFDLFHMILHSVWHSRLNRV  535



>emb|CDY53533.1| BnaCnng25370D [Brassica napus]
Length=546

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 166/214 (78%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T+ HM+N +R+LC S++ +G ++G D +LP TY+ S+ +P +  GG  PS+R  LAFFAG
Sbjct  326  TKKHMSNSVRALCNSNVAQGFRIGIDTALPVTYIRSAESPIEYRGGKTPSERKILAFFAG  385

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP L+Q WENK PDMKI G M      KK Y  +MKSS+YCICARGYEV++PRV
Sbjct  386  SMHGYLRPILVQLWENKSPDMKILGPMPRDPQGKKQYREYMKSSRYCICARGYEVHTPRV  445

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI  ECVPVII+DN+VPPFFE LNWE FAVFV EKDI NL+NIL+SIPE  Y  MQ R
Sbjct  446  VEAIVNECVPVIIADNYVPPFFEVLNWEEFAVFVEEKDIQNLRNILVSIPEERYIGMQAR  505

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            VK VQ+HFLWH  P ++D+FHMILHS+W++R+ R
Sbjct  506  VKTVQQHFLWHKKPVKFDLFHMILHSVWHSRINR  539



>emb|CDX74602.1| BnaA04g07870D [Brassica napus]
Length=545

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 167/215 (78%), Gaps = 5/215 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T+ HM+N +R+LC S++ +G ++G + +LP TY+ S+ +P +  GG  PS+R  LAFFAG
Sbjct  325  TKKHMSNSVRALCNSNVAQGFRIGINTALPVTYIRSAESPIEYRGGKTPSERKILAFFAG  384

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP L+Q WENK PDMKIFG M      KK Y  +MKSS+YCICARGYEV++PRV
Sbjct  385  SMHGYLRPILVQLWENKSPDMKIFGPMPRDPQGKKQYREYMKSSRYCICARGYEVHTPRV  444

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI  ECVPVII+DN+VPPFFE LNWE FAVFV EKDI NL+NIL+SIPE  Y  MQ R
Sbjct  445  VEAIINECVPVIIADNYVPPFFEVLNWEEFAVFVEEKDIQNLRNILVSIPEERYIGMQAR  504

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            VK VQ+HFLWH  P ++D+FHMILHS+W++R+ R 
Sbjct  505  VKTVQQHFLWHKKPVKFDLFHMILHSVWHSRLNRV  539



>ref|XP_010440808.1| PREDICTED: probable glycosyltransferase At3g07620 [Camelina sativa]
Length=553

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 165/214 (77%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T+  M N +R+LC S++ +G ++G D +LP TY+ S+ +P + +GG  PS+R  LAFFAG
Sbjct  336  TKKTMRNSVRALCNSNVAQGFRIGSDTALPVTYIRSAESPLEYLGGKAPSERKILAFFAG  395

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP L++ WENK+PDMKIFG M      KK Y  +MKSS+YCICARGYEV++PRV
Sbjct  396  SMHGYLRPILVKLWENKEPDMKIFGPMPRHPESKKQYREYMKSSRYCICARGYEVHTPRV  455

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI  ECVPVII+DN+VPPFFE LNWE FAVFV EKDI NL+NIL+SIPE  Y  MQ R
Sbjct  456  VEAIMNECVPVIIADNYVPPFFEVLNWEEFAVFVEEKDIPNLRNILLSIPEERYIGMQAR  515

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            VK VQ+HFLWH    + D+FHMILHSIWY+RV R
Sbjct  516  VKAVQQHFLWHKKAVKLDLFHMILHSIWYSRVHR  549



>ref|XP_004163851.1| PREDICTED: probable glycosyltransferase At3g07620-like [Cucumis 
sativus]
Length=341

 Score =   281 bits (718),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 165/218 (76%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A + T+  + NCIR+LC ++     ++GKD SLP T+V+S+ +    IGG PPS+R  LA
Sbjct  120  APKLTKRLVKNCIRALCNANGAGDFEIGKDTSLPVTFVHSTEDLITKIGGKPPSERTTLA  179

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LL +WENK+PDM I G M      K  Y+  MKSSKYCICARGY+V+
Sbjct  180  FFAGSMHGYLRPILLHYWENKEPDMMIVGPMPNSIEGKNAYMEQMKSSKYCICARGYQVH  239

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRV+EAI  EC+PVIISDN+VPP FE LNWESF+VFV E++I  L++IL+SIPE  YR 
Sbjct  240  SPRVIEAILNECIPVIISDNYVPPLFEVLNWESFSVFVKEREIPYLRDILLSIPEENYRV  299

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            M +RVK VQ+HFLWH  P +YD FHMILHSIWYTRVF+
Sbjct  300  MHSRVKMVQQHFLWHEKPAKYDAFHMILHSIWYTRVFQ  337



>ref|XP_003638181.1| hypothetical protein MTR_121s0013 [Medicago truncatula]
 gb|KEH43324.1| glycosyltransferase family protein [Medicago truncatula]
Length=550

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 165/216 (76%), Gaps = 5/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A+  TR  M NCIRSLC +++ +G Q+GKD +LP TY++S  NP + I G  PS+R  LA
Sbjct  329  ASRITRQPMKNCIRSLCNANVAKGFQIGKDTTLPATYIHSVMNPLRKIAGKHPSERTILA  388

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LL+HWENK+PDMKIFG M      K+ Y+ +M SSKYCICARGYEV 
Sbjct  389  FFAGSMHGYLRPILLKHWENKEPDMKIFGAMARDAEGKRIYMDYMNSSKYCICARGYEVY  448

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPR+VEAI  ECVPVIISDN+VPPFFE L WE+F+VFV E+D+ NL++IL+SI E  Y  
Sbjct  449  SPRIVEAIFSECVPVIISDNYVPPFFEVLKWEAFSVFVRERDVPNLRSILLSITEEKYLA  508

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +   VK+VQ+HFLWH  P +YD+FHMILHSIW  R+
Sbjct  509  LHLGVKKVQQHFLWHKVPVKYDLFHMILHSIWNNRL  544



>ref|XP_004287456.1| PREDICTED: probable glycosyltransferase At5g03795-like [Fragaria 
vesca subsp. vesca]
Length=598

 Score =   288 bits (737),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 165/214 (77%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T  +M +CIRSLC +++    ++GKD SLP TY+ S  +P  ++GG P S+R  LAFFAG
Sbjct  382  TSKYMGSCIRSLCNANVARDFKIGKDTSLPVTYIRSVEDPLANLGGKPASERSILAFFAG  441

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP LL +WENK+PDMKIFG M      K+ Y  +MKSSKYCICARGYEV++PRV
Sbjct  442  GMHGYLRPILLHYWENKEPDMKIFGPMPRDIESKRLYREYMKSSKYCICARGYEVHTPRV  501

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI YECVPVIISDN+VPPFFE  NWE+F+VF+ EKDI NL+NILMSIP+  Y  M++ 
Sbjct  502  VEAIFYECVPVIISDNYVPPFFEVFNWETFSVFIQEKDIPNLRNILMSIPDEKYLMMKSE  561

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            VK VQ+HF WH  P +YD+FHMILHS+WY R+ +
Sbjct  562  VKMVQQHFFWHKKPVKYDLFHMILHSVWYNRILQ  595



>ref|XP_010450462.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Camelina sativa]
Length=558

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 165/214 (77%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T+  M N +R+LC S++ +G ++G D +LP TY+ S+ +P + +GG  PS+R  LAFFAG
Sbjct  341  TKKTMRNSVRALCNSNVAQGFRIGSDTALPVTYIRSAESPLEYLGGKTPSERKILAFFAG  400

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP L++ WENK+PDMKIFG M      KK Y  +MKSS+YCICARGYEV++PRV
Sbjct  401  SMHGYLRPILVKLWENKEPDMKIFGPMPRDPESKKQYREYMKSSRYCICARGYEVHTPRV  460

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI  ECVPVII+DN+VPPFFE LNWE FAVFV EKDI NL+NIL+SI E  Y  MQ R
Sbjct  461  VEAIMNECVPVIIADNYVPPFFEVLNWEEFAVFVEEKDIPNLRNILLSIREERYIGMQAR  520

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            VK VQ+HFLWH  P + D+FHMILHSIWY+RV R
Sbjct  521  VKAVQQHFLWHKKPVKLDLFHMILHSIWYSRVHR  554



>ref|XP_008465462.1| PREDICTED: probable glycosyltransferase At3g07620 [Cucumis melo]
Length=625

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 166/218 (76%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A + T+  + NCIR+LC ++     ++GKD SLP T+V+S+ +    IGG PPS+R  LA
Sbjct  404  APKLTKRLVKNCIRALCNANAAGDFEIGKDTSLPVTFVHSTEDLITEIGGKPPSERTTLA  463

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+R  LL +WENK+PDM I G M      K  Y+  MKSSKYCICARGY+V+
Sbjct  464  FFAGSMHGYLRSILLHYWENKEPDMMIVGPMPNSIEGKNAYMEQMKSSKYCICARGYQVH  523

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPRV+EAI  EC+PVIISDN+VPPFFE LNW+SF+VFV E++I NL++IL+SIPE  YR 
Sbjct  524  SPRVIEAILNECIPVIISDNYVPPFFEVLNWKSFSVFVKEREIPNLRDILLSIPEENYRA  583

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            M +RVK VQ+HFLWH  P +YD FHMILHSIWYTRVF+
Sbjct  584  MHSRVKMVQQHFLWHEKPAKYDAFHMILHSIWYTRVFQ  621



>ref|XP_008362948.1| PREDICTED: probable glycosyltransferase At3g07620 [Malus domestica]
Length=662

 Score =   288 bits (737),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 167/218 (77%), Gaps = 5/218 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A + T+  M NCIRSLC + +    ++GKD SLP TY+ S  NP Q +GG P S+R  LA
Sbjct  441  APKLTKQCMKNCIRSLCNAHVDREFEIGKDTSLPVTYIRSVENPLQDLGGKPASERSILA  500

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG +HGY+RP LL +W NK+PDMKIFG M      K+ Y  +MKSSK+CICARGYEV+
Sbjct  501  FFAGGLHGYLRPILLHYWANKEPDMKIFGPMPHDIEGKRMYREYMKSSKFCICARGYEVH  560

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            +PR+VEAI YECVPVIISD+++PPFFE  NWE+FAVF+ E+DI NL+NIL+SIPE+ Y  
Sbjct  561  TPRIVEAIFYECVPVIISDSYMPPFFEVFNWEAFAVFIQERDIPNLRNILLSIPEDKYLT  620

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            M +R+K VQ+HF WH  P++YD+FHM+LHS+WY R+ +
Sbjct  621  MMSRIKMVQQHFFWHKKPKKYDLFHMVLHSVWYNRILQ  658



>ref|XP_010095378.1| putative glycosyltransferase [Morus notabilis]
 gb|EXB59797.1| putative glycosyltransferase [Morus notabilis]
Length=637

 Score =   287 bits (734),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 163/214 (76%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            TR  M NCIR+LC +++  G  +GKD SLP TYV SS +P + +GG P S+R  LAFFAG
Sbjct  421  TRTSMKNCIRALCNANVGRGFVIGKDTSLPVTYVRSSEDPLKDVGGKPASERSILAFFAG  480

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP LL +WENK+ DMKIFG M      K+ Y  +MKSSKYCICA+GYEV++PRV
Sbjct  481  GMHGYLRPILLHYWENKESDMKIFGPMPRDIEGKRTYREYMKSSKYCICAKGYEVHTPRV  540

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI YECVPVIISDN+VPP FE LNWE+F+VFV EKDI NL+NIL+SIP+  Y  +Q  
Sbjct  541  VEAIFYECVPVIISDNYVPPLFEVLNWEAFSVFVQEKDIHNLRNILLSIPKEKYEGLQLG  600

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            V+ VQ+HF WH  P +YD+FHMILHS+W  ++ +
Sbjct  601  VRMVQKHFFWHKEPVKYDLFHMILHSVWNNKLLQ  634



>ref|XP_002870514.1| hypothetical protein ARALYDRAFT_915839 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46773.1| hypothetical protein ARALYDRAFT_915839 [Arabidopsis lyrata subsp. 
lyrata]
Length=536

 Score =   284 bits (726),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 165/215 (77%), Gaps = 5/215 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T+  M N +R+LC S++ +G ++G D +LP TY+ S+ +P + +GG  PSKR  LAFFAG
Sbjct  319  TKKTMKNSVRALCNSNVAQGFRIGTDTALPVTYIRSAESPLEYLGGKTPSKRKILAFFAG  378

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP L++ WENK+PDMKI G M      K  Y  +MKSSKYCICARGYEV++PRV
Sbjct  379  SMHGYLRPILVKLWENKEPDMKIVGPMPRDPESKTQYREYMKSSKYCICARGYEVHTPRV  438

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI  ECVPVII+DN+VPPFFE LNWE FAVFV EK+I NL+NIL+SI E  Y  MQ R
Sbjct  439  VEAIINECVPVIIADNYVPPFFEILNWEEFAVFVEEKEIANLRNILLSISEERYIVMQAR  498

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            VK VQ+HFLWH  P ++D+FHMILHSIW++RV++ 
Sbjct  499  VKAVQQHFLWHKKPVKFDLFHMILHSIWHSRVYKV  533



>ref|XP_009121930.1| PREDICTED: probable glycosyltransferase At3g07620 [Brassica rapa]
 ref|XP_009121931.1| PREDICTED: probable glycosyltransferase At3g07620 [Brassica rapa]
 ref|XP_009121932.1| PREDICTED: probable glycosyltransferase At3g07620 [Brassica rapa]
Length=540

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 164/216 (76%), Gaps = 2/216 (1%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR    NCIRSLC +D+     +GKDVSLPET + +++NP  +IGG  PSKR  LA
Sbjct  324  APAETRGPYMNCIRSLCNADVGLDFVVGKDVSLPETKISTAQNPNGNIGGNRPSKRTILA  383

Query  293  FFAGQMHGYVRPTLLQHWENK-DPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRV  469
            FFAG MHGYVRP LL HW +  +PDMKIF  ++ K Y+  MK S++C+CA+GYEVNSPRV
Sbjct  384  FFAGNMHGYVRPILLNHWSSSPEPDMKIFNRINHKSYIRFMKQSRFCVCAKGYEVNSPRV  443

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE++ Y CVPVIISDNFVPPF E L+WESFAVFV EK+I NL+ IL+SIP   Y EM  R
Sbjct  444  VESVLYGCVPVIISDNFVPPFLEVLDWESFAVFVPEKEIPNLRKILISIPLRRYVEMHKR  503

Query  650  VKRVQRHFLWHPS-PQRYDIFHMILHSIWYTRVFRT  754
            V +VQ+HF+WH   P RYD+FHMILHS+WY RVF+T
Sbjct  504  VLKVQKHFMWHDGEPVRYDMFHMILHSVWYNRVFQT  539



>ref|NP_196722.1| Exostosin family protein [Arabidopsis thaliana]
 emb|CAB87721.1| putative protein [Arabidopsis thaliana]
 gb|AED91700.1| Exostosin family protein [Arabidopsis thaliana]
Length=546

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 163/216 (75%), Gaps = 2/216 (1%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR    NCIR+LC +D+     +GKDVSLPET V S +NP   IGG  PSKR  LA
Sbjct  330  APTETRGPYINCIRALCNADVGIDFVVGKDVSLPETKVSSLQNPNGKIGGSRPSKRTILA  389

Query  293  FFAGQMHGYVRPTLLQHWENK-DPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRV  469
            FFAG +HGYVRP LL  W ++ + DMKIF  +D K Y+ +MK S++C+CA+GYEVNSPRV
Sbjct  390  FFAGSLHGYVRPILLNQWSSRPEQDMKIFNRIDHKSYIRYMKRSRFCVCAKGYEVNSPRV  449

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE+I Y CVPVIISDNFVPPF E LNWESFAVFV EK+I NL+ IL+SIP   Y EMQ R
Sbjct  450  VESILYGCVPVIISDNFVPPFLEILNWESFAVFVPEKEIPNLRKILISIPVRRYVEMQKR  509

Query  650  VKRVQRHFLWHPS-PQRYDIFHMILHSIWYTRVFRT  754
            V +VQ+HF+WH   P RYDIFHMILHS+WY RVF+T
Sbjct  510  VLKVQKHFMWHDGEPVRYDIFHMILHSVWYNRVFQT  545



>dbj|BAC42362.1| unknown protein [Arabidopsis thaliana]
Length=546

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 163/216 (75%), Gaps = 2/216 (1%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR    NCIR+LC +D+     +GKDVSLPET V S +NP   IGG  PSKR  LA
Sbjct  330  APTETRGPYINCIRALCNADVGIDFVVGKDVSLPETKVSSLQNPNGKIGGSRPSKRTILA  389

Query  293  FFAGQMHGYVRPTLLQHWENK-DPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRV  469
            FFAG +HGYVRP LL  W ++ + DMKIF  +D K Y+ +MK S++C+CA+GYEVNSPRV
Sbjct  390  FFAGSLHGYVRPILLNQWSSRPEQDMKIFNRIDHKSYIRYMKRSRFCVCAKGYEVNSPRV  449

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE+I Y CVPVIISDNFVPPF E LNWESFAVFV EK+I NL+ IL+SIP   Y EMQ R
Sbjct  450  VESILYGCVPVIISDNFVPPFLEILNWESFAVFVPEKEIPNLRKILISIPVRRYVEMQKR  509

Query  650  VKRVQRHFLWHPS-PQRYDIFHMILHSIWYTRVFRT  754
            V +VQ+HF+WH   P RYDIFHMILHS+WY RVF+T
Sbjct  510  VLKVQKHFMWHDGEPVRYDIFHMILHSVWYNRVFQT  545



>ref|XP_010519887.1| PREDICTED: probable glycosyltransferase At5g03795 [Tarenaya hassleriana]
Length=572

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 161/216 (75%), Gaps = 2/216 (1%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR  + +CIR+LC +D+     +GKDVSLPET V S  NP   +GG  PSKRP LA
Sbjct  356  APAETRGPLLSCIRALCNADVGSDFVIGKDVSLPETKVSSPENPNDGVGGNRPSKRPILA  415

Query  293  FFAGQMHGYVRPTLLQHWENK-DPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRV  469
            FFAG +HGYVR  LL +W +K DPDMKI   +D K Y+  MK S+YC+CA+GYEVNSPRV
Sbjct  416  FFAGSLHGYVRQILLDYWTSKPDPDMKILNRVDHKSYVRFMKRSRYCVCAKGYEVNSPRV  475

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE++ Y CVPVIISDNFVPPF E L+WESFAVFV EK+I NLK IL  IP+  Y EMQ R
Sbjct  476  VESVLYGCVPVIISDNFVPPFLEVLDWESFAVFVPEKEIPNLKKILSKIPKRKYVEMQRR  535

Query  650  VKRVQRHFLWHP-SPQRYDIFHMILHSIWYTRVFRT  754
            V  VQ+HF+WH   P RYD+FHMILHS+WY RVF+T
Sbjct  536  VLMVQKHFMWHDHEPVRYDLFHMILHSVWYNRVFQT  571



>gb|EYU30729.1| hypothetical protein MIMGU_mgv1a006113mg [Erythranthe guttata]
Length=456

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 162/220 (74%), Gaps = 5/220 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A   TR    NC R+LC S++  G ++GKDVSLP TY+ SS NP + I   P   +  LA
Sbjct  237  APRSTRKIFENCTRALCNSNIAGGFKIGKDVSLPVTYIRSSENPLKDIEKNPSPNKTILA  296

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGYVRP LL +W+NK PDMKI G M      K  Y   MK+SKYCICA+GYEV+
Sbjct  297  FFAGGMHGYVRPILLHYWQNKQPDMKIVGPMPRDIEGKAKYREFMKASKYCICAKGYEVH  356

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            +PRVVE+I YECVPVIISDN+VPP FE  +WESFA+FVLEKDI NL+ IL+S+ E+ Y  
Sbjct  357  TPRVVESIYYECVPVIISDNYVPPLFEVFDWESFALFVLEKDIPNLREILLSVSEDRYAM  416

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRTV  757
            M+ R+K VQR+F WH  P++YD+FHMILHS+WY+RVFR +
Sbjct  417  MKRRLKMVQRYFFWHKIPEKYDLFHMILHSVWYSRVFRVL  456



>emb|CDX97126.1| BnaC09g44990D [Brassica napus]
Length=534

 Score =   282 bits (721),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 164/216 (76%), Gaps = 2/216 (1%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR    NCIRSLC +D+     +GKDVSLPET + +++NP  ++GG  PSKR  LA
Sbjct  318  APAETRGPYMNCIRSLCNADVGIDFVVGKDVSLPETKISAAQNPNGNVGGNRPSKRTILA  377

Query  293  FFAGQMHGYVRPTLLQHWENK-DPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRV  469
            FFAG MHGYVRP LL HW +  +PDMKIF  ++ K Y+  MK S++C+CA+GYEVNSPRV
Sbjct  378  FFAGNMHGYVRPILLNHWSSSPEPDMKIFNRINHKSYIRFMKQSRFCVCAKGYEVNSPRV  437

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE++ Y CVPVI+SDNFVPPF E L+WESFAVFV EK+I NL+ IL+SIP   Y EM  R
Sbjct  438  VESVLYGCVPVIVSDNFVPPFLEVLDWESFAVFVSEKEIPNLRKILISIPLRRYVEMHKR  497

Query  650  VKRVQRHFLWHPS-PQRYDIFHMILHSIWYTRVFRT  754
            V +VQ+HF+WH   P RYD+FHMILHS+WY RVF+T
Sbjct  498  VLKVQKHFMWHDGEPVRYDMFHMILHSVWYNRVFQT  533



>ref|XP_006399668.1| hypothetical protein EUTSA_v10013187mg [Eutrema salsugineum]
 gb|ESQ41121.1| hypothetical protein EUTSA_v10013187mg [Eutrema salsugineum]
Length=543

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 163/216 (75%), Gaps = 2/216 (1%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ETR    NCIRSLC +D+     +GKDVSLPET V SS+ P  +IGG  PSKR  LA
Sbjct  327  APAETRGPYMNCIRSLCNADVGVDFIVGKDVSLPETKVSSSQTPNGNIGGNRPSKRTILA  386

Query  293  FFAGQMHGYVRPTLLQHWENK-DPDMKIFGTMDKKDYLVHMKSSKYCICARGYEVNSPRV  469
            FFAG +HGYVRP LL  W ++ +PDMKIF  +D K Y+  MK S++C+CA+GYEVNSPRV
Sbjct  387  FFAGNLHGYVRPILLNQWSSRPEPDMKIFNRIDHKSYIRFMKRSRFCVCAKGYEVNSPRV  446

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE++ Y CVPVIISDNFVPPF E L+WESFAVFV E +I NL+ IL+SIP   Y EMQ R
Sbjct  447  VESVLYGCVPVIISDNFVPPFLEVLDWESFAVFVPENEIPNLRKILISIPVRRYVEMQRR  506

Query  650  VKRVQRHFLWHPS-PQRYDIFHMILHSIWYTRVFRT  754
            V +VQ+HF+WH   P RYD+FHMILHS+WY RVF+T
Sbjct  507  VLKVQKHFMWHDGEPVRYDLFHMILHSVWYNRVFQT  542



>ref|XP_004498470.1| PREDICTED: probable glycosyltransferase At5g03795-like isoform 
X3 [Cicer arietinum]
Length=553

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 155/219 (71%), Gaps = 34/219 (16%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+ H+ANCIRSLC +D++EG   GKD SLPETYV +++NP + +GG   SKR  LA
Sbjct  364  APSETKLHLANCIRSLCNADVKEGFVFGKDASLPETYVRNAQNPTRDLGGNSGSKRTTLA  423

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTMDK----KDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGY+RP LLQHWENKDPDMKIFG + K     +Y+ +MKSSKYCICA+GYEVNS
Sbjct  424  FFAGSMHGYLRPILLQHWENKDPDMKIFGKLPKSKGNSNYIQYMKSSKYCICAKGYEVNS  483

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE L+WESFAVF                        
Sbjct  484  PRVVEAIFYECVPVIISDNFVPPFFEVLDWESFAVF------------------------  519

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRTV  757
                  VQ+HFLWH +P +YDIFHMILHSIWY RVF   
Sbjct  520  ------VQQHFLWHKNPVKYDIFHMILHSIWYNRVFSAT  552



>dbj|BAB08970.1| unnamed protein product [Arabidopsis thaliana]
Length=559

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 164/219 (75%), Gaps = 10/219 (5%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T   M N +RSLC S++ +G ++G D +LP TY+ SS  P + +GG   S+R  LAFFAG
Sbjct  337  TTKTMKNSVRSLCNSNVAQGFRIGTDTALPVTYIRSSEAPLEYLGGKTSSERKILAFFAG  396

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSS-----KYCICARGYEV  454
             MHGY+RP L++ WENK+PDMKIFG M      KK Y  +MKSS     +YCICARGYEV
Sbjct  397  SMHGYLRPILVKLWENKEPDMKIFGPMPRDPKSKKQYREYMKSSSSHFNRYCICARGYEV  456

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            ++PRVVEAI  ECVPVII+DN+VPPFFE LNWE FAVFV EKDI NL+NIL+SIPE+ Y 
Sbjct  457  HTPRVVEAIINECVPVIIADNYVPPFFEVLNWEEFAVFVEEKDIPNLRNILLSIPEDRYI  516

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
             MQ RVK VQ+HFLWH  P ++D FHMILHSIWY+RV R
Sbjct  517  GMQARVKAVQQHFLWHKKPVKFDQFHMILHSIWYSRVHR  555



>ref|XP_011078274.1| PREDICTED: probable glycosyltransferase At3g07620 [Sesamum indicum]
Length=642

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 165/214 (77%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            TR    + IR LC S++  G ++GKDVSLP TYV S+ NP + IGG  PS +P LAFFAG
Sbjct  426  TRNIFGSSIRVLCNSNIARGFRIGKDVSLPVTYVRSAENPLKDIGGNLPSNKPILAFFAG  485

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             +HGYVRP LL+HW NK+PDMKI G M      K  Y   MKSSKYCICA+GYEV++PRV
Sbjct  486  GLHGYVRPLLLRHWHNKEPDMKIIGPMPRDIEGKARYREFMKSSKYCICAKGYEVHTPRV  545

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE+I Y CVPV+ISDN+VPP FE  NWESFA+F++E DI NL+NIL+S+P++ Y  MQ+R
Sbjct  546  VESIYYGCVPVVISDNYVPPLFEVFNWESFALFIVEDDIPNLRNILLSVPQDRYMMMQSR  605

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +K V+++FLWH  P++YD+FHMILHS+WY RVF+
Sbjct  606  LKIVRQYFLWHKIPEKYDLFHMILHSVWYNRVFQ  639



>ref|XP_010047718.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Eucalyptus grandis]
 gb|KCW79662.1| hypothetical protein EUGRSUZ_C01013 [Eucalyptus grandis]
Length=615

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 161/210 (77%), Gaps = 5/210 (2%)
 Frame = +2

Query  137  MANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHG  316
            M NCIR+LC +++  G ++GKD +LP TYV S  +P + IGG PP +R  LAFFAG MHG
Sbjct  402  MGNCIRALCNANVARGFKIGKDTTLPVTYVRSVEDPVRDIGGKPPLERSILAFFAGGMHG  461

Query  317  YVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRVVEAI  481
            Y+RP L  +WENK+ DMKI G M      K+ Y  +MKSSKYCICARGYEV++PR+VEAI
Sbjct  462  YLRPILRHYWENKEADMKILGPMPRDIDGKRAYREYMKSSKYCICARGYEVHTPRIVEAI  521

Query  482  SYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRV  661
             YECVPVIISDN+VPPFFE LNWE+F++FV E D+  L++IL+SIPE  Y  MQ  V+ V
Sbjct  522  FYECVPVIISDNYVPPFFEVLNWEAFSLFVKESDLPKLRDILLSIPEEEYLRMQMGVRMV  581

Query  662  QRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q+HF+WH  P +YD+FHM+LHS+W+ R+F+
Sbjct  582  QKHFIWHKKPTKYDLFHMVLHSVWHNRIFQ  611



>ref|XP_010047716.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Eucalyptus grandis]
 ref|XP_010047717.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Eucalyptus grandis]
Length=642

 Score =   282 bits (721),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 161/210 (77%), Gaps = 5/210 (2%)
 Frame = +2

Query  137  MANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHG  316
            M NCIR+LC +++  G ++GKD +LP TYV S  +P + IGG PP +R  LAFFAG MHG
Sbjct  429  MGNCIRALCNANVARGFKIGKDTTLPVTYVRSVEDPVRDIGGKPPLERSILAFFAGGMHG  488

Query  317  YVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRVVEAI  481
            Y+RP L  +WENK+ DMKI G M      K+ Y  +MKSSKYCICARGYEV++PR+VEAI
Sbjct  489  YLRPILRHYWENKEADMKILGPMPRDIDGKRAYREYMKSSKYCICARGYEVHTPRIVEAI  548

Query  482  SYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRV  661
             YECVPVIISDN+VPPFFE LNWE+F++FV E D+  L++IL+SIPE  Y  MQ  V+ V
Sbjct  549  FYECVPVIISDNYVPPFFEVLNWEAFSLFVKESDLPKLRDILLSIPEEEYLRMQMGVRMV  608

Query  662  QRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            Q+HF+WH  P +YD+FHM+LHS+W+ R+F+
Sbjct  609  QKHFIWHKKPTKYDLFHMVLHSVWHNRIFQ  638



>ref|XP_006573464.1| PREDICTED: probable glycosyltransferase At3g07620-like isoform 
X1 [Glycine max]
 ref|XP_006573465.1| PREDICTED: probable glycosyltransferase At3g07620-like isoform 
X2 [Glycine max]
 gb|KHN41717.1| Putative glycosyltransferase [Glycine soja]
Length=596

 Score =   278 bits (711),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 163/216 (75%), Gaps = 5/216 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A+  TR  M  CIRSLC S++ +G Q+GKD +LP TY++S  +P +   G PPS+R  LA
Sbjct  375  ASRITRQPMKGCIRSLCNSNVAKGFQIGKDTTLPVTYIHSVMDPLKECAGKPPSERSALA  434

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LL+HW NK+PDMKIFG M      KK Y+ +M SSKYCICARGYEV+
Sbjct  435  FFAGSMHGYLRPILLKHWANKEPDMKIFGPMPRDLEGKKMYMEYMNSSKYCICARGYEVH  494

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            +PR++EAI   CVPVIISDN+VPP FE L WE+F++FV E+D+ +L++IL+SIPE  Y  
Sbjct  495  TPRIIEAIFSGCVPVIISDNYVPPLFEVLKWEAFSLFVRERDVPSLRDILLSIPEEKYLA  554

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +   VK+VQ+HFLWH  P +YD+FHMILH+IW  R+
Sbjct  555  LHLGVKKVQQHFLWHKVPVKYDLFHMILHAIWKNRL  590



>ref|XP_007152901.1| hypothetical protein PHAVU_004G169700g [Phaseolus vulgaris]
 gb|ESW24895.1| hypothetical protein PHAVU_004G169700g [Phaseolus vulgaris]
Length=616

 Score =   278 bits (711),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 167/219 (76%), Gaps = 5/219 (2%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A++ TR  M  CIR LC S++ +G Q+GKD +LP TY++S  +P +   G PPS+R  LA
Sbjct  395  ASQITRQPMKGCIRCLCNSNVAKGFQIGKDTTLPVTYIHSVMDPLRGFVGKPPSERSILA  454

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAG MHGY+RP LL+HWENK+P+MKI G M      KK Y+ +M SSKYCICARGYEV+
Sbjct  455  FFAGSMHGYLRPILLEHWENKEPNMKILGPMPRDLEGKKLYMGYMNSSKYCICARGYEVH  514

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            +PR++EAI   CVPVIISD++VPPFFE LNWE+F++FV E+DI +L++IL+SIPE  Y  
Sbjct  515  TPRIIEAIFSGCVPVIISDDYVPPFFEVLNWEAFSLFVRERDIPSLRDILLSIPEEKYLA  574

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFRT  754
            +   VK+VQ+HFLWH  P +YD+FHMILH+IW  R+ +T
Sbjct  575  LHLGVKKVQQHFLWHKVPVKYDLFHMILHAIWNNRLSQT  613



>ref|XP_010688285.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=609

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 168/214 (79%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            TR HM++CI +LC +++  G  + KDVSLP T++++  +P    GG PPS+R  LAFFAG
Sbjct  392  TRKHMSSCIGALCNANVARGFTISKDVSLPVTFIHNEDDPSIEFGGKPPSEREILAFFAG  451

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
            +MHGY+RP LL++WEN+  DMKI G M      +  Y  +MKSSKYCICARGY+V+SPRV
Sbjct  452  KMHGYLRPLLLKYWENEASDMKISGPMPSNIEGEATYNEYMKSSKYCICARGYQVHSPRV  511

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE+I YECVPVII+DN+VPPFFE L+WE+FAVFV EKDI NL+NIL++I E+ Y +M  R
Sbjct  512  VESILYECVPVIIADNYVPPFFEVLDWEAFAVFVQEKDIPNLRNILLAISEDRYLDMHYR  571

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +K V+RHF+W+ +P++YD+FHMILHS+W +RV R
Sbjct  572  LKLVKRHFIWNKTPKKYDLFHMILHSLWSSRVSR  605



>ref|XP_010688284.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=649

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 168/214 (79%), Gaps = 5/214 (2%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            TR HM++CI +LC +++  G  + KDVSLP T++++  +P    GG PPS+R  LAFFAG
Sbjct  432  TRKHMSSCIGALCNANVARGFTISKDVSLPVTFIHNEDDPSIEFGGKPPSEREILAFFAG  491

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
            +MHGY+RP LL++WEN+  DMKI G M      +  Y  +MKSSKYCICARGY+V+SPRV
Sbjct  492  KMHGYLRPLLLKYWENEASDMKISGPMPSNIEGEATYNEYMKSSKYCICARGYQVHSPRV  551

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VE+I YECVPVII+DN+VPPFFE L+WE+FAVFV EKDI NL+NIL++I E+ Y +M  R
Sbjct  552  VESILYECVPVIIADNYVPPFFEVLDWEAFAVFVQEKDIPNLRNILLAISEDRYLDMHYR  611

Query  650  VKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVFR  751
            +K V+RHF+W+ +P++YD+FHMILHS+W +RV R
Sbjct  612  LKLVKRHFIWNKTPKKYDLFHMILHSLWSSRVSR  645



>ref|XP_004967954.1| PREDICTED: probable glycosyltransferase At5g03795-like [Setaria 
italica]
Length=565

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 164/207 (79%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EGV + GKDVSLPET++ + R P + IGG P ++R  LAFFAGQMHG 
Sbjct  353  NTIKALCNADLSEGVFVRGKDVSLPETFLRAPRRPLRDIGGRPVAQRTILAFFAGQMHGR  412

Query  320  VRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LL++W +KDPDM+I+  +      +++Y+ HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  413  VRPVLLKYWGDKDPDMRIYSKLPHRITRRRNYVQHMKSSKYCICPMGYEVNSPRIVEAIY  472

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+DNFV PF + LNW SF+V V E+D+  LK+IL+ IPE+ Y  +Q+ VKRVQ
Sbjct  473  YECVPVIIADNFVLPFDDALNWSSFSVVVAERDVPKLKDILLGIPESRYITLQSNVKRVQ  532

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HFLWHP+P +YDIFHMILHS+W++RV
Sbjct  533  KHFLWHPNPVKYDIFHMILHSVWFSRV  559



>ref|XP_006837291.1| hypothetical protein AMTR_s00111p00027680 [Amborella trichopoda]
 gb|ERN00145.1| hypothetical protein AMTR_s00111p00027680 [Amborella trichopoda]
Length=651

 Score =   273 bits (699),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 159/207 (77%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EG  + GKDVSLPET + + + P + IGG P S+RP LAFFAG MHG 
Sbjct  439  NTIKALCNADLSEGFFVPGKDVSLPETTIRTPKRPLRQIGGRPISQRPILAFFAGYMHGR  498

Query  320  VRPTLLQHWENKDPDMKIFGTMDKK-----DYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LL++W +KD DMKI+G +  K      Y+ HMKSSKYCIC  G+EVNSPR+VE+I 
Sbjct  499  VRPILLKYWGDKDDDMKIYGPLPNKISTKMTYVQHMKSSKYCICPMGFEVNSPRIVESIY  558

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVP+II+DNFVPPF + LNW++FAVFV EKDI NLKNIL++IP   Y  MQ  VKRVQ
Sbjct  559  YECVPIIIADNFVPPFDDVLNWKAFAVFVAEKDIPNLKNILLAIPLRQYISMQNNVKRVQ  618

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            RHFLWH  P R+D+FHMILHSIWY R+
Sbjct  619  RHFLWHSKPIRFDLFHMILHSIWYNRL  645



>gb|EEC69788.1| hypothetical protein OsI_00072 [Oryza sativa Indica Group]
Length=536

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 160/207 (77%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EGV + G+DVSLPET++ S R P + IGG P ++R  LAFFAGQMHG 
Sbjct  324  NTIKALCNADLSEGVFIHGRDVSLPETFLRSPRRPLRGIGGKPAAERSILAFFAGQMHGR  383

Query  320  VRPTLLQHWENKDPDMKIFGTMDKK-----DYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LLQ+W  KD DM+I+  +  +     +Y+ HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  384  VRPVLLQYWGGKDADMRIYDRLPHRITRRMNYIQHMKSSKYCICPMGYEVNSPRIVEAIY  443

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+DNFV PF +  NW +F+V +LEKD+  LK IL+ IP++ Y  MQ+ V+RVQ
Sbjct  444  YECVPVIIADNFVLPFDDAFNWSAFSVVILEKDVPKLKQILLEIPDDQYMAMQSNVQRVQ  503

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HF+WHP+P +YDIFHMILHSIWY+RV
Sbjct  504  KHFIWHPNPIKYDIFHMILHSIWYSRV  530



>ref|XP_002457517.1| hypothetical protein SORBIDRAFT_03g008610 [Sorghum bicolor]
 gb|EES02637.1| hypothetical protein SORBIDRAFT_03g008610 [Sorghum bicolor]
Length=521

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 161/207 (78%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EG+ + GKDVSLPET++ S R P + IGG P ++R  LAFFAGQMHG 
Sbjct  311  NTIKALCNADLSEGIFIRGKDVSLPETFLRSPRRPLRDIGGRPAAQRTILAFFAGQMHGR  370

Query  320  VRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LL++W +KD DM+I+  +      K++Y+ HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  371  VRPVLLKYWGDKDADMRIYSRLPHRITRKRNYVQHMKSSKYCICPMGYEVNSPRIVEAIY  430

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+DNFV PF   LNW +F+V V E D+  LK IL++IPE+ Y  +Q+ VKRVQ
Sbjct  431  YECVPVIIADNFVLPFDAALNWSAFSVVVPESDVPKLKEILLAIPESRYITLQSNVKRVQ  490

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HFLWHP+P +YDIFHMILHS+W++RV
Sbjct  491  KHFLWHPNPVKYDIFHMILHSVWFSRV  517



>ref|XP_008655546.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X7 
[Zea mays]
Length=406

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 159/207 (77%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EG  + GKDVSLPET++ S R P + IGG P ++R  LAFFAGQMHG 
Sbjct  196  NTIKALCNADLSEGFFIRGKDVSLPETFLRSPRRPLRDIGGRPAAQRTILAFFAGQMHGR  255

Query  320  VRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LL++W NKD DM+I+  +      K++Y+ HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  256  VRPVLLKYWGNKDDDMRIYSRLPHRITRKRNYVQHMKSSKYCICPMGYEVNSPRIVEAIY  315

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+D+FV PF   LNW +F+V V E D+  LK IL++IPE+ Y  +Q  VKRVQ
Sbjct  316  YECVPVIIADHFVLPFDAALNWSTFSVVVPESDVPKLKQILLAIPESRYITLQANVKRVQ  375

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HF+WHP+P +YDIFHMILHS+W++RV
Sbjct  376  KHFMWHPNPVKYDIFHMILHSVWFSRV  402



>ref|NP_001041784.1| Os01g0107700 [Oryza sativa Japonica Group]
 dbj|BAD44851.1| pectin-glucuronyltransferase -like [Oryza sativa Japonica Group]
 dbj|BAD44890.1| pectin-glucuronyltransferase -like [Oryza sativa Japonica Group]
 dbj|BAF03698.1| Os01g0107700 [Oryza sativa Japonica Group]
 dbj|BAG91731.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53723.1| hypothetical protein OsJ_00064 [Oryza sativa Japonica Group]
Length=550

 Score =   269 bits (688),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 161/207 (78%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EGV + G+DVSLPET++ S R P + IGG P ++R  LAFFAGQMHG 
Sbjct  338  NTIKALCNADLSEGVFIHGRDVSLPETFLRSPRRPLRGIGGKPAAERSILAFFAGQMHGR  397

Query  320  VRPTLLQHWENKDPDMKIFGTMDKK-----DYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LLQ+W  KD DM+I+  +  +     +Y+ HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  398  VRPVLLQYWGGKDADMRIYDRLPHRITRRMNYIQHMKSSKYCICPMGYEVNSPRIVEAIY  457

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+DNFV PF + LNW +F+V + EKD+  LK IL++IP++ Y  MQ+ V+RVQ
Sbjct  458  YECVPVIIADNFVLPFDDALNWSAFSVVIPEKDVPKLKQILLAIPDDQYMAMQSNVQRVQ  517

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HF+WHP+P +YDIFHMILHSIWY+RV
Sbjct  518  KHFIWHPNPIKYDIFHMILHSIWYSRV  544



>ref|XP_008655545.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X6 
[Zea mays]
Length=407

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 159/207 (77%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EG  + GKDVSLPET++ S R P + IGG P ++R  LAFFAGQMHG 
Sbjct  197  NTIKALCNADLSEGFFIRGKDVSLPETFLRSPRRPLRDIGGRPAAQRTILAFFAGQMHGR  256

Query  320  VRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LL++W NKD DM+I+  +      K++Y+ HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  257  VRPVLLKYWGNKDDDMRIYSRLPHRITRKRNYVQHMKSSKYCICPMGYEVNSPRIVEAIY  316

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+D+FV PF   LNW +F+V V E D+  LK IL++IPE+ Y  +Q  VKRVQ
Sbjct  317  YECVPVIIADHFVLPFDAALNWSTFSVVVPESDVPKLKQILLAIPESRYITLQANVKRVQ  376

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HF+WHP+P +YDIFHMILHS+W++RV
Sbjct  377  KHFMWHPNPVKYDIFHMILHSVWFSRV  403



>ref|XP_010230336.1| PREDICTED: probable glycosyltransferase At5g03795 [Brachypodium 
distachyon]
Length=540

 Score =   268 bits (686),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 160/207 (77%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EGV + G+DVSLPET+V S R P + IGG P ++R  LAFFAGQMHG 
Sbjct  328  NTIKALCNADLSEGVFIRGRDVSLPETFVRSPRRPLRDIGGKPATERSILAFFAGQMHGR  387

Query  320  VRPTLLQHWENKDPDMKIFGTMDKK-----DYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LLQ+W  KD DM+I+G + ++     +Y+ HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  388  VRPILLQYWGGKDTDMRIYGRLPRRITRRMNYVQHMKSSKYCICPMGYEVNSPRIVEAIY  447

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YEC+PVII+DNFV PF + L+W +F+V V EKD+  LK IL+ IPE+ Y  MQ+ VK+VQ
Sbjct  448  YECIPVIIADNFVLPFDDALDWSTFSVVVPEKDVPRLKEILLRIPESRYITMQSNVKKVQ  507

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HFLWH  P +YDIFHMILHS+W++RV
Sbjct  508  KHFLWHAKPVKYDIFHMILHSVWFSRV  534



>ref|XP_008655544.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X5 
[Zea mays]
Length=433

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 159/207 (77%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EG  + GKDVSLPET++ S R P + IGG P ++R  LAFFAGQMHG 
Sbjct  223  NTIKALCNADLSEGFFIRGKDVSLPETFLRSPRRPLRDIGGRPAAQRTILAFFAGQMHGR  282

Query  320  VRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LL++W NKD DM+I+  +      K++Y+ HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  283  VRPVLLKYWGNKDDDMRIYSRLPHRITRKRNYVQHMKSSKYCICPMGYEVNSPRIVEAIY  342

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+D+FV PF   LNW +F+V V E D+  LK IL++IPE+ Y  +Q  VKRVQ
Sbjct  343  YECVPVIIADHFVLPFDAALNWSTFSVVVPESDVPKLKQILLAIPESRYITLQANVKRVQ  402

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HF+WHP+P +YDIFHMILHS+W++RV
Sbjct  403  KHFMWHPNPVKYDIFHMILHSVWFSRV  429



>ref|XP_006853629.1| hypothetical protein AMTR_s00056p00069610 [Amborella trichopoda]
 gb|ERN15096.1| hypothetical protein AMTR_s00056p00069610 [Amborella trichopoda]
Length=205

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 150/196 (77%), Gaps = 6/196 (3%)
 Frame = +2

Query  173  LREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGYVRPTLLQHWEN  352
            LRE  ++GKD++LPE YV   +NP   +GG P S+RP LAFFAGQMHG VRP LL++WEN
Sbjct  6    LREIFKVGKDITLPEVYV-RVKNPVAYVGGKPVSQRPILAFFAGQMHGKVRPILLKYWEN  64

Query  353  KDPDMKI-----FGTMDKKDYLVHMKSSKYCICARGYEVNSPRVVEAISYECVPVIISDN  517
            KDPDMKI     +G   K  Y+ +MK SKYCIC +GYEVNSPRV+EAI +ECVPVIISDN
Sbjct  65   KDPDMKILGPKFYGIGKKGPYIEYMKLSKYCICPKGYEVNSPRVMEAIYFECVPVIISDN  124

Query  518  FVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQRHFLWHPSPQR  697
            FV PF   LNW++F+V +LE+DI  LK IL+SI E  Y  MQ RVKRVQ+HFLWH  P +
Sbjct  125  FVLPFDNILNWKAFSVVILERDIPRLKEILLSISEKRYLTMQARVKRVQKHFLWHNKPVK  184

Query  698  YDIFHMILHSIWYTRV  745
            YD+FHMILHSIW+ R+
Sbjct  185  YDLFHMILHSIWHNRI  200



>gb|AFW79782.1| putative homeodomain-like transcription factor superfamily protein 
[Zea mays]
Length=544

 Score =   265 bits (678),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 159/207 (77%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EG  + GKDVSLPET++ S R P + IGG P ++R  LAFFAGQMHG 
Sbjct  334  NTIKALCNADLSEGFFIRGKDVSLPETFLRSPRRPLRDIGGRPAAQRTILAFFAGQMHGR  393

Query  320  VRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LL++W NKD DM+I+  +      K++Y+ HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  394  VRPVLLKYWGNKDDDMRIYSRLPHRITRKRNYVQHMKSSKYCICPMGYEVNSPRIVEAIY  453

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+D+FV PF   LNW +F+V V E D+  LK IL++IPE+ Y  +Q  VKRVQ
Sbjct  454  YECVPVIIADHFVLPFDAALNWSTFSVVVPESDVPKLKQILLAIPESRYITLQANVKRVQ  513

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HF+WHP+P +YDIFHMILHS+W++RV
Sbjct  514  KHFMWHPNPVKYDIFHMILHSVWFSRV  540



>ref|XP_003588379.1| Exostosin-2 [Medicago truncatula]
Length=551

 Score =   265 bits (678),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 151/216 (70%), Gaps = 34/216 (16%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            A  ET+  +ANCIRSLC +D++EG   GKD SLPETYV +++ P + +GG   SK+  LA
Sbjct  362  APSETKLRLANCIRSLCNADVKEGFVFGKDASLPETYVRNAQIPTRDLGGNSFSKKTTLA  421

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM----DKKDYLVHMKSSKYCICARGYEVNS  460
            FFAG MHGYVRP LL+HWENKDPDMKIFG +       +Y+ +MKSSKYCICA+GYEVNS
Sbjct  422  FFAGSMHGYVRPILLKHWENKDPDMKIFGKLPNSKGNSNYIHYMKSSKYCICAKGYEVNS  481

Query  461  PRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREM  640
            PRVVEAI YECVPVIISDNFVPPFFE L+WESF+V                         
Sbjct  482  PRVVEAIFYECVPVIISDNFVPPFFEVLDWESFSVI------------------------  517

Query  641  QTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRVF  748
                  VQ+HFLW+ +P +YDIFHMILHSIWY RVF
Sbjct  518  ------VQKHFLWNKNPVKYDIFHMILHSIWYNRVF  547



>ref|XP_008655541.1| PREDICTED: probable glycosyltransferase At5g25310 isoform X3 
[Zea mays]
Length=566

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 159/207 (77%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EG  + GKDVSLPET++ S R P + IGG P ++R  LAFFAGQMHG 
Sbjct  356  NTIKALCNADLSEGFFIRGKDVSLPETFLRSPRRPLRDIGGRPAAQRTILAFFAGQMHGR  415

Query  320  VRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LL++W NKD DM+I+  +      K++Y+ HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  416  VRPVLLKYWGNKDDDMRIYSRLPHRITRKRNYVQHMKSSKYCICPMGYEVNSPRIVEAIY  475

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+D+FV PF   LNW +F+V V E D+  LK IL++IPE+ Y  +Q  VKRVQ
Sbjct  476  YECVPVIIADHFVLPFDAALNWSTFSVVVPESDVPKLKQILLAIPESRYITLQANVKRVQ  535

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HF+WHP+P +YDIFHMILHS+W++RV
Sbjct  536  KHFMWHPNPVKYDIFHMILHSVWFSRV  562



>ref|XP_008655540.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X2 
[Zea mays]
Length=571

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 159/207 (77%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EG  + GKDVSLPET++ S R P + IGG P ++R  LAFFAGQMHG 
Sbjct  361  NTIKALCNADLSEGFFIRGKDVSLPETFLRSPRRPLRDIGGRPAAQRTILAFFAGQMHGR  420

Query  320  VRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LL++W NKD DM+I+  +      K++Y+ HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  421  VRPVLLKYWGNKDDDMRIYSRLPHRITRKRNYVQHMKSSKYCICPMGYEVNSPRIVEAIY  480

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+D+FV PF   LNW +F+V V E D+  LK IL++IPE+ Y  +Q  VKRVQ
Sbjct  481  YECVPVIIADHFVLPFDAALNWSTFSVVVPESDVPKLKQILLAIPESRYITLQANVKRVQ  540

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HF+WHP+P +YDIFHMILHS+W++RV
Sbjct  541  KHFMWHPNPVKYDIFHMILHSVWFSRV  567



>emb|CDM80206.1| unnamed protein product [Triticum aestivum]
Length=559

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 160/207 (77%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +D+ EGV + G+DVSLPETY+ S+R P + IGG P ++R  LAFFAGQMHG 
Sbjct  346  NTIKALCNADVSEGVFIRGRDVSLPETYIKSARRPVRDIGGKPAAERSILAFFAGQMHGR  405

Query  320  VRPTLLQHWENKDPDMKIFGTMDKK-----DYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP L+++W  KD DM+I+  + ++     +Y  HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  406  VRPVLVKYWGGKDADMRIYTRIPRQITRRMNYAKHMKSSKYCICPMGYEVNSPRIVEAIY  465

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+DNFV PF + L+W +F+V V EKD+  LK IL+SIPEN Y  M++ VK+VQ
Sbjct  466  YECVPVIIADNFVLPFDDVLDWTAFSVVVAEKDVPRLKEILLSIPENRYITMRSNVKKVQ  525

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            RHFLWH  P +YDIFHMILHS+W++RV
Sbjct  526  RHFLWHTKPVKYDIFHMILHSVWFSRV  552



>ref|XP_008655539.1| PREDICTED: probable glycosyltransferase At3g07620 isoform X1 
[Zea mays]
Length=572

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 159/207 (77%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EG  + GKDVSLPET++ S R P + IGG P ++R  LAFFAGQMHG 
Sbjct  362  NTIKALCNADLSEGFFIRGKDVSLPETFLRSPRRPLRDIGGRPAAQRTILAFFAGQMHGR  421

Query  320  VRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LL++W NKD DM+I+  +      K++Y+ HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  422  VRPVLLKYWGNKDDDMRIYSRLPHRITRKRNYVQHMKSSKYCICPMGYEVNSPRIVEAIY  481

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+D+FV PF   LNW +F+V V E D+  LK IL++IPE+ Y  +Q  VKRVQ
Sbjct  482  YECVPVIIADHFVLPFDAALNWSTFSVVVPESDVPKLKQILLAIPESRYITLQANVKRVQ  541

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HF+WHP+P +YDIFHMILHS+W++RV
Sbjct  542  KHFMWHPNPVKYDIFHMILHSVWFSRV  568



>ref|XP_006645431.1| PREDICTED: probable glycosyltransferase At3g07620-like [Oryza 
brachyantha]
Length=700

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 158/207 (76%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EGV + G+DVSLPET++ S R P + IGG P + R  LAFFAGQMHG 
Sbjct  488  NTIKALCNADLSEGVFIHGRDVSLPETFLRSPRRPLRGIGGKPAADRSILAFFAGQMHGR  547

Query  320  VRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LLQ+W  KD DMKI+  +      K +Y+ HMKSSKYC+C  GYEVNSPR+VEAI 
Sbjct  548  VRPVLLQYWGGKDADMKIYDRLPHRITRKMNYVQHMKSSKYCVCPMGYEVNSPRIVEAIY  607

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+DNFV PF + LNW +F+V V EKD+  LK IL+ IPE+ Y +MQ  VK+VQ
Sbjct  608  YECVPVIIADNFVLPFDDALNWSAFSVVVPEKDVPKLKQILLEIPEDRYMDMQLNVKQVQ  667

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HFLWHP+P +YDIFHMILHS+W +RV
Sbjct  668  KHFLWHPNPIKYDIFHMILHSVWSSRV  694



>ref|XP_010646853.1| PREDICTED: probable glycosyltransferase At5g03795 [Vitis vinifera]
Length=549

 Score =   263 bits (673),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 158/207 (76%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EG+ + GKDVSLPET + + R P +++GG   S+RP LAFFAG MHG 
Sbjct  335  NTIKALCNADLSEGIFVAGKDVSLPETTIRNPRRPLRNVGGRRVSQRPILAFFAGNMHGR  394

Query  320  VRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRPTLL++W +KD DM+I+G +      K  Y+ HMKSS++CIC  GYEVNSPR+VEAI 
Sbjct  395  VRPTLLKYWSDKDEDMRIYGPLPNRISRKMSYIQHMKSSRFCICPMGYEVNSPRIVEAIY  454

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+DNFVPP  + L+W +F+V V EKDI  LK IL++IP   Y  MQT VK VQ
Sbjct  455  YECVPVIIADNFVPPLNDVLDWTAFSVIVAEKDIPKLKEILLAIPLRRYLVMQTNVKMVQ  514

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HFLW+P P RYD+FHMILHSIW++R+
Sbjct  515  KHFLWNPKPVRYDLFHMILHSIWFSRL  541



>ref|XP_004172570.1| PREDICTED: probable glycosyltransferase At5g03795-like, partial 
[Cucumis sativus]
Length=344

 Score =   257 bits (656),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 158/217 (73%), Gaps = 6/217 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGV-QLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYL  289
               E R    + I++LC +DL EGV +LGKDVSLPET + + R P +++GG   S+RP L
Sbjct  120  TVNEHRELSQHTIKALCNADLSEGVFKLGKDVSLPETTIRTPRKPLRNVGGKRVSQRPIL  179

Query  290  AFFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEV  454
            AFFAG MHG VRP LL+HW +KD D++++G +      K  Y+ HMKSSKYCIC  GYEV
Sbjct  180  AFFAGNMHGRVRPILLKHWNDKDDDIRVYGPLPLRVSRKMTYIQHMKSSKYCICPMGYEV  239

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPR++EAI YECVPVII+DNFV PF E L+W +F+V V EKDI  LK IL +IP   Y 
Sbjct  240  NSPRIIEAIYYECVPVIIADNFVLPFSEFLDWSAFSVVVAEKDIPKLKEILTAIPLKRYL  299

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
             MQ  VK VQ+HFLW+P P +YD+FHM+LHSIW++R+
Sbjct  300  TMQINVKMVQKHFLWNPKPLKYDLFHMVLHSIWFSRL  336



>ref|XP_010264376.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X2 
[Nelumbo nucifera]
Length=480

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 156/207 (75%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EG+ + G+DVSLPET + + R P + +GG   S+RP LAFFAG MHG 
Sbjct  267  NTIKALCNADLSEGIFVAGRDVSLPETTIRNPRKPLREVGGKRVSQRPILAFFAGNMHGR  326

Query  320  VRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LL++W+ KD DM+I+G +      K  Y+ HMKSS++CIC  GYEVNSPR+VEAI 
Sbjct  327  VRPILLKYWKGKDEDMRIYGPLPNRISRKMSYIQHMKSSRFCICPMGYEVNSPRIVEAIY  386

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+DNFVPPF E L+W  F+V V EKDI NLK+IL++IP   Y  MQT VK VQ
Sbjct  387  YECVPVIIADNFVPPFNEVLDWSVFSVIVAEKDIPNLKDILLAIPLRRYLSMQTNVKMVQ  446

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HF W+P P RYDIFHMILHSIW+ R+
Sbjct  447  KHFFWNPRPIRYDIFHMILHSIWFNRL  473



>ref|XP_010264375.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Nelumbo nucifera]
Length=529

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 156/207 (75%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EG+ + G+DVSLPET + + R P + +GG   S+RP LAFFAG MHG 
Sbjct  316  NTIKALCNADLSEGIFVAGRDVSLPETTIRNPRKPLREVGGKRVSQRPILAFFAGNMHGR  375

Query  320  VRPTLLQHWENKDPDMKIFGTMD-----KKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP LL++W+ KD DM+I+G +      K  Y+ HMKSS++CIC  GYEVNSPR+VEAI 
Sbjct  376  VRPILLKYWKGKDEDMRIYGPLPNRISRKMSYIQHMKSSRFCICPMGYEVNSPRIVEAIY  435

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+DNFVPPF E L+W  F+V V EKDI NLK+IL++IP   Y  MQT VK VQ
Sbjct  436  YECVPVIIADNFVPPFNEVLDWSVFSVIVAEKDIPNLKDILLAIPLRRYLSMQTNVKMVQ  495

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HF W+P P RYDIFHMILHSIW+ R+
Sbjct  496  KHFFWNPRPIRYDIFHMILHSIWFNRL  522



>emb|CBI23466.3| unnamed protein product [Vitis vinifera]
Length=585

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 158/207 (76%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +DL EG+ + GKDVSLPET + + R P +++GG   S+RP LAFFAG MHG 
Sbjct  324  NTIKALCNADLSEGIFVAGKDVSLPETTIRNPRRPLRNVGGRRVSQRPILAFFAGNMHGR  383

Query  320  VRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRPTLL++W +KD DM+I+G +      K  Y+ HMKSS++CIC  GYEVNSPR+VEAI 
Sbjct  384  VRPTLLKYWSDKDEDMRIYGPLPNRISRKMSYIQHMKSSRFCICPMGYEVNSPRIVEAIY  443

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+DNFVPP  + L+W +F+V V EKDI  LK IL++IP   Y  MQT VK VQ
Sbjct  444  YECVPVIIADNFVPPLNDVLDWTAFSVIVAEKDIPKLKEILLAIPLRRYLVMQTNVKMVQ  503

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HFLW+P P RYD+FHMILHSIW++R+
Sbjct  504  KHFLWNPKPVRYDLFHMILHSIWFSRL  530



>gb|EMT33304.1| Exostosin-1 [Aegilops tauschii]
Length=570

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 160/207 (77%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +D+ EGV + G+DVSLPETY+ S+R P + IGG P ++R  LAFFAGQMHG 
Sbjct  356  NTIKALCNADVSEGVFIRGRDVSLPETYLKSARRPVRDIGGKPAAERSILAFFAGQMHGR  415

Query  320  VRPTLLQHWENKDPDMKIFGTMDKK-----DYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP L+++W  KD DM+I+  + ++     +Y  HMKSSKYCIC  GYEVNSPR+VEAI 
Sbjct  416  VRPVLVKYWGGKDADMRIYTRIPRQITRRMNYAKHMKSSKYCICPMGYEVNSPRIVEAIY  475

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+DNFV PF + L+W +F+V V EKD+  LK IL++IPE+ Y  M++ VK+VQ
Sbjct  476  YECVPVIIADNFVLPFDDALDWTAFSVVVAEKDVPRLKEILLAIPESRYITMRSNVKKVQ  535

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            RHFLWH  P +YDIFHMILHS+W++RV
Sbjct  536  RHFLWHTKPVKYDIFHMILHSVWFSRV  562



>ref|XP_008437051.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
 ref|XP_008437052.1| PREDICTED: probable glycosyltransferase At5g03795 [Cucumis melo]
Length=541

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 158/217 (73%), Gaps = 6/217 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGV-QLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYL  289
               E R    N I++LC +DL EGV +LGKDVSLPET + + R P +++GG   S+RP L
Sbjct  317  TVNEHRELSQNTIKALCNADLSEGVFKLGKDVSLPETTIRTPRKPLRNVGGKRVSQRPIL  376

Query  290  AFFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEV  454
            AFFAG MHG VRP LL+HW +KD D++++G +      K  Y+ HMKSSKYCIC  GYEV
Sbjct  377  AFFAGNMHGRVRPILLKHWNDKDDDIRVYGPLPLRVSRKMTYIQHMKSSKYCICPMGYEV  436

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPR++EAI YECVPVII+DNFV PF E L+W +F+V V EKDI  LK IL +IP   Y 
Sbjct  437  NSPRIIEAIYYECVPVIIADNFVLPFSEFLDWSAFSVVVAEKDIPKLKEILTAIPLKRYL  496

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
             MQ  VK VQ+HFLW+P P +YD+FHM+LHSIW++R+
Sbjct  497  TMQINVKMVQKHFLWNPKPLKYDLFHMVLHSIWFSRL  533



>ref|XP_008787956.1| PREDICTED: probable glycosyltransferase At5g03795 isoform X1 
[Phoenix dactylifera]
Length=563

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 156/207 (75%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +D+ EGV + GKDVSLPETY+ + R P + +GG P S+R  LAFFAGQMHG 
Sbjct  352  NTIKALCNADVSEGVFIRGKDVSLPETYIRTPRRPLRDVGGKPVSQRSILAFFAGQMHGR  411

Query  320  VRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP L+Q+W  KD DM+I+ ++      K  Y+ HMKSSK+CIC  GYEVNSPR+VEAI 
Sbjct  412  VRPILIQYWRGKDADMRIYESLPHRAAKKMSYIQHMKSSKFCICPMGYEVNSPRIVEAIY  471

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+DNFV PF E L+W +F+V + EKDI NLK+IL+ IP   Y  MQ  VK++Q
Sbjct  472  YECVPVIIADNFVLPFDEVLDWSTFSVVIAEKDIPNLKDILLKIPLRRYITMQMNVKKLQ  531

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HFLWH  P +YDIFHMILHS+W+ R+
Sbjct  532  KHFLWHAKPVKYDIFHMILHSVWFNRL  558



>ref|XP_009410556.1| PREDICTED: probable glycosyltransferase At5g03795 [Musa acuminata 
subsp. malaccensis]
Length=570

 Score =   262 bits (669),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 160/216 (74%), Gaps = 9/216 (4%)
 Frame = +2

Query  125  TRYHMA---NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLA  292
            T++H     N I++LC +D+ EGV + GKDVSLPET + + R P + IGG P S+R  LA
Sbjct  348  TKWHQELRQNTIKALCNADVSEGVFIRGKDVSLPETSIRNPRRPPRDIGGKPASQRTILA  407

Query  293  FFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVN  457
            FFAGQMHG VRP LLQ+W  +D ++KI+G +      K  Y  HMKSSK+CIC  GYEVN
Sbjct  408  FFAGQMHGRVRPILLQYWSGRDENIKIYGPLPKGVAKKMSYAEHMKSSKFCICPMGYEVN  467

Query  458  SPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYRE  637
            SPR+VEAI YECVPV+I+DNFV PF E L+W +F+V + EKDI NLK+IL+ IP++ Y  
Sbjct  468  SPRIVEAIYYECVPVVIADNFVLPFEEVLDWHAFSVVIAEKDIANLKDILLRIPQSEYVT  527

Query  638  MQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
            MQ  VK++Q+HFLWH  P +YDIFHMILHSIW+ R+
Sbjct  528  MQMNVKKLQKHFLWHAKPVKYDIFHMILHSIWFNRL  563



>ref|XP_004152424.1| PREDICTED: probable glycosyltransferase At5g03795-like [Cucumis 
sativus]
Length=472

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 158/217 (73%), Gaps = 6/217 (3%)
 Frame = +2

Query  113  AAEETRYHMANCIRSLCVSDLREGV-QLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYL  289
               E R    + I++LC +DL EGV +LGKDVSLPET + + R P +++GG   S+RP L
Sbjct  248  TVNEHRELSQHTIKALCNADLSEGVFKLGKDVSLPETTIRTPRKPLRNVGGKRVSQRPIL  307

Query  290  AFFAGQMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEV  454
            AFFAG MHG VRP LL+HW +KD D++++G +      K  Y+ HMKSSKYCIC  GYEV
Sbjct  308  AFFAGNMHGRVRPILLKHWNDKDDDIRVYGPLPLRVSRKMTYIQHMKSSKYCICPMGYEV  367

Query  455  NSPRVVEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYR  634
            NSPR++EAI YECVPVII+DNFV PF E L+W +F+V V EKDI  LK IL +IP   Y 
Sbjct  368  NSPRIIEAIYYECVPVIIADNFVLPFSEFLDWSAFSVVVAEKDIPKLKEILTAIPLKRYL  427

Query  635  EMQTRVKRVQRHFLWHPSPQRYDIFHMILHSIWYTRV  745
             MQ  VK VQ+HFLW+P P +YD+FHM+LHSIW++R+
Sbjct  428  TMQINVKMVQKHFLWNPKPLKYDLFHMVLHSIWFSRL  464



>ref|XP_010940042.1| PREDICTED: probable glycosyltransferase At5g03795 [Elaeis guineensis]
Length=587

 Score =   262 bits (669),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 155/207 (75%), Gaps = 6/207 (3%)
 Frame = +2

Query  143  NCIRSLCVSDLREGVQL-GKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAGQMHGY  319
            N I++LC +D+ EGV + GKDVSLPETY+ + R P + +GG P S+R  LAFFAGQMHG 
Sbjct  376  NTIKALCNADVSEGVFIRGKDVSLPETYIRTPRRPLRDVGGKPVSQRSILAFFAGQMHGR  435

Query  320  VRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRVVEAIS  484
            VRP L+Q+W  KD DM+I+  +      K  Y+ HMK+SK+CIC  GYEVNSPR+VEAI 
Sbjct  436  VRPILIQYWRGKDADMRIYEALPHRVAKKMSYIQHMKTSKFCICPMGYEVNSPRIVEAIY  495

Query  485  YECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRVQ  664
            YECVPVII+DNFV PF E L+W +F+V V EKDI NLK+IL+ IP   Y  MQ  VKR+Q
Sbjct  496  YECVPVIIADNFVLPFDEVLDWSAFSVVVAEKDIPNLKDILLKIPLRQYITMQMNVKRLQ  555

Query  665  RHFLWHPSPQRYDIFHMILHSIWYTRV  745
            +HFLWH  P +YDIFHMILHS+W+ R+
Sbjct  556  KHFLWHAKPIKYDIFHMILHSVWFNRL  582



>ref|XP_006405956.1| hypothetical protein EUTSA_v10027719mg [Eutrema salsugineum]
 gb|ESQ47409.1| hypothetical protein EUTSA_v10027719mg [Eutrema salsugineum]
Length=528

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 147/194 (76%), Gaps = 5/194 (3%)
 Frame = +2

Query  125  TRYHMANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQSIGGYPPSKRPYLAFFAG  304
            T+ HM N +R+LC S++ +G ++G D +LP TY+ S+ +P + +GG  PS+R  LAFFAG
Sbjct  332  TKKHMKNSVRALCNSNVAQGFRIGIDTALPVTYIRSAESPLEYLGGKTPSERKILAFFAG  391

Query  305  QMHGYVRPTLLQHWENKDPDMKIFGTM-----DKKDYLVHMKSSKYCICARGYEVNSPRV  469
             MHGY+RP LLQ WENK+PDMKI G M      KK Y  +MKSS+YCICARGYEV++PRV
Sbjct  392  SMHGYLRPILLQLWENKEPDMKILGPMPRDPQSKKQYREYMKSSRYCICARGYEVHTPRV  451

Query  470  VEAISYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTR  649
            VEAI  ECVPVII+DN+VPPFFE L WE FAVFV EKDI NL+NIL+SIPE  Y  MQ R
Sbjct  452  VEAIMNECVPVIIADNYVPPFFEVLEWEEFAVFVKEKDIANLRNILLSIPEERYVGMQAR  511

Query  650  VKRVQRHFLWHPSP  691
            V  VQ+HFLWH  P
Sbjct  512  VNMVQQHFLWHKKP  525



>ref|XP_001781687.1| predicted protein [Physcomitrella patens]
 gb|EDQ53500.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 156/213 (73%), Gaps = 6/213 (3%)
 Frame = +2

Query  140  ANCIRSLCVSDLREGVQLGKDVSLPETYVYSSRNPQQ-SIGGYPPSKRPYLAFFAGQMHG  316
            +N ++ +C +DL E   +GKD SLPE Y++ S+      +GG    +RPYLAFFAGQMHG
Sbjct  153  SNAVKVVCNADLTEEFVVGKDASLPEVYMHKSKTKAPIKLGGPGYDERPYLAFFAGQMHG  212

Query  317  YVRPTLLQHWENKDPDMKIFGTMDKK-----DYLVHMKSSKYCICARGYEVNSPRVVEAI  481
             VRP LL HW++KDPD+ I+G + K       Y+ HMK SKYCICA GYEVNSPR+VE+I
Sbjct  213  RVRPILLDHWKDKDPDLMIYGVLPKPIAKQISYVQHMKMSKYCICAAGYEVNSPRIVESI  272

Query  482  SYECVPVIISDNFVPPFFETLNWESFAVFVLEKDILNLKNILMSIPENTYREMQTRVKRV  661
             Y+CVPVII+DNFV PF + LNW++F+V + E DI  LK IL  IPE TYR MQ R++++
Sbjct  273  HYDCVPVIIADNFVLPFSDVLNWDAFSVTMPESDIPKLKAILNDIPEKTYRSMQIRLRKI  332

Query  662  QRHFLWHPSPQRYDIFHMILHSIWYTRVFRTVQ  760
            ++HF+WH  P++YD+FHMILHS+W +R+ R  Q
Sbjct  333  RQHFVWHKKPEKYDVFHMILHSVWMSRINRLEQ  365



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1761970051296