BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21117_g1_i1 len=1088 path=[403:0-58 462:59-64 468:65-83 579:84-100
201:101-140 1877:141-806 2543:807-839 2576:840-1087]

Length=1088
                                                                      Score     E

ref|XP_011078428.1|  PREDICTED: probable LRR receptor-like serine...    303   1e-89   
ref|XP_011078427.1|  PREDICTED: LRR receptor-like serine/threonin...    298   1e-88   
ref|XP_011078429.1|  PREDICTED: probable LRR receptor-like serine...    299   4e-88   
emb|CDP21092.1|  unnamed protein product                                271   3e-84   
emb|CDP21744.1|  unnamed protein product                                266   2e-82   
ref|XP_009799744.1|  PREDICTED: probable LRR receptor-like serine...    282   5e-82   
ref|XP_009799745.1|  PREDICTED: probable LRR receptor-like serine...    281   5e-82   
ref|XP_009783409.1|  PREDICTED: probable leucine-rich repeat rece...    265   4e-81   
emb|CDP18217.1|  unnamed protein product                                273   7e-81   
ref|XP_006367833.1|  PREDICTED: probable leucine-rich repeat rece...    264   1e-80   
ref|XP_009604297.1|  PREDICTED: probable LRR receptor-like serine...    275   9e-80   
ref|XP_006358724.1|  PREDICTED: probable LRR receptor-like serine...    275   1e-79   
emb|CDO96823.1|  unnamed protein product                                273   2e-79   
ref|XP_010316828.1|  PREDICTED: probable LRR receptor-like serine...    273   3e-79   
emb|CDP06347.1|  unnamed protein product                                256   4e-79   
ref|XP_006358154.1|  PREDICTED: probable LRR receptor-like serine...    271   2e-78   
emb|CDP21851.1|  unnamed protein product                                255   2e-78   
emb|CDP08225.1|  unnamed protein product                                254   1e-77   
ref|XP_009589616.1|  PREDICTED: receptor-like protein kinase            253   7e-77   
ref|XP_006362615.1|  PREDICTED: probable LRR receptor-like serine...    266   8e-77   
emb|CDO96824.1|  unnamed protein product                                266   1e-76   
ref|XP_011091709.1|  PREDICTED: probable LRR receptor-like serine...    266   2e-76   
ref|XP_006358153.1|  PREDICTED: probable LRR receptor-like serine...    262   4e-76   
ref|XP_010316829.1|  PREDICTED: probable LRR receptor-like serine...    265   5e-76   
ref|XP_006358717.1|  PREDICTED: LRR receptor-like serine/threonin...    263   1e-75   
ref|XP_010321910.1|  PREDICTED: probable LRR receptor-like serine...    260   2e-75   
ref|XP_008225251.1|  PREDICTED: probable LRR receptor-like serine...    261   3e-75   
ref|XP_009613027.1|  PREDICTED: LRR receptor-like serine/threonin...    248   3e-75   
ref|XP_009799747.1|  PREDICTED: probable LRR receptor-like serine...    263   3e-75   
ref|XP_006367834.1|  PREDICTED: probable LRR receptor-like serine...    253   5e-75   
ref|XP_006358723.1|  PREDICTED: probable LRR receptor-like serine...    260   6e-75   
ref|XP_010322115.1|  PREDICTED: probable LRR receptor-like serine...    260   1e-74   
ref|XP_009760442.1|  PREDICTED: probable LRR receptor-like serine...    260   1e-74   
ref|XP_006344114.1|  PREDICTED: putative receptor-like protein ki...    245   1e-74   
ref|XP_009376755.1|  PREDICTED: LRR receptor-like serine/threonin...    260   2e-74   
ref|XP_010317427.1|  PREDICTED: probable LRR receptor-like serine...    259   3e-74   
ref|XP_008226831.1|  PREDICTED: probable LRR receptor-like serine...    259   3e-74   
ref|XP_010260175.1|  PREDICTED: LRR receptor-like serine/threonin...    259   4e-74   
ref|XP_009611662.1|  PREDICTED: LRR receptor-like serine/threonin...    258   5e-74   
ref|XP_009611661.1|  PREDICTED: probable LRR receptor-like serine...    258   6e-74   
ref|XP_009780871.1|  PREDICTED: receptor-like protein kinase            251   6e-74   
ref|XP_008346276.1|  PREDICTED: receptor-like protein kinase            255   8e-74   
ref|XP_009617958.1|  PREDICTED: probable LRR receptor-like serine...    258   8e-74   
ref|XP_009589466.1|  PREDICTED: probable LRR receptor-like serine...    258   9e-74   
ref|XP_009589465.1|  PREDICTED: probable LRR receptor-like serine...    258   9e-74   
ref|XP_009593033.1|  PREDICTED: LRR receptor-like serine/threonin...    258   9e-74   
ref|XP_008355308.1|  PREDICTED: LRR receptor-like serine/threonin...    248   1e-73   
ref|XP_009799273.1|  PREDICTED: probable LRR receptor-like serine...    258   1e-73   
ref|XP_009799274.1|  PREDICTED: LRR receptor-like serine/threonin...    258   1e-73   
ref|XP_010321913.1|  PREDICTED: probable LRR receptor-like serine...    254   2e-73   
emb|CDP18219.1|  unnamed protein product                                256   2e-73   
ref|XP_007021924.1|  Serine-threonine protein kinase                    244   4e-73   
ref|XP_007214168.1|  hypothetical protein PRUPE_ppa018998mg             255   5e-73   
ref|XP_004231674.1|  PREDICTED: probable LRR receptor-like serine...    255   6e-73   
ref|XP_009375059.1|  PREDICTED: probable LRR receptor-like serine...    255   8e-73   
emb|CDP15116.1|  unnamed protein product                                255   1e-72   
ref|XP_011101453.1|  PREDICTED: probable LRR receptor-like serine...    254   3e-72   
ref|XP_009775020.1|  PREDICTED: probable LRR receptor-like serine...    253   3e-72   
ref|XP_006358728.1|  PREDICTED: LRR receptor-like serine/threonin...    253   4e-72   
emb|CDP08216.1|  unnamed protein product                                253   4e-72   
emb|CDP20776.1|  unnamed protein product                                241   4e-72   
emb|CDP06824.1|  unnamed protein product                                253   5e-72   
ref|XP_008347286.1|  PREDICTED: LRR receptor-like serine/threonin...    251   5e-72   
ref|XP_009760562.1|  PREDICTED: probable LRR receptor-like serine...    253   9e-72   
emb|CDP21532.1|  unnamed protein product                                238   1e-71   
ref|XP_009763990.1|  PREDICTED: probable LRR receptor-like serine...    251   1e-71   
ref|XP_006367573.1|  PREDICTED: LRR receptor-like serine/threonin...    245   2e-71   
ref|XP_009783787.1|  PREDICTED: putative receptor-like protein ki...    252   2e-71   
ref|XP_006367143.1|  PREDICTED: LRR receptor-like serine/threonin...    249   2e-71   
ref|XP_009763989.1|  PREDICTED: probable LRR receptor-like serine...    251   2e-71   
ref|XP_008362210.1|  PREDICTED: probable LRR receptor-like serine...    251   2e-71   
ref|XP_009763988.1|  PREDICTED: probable LRR receptor-like serine...    251   2e-71   
emb|CDP11283.1|  unnamed protein product                                251   2e-71   
ref|XP_009623836.1|  PREDICTED: probable LRR receptor-like serine...    251   2e-71   
ref|XP_008364201.1|  PREDICTED: LRR receptor-like serine/threonin...    244   3e-71   
ref|XP_006357294.1|  PREDICTED: probable LRR receptor-like serine...    250   3e-71   
ref|XP_009611716.1|  PREDICTED: probable LRR receptor-like serine...    244   4e-71   
emb|CDO96776.1|  unnamed protein product                                250   4e-71   
ref|XP_010317513.1|  PREDICTED: LRR receptor-like serine/threonin...    235   5e-71   
ref|XP_009376753.1|  PREDICTED: probable LRR receptor-like serine...    249   8e-71   
ref|XP_009376752.1|  PREDICTED: probable LRR receptor-like serine...    249   8e-71   
ref|XP_009376751.1|  PREDICTED: probable LRR receptor-like serine...    249   1e-70   
ref|XP_009351430.1|  PREDICTED: leucine-rich repeat receptor-like...    237   2e-70   
ref|XP_004293986.1|  PREDICTED: probable LRR receptor-like serine...    248   2e-70   
ref|XP_008225314.1|  PREDICTED: LRR receptor-like serine/threonin...    249   2e-70   
ref|XP_011099195.1|  PREDICTED: probable LRR receptor-like serine...    249   2e-70   
emb|CDP11295.1|  unnamed protein product                                248   2e-70   
ref|XP_006355253.1|  PREDICTED: probable leucine-rich repeat rece...    239   2e-70   
ref|XP_011039410.1|  PREDICTED: putative receptor-like protein ki...    248   3e-70   
ref|XP_008371720.1|  PREDICTED: probable LRR receptor-like serine...    243   3e-70   
ref|XP_007020361.1|  Serine-threonine protein kinase, putative          242   4e-70   
ref|XP_009772313.1|  PREDICTED: probable LRR receptor-like serine...    248   4e-70   
ref|XP_008225333.1|  PREDICTED: probable LRR receptor-like serine...    249   5e-70   
ref|XP_009783779.1|  PREDICTED: putative receptor-like protein ki...    248   6e-70   
emb|CDP11291.1|  unnamed protein product                                248   7e-70   
ref|XP_008223924.1|  PREDICTED: probable LRR receptor-like serine...    248   7e-70   
emb|CAN65889.1|  hypothetical protein VITISV_030571                     240   8e-70   Vitis vinifera
ref|XP_008225337.1|  PREDICTED: putative receptor-like protein ki...    247   8e-70   
emb|CDP08227.1|  unnamed protein product                                246   1e-69   
ref|XP_011091710.1|  PREDICTED: probable LRR receptor-like serine...    246   2e-69   
ref|XP_008372676.1|  PREDICTED: probable LRR receptor-like serine...    246   2e-69   
ref|XP_006362616.1|  PREDICTED: probable LRR receptor-like serine...    245   2e-69   
ref|XP_009606161.1|  PREDICTED: putative receptor-like protein ki...    246   3e-69   
ref|XP_009595556.1|  PREDICTED: probable LRR receptor-like serine...    234   3e-69   
gb|KEH29237.1|  LRR receptor-like kinase                                244   3e-69   
ref|XP_008383875.1|  PREDICTED: LRR receptor-like serine/threonin...    244   4e-69   
ref|XP_007021887.1|  Leucine-rich repeat protein kinase family pr...    245   4e-69   
ref|XP_006358722.1|  PREDICTED: LRR receptor-like serine/threonin...    246   5e-69   
emb|CDP00850.1|  unnamed protein product                                247   5e-69   
ref|XP_004295582.1|  PREDICTED: probable LRR receptor-like serine...    244   7e-69   
emb|CDO96827.1|  unnamed protein product                                243   8e-69   
gb|EYU28102.1|  hypothetical protein MIMGU_mgv1a000498mg                244   1e-68   
ref|XP_006449526.1|  hypothetical protein CICLE_v10017696mg             233   1e-68   
ref|XP_007021926.1|  Serine-threonine protein kinase, putative          243   1e-68   
ref|XP_006356908.1|  PREDICTED: leucine-rich repeat receptor-like...    230   2e-68   
ref|XP_007212752.1|  hypothetical protein PRUPE_ppa016624mg             243   2e-68   
ref|XP_008344924.1|  PREDICTED: putative receptor-like protein ki...    241   2e-68   
ref|XP_002532618.1|  serine-threonine protein kinase, plant-type,...    231   2e-68   Ricinus communis
ref|XP_008364895.1|  PREDICTED: probable LRR receptor-like serine...    236   4e-68   
ref|XP_009759632.1|  PREDICTED: LRR receptor-like serine/threonin...    242   5e-68   
ref|XP_009759631.1|  PREDICTED: probable LRR receptor-like serine...    242   5e-68   
ref|XP_009623595.1|  PREDICTED: LRR receptor-like serine/threonin...    242   5e-68   
ref|XP_006448720.1|  hypothetical protein CICLE_v10017727mg             241   9e-68   
emb|CDP16051.1|  unnamed protein product                                239   1e-67   
emb|CDP09585.1|  unnamed protein product                                241   1e-67   
emb|CDP05658.1|  unnamed protein product                                240   1e-67   
emb|CDP00840.1|  unnamed protein product                                241   1e-67   
ref|XP_009609323.1|  PREDICTED: probable LRR receptor-like serine...    241   1e-67   
ref|XP_004295584.1|  PREDICTED: putative receptor-like protein ki...    241   1e-67   
ref|XP_009603193.1|  PREDICTED: probable LRR receptor-like serine...    240   1e-67   
ref|XP_009609321.1|  PREDICTED: probable LRR receptor-like serine...    241   1e-67   
emb|CDP11244.1|  unnamed protein product                                240   2e-67   
ref|XP_004161209.1|  PREDICTED: probable LRR receptor-like serine...    239   2e-67   
ref|XP_009772557.1|  PREDICTED: probable LRR receptor-like serine...    240   2e-67   
ref|XP_010316831.1|  PREDICTED: probable LRR receptor-like serine...    227   2e-67   
ref|XP_009603194.1|  PREDICTED: probable LRR receptor-like serine...    239   2e-67   
ref|XP_010316830.1|  PREDICTED: probable LRR receptor-like serine...    228   2e-67   
ref|XP_006358149.1|  PREDICTED: probable LRR receptor-like serine...    240   3e-67   
ref|XP_009765991.1|  PREDICTED: putative receptor-like protein ki...    240   3e-67   
ref|XP_007021885.1|  Leucine-rich repeat protein kinase family pr...    240   3e-67   
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413    242   3e-67   
ref|XP_009603191.1|  PREDICTED: LRR receptor-like serine/threonin...    239   3e-67   
ref|XP_009362010.1|  PREDICTED: receptor-like protein kinase 2          236   3e-67   
emb|CDO96841.1|  unnamed protein product                                240   3e-67   
ref|XP_007021888.1|  Leucine-rich repeat protein kinase family pr...    239   4e-67   
ref|XP_007021766.1|  Leucine-rich repeat protein kinase family pr...    239   4e-67   
ref|XP_007020362.1|  Serine-threonine protein kinase                    228   7e-67   
ref|XP_009373071.1|  PREDICTED: probable LRR receptor-like serine...    238   8e-67   
ref|XP_009604574.1|  PREDICTED: LRR receptor-like serine/threonin...    227   9e-67   
emb|CDP19967.1|  unnamed protein product                                225   1e-66   
ref|XP_008225334.1|  PREDICTED: probable LRR receptor-like serine...    227   1e-66   
ref|XP_009780759.1|  PREDICTED: probable LRR receptor-like serine...    238   1e-66   
emb|CDP11293.1|  unnamed protein product                                240   2e-66   
ref|XP_007021758.1|  Leucine-rich repeat protein kinase family pr...    238   2e-66   
ref|XP_006358404.1|  PREDICTED: LRR receptor-like serine/threonin...    239   2e-66   
ref|XP_004150225.1|  PREDICTED: probable LRR receptor-like serine...    237   2e-66   
ref|XP_007021890.1|  Leucine-rich repeat protein kinase family pr...    238   2e-66   
gb|EYU43344.1|  hypothetical protein MIMGU_mgv11b018117mg               237   2e-66   
emb|CDP00842.1|  unnamed protein product                                231   2e-66   
emb|CDP21738.1|  unnamed protein product                                229   2e-66   
ref|XP_003636115.1|  Receptor protein kinase-like protein               226   3e-66   
ref|XP_009362012.1|  PREDICTED: probable LRR receptor-like serine...    236   3e-66   
emb|CDP00839.1|  unnamed protein product                                236   4e-66   
ref|XP_008347098.1|  PREDICTED: putative receptor-like protein ki...    235   4e-66   
ref|XP_010268403.1|  PREDICTED: probable LRR receptor-like serine...    236   6e-66   
ref|XP_007042790.1|  Serine-threonine protein kinase, putative          229   6e-66   
emb|CDP20522.1|  unnamed protein product                                223   6e-66   
ref|XP_007021761.1|  Leucine-rich repeat protein kinase family pr...    236   7e-66   
ref|XP_010265745.1|  PREDICTED: probable LRR receptor-like serine...    236   8e-66   
emb|CDP15118.1|  unnamed protein product                                229   1e-65   
ref|XP_010316836.1|  PREDICTED: probable LRR receptor-like serine...    236   1e-65   
emb|CDP17628.1|  unnamed protein product                                236   2e-65   
gb|EYU30632.1|  hypothetical protein MIMGU_mgv1a022995mg                221   2e-65   
emb|CDP00866.1|  unnamed protein product                                235   3e-65   
ref|XP_009785408.1|  PREDICTED: LRR receptor-like serine/threonin...    221   3e-65   
ref|XP_006367140.1|  PREDICTED: probable LRR receptor-like serine...    234   3e-65   
emb|CDP20322.1|  unnamed protein product                                234   3e-65   
ref|XP_009771022.1|  PREDICTED: probable LRR receptor-like serine...    234   4e-65   
ref|XP_008446690.1|  PREDICTED: probable LRR receptor-like serine...    233   5e-65   
ref|XP_003524106.1|  PREDICTED: probable LRR receptor-like serine...    234   7e-65   
ref|XP_004486275.1|  PREDICTED: LRR receptor-like serine/threonin...    233   7e-65   
ref|XP_009619421.1|  PREDICTED: probable LRR receptor-like serine...    233   7e-65   
ref|XP_009612505.1|  PREDICTED: putative receptor-like protein ki...    220   8e-65   
ref|XP_004234249.1|  PREDICTED: probable LRR receptor-like serine...    233   8e-65   
ref|XP_009587372.1|  PREDICTED: LRR receptor-like serine/threonin...    223   8e-65   
emb|CDP21678.1|  unnamed protein product                                222   9e-65   
ref|XP_008357586.1|  PREDICTED: probably inactive leucine-rich re...    224   1e-64   
ref|XP_009375060.1|  PREDICTED: probable LRR receptor-like serine...    231   1e-64   
ref|XP_007214383.1|  hypothetical protein PRUPE_ppb001416mg             229   2e-64   
ref|XP_009376795.1|  PREDICTED: putative receptor-like protein ki...    232   2e-64   
emb|CDP20952.1|  unnamed protein product                                221   2e-64   
ref|XP_004240621.1|  PREDICTED: probable LRR receptor-like serine...    231   2e-64   
ref|XP_006362614.1|  PREDICTED: probable LRR receptor-like serine...    229   3e-64   
ref|XP_009587371.1|  PREDICTED: putative receptor-like protein ki...    224   3e-64   
gb|KHN25863.1|  LRR receptor-like serine/threonine-protein kinase...    231   4e-64   
ref|XP_010657153.1|  PREDICTED: probable LRR receptor-like serine...    233   4e-64   
ref|XP_010268541.1|  PREDICTED: probable LRR receptor-like serine...    231   7e-64   
ref|XP_006361600.1|  PREDICTED: probable LRR receptor-like serine...    230   7e-64   
ref|XP_002317405.2|  hypothetical protein POPTR_0011s07140g             229   7e-64   Populus trichocarpa [western balsam poplar]
ref|XP_003635790.1|  Receptor-like kinase                               233   7e-64   
ref|XP_007214129.1|  hypothetical protein PRUPE_ppa018020mg             231   8e-64   
ref|XP_007020364.1|  Serine-threonine protein kinase                    228   1e-63   
emb|CDP08220.1|  unnamed protein product                                229   1e-63   
emb|CDP16386.1|  unnamed protein product                                230   1e-63   
ref|XP_004233904.1|  PREDICTED: LRR receptor-like serine/threonin...    229   1e-63   
emb|CDP20095.1|  unnamed protein product                                226   1e-63   
ref|XP_006448739.1|  hypothetical protein CICLE_v10017714mg             228   1e-63   
emb|CAN71566.1|  hypothetical protein VITISV_016304                     218   2e-63   Vitis vinifera
ref|XP_008343840.1|  PREDICTED: LRR receptor-like serine/threonin...    218   2e-63   
emb|CDP11411.1|  unnamed protein product                                228   2e-63   
emb|CDP08222.1|  unnamed protein product                                227   2e-63   
ref|XP_006442565.1|  hypothetical protein CICLE_v10018687mg             228   3e-63   
ref|XP_007021764.1|  Leucine-rich repeat protein kinase family pr...    229   3e-63   
ref|XP_007021931.1|  Serine-threonine protein kinase, putative          226   3e-63   
ref|XP_011074907.1|  PREDICTED: LRR receptor-like serine/threonin...    227   5e-63   
gb|KDO40017.1|  hypothetical protein CISIN_1g0405402mg                  219   6e-63   
ref|XP_006442569.1|  hypothetical protein CICLE_v10024586mg             220   6e-63   
ref|XP_007219655.1|  hypothetical protein PRUPE_ppa025151mg             227   6e-63   
ref|XP_007213507.1|  hypothetical protein PRUPE_ppa020889mg             226   7e-63   
ref|XP_009631801.1|  PREDICTED: probable LRR receptor-like serine...    228   8e-63   
ref|XP_011074906.1|  PREDICTED: probable LRR receptor-like serine...    227   1e-62   
ref|XP_003633210.1|  PREDICTED: probable LRR receptor-like serine...    225   2e-62   
emb|CDP08221.1|  unnamed protein product                                225   2e-62   
ref|XP_009798297.1|  PREDICTED: probable LRR receptor-like serine...    227   2e-62   
ref|XP_010657053.1|  PREDICTED: probable LRR receptor-like serine...    228   2e-62   
ref|XP_010316832.1|  PREDICTED: probable LRR receptor-like serine...    213   2e-62   
ref|XP_010655824.1|  PREDICTED: LRR receptor-like serine/threonin...    227   2e-62   
ref|XP_007021753.1|  Leucine-rich repeat protein kinase family pr...    226   2e-62   
ref|XP_008225338.1|  PREDICTED: probable LRR receptor-like serine...    226   3e-62   
ref|XP_006477788.1|  PREDICTED: probable LRR receptor-like serine...    224   3e-62   
ref|XP_009617698.1|  PREDICTED: probable LRR receptor-like serine...    226   4e-62   
ref|XP_007022173.1|  Serine-threonine protein kinase, putative          224   4e-62   
ref|XP_010275839.1|  PREDICTED: putative leucine-rich repeat rece...    225   4e-62   
gb|KDO77886.1|  hypothetical protein CISIN_1g0368791mg                  214   4e-62   
gb|EYU43429.1|  hypothetical protein MIMGU_mgv1a022492mg                224   6e-62   
ref|XP_010655183.1|  PREDICTED: putative receptor-like protein ki...    223   8e-62   
gb|KEH19631.1|  LRR receptor-like kinase                                224   1e-61   
ref|XP_006493622.1|  PREDICTED: LRR receptor-like serine/threonin...    224   1e-61   
gb|KDO49788.1|  hypothetical protein CISIN_1g036011mg                   223   1e-61   
ref|XP_002317008.2|  hypothetical protein POPTR_0011s14420g             223   1e-61   Populus trichocarpa [western balsam poplar]
emb|CDP07986.1|  unnamed protein product                                211   1e-61   
ref|XP_006442566.1|  hypothetical protein CICLE_v10024214mg             219   2e-61   
ref|XP_009780758.1|  PREDICTED: LRR receptor-like serine/threonin...    209   2e-61   
ref|XP_006476119.1|  PREDICTED: probable LRR receptor-like serine...    223   2e-61   
ref|XP_010321749.1|  PREDICTED: LRR receptor-like serine/threonin...    222   2e-61   
gb|KDO40390.1|  hypothetical protein CISIN_1g0383932mg                  211   2e-61   
ref|XP_007010363.1|  Serine-threonine protein kinase, plant-type,...    222   2e-61   
ref|XP_006442392.1|  hypothetical protein CICLE_v10023311mg             221   3e-61   
ref|XP_010324935.1|  PREDICTED: putative receptor-like protein ki...    211   3e-61   
emb|CDP11288.1|  unnamed protein product                                221   6e-61   
ref|XP_007025320.1|  Leucine-rich repeat protein kinase family pr...    222   6e-61   
emb|CAN72034.1|  hypothetical protein VITISV_000078                     222   7e-61   Vitis vinifera
ref|XP_010321747.1|  PREDICTED: probable LRR receptor-like serine...    220   7e-61   
ref|XP_008346977.1|  PREDICTED: probable LRR receptor-like serine...    209   8e-61   
emb|CDP00845.1|  unnamed protein product                                221   1e-60   
ref|XP_006493618.1|  PREDICTED: probable LRR receptor-like serine...    216   1e-60   
ref|XP_004509927.1|  PREDICTED: putative receptor-like protein ki...    221   2e-60   
ref|XP_007021751.1|  Leucine-rich repeat protein kinase family pr...    220   2e-60   
gb|KEH19880.1|  LRR receptor-like kinase family protein                 207   2e-60   
gb|KEH19914.1|  Serine/Threonine kinase, plant-type protein             208   3e-60   
ref|XP_007020359.1|  Serine-threonine protein kinase, putative          217   3e-60   
ref|XP_004485915.1|  PREDICTED: LRR receptor-like serine/threonin...    221   3e-60   
emb|CDP07983.1|  unnamed protein product                                207   3e-60   
ref|XP_010321748.1|  PREDICTED: probable LRR receptor-like serine...    218   4e-60   
gb|KEH19902.1|  Serine/Threonine kinase, plant-type protein, puta...    209   4e-60   
gb|KDO77432.1|  hypothetical protein CISIN_1g001794mg                   219   4e-60   
ref|XP_007213736.1|  hypothetical protein PRUPE_ppa000173mg             221   6e-60   
gb|KDP21115.1|  hypothetical protein JCGZ_21586                         218   7e-60   
emb|CDP11298.1|  unnamed protein product                                218   8e-60   
ref|XP_007025344.1|  Leucine-rich repeat protein kinase family pr...    219   9e-60   
ref|XP_007021767.1|  Leucine-rich repeat protein kinase family pr...    219   9e-60   
emb|CDP11280.1|  unnamed protein product                                217   1e-59   
ref|XP_002280075.2|  PREDICTED: probable LRR receptor-like serine...    219   1e-59   Vitis vinifera
emb|CDP05616.1|  unnamed protein product                                216   1e-59   
emb|CDP15925.1|  unnamed protein product                                212   2e-59   
emb|CDP00847.1|  unnamed protein product                                218   2e-59   
gb|KCW80921.1|  hypothetical protein EUGRSUZ_C02281                     216   2e-59   
emb|CDP11245.1|  unnamed protein product                                217   2e-59   
emb|CDP20521.1|  unnamed protein product                                214   3e-59   
emb|CDP16048.1|  unnamed protein product                                211   3e-59   
ref|XP_010050947.1|  PREDICTED: putative receptor-like protein ki...    217   4e-59   
emb|CDO96830.1|  unnamed protein product                                211   4e-59   
emb|CDP18319.1|  unnamed protein product                                217   5e-59   
ref|XP_002270587.2|  PREDICTED: probable LRR receptor-like serine...    215   5e-59   
ref|XP_006477769.1|  PREDICTED: LRR receptor-like serine/threonin...    213   6e-59   
ref|XP_009775745.1|  PREDICTED: probable LRR receptor-like serine...    216   7e-59   
ref|XP_006436337.1|  hypothetical protein CICLE_v10030526mg             215   8e-59   
ref|XP_006436335.1|  hypothetical protein CICLE_v10030526mg             216   1e-58   
ref|XP_007022610.1|  Leucine-rich repeat protein kinase family pr...    216   1e-58   
ref|XP_006436338.1|  hypothetical protein CICLE_v10030526mg             215   1e-58   
emb|CAN81714.1|  hypothetical protein VITISV_005816                     216   1e-58   
ref|XP_007021760.1|  Leucine-rich repeat protein kinase family pr...    215   1e-58   
ref|XP_006436336.1|  hypothetical protein CICLE_v10030526mg             215   2e-58   
ref|XP_007019788.1|  Receptor like protein 33                           201   2e-58   
ref|XP_002270207.2|  PREDICTED: probable LRR receptor-like serine...    215   2e-58   
emb|CDP16049.1|  unnamed protein product                                214   2e-58   
emb|CDP11286.1|  unnamed protein product                                214   3e-58   
ref|XP_007213069.1|  hypothetical protein PRUPE_ppa020550mg             214   4e-58   
emb|CAN78527.1|  hypothetical protein VITISV_039533                     215   4e-58   
emb|CBI31777.3|  unnamed protein product                                210   4e-58   
ref|XP_006468351.1|  PREDICTED: LRR receptor-like serine/threonin...    210   5e-58   
ref|XP_004252061.1|  PREDICTED: LRR receptor-like serine/threonin...    214   7e-58   
ref|XP_010655821.1|  PREDICTED: LRR receptor-like serine/threonin...    208   1e-57   
gb|EYU26016.1|  hypothetical protein MIMGU_mgv1a021182mg                209   1e-57   
ref|XP_006448927.1|  hypothetical protein CICLE_v10014011mg             214   1e-57   
emb|CDP00821.1|  unnamed protein product                                201   1e-57   
ref|XP_010050948.1|  PREDICTED: probable LRR receptor-like serine...    213   1e-57   
emb|CDP22173.1|  unnamed protein product                                201   1e-57   
ref|XP_010656878.1|  PREDICTED: probable LRR receptor-like serine...    211   2e-57   
emb|CDP21228.1|  unnamed protein product                                206   3e-57   
ref|XP_010051564.1|  PREDICTED: putative receptor-like protein ki...    211   4e-57   
gb|EYU30656.1|  hypothetical protein MIMGU_mgv1a025198mg                211   4e-57   
ref|XP_006431446.1|  hypothetical protein CICLE_v10003773mg             210   4e-57   
ref|XP_007021744.1|  Leucine-rich repeat protein kinase family pr...    211   5e-57   
ref|XP_010657056.1|  PREDICTED: LRR receptor-like serine/threonin...    212   5e-57   
ref|XP_010051569.1|  PREDICTED: putative receptor-like protein ki...    211   5e-57   
ref|XP_006427090.1|  hypothetical protein CICLE_v10026978mg             211   6e-57   
emb|CDP18966.1|  unnamed protein product                                211   6e-57   
ref|XP_007021880.1|  Serine-threonine protein kinase                    197   7e-57   
ref|XP_006494760.1|  PREDICTED: probable LRR receptor-like serine...    211   7e-57   
ref|XP_010657052.1|  PREDICTED: putative receptor-like protein ki...    212   8e-57   
emb|CDO96775.1|  unnamed protein product                                209   9e-57   
ref|XP_006494305.1|  PREDICTED: LRR receptor-like serine/threonin...    202   1e-56   
ref|XP_010655741.1|  PREDICTED: LRR receptor-like serine/threonin...    199   1e-56   
ref|XP_010657057.1|  PREDICTED: probable LRR receptor-like serine...    210   1e-56   
ref|XP_010051566.1|  PREDICTED: LRR receptor-like serine/threonin...    208   1e-56   
ref|XP_006465517.1|  PREDICTED: LRR receptor-like serine/threonin...    209   1e-56   
gb|EYU43343.1|  hypothetical protein MIMGU_mgv1a020194mg                209   1e-56   
ref|XP_010655823.1|  PREDICTED: LRR receptor-like serine/threonin...    206   2e-56   
ref|XP_010050145.1|  PREDICTED: putative receptor-like protein ki...    210   2e-56   
ref|XP_007022606.1|  Leucine-rich repeat protein kinase family pr...    197   2e-56   
gb|KCW82350.1|  hypothetical protein EUGRSUZ_C03755                     207   3e-56   
ref|XP_002530297.1|  serine-threonine protein kinase, plant-type,...    208   3e-56   
emb|CBI31014.3|  unnamed protein product                                210   3e-56   
emb|CBI25249.3|  unnamed protein product                                210   4e-56   
emb|CDP18965.1|  unnamed protein product                                197   4e-56   
emb|CDP11033.1|  unnamed protein product                                208   4e-56   
gb|KEH19860.1|  LRR receptor-like kinase family protein                 193   6e-56   
emb|CDP12430.1|  unnamed protein product                                207   7e-56   
ref|XP_008343375.1|  PREDICTED: probable LRR receptor-like serine...    207   9e-56   
emb|CDP21987.1|  unnamed protein product                                202   9e-56   
emb|CDP22133.1|  unnamed protein product                                197   1e-55   
gb|KDO49786.1|  hypothetical protein CISIN_1g001710mg                   206   2e-55   
ref|XP_011030944.1|  PREDICTED: probable LRR receptor-like serine...    196   2e-55   
emb|CDP17635.1|  unnamed protein product                                206   2e-55   
ref|XP_002527075.1|  serine-threonine protein kinase, plant-type,...    206   3e-55   
gb|KEH36626.1|  LRR receptor-like kinase                                206   3e-55   
ref|XP_009765417.1|  PREDICTED: LRR receptor-like serine/threonin...    206   3e-55   
gb|KDO47795.1|  hypothetical protein CISIN_1g011044mg                   199   4e-55   
gb|EYU38097.1|  hypothetical protein MIMGU_mgv1a019608mg                201   4e-55   
ref|XP_008443430.1|  PREDICTED: probable LRR receptor-like serine...    206   4e-55   
emb|CDP08219.1|  unnamed protein product                                203   6e-55   
ref|XP_006367139.1|  PREDICTED: probable leucine-rich repeat rece...    197   6e-55   
emb|CDP22075.1|  unnamed protein product                                193   1e-54   
emb|CDO96774.1|  unnamed protein product                                202   1e-54   
gb|KEH36629.1|  LRR receptor-like kinase                                195   2e-54   
ref|XP_007022966.1|  Leucine-rich repeat protein kinase family pr...    204   2e-54   
ref|XP_008231611.1|  PREDICTED: probable LRR receptor-like serine...    204   2e-54   
gb|KEH16905.1|  LRR receptor-like kinase family protein                 189   2e-54   
ref|XP_009761465.1|  PREDICTED: LRR receptor-like serine/threonin...    195   2e-54   
gb|KDO39505.1|  hypothetical protein CISIN_1g037331mg                   192   3e-54   
ref|XP_006436344.1|  hypothetical protein CICLE_v100305551mg            192   3e-54   
ref|XP_009604041.1|  PREDICTED: probable LRR receptor-like serine...    202   3e-54   
ref|XP_006358151.1|  PREDICTED: LRR receptor-like serine/threonin...    200   4e-54   
ref|XP_006353574.1|  PREDICTED: LRR receptor-like serine/threonin...    201   4e-54   
emb|CBI22001.3|  unnamed protein product                                201   5e-54   
ref|XP_007221162.1|  hypothetical protein PRUPE_ppa020518mg             189   6e-54   
ref|XP_002323215.1|  hypothetical protein POPTR_0016s02970g             201   6e-54   
ref|XP_009604040.1|  PREDICTED: probable LRR receptor-like serine...    202   6e-54   
ref|XP_010654174.1|  PREDICTED: putative receptor-like protein ki...    201   8e-54   
ref|XP_006431452.1|  hypothetical protein CICLE_v10003919mg             201   9e-54   
ref|XP_010268540.1|  PREDICTED: probable LRR receptor-like serine...    203   9e-54   
emb|CAN83822.1|  hypothetical protein VITISV_030954                     203   1e-53   
ref|XP_010647269.1|  PREDICTED: probable LRR receptor-like serine...    201   1e-53   
ref|XP_003623235.1|  Receptor kinase-like protein                       201   1e-53   
gb|KCW82356.1|  hypothetical protein EUGRSUZ_C03760                     201   1e-53   
gb|KCW82349.1|  hypothetical protein EUGRSUZ_C03754                     200   1e-53   
gb|KEH19908.1|  LRR receptor-like kinase family protein                 187   2e-53   
ref|XP_010656926.1|  PREDICTED: probable LRR receptor-like serine...    201   2e-53   
gb|KEH19876.1|  LRR receptor-like kinase family protein                 187   2e-53   
gb|EYU38401.1|  hypothetical protein MIMGU_mgv1a027048mg                194   2e-53   
ref|XP_007021859.1|  Leucine-rich repeat protein kinase family pr...    188   3e-53   
gb|KDO77404.1|  hypothetical protein CISIN_1g039290mg                   200   3e-53   
ref|XP_006494359.1|  PREDICTED: LRR receptor-like serine/threonin...    200   3e-53   
gb|KEH19870.1|  LRR receptor-like kinase family protein                 188   3e-53   
emb|CBI22000.3|  unnamed protein product                                198   3e-53   
ref|XP_006494358.1|  PREDICTED: LRR receptor-like serine/threonin...    200   3e-53   
gb|AFK35762.1|  unknown                                                 187   4e-53   
ref|XP_007224579.1|  hypothetical protein PRUPE_ppa1027223mg            200   4e-53   
ref|XP_006358148.1|  PREDICTED: probable LRR receptor-like serine...    198   4e-53   
gb|AFK43911.1|  unknown                                                 186   5e-53   
ref|XP_009629750.1|  PREDICTED: receptor-like protein 12 isoform X2     191   5e-53   
gb|KDP42121.1|  hypothetical protein JCGZ_01909                         197   5e-53   
ref|XP_006442554.1|  hypothetical protein CICLE_v10018659mg             199   6e-53   
gb|KDO37318.1|  hypothetical protein CISIN_1g0365931mg                  191   6e-53   
gb|KCW80922.1|  hypothetical protein EUGRSUZ_C02282                     199   7e-53   
ref|XP_003636112.1|  LRR receptor-like serine/threonine-protein k...    186   9e-53   
ref|XP_008352360.1|  PREDICTED: LRR receptor-like serine/threonin...    185   9e-53   
emb|CDP08525.1|  unnamed protein product                                197   1e-52   
ref|XP_006442591.1|  hypothetical protein CICLE_v10024001mg             195   1e-52   
ref|XP_007021743.1|  Leucine-rich repeat protein kinase family pr...    198   1e-52   
ref|XP_006410453.1|  hypothetical protein EUTSA_v10016163mg             198   2e-52   
ref|XP_009770228.1|  PREDICTED: LRR receptor-like serine/threonin...    189   2e-52   
ref|XP_007099725.1|  Serine-threonine protein kinase                    186   3e-52   
ref|XP_009629749.1|  PREDICTED: LRR receptor-like serine/threonin...    191   3e-52   
gb|KCW82344.1|  hypothetical protein EUGRSUZ_C03748                     196   3e-52   
gb|KCW82341.1|  hypothetical protein EUGRSUZ_C03742                     197   4e-52   
gb|KDO75298.1|  hypothetical protein CISIN_1g047591mg                   198   4e-52   
gb|KEH19894.1|  LRR receptor-like kinase                                184   5e-52   
ref|XP_006350918.1|  PREDICTED: putative receptor-like protein ki...    196   6e-52   
gb|EYU38400.1|  hypothetical protein MIMGU_mgv1a023263mg                193   7e-52   
emb|CDP11031.1|  unnamed protein product                                188   7e-52   
ref|XP_004242063.1|  PREDICTED: putative receptor-like protein ki...    196   1e-51   
ref|XP_009629804.1|  PREDICTED: probable LRR receptor-like serine...    196   1e-51   
gb|KEH41733.1|  LRR receptor-like kinase family protein                 182   1e-51   
gb|KDP42118.1|  hypothetical protein JCGZ_01906                         193   1e-51   
ref|XP_007022611.1|  Leucine-rich repeat protein kinase family pr...    184   1e-51   
gb|EYU40944.1|  hypothetical protein MIMGU_mgv1a022927mg                195   1e-51   
emb|CBI22003.3|  unnamed protein product                                194   4e-51   
gb|EYU22113.1|  hypothetical protein MIMGU_mgv1a021589mg                192   4e-51   
ref|XP_002449087.1|  hypothetical protein SORBIDRAFT_05g004560          193   4e-51   
emb|CDX72123.1|  BnaC08g27510D                                          193   4e-51   
ref|XP_010034803.1|  PREDICTED: probable LRR receptor-like serine...    193   5e-51   
gb|KEH19597.1|  LRR receptor-like kinase                                181   5e-51   
ref|XP_006468289.1|  PREDICTED: LRR receptor-like serine/threonin...    182   6e-51   
ref|XP_009588917.1|  PREDICTED: putative receptor-like protein ki...    193   8e-51   
ref|XP_010030716.1|  PREDICTED: LRR receptor-like serine/threonin...    193   9e-51   
ref|XP_009766972.1|  PREDICTED: LRR receptor-like serine/threonin...    181   1e-50   
gb|KEH19878.1|  LRR receptor-like kinase                                180   1e-50   
emb|CBI22006.3|  unnamed protein product                                194   1e-50   
gb|KEH19869.1|  LRR receptor-like kinase                                180   1e-50   
ref|XP_010033733.1|  PREDICTED: probable LRR receptor-like serine...    192   1e-50   
gb|KDO48780.1|  hypothetical protein CISIN_1g045729mg                   179   1e-50   
emb|CBI31011.3|  unnamed protein product                                193   2e-50   
ref|XP_010664964.1|  PREDICTED: probable LRR receptor-like serine...    192   2e-50   
ref|NP_001068499.2|  Os11g0692500                                       192   2e-50   
ref|XP_006293587.1|  hypothetical protein CARUB_v10022534mg             192   2e-50   
ref|XP_007136457.1|  hypothetical protein PHAVU_009G046900g             191   3e-50   
ref|XP_009618499.1|  PREDICTED: probable LRR receptor-like serine...    192   3e-50   
ref|XP_007019775.1|  Receptor like protein 33                           179   3e-50   
ref|XP_009612225.1|  PREDICTED: probable LRR receptor-like serine...    191   4e-50   
ref|XP_010096917.1|  putative leucine-rich repeat receptor-like p...    191   4e-50   
ref|XP_009786457.1|  PREDICTED: probable LRR receptor-like serine...    191   4e-50   
emb|CDP21317.1|  unnamed protein product                                179   5e-50   
ref|XP_009775496.1|  PREDICTED: putative receptor-like protein ki...    191   5e-50   
ref|XP_009786455.1|  PREDICTED: LRR receptor-like serine/threonin...    191   5e-50   
ref|XP_011041412.1|  PREDICTED: probable LRR receptor-like serine...    190   5e-50   
ref|XP_004293509.1|  PREDICTED: LRR receptor-like serine/threonin...    191   6e-50   
ref|XP_006442557.1|  hypothetical protein CICLE_v10024078mg             179   7e-50   
ref|XP_009604303.1|  PREDICTED: LRR receptor-like serine/threonin...    179   7e-50   
ref|XP_006279948.1|  hypothetical protein CARUB_v10025818mg             190   7e-50   
emb|CAN69907.1|  hypothetical protein VITISV_011744                     190   7e-50   
ref|XP_008804749.1|  PREDICTED: probable leucine-rich repeat rece...    190   8e-50   
ref|XP_004235483.1|  PREDICTED: putative receptor-like protein ki...    190   8e-50   
ref|XP_010484821.1|  PREDICTED: putative receptor-like protein ki...    186   9e-50   
ref|XP_010050956.1|  PREDICTED: probable LRR receptor-like serine...    190   9e-50   
ref|XP_007018575.1|  Serine-threonine protein kinase, plant-type,...    190   1e-49   
gb|EYU36356.1|  hypothetical protein MIMGU_mgv1a018150mg                188   1e-49   
ref|XP_004234341.1|  PREDICTED: putative receptor-like protein ki...    189   2e-49   
emb|CBI19443.3|  unnamed protein product                                188   2e-49   
tpg|DAA53431.1|  TPA: putative leucine-rich repeat receptor-like ...    188   2e-49   
ref|XP_010030438.1|  PREDICTED: probable LRR receptor-like serine...    187   2e-49   
emb|CDY26403.1|  BnaA02g23670D                                          187   2e-49   
ref|XP_006436350.1|  hypothetical protein CICLE_v10033735mg             184   2e-49   
emb|CBI36453.3|  unnamed protein product                                187   2e-49   
gb|ABR18395.1|  unknown                                                 185   2e-49   
ref|XP_006450886.1|  hypothetical protein CICLE_v10009201mg             178   2e-49   
emb|CDP19861.1|  unnamed protein product                                187   3e-49   
ref|XP_010446261.1|  PREDICTED: probable leucine-rich repeat rece...    189   3e-49   
ref|XP_002864877.1|  hypothetical protein ARALYDRAFT_496585             189   3e-49   
ref|XP_010262819.1|  PREDICTED: putative receptor-like protein ki...    187   5e-49   
ref|XP_011078629.1|  PREDICTED: LRR receptor-like serine/threonin...    188   5e-49   
gb|KCW54526.1|  hypothetical protein EUGRSUZ_I00479                     187   5e-49   
ref|XP_006351028.1|  PREDICTED: probable LRR receptor-like serine...    187   6e-49   
ref|XP_009123620.1|  PREDICTED: putative receptor-like protein ki...    187   7e-49   
emb|CDX71117.1|  BnaC03g12010D                                          189   7e-49   
ref|XP_002877365.1|  predicted protein                                  187   7e-49   
emb|CDP20097.1|  unnamed protein product                                181   7e-49   
ref|XP_010042875.1|  PREDICTED: probable LRR receptor-like serine...    177   7e-49   
ref|XP_009765007.1|  PREDICTED: LRR receptor-like serine/threonin...    187   1e-48   
ref|XP_002881266.1|  hypothetical protein ARALYDRAFT_482252             187   1e-48   
ref|XP_006404361.1|  hypothetical protein EUTSA_v10010090mg             187   1e-48   
emb|CDY67983.1|  BnaA09g53520D                                          186   1e-48   
gb|KDO80192.1|  hypothetical protein CISIN_1g036959mg                   175   1e-48   
ref|XP_010656820.1|  PREDICTED: probable LRR receptor-like serine...    186   2e-48   
ref|XP_009774605.1|  PREDICTED: LRR receptor-like serine/threonin...    187   2e-48   
ref|XP_007214468.1|  hypothetical protein PRUPE_ppa023770mg             177   2e-48   
gb|EEE69278.1|  hypothetical protein OsJ_28546                          186   2e-48   
ref|XP_006290635.1|  hypothetical protein CARUB_v10016726mg             184   2e-48   
ref|XP_002311912.2|  leucine-rich repeat transmembrane protein ki...    186   2e-48   
emb|CDY18490.1|  BnaA01g27050D                                          185   2e-48   
ref|XP_009765005.1|  PREDICTED: putative receptor-like protein ki...    186   2e-48   
ref|XP_002883863.1|  predicted protein                                  186   2e-48   
emb|CDY36706.1|  BnaC02g31270D                                          185   2e-48   
ref|XP_006431447.1|  hypothetical protein CICLE_v10003269mg             173   2e-48   
ref|XP_011035450.1|  PREDICTED: LRR receptor-like serine/threonin...    186   2e-48   
ref|XP_010484156.1|  PREDICTED: probable leucine-rich repeat rece...    186   3e-48   
gb|KDO46289.1|  hypothetical protein CISIN_1g001434mg                   186   3e-48   
ref|XP_009605331.1|  PREDICTED: LRR receptor-like serine/threonin...    185   3e-48   
gb|KDP46931.1|  hypothetical protein JCGZ_08919                         184   3e-48   



>ref|XP_011078428.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1153

 Score =   303 bits (775),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 221/308 (72%), Gaps = 1/308 (0%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFN  804
            A TNITTD+ ALL+LKS+++ DP  IL+ NWS +S + C+WIGVTC SRH RV+AL++  
Sbjct  2    ALTNITTDESALLALKSRLAIDPSHILSRNWS-DSTSVCSWIGVTCGSRHQRVTALDIST  60

Query  803  MGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
            MGL G L PD+GNL+FLVSLNLS N+FH S P+EL+QLRRL+++   FNDF G++PSWFG
Sbjct  61   MGLAGNLPPDMGNLTFLVSLNLSSNSFHGSLPQELAQLRRLEVIDFRFNDFGGDVPSWFG  120

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
             L  L+FL L NN+ SGF PTS+ N+SKLE+L L  NSL+G IP EIGNL  LK L+L  
Sbjct  121  FLGELQFLNLRNNSFSGFGPTSIANMSKLEMLDLSYNSLQGKIPDEIGNLHNLKRLSLQF  180

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N F G  P  I N+S LE+L+L+ NSL G+L  DL   LP+L    + SN+  G+IPS++
Sbjct  181  NKFDGLIPTTIFNISSLESLALTGNSLSGDLQGDLCGSLPRLIELYLSSNELDGQIPSNI  240

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
            S+CS L+ LSL  N FSG VP   GNLT LE L+L SN LTG IP E+G L +L  + + 
Sbjct  241  SQCSQLRLLSLSHNKFSGSVPSGIGNLTALEILYLGSNDLTGQIPEELGDLRNLKELGMG  300

Query  83   NNKLYGTF  60
            +N L G+ 
Sbjct  301  DNFLKGSI  308


 Score =   147 bits (371),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 139/257 (54%), Gaps = 25/257 (10%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            + +L L    L G+L  DL G+L  L+ L LS N      P  +SQ  +L++L  S N F
Sbjct  197  LESLALTGNSLSGDLQGDLCGSLPRLIELYLSSNELDGQIPSNISQCSQLRLLSLSHNKF  256

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
            SG++PS  G L  L  LYLG+N+++G +P  L +L  L+ L +G N L+GSIP  I N+ 
Sbjct  257  SGSVPSGIGNLTALEILYLGSNDLTGQIPEELGDLRNLKELGMGDNFLKGSIPSTIFNIS  316

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
             L+ +N+++ + +G+                        LP D+ +   +LQ      N+
Sbjct  317  SLQYINIANCNLTGA------------------------LPADMCSGSSRLQEVFFHVNE  352

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
              GE+P  + +CS LQT SL +NN +G +PR  GNLT L+  ++  N L G IP+EIG L
Sbjct  353  LVGELPERIGECSALQTWSLSYNNITGVIPRGVGNLTMLQNFYVGYNNLIGTIPKEIGNL  412

Query  110  SSLLIVDLSNNKLYGTF  60
             SL ++ L  N L G+ 
Sbjct  413  QSLQVLYLGVNNLRGSI  429


 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 143/281 (51%), Gaps = 27/281 (10%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            R+  L L +  L G++  ++   S L  L+LS N F  S P  +  L  L+IL    ND 
Sbjct  221  RLIELYLSSNELDGQIPSNISQCSQLRLLSLSHNKFSGSVPSGIGNLTALEILYLGSNDL  280

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG----------------  519
            +G IP   G L+NL+ L +G+N + G +P+++FN+S L+ +++                 
Sbjct  281  TGQIPEELGDLRNLKELGMGDNFLKGSIPSTIFNISSLQYINIANCNLTGALPADMCSGS  340

Query  518  ---------VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvns  366
                     VN L G +P  IG    L+  +LS N+ +G  P  + NL+ L+N  +  N+
Sbjct  341  SRLQEVFFHVNELVGELPERIGECSALQTWSLSYNNITGVIPRGVGNLTMLQNFYVGYNN  400

Query  365  LFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGN  186
            L G +P ++GN L  LQ+  +  N   G IP+ +   S LQ++++  N  SG +P  FG+
Sbjct  401  LIGTIPKEIGN-LQSLQVLYLGVNNLRGSIPTEIFNISTLQSITVLMNQLSGQLPSNFGH  459

Query  185  -LTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             L  +E+++L  N L+G IP  I   S L I+  S N   G
Sbjct  460  GLPNIEEIYLNDNNLSGEIPDSIANSSKLTIISFSGNNFTG  500


 Score =   111 bits (278),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 140/257 (54%), Gaps = 8/257 (3%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            LVGEL   +G  S L + +LS NN     PR +  L  L+     +N+  G IP   G L
Sbjct  353  LVGELPERIGECSALQTWSLSYNNITGVIPRGVGNLTMLQNFYVGYNNLIGTIPKEIGNL  412

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN-LFQLKLLNLSDN  441
            Q+L+ LYLG NN+ G +PT +FN+S L+ + + +N L G +P   G+ L  ++ + L+DN
Sbjct  413  QSLQVLYLGVNNLRGSIPTEIFNISTLQSITVLMNQLSGQLPSNFGHGLPNIEEIYLNDN  472

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF---SGEIP-  273
            + SG  P  I N SKL  +S S N+  G +P  LG  L  LQ   +  N F   S E+  
Sbjct  473  NLSGEIPDSIANSSKLTIISFSGNNFTGLVPNSLG-ELSFLQDIYLGENSFVSKSSELSF  531

Query  272  -SSLSKCSLLQTLSLPFNNFSGHVPREFGNLT-KLEKLFLRSNQLTGAIPREIGALSSLL  99
              SL+ C  L+ LSL  N F+  +P   GNL+  LE  +  +  L G+IP E G L++L 
Sbjct  532  IRSLTNCRHLRRLSLGDNLFNSILPVSVGNLSNSLEYFYGYNCGLYGSIPDEFGNLTNLF  591

Query  98   IVDLSNNKLYGTFIQNL  48
            ++ L  N+L G+  + L
Sbjct  592  LLSLYGNQLTGSIPKTL  608


 Score = 98.6 bits (244),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 87/273 (32%), Positives = 129/273 (47%), Gaps = 32/273 (12%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG-L  621
            L+G +  ++GNL  L  L L  NN   S P E+  +  L+ +    N  SG +PS FG  
Sbjct  401  LIGTIPKEIGNLQSLQVLYLGVNNLRGSIPTEIFNISTLQSITVLMNQLSGQLPSNFGHG  460

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG-------------  480
            L N+  +YL +NN+SG +P S+ N SKL ++    N+  G +P  +G             
Sbjct  461  LPNIEEIYLNDNNLSGEIPDSIANSSKLTIISFSGNNFTGLVPNSLGELSFLQDIYLGEN  520

Query  479  ----------------NLFQLKLLNLSDNHFSGSFPLDIlnlsklenl-slsvnsLFGEL  351
                            N   L+ L+L DN F+   P+ + NLS            L+G +
Sbjct  521  SFVSKSSELSFIRSLTNCRHLRRLSLGDNLFNSILPVSVGNLSNSLEYFYGYNCGLYGSI  580

Query  350  PLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLE  171
            P + GN L  L +  +  N+ +G IP +L     LQ L+L  N  SG +P +   L  L 
Sbjct  581  PDEFGN-LTNLFLLSLYGNQLTGSIPKTLVNLQKLQGLALMRNRISGPIPEDLCGLQNLN  639

Query  170  KLFLRSNQLTGAIPREIGALSSLLIVDLSNNKL  72
             L L  NQ++GAIP  IG L++L  + + NN L
Sbjct  640  GLLLHQNQISGAIPDCIGNLTALRSLYIGNNNL  672


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 102/292 (35%), Positives = 140/292 (48%), Gaps = 9/292 (3%)
 Frame = -1

Query  932  KISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSAL--NLFNMGLVGELTPDLGNLS  759
            ++SF     L +N  V+  +  ++I    N RH R  +L  NLFN      L   +GNLS
Sbjct  508  ELSFLQDIYLGENSFVSKSSELSFIRSLTNCRHLRRLSLGDNLFN----SILPVSVGNLS  563

Query  758  FLVSLNLSQN-NFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNN  582
              +      N   + S P E   L  L +L    N  +G+IP     LQ L+ L L  N 
Sbjct  564  NSLEYFYGYNCGLYGSIPDEFGNLTNLFLLSLYGNQLTGSIPKTLVNLQKLQGLALMRNR  623

Query  581  ISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnl  402
            ISG +P  L  L  L  L L  N + G+IP  IGNL  L+ L + +N+ S   P  +  L
Sbjct  624  ISGPIPEDLCGLQNLNGLLLHQNQISGAIPDCIGNLTALRSLYIGNNNLSSVSP-SLWRL  682

Query  401  sklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFN  222
            + L  L+L+ N L G L  D+GN L    +  +  N+FSG IP S+     L  LSL  N
Sbjct  683  NDLLQLNLTSNVLVGSLSPDIGN-LKTATVLDLSMNQFSGTIPPSVGDMHDLINLSLAHN  741

Query  221  NFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             F G +P   G L  L +L L  N L+G IPR +  +  L   ++S N L G
Sbjct  742  KFEGSIPESIGQLVNLAELDLSHNNLSGNIPRSLERILYLTYFNVSFNDLSG  793


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 97/288 (34%), Positives = 136/288 (47%), Gaps = 33/288 (11%)
 Frame = -1

Query  785  LTPD-LGNLSFLVSLNLSQNNFHN-----SFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
            L P+ LG LSFL  + L +N+F +     SF R L+  R L+ L    N F+  +P   G
Sbjct  501  LVPNSLGELSFLQDIYLGENSFVSKSSELSFIRSLTNCRHLRRLSLGDNLFNSILPVSVG  560

Query  623  LLQN-LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
             L N L + Y  N  + G +P    NL+ L +L L  N L GSIP+ + NL +L+ L L 
Sbjct  561  NLSNSLEYFYGYNCGLYGSIPDEFGNLTNLFLLSLYGNQLTGSIPKTLVNLQKLQGLALM  620

Query  446  DNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSS  267
             N  SG  P D+  L  L  L L  N + G +P  +GN L  L+   + +N  S   PS 
Sbjct  621  RNRISGPIPEDLCGLQNLNGLLLHQNQISGAIPDCIGN-LTALRSLYIGNNNLSSVSPSL  679

Query  266  LSKCSLLQ-----------------------TLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
                 LLQ                        L L  N FSG +P   G++  L  L L 
Sbjct  680  WRLNDLLQLNLTSNVLVGSLSPDIGNLKTATVLDLSMNQFSGTIPPSVGDMHDLINLSLA  739

Query  155  SNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDTP*LK*LSYYN  12
             N+  G+IP  IG L +L  +DLS+N L G   ++L+   +  L+Y+N
Sbjct  740  HNKFEGSIPESIGQLVNLAELDLSHNNLSGNIPRSLER--ILYLTYFN  785


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 90/252 (36%), Positives = 126/252 (50%), Gaps = 8/252 (3%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIP--SWFG  624
            L GE+   + N S L  ++ S NNF    P  L +L  L+ +    N F       S+  
Sbjct  474  LSGEIPDSIANSSKLTIISFSGNNFTGLVPNSLGELSFLQDIYLGENSFVSKSSELSFIR  533

Query  623  LLQN---LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVN-SLEGSIPREIGNLFQLKLL  456
             L N   LR L LG+N  +  LP S+ NLS       G N  L GSIP E GNL  L LL
Sbjct  534  SLTNCRHLRRLSLGDNLFNSILPVSVGNLSNSLEYFYGYNCGLYGSIPDEFGNLTNLFLL  593

Query  455  NLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEI  276
            +L  N  +GS P  ++NL KL+ L+L  N + G +P DL      L   ++  N+ SG I
Sbjct  594  SLYGNQLTGSIPKTLVNLQKLQGLALMRNRISGPIPEDLCGLQ-NLNGLLLHQNQISGAI  652

Query  275  PSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLI  96
            P  +   + L++L +  NN S   P  +  L  L +L L SN L G++  +IG L +  +
Sbjct  653  PDCIGNLTALRSLYIGNNNLSSVSPSLW-RLNDLLQLNLTSNVLVGSLSPDIGNLKTATV  711

Query  95   VDLSNNKLYGTF  60
            +DLS N+  GT 
Sbjct  712  LDLSMNQFSGTI  723


 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 73/141 (52%), Gaps = 7/141 (5%)
 Frame = -1

Query  914  HSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLS  735
             S+   N +++S++P  W       R N +  LNL +  LVG L+PD+GNL     L+LS
Sbjct  663  RSLYIGNNNLSSVSPSLW-------RLNDLLQLNLTSNVLVGSLSPDIGNLKTATVLDLS  715

Query  734  QNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSL  555
             N F  + P  +  +  L  L  + N F G+IP   G L NL  L L +NN+SG +P SL
Sbjct  716  MNQFSGTIPPSVGDMHDLINLSLAHNKFEGSIPESIGQLVNLAELDLSHNNLSGNIPRSL  775

Query  554  FNLSKLEVLHLGVNSLEGSIP  492
              +  L   ++  N L G IP
Sbjct  776  ERILYLTYFNVSFNDLSGEIP  796


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = -1

Query  785  LTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLR  606
            ++P L  L+ L+ LNL+ N    S   ++  L+   +L  S N FSG IP   G + +L 
Sbjct  675  VSPSLWRLNDLLQLNLTSNVLVGSLSPDIGNLKTATVLDLSMNQFSGTIPPSVGDMHDLI  734

Query  605  FLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGS  426
             L L +N   G +P S+  L  L  L L  N+L G+IPR +  +  L   N+S N  SG 
Sbjct  735  NLSLAHNKFEGSIPESIGQLVNLAELDLSHNNLSGNIPRSLERILYLTYFNVSFNDLSGE  794

Query  425  FP  420
             P
Sbjct  795  IP  796



>ref|XP_011078427.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Sesamum indicum]
Length=1021

 Score =   298 bits (764),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 220/308 (71%), Gaps = 1/308 (0%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFN  804
            A TNITTD+ ALL+LKS+++ DP  IL+ NWS +S + C+WIGVTC SRH RV+AL++  
Sbjct  2    ALTNITTDESALLALKSRLAIDPSHILSRNWS-DSTSVCSWIGVTCGSRHQRVTALDIST  60

Query  803  MGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
            MGL G L PD+GNLS ++SLNLS N+FH S P+EL+QLRRL+++   FNDF G++PSWFG
Sbjct  61   MGLAGNLPPDMGNLSCVMSLNLSSNSFHGSLPQELAQLRRLEVIDFRFNDFGGDVPSWFG  120

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
             L  L+FL L NN+ SGF PTS+ N+SKLE+L L  NSL+G IP EIGNL  LK L+L  
Sbjct  121  FLGELQFLNLRNNSFSGFGPTSIANMSKLEMLDLSYNSLQGKIPDEIGNLHNLKRLSLQF  180

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N F G  P  I N+S LE+L+L+ NSL G+L  DL   LP+L    + SN+  G+IPS++
Sbjct  181  NKFDGLIPTTIFNISSLESLALTGNSLSGDLQGDLCRSLPRLNELYLSSNELDGQIPSNI  240

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
            S+CS L+ LSL  N FSG VP   GNLT LE L+L SN LTG IP E+G L +L  + + 
Sbjct  241  SQCSQLRLLSLSHNKFSGSVPSGIGNLTALEILYLGSNDLTGQIPEELGDLRNLKELGMG  300

Query  83   NNKLYGTF  60
            +N L G+ 
Sbjct  301  DNFLKGSI  308


 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 136/257 (53%), Gaps = 25/257 (10%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            + +L L    L G+L  DL  +L  L  L LS N      P  +SQ  +L++L  S N F
Sbjct  197  LESLALTGNSLSGDLQGDLCRSLPRLNELYLSSNELDGQIPSNISQCSQLRLLSLSHNKF  256

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
            SG++PS  G L  L  LYLG+N+++G +P  L +L  L+ L +G N L+GSIP  I N+ 
Sbjct  257  SGSVPSGIGNLTALEILYLGSNDLTGQIPEELGDLRNLKELGMGDNFLKGSIPSTIFNIS  316

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
             L+ +N+++ + +G+                        LP D+ +   +LQ      N+
Sbjct  317  SLQYINIANCNLTGA------------------------LPADMCSGSSRLQEVFFHVNE  352

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
              GE+P  + +CS LQ  SL +NN +G +PR  GNLT L+  ++  N L G IP+EIG L
Sbjct  353  LVGELPERIGECSALQMWSLSYNNITGVIPRGVGNLTMLQNFYVGYNNLIGTIPKEIGNL  412

Query  110  SSLLIVDLSNNKLYGTF  60
             SL ++ L  N L GT 
Sbjct  413  QSLEVLYLGVNNLMGTI  429


 Score =   120 bits (302),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 89/281 (32%), Positives = 147/281 (52%), Gaps = 27/281 (10%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            R++ L L +  L G++  ++   S L  L+LS N F  S P  +  L  L+IL    ND 
Sbjct  221  RLNELYLSSNELDGQIPSNISQCSQLRLLSLSHNKFSGSVPSGIGNLTALEILYLGSNDL  280

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG----------------  519
            +G IP   G L+NL+ L +G+N + G +P+++FN+S L+ +++                 
Sbjct  281  TGQIPEELGDLRNLKELGMGDNFLKGSIPSTIFNISSLQYINIANCNLTGALPADMCSGS  340

Query  518  ---------VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvns  366
                     VN L G +P  IG    L++ +LS N+ +G  P  + NL+ L+N  +  N+
Sbjct  341  SRLQEVFFHVNELVGELPERIGECSALQMWSLSYNNITGVIPRGVGNLTMLQNFYVGYNN  400

Query  365  LFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGN  186
            L G +P ++GN L  L++  +  N   G IP+ +   S LQ++S+  N  SG +P  FG+
Sbjct  401  LIGTIPKEIGN-LQSLEVLYLGVNNLMGTIPTEIFNISTLQSISVSMNQLSGQLPSNFGH  459

Query  185  -LTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             L  +E+L+L +N L+G IP  I   S L +++ + N   G
Sbjct  460  GLPNIEELYLNNNNLSGEIPDSISNSSKLTVINFAGNNFTG  500


 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 141/281 (50%), Gaps = 32/281 (11%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            LVGEL   +G  S L   +LS NN     PR +  L  L+     +N+  G IP   G L
Sbjct  353  LVGELPERIGECSALQMWSLSYNNITGVIPRGVGNLTMLQNFYVGYNNLIGTIPKEIGNL  412

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN-LFQLKLLNLSDN  441
            Q+L  LYLG NN+ G +PT +FN+S L+ + + +N L G +P   G+ L  ++ L L++N
Sbjct  413  QSLEVLYLGVNNLMGTIPTEIFNISTLQSISVSMNQLSGQLPSNFGHGLPNIEELYLNNN  472

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF---SGEIP-  273
            + SG  P  I N SKL  ++ + N+  G +P  LG  L  LQ   +  N F   S E+  
Sbjct  473  NLSGEIPDSISNSSKLTVINFAGNNFTGLVPNSLG-ELSFLQDMNLGENSFVSKSSELNF  531

Query  272  -SSLSKCSLLQTLSLPFNNFS-------------------------GHVPREFGNLTKLE  171
             SSL+ C  L+ LSL  N FS                         G +P EFGNLT L 
Sbjct  532  ISSLTNCRHLRKLSLGDNLFSSILPVSVGNLSNSLEYFYGYNCGLYGSIPDEFGNLTNLF  591

Query  170  KLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             L L  NQLTG+IP+ +  L  L  + L  N++ G   +NL
Sbjct  592  LLSLYGNQLTGSIPKALVNLQKLQGLALMRNRISGPIPENL  632


 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 98/315 (31%), Positives = 135/315 (43%), Gaps = 72/315 (23%)
 Frame = -1

Query  932  KISFDPHSILADNWSVNSITPCNWIGVTCNSRHNR--------------VSALNL-----  810
            ++SF     L +N  V+  +  N+I    N RH R              VS  NL     
Sbjct  508  ELSFLQDMNLGENSFVSKSSELNFISSLTNCRHLRKLSLGDNLFSSILPVSVGNLSNSLE  567

Query  809  ----FNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ---------  669
                +N GL G +  + GNL+ L  L+L  N    S P+ L  L++L+ L          
Sbjct  568  YFYGYNCGLYGSIPDEFGNLTNLFLLSLYGNQLTGSIPKALVNLQKLQGLALMRNRISGP  627

Query  668  -----CSF----------NDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLE  534
                 C            N  SG IP   G L  LR LY+GNNN+S  +P SL+ L+ L 
Sbjct  628  IPENLCGLQNLNGLLLYQNQISGAIPDCIGNLTALRSLYIGNNNLSSGIPPSLWRLNDLL  687

Query  533  VLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGE  354
             L+L  N L GS+  +IGNL    +L+LS N FSG+ P  +                 G+
Sbjct  688  QLNLTSNVLVGSLSPDIGNLKTATVLDLSMNQFSGTIPPSV-----------------GD  730

Query  353  LPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKL  174
            +  DL N         +  NKF G IP S+ +   L  L L  NN SG++PR    +  L
Sbjct  731  M-FDLIN-------LSLAHNKFEGSIPESIGQLVNLAELDLSHNNLSGNIPRSLERILYL  782

Query  173  EKLFLRSNQLTGAIP  129
                +  N L+G IP
Sbjct  783  TYFNVSFNDLSGEIP  797


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 144/307 (47%), Gaps = 33/307 (11%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNS-----FPRELSQLRRLK  678
            S  ++++ +N       G +   LG LSFL  +NL +N+F +      F   L+  R L+
Sbjct  483  SNSSKLTVINFAGNNFTGLVPNSLGELSFLQDMNLGENSFVSKSSELNFISSLTNCRHLR  542

Query  677  ILQCSFNDFSGNIPSWFGLLQN-LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEG  501
             L    N FS  +P   G L N L + Y  N  + G +P    NL+ L +L L  N L G
Sbjct  543  KLSLGDNLFSSILPVSVGNLSNSLEYFYGYNCGLYGSIPDEFGNLTNLFLLSLYGNQLTG  602

Query  500  SIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPK  321
            SIP+ + NL +L+ L L  N  SG  P ++  L  L  L L  N + G +P  +GN L  
Sbjct  603  SIPKALVNLQKLQGLALMRNRISGPIPENLCGLQNLNGLLLYQNQISGAIPDCIGN-LTA  661

Query  320  LQIFVMRSNKFSGEIPSSLSKC-SLLQ-----------------------TLSLPFNNFS  213
            L+   + +N  S  IP SL +   LLQ                        L L  N FS
Sbjct  662  LRSLYIGNNNLSSGIPPSLWRLNDLLQLNLTSNVLVGSLSPDIGNLKTATVLDLSMNQFS  721

Query  212  GHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDTP*L  33
            G +P   G++  L  L L  N+  G+IP  IG L +L  +DLS+N L G   ++L+   +
Sbjct  722  GTIPPSVGDMFDLINLSLAHNKFEGSIPESIGQLVNLAELDLSHNNLSGNIPRSLER--I  779

Query  32   K*LSYYN  12
              L+Y+N
Sbjct  780  LYLTYFN  786


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 91/262 (35%), Positives = 130/262 (50%), Gaps = 7/262 (3%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +  L L N  L GE+   + N S L  +N + NNF    P  L +L  L+ +    N F 
Sbjct  464  IEELYLNNNNLSGEIPDSISNSSKLTVINFAGNNFTGLVPNSLGELSFLQDMNLGENSFV  523

Query  647  G-----NIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVN-SLEGSIPRE  486
                  N  S     ++LR L LG+N  S  LP S+ NLS       G N  L GSIP E
Sbjct  524  SKSSELNFISSLTNCRHLRKLSLGDNLFSSILPVSVGNLSNSLEYFYGYNCGLYGSIPDE  583

Query  485  IGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
             GNL  L LL+L  N  +GS P  ++NL KL+ L+L  N + G +P +L        + +
Sbjct  584  FGNLTNLFLLSLYGNQLTGSIPKALVNLQKLQGLALMRNRISGPIPENLCGLQNLNGLLL  643

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
             + N+ SG IP  +   + L++L +  NN S  +P     L  L +L L SN L G++  
Sbjct  644  YQ-NQISGAIPDCIGNLTALRSLYIGNNNLSSGIPPSLWRLNDLLQLNLTSNVLVGSLSP  702

Query  125  EIGALSSLLIVDLSNNKLYGTF  60
            +IG L +  ++DLS N+  GT 
Sbjct  703  DIGNLKTATVLDLSMNQFSGTI  724



>ref|XP_011078429.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1216

 Score =   299 bits (766),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 170/322 (53%), Positives = 222/322 (69%), Gaps = 1/322 (0%)
 Frame = -1

Query  1025  IFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTC  846
             +  F   +      A TNITTD+ ALL+LKS+++ DP  IL+ NWS +S + C+WIGV C
Sbjct  10    VLLFTQCLTAFLAMALTNITTDETALLALKSRLAIDPSHILSRNWS-DSTSVCSWIGVMC  68

Query  845   NSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQC  666
              +RH RV+AL++  MGL G L PD+GNL+FLVSLNLS N+FH S P+EL+QLRRL+++  
Sbjct  69    GARHQRVTALDISTMGLAGNLPPDMGNLTFLVSLNLSSNSFHGSLPQELAQLRRLEVIDF  128

Query  665   SFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
              FNDF G++PSWFG L  L+FL L NN+ SGF PTS+ N+SKLE+L L  N L+G IP E
Sbjct  129   RFNDFGGDVPSWFGFLGELQFLNLRNNSFSGFGPTSIANMSKLEMLDLSYNPLQGKIPDE  188

Query  485   IGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
             IGNL  LK L+L  N F G  P  I N+S LE+L+L+ NSL G+L  DL   LP+L    
Sbjct  189   IGNLHNLKRLSLQFNKFDGLIPTTIFNISSLESLALTGNSLSGDLQGDLCRSLPRLNELY  248

Query  305   MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
             + SN+  G+IPS++S+CS L+ LSL  N FSG VP   GNLT LE L+L SN LTG IP 
Sbjct  249   LSSNELDGQIPSNISQCSQLRLLSLSHNKFSGSVPSGIGNLTALEILYLGSNDLTGQIPE  308

Query  125   EIGALSSLLIVDLSNNKLYGTF  60
             E+G L +L  + + +N L G+ 
Sbjct  309   ELGDLRNLKELGMGDNFLKGSI  330


 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 136/257 (53%), Gaps = 25/257 (10%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            + +L L    L G+L  DL  +L  L  L LS N      P  +SQ  +L++L  S N F
Sbjct  219  LESLALTGNSLSGDLQGDLCRSLPRLNELYLSSNELDGQIPSNISQCSQLRLLSLSHNKF  278

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
            SG++PS  G L  L  LYLG+N+++G +P  L +L  L+ L +G N L+GSIP  I N+ 
Sbjct  279  SGSVPSGIGNLTALEILYLGSNDLTGQIPEELGDLRNLKELGMGDNFLKGSIPSTIFNIS  338

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
             L+ +N+++ + +G+                        LP D+ +   +LQ      N+
Sbjct  339  SLQYINIANCNLTGA------------------------LPADMCSGSSRLQEVFFHVNE  374

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
              GE+P  + +CS LQ  SL +NN +G +PR  GNLT L+  ++  N L G IP+EIG L
Sbjct  375  LVGELPERIGECSALQMWSLSYNNITGVIPRGVGNLTMLQNFYVGYNNLIGTIPKEIGNL  434

Query  110  SSLLIVDLSNNKLYGTF  60
             SL ++ L  N L GT 
Sbjct  435  QSLEVLYLGVNNLMGTI  451


 Score =   120 bits (302),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 89/281 (32%), Positives = 147/281 (52%), Gaps = 27/281 (10%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            R++ L L +  L G++  ++   S L  L+LS N F  S P  +  L  L+IL    ND 
Sbjct  243  RLNELYLSSNELDGQIPSNISQCSQLRLLSLSHNKFSGSVPSGIGNLTALEILYLGSNDL  302

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG----------------  519
            +G IP   G L+NL+ L +G+N + G +P+++FN+S L+ +++                 
Sbjct  303  TGQIPEELGDLRNLKELGMGDNFLKGSIPSTIFNISSLQYINIANCNLTGALPADMCSGS  362

Query  518  ---------VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvns  366
                     VN L G +P  IG    L++ +LS N+ +G  P  + NL+ L+N  +  N+
Sbjct  363  SRLQEVFFHVNELVGELPERIGECSALQMWSLSYNNITGVIPRGVGNLTMLQNFYVGYNN  422

Query  365  LFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGN  186
            L G +P ++GN L  L++  +  N   G IP+ +   S LQ++S+  N  SG +P  FG+
Sbjct  423  LIGTIPKEIGN-LQSLEVLYLGVNNLMGTIPTEIFNISTLQSISVSMNQLSGQLPSNFGH  481

Query  185  -LTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             L  +E+L+L +N L+G IP  I   S L +++ + N   G
Sbjct  482  GLPNIEELYLNNNNLSGEIPDSISNSSKLTVINFAGNNFTG  522


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 100/282 (35%), Positives = 140/282 (50%), Gaps = 34/282 (12%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            LVGEL   +G  S L   +LS NN     PR +  L  L+     +N+  G IP   G L
Sbjct  375  LVGELPERIGECSALQMWSLSYNNITGVIPRGVGNLTMLQNFYVGYNNLIGTIPKEIGNL  434

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN-LFQLKLLNLSDN  441
            Q+L  LYLG NN+ G +PT +FN+S L+ + + +N L G +P   G+ L  ++ L L++N
Sbjct  435  QSLEVLYLGVNNLMGTIPTEIFNISTLQSISVSMNQLSGQLPSNFGHGLPNIEELYLNNN  494

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGE------  279
            + SG  P  I N SKL  ++ + N+  G +P  LG  L  LQ   +  N F  +      
Sbjct  495  NLSGEIPDSISNSSKLTVINFAGNNFTGLVPNSLG-ELSFLQDIYLGENSFVSKSLELNF  553

Query  278  IPSSLSKCSLLQTLSLPFNNFS-------------------------GHVPREFGNLTKL  174
            IP SL+ C  L+ L L  N F+                         G +P EFGNLT L
Sbjct  554  IP-SLANCRHLRRLFLGDNLFNSILPVSVGNLSNTLENFYGYNCGLYGSIPDEFGNLTNL  612

Query  173  EKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
              L L  NQLTG+IP+ +  L +L  + L  NK+ G   +NL
Sbjct  613  FLLSLFDNQLTGSIPKTLVNLQTLQGLALMRNKISGPIPENL  654


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 127/280 (45%), Gaps = 31/280 (11%)
 Frame = -1

Query  905  LADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNN  726
            L DN   NSI P     V+  +  N +     +N GL G +  + GNL+ L  L+L  N 
Sbjct  568  LGDNL-FNSILP-----VSVGNLSNTLENFYGYNCGLYGSIPDEFGNLTNLFLLSLFDNQ  621

Query  725  FHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNL  546
               S P+ L  L+ L+ L    N  SG IP     LQNL  L L  N ISG +P  + NL
Sbjct  622  LTGSIPKTLVNLQTLQGLALMRNKISGPIPENLCGLQNLNGLLLHQNQISGAIPDCIGNL  681

Query  545  SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvns  366
            + L  L++G N+L   IP  +  L  L  LNL+ N   GS                    
Sbjct  682  TALRTLYIGNNNLSSGIPPSLWRLNDLLQLNLTSNVLVGS--------------------  721

Query  365  LFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGN  186
                LP D+GN L    +  +  N+FSG IP SL     L  LSL  N F G +P   G 
Sbjct  722  ----LPPDIGN-LKTATVLDLSMNQFSGTIPPSLGDIHDLINLSLAHNKFEGSIPESIGQ  776

Query  185  LTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            L  + +L L  N L+G IPR +  +  L   ++S N L G
Sbjct  777  LVNIAELDLSHNNLSGNIPRSLERILYLTYFNVSFNDLSG  816


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 94/263 (36%), Positives = 133/263 (51%), Gaps = 9/263 (3%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +  L L N  L GE+   + N S L  +N + NNF    P  L +L  L+ +    N F 
Sbjct  486  IEELYLNNNNLSGEIPDSISNSSKLTVINFAGNNFTGLVPNSLGELSFLQDIYLGENSFV  545

Query  647  GN------IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVN-SLEGSIPR  489
                    IPS     ++LR L+LG+N  +  LP S+ NLS       G N  L GSIP 
Sbjct  546  SKSLELNFIPS-LANCRHLRRLFLGDNLFNSILPVSVGNLSNTLENFYGYNCGLYGSIPD  604

Query  488  EIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIF  309
            E GNL  L LL+L DN  +GS P  ++NL  L+ L+L  N + G +P +L      L   
Sbjct  605  EFGNLTNLFLLSLFDNQLTGSIPKTLVNLQTLQGLALMRNKISGPIPENLCGLQ-NLNGL  663

Query  308  VMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
            ++  N+ SG IP  +   + L+TL +  NN S  +P     L  L +L L SN L G++P
Sbjct  664  LLHQNQISGAIPDCIGNLTALRTLYIGNNNLSSGIPPSLWRLNDLLQLNLTSNVLVGSLP  723

Query  128  REIGALSSLLIVDLSNNKLYGTF  60
             +IG L +  ++DLS N+  GT 
Sbjct  724  PDIGNLKTATVLDLSMNQFSGTI  746



>emb|CDP21092.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 159/310 (51%), Positives = 205/310 (66%), Gaps = 1/310 (0%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            NITTD+ ALLSLK+KI++DPH ILA NWS  S + C+W GVTC SRH RV+ALN+ N+GL
Sbjct  28   NITTDQSALLSLKAKITWDPHEILASNWSATS-SVCDWRGVTCGSRHRRVTALNISNLGL  86

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             G + P LGNLSFL+SL++ +NNF+   P EL +L RL++L    N  SGNIP W G LQ
Sbjct  87   TGTIPPQLGNLSFLMSLDMRRNNFYGELPHELIRLSRLRVLSLGINRLSGNIPPWVGSLQ  146

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            +LR+  L NN+ +G++P S+ N+SKLE L+L  NSL+G+IP EIG L +LK + L  N  
Sbjct  147  DLRYFSLRNNSFTGYIPPSVSNMSKLETLNLKFNSLQGAIPMEIGKLKKLKQIVLDFNQL  206

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            SG  P  + N+S LE ++L  NSL G LP  +   L  L    +  NK SG IP SLS+C
Sbjct  207  SGFLPPGLFNISSLEAIALRSNSLSGSLPSSICPRLQGLTWLDLGFNKLSGVIPPSLSEC  266

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
            S LQ L L  NNFSG +P  FGNLT L +L L  N L G IP   G L++L+ + L +N 
Sbjct  267  SKLQVLRLFENNFSGVIPEGFGNLTALVELRLARNNLIGVIPEGFGNLTALVELGLGHND  326

Query  74   LYGTFIQNLD  45
            L GT +   D
Sbjct  327  LDGTVLTVFD  336



>emb|CDP21744.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 161/309 (52%), Positives = 202/309 (65%), Gaps = 1/309 (0%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFN  804
            A  NIT+D+ ALLSLK+KI+ DPH ILA NW   S + C+W GVTC SRH RV+ALN+ N
Sbjct  26   ATPNITSDQSALLSLKAKITGDPHEILASNWPATS-SVCDWRGVTCGSRHRRVTALNISN  84

Query  803  MGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
            +GL G + P LGNLSFL+SL++S+NNF+   P EL +L RL++L    N  SGNIPSW G
Sbjct  85   LGLTGTIPPQLGNLSFLMSLDMSRNNFYGELPHELIRLSRLRVLSLGINVLSGNIPSWVG  144

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
              Q L+   L NN+ +GF+P S+ NLSKLE L+L  NSL+G+IP EIGNL +LK + L  
Sbjct  145  SFQQLQHFSLKNNSFTGFIPPSISNLSKLETLNLQFNSLQGAIPMEIGNLNKLKQIVLDF  204

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N  SG  PL + N+S LE ++L  NSL G LP  +   L  L    +  NK SG IP SL
Sbjct  205  NQLSGFLPLGMFNISSLEVIALQNNSLSGSLPSSICPRLHGLTWLDLGRNKLSGVIPPSL  264

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
            S+CS LQ L L  N FSG +P  FGNLT L +L L  N L G IP   G L++L  + LS
Sbjct  265  SECSKLQVLGLDDNFFSGVIPEGFGNLTALVELRLARNNLIGVIPEGFGNLTALKQLYLS  324

Query  83   NNKLYGTFI  57
             N L GT +
Sbjct  325  ENNLIGTIL  333



>ref|XP_009799744.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Nicotiana sylvestris]
Length=1224

 Score =   282 bits (721),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 213/312 (68%), Gaps = 1/312 (0%)
 Frame = -1

Query  1001  LCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVS  822
             L L+  A  N+ TD+ ALL+LKS ++ D ++IL  NW+ ++ + C WIGVTC SRH RV+
Sbjct  54    LILSATAEVNLKTDEAALLALKSYLTSDTYNILTSNWT-STTSVCQWIGVTCGSRHQRVT  112

Query  821   ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
             AL++ NMGL+G + P LGNLSFLVSL++S N FH   P++LS L RL+ +  + N FSG+
Sbjct  113   ALDISNMGLIGTIPPHLGNLSFLVSLDISSNRFHGILPQDLSNLHRLEFINVTSNKFSGD  172

Query  641   IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
             IPSWF LL  L+ L+L  N+ +G +P ++FN SKLE L LGVN L+G IP EIGNL  L 
Sbjct  173   IPSWFSLLPELQHLHLAFNSFTGIIPPAIFNASKLESLVLGVNQLQGEIPNEIGNLQGLT  232

Query  461   LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
              L+L  N  +G  PL + N+S L  L L+ NSL G LP+D+ ++LP+L +  + +N+F G
Sbjct  233   WLSLGSNRLTGLVPLSLFNISSLRRLVLTNNSLSGNLPVDICSNLPELMVLALSNNEFDG  292

Query  281   EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
             +IP  + KCS LQ LSL FN F+G +PR+ GNLT +  L+L  N L G IP EIG L +L
Sbjct  293   QIPLDIDKCSNLQILSLSFNRFTGVIPRKIGNLTMISSLYLGRNDLEGEIPEEIGYLRNL  352

Query  101   LIVDLSNNKLYG  66
              I+D+ N  L G
Sbjct  353   EILDVQNCSLSG  364


 Score =   120 bits (300),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 90/258 (35%), Positives = 124/258 (48%), Gaps = 25/258 (10%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            L L N  L G L  D+  NL  L+ L LS N F    P ++ +   L+IL  SFN F+G 
Sbjct  258  LVLTNNSLSGNLPVDICSNLPELMVLALSNNEFDGQIPLDIDKCSNLQILSLSFNRFTGV  317

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IP   G L  +  LYLG N++ G +P  +  L  LE+L +   SL G +P  I N+  L+
Sbjct  318  IPRKIGNLTMISSLYLGRNDLEGEIPEEIGYLRNLEILDVQNCSLSGPLPFSISNITSLR  377

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
            LLNL  N  SGS P D+                          ++P L+ F + +N+FSG
Sbjct  378  LLNLYGNKLSGSLPPDMCL------------------------NMPDLRAFDLGNNQFSG  413

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
             IP     C+ L  L L  NN  G +P E GNL  L +L L  N LTG IP  I  +S++
Sbjct  414  TIPKEFGNCTSLSDLFLRENNLIGELPMEIGNLFNLGRLDLHYNFLTGPIPSTIFNMSNI  473

Query  101  LIVDLSNNKLYGTFIQNL  48
              +    N   G+   ++
Sbjct  474  RGISFLGNFFTGSLPADI  491


 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 89/243 (37%), Positives = 120/243 (49%), Gaps = 25/243 (10%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ---CSF------------  660
             G +   +GNL+ + SL L +N+     P E+  LR L+IL    CS             
Sbjct  315  TGVIPRKIGNLTMISSLYLGRNDLEGEIPEEIGYLRNLEILDVQNCSLSGPLPFSISNIT  374

Query  659  ---------NDFSGNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNS  510
                     N  SG++P    L + +LR   LGNN  SG +P    N + L  L L  N+
Sbjct  375  SLRLLNLYGNKLSGSLPPDMCLNMPDLRAFDLGNNQFSGTIPKEFGNCTSLSDLFLRENN  434

Query  509  LEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNH  330
            L G +P EIGNLF L  L+L  N  +G  P  I N+S +  +S   N   G LP D+G  
Sbjct  435  LIGELPMEIGNLFNLGRLDLHYNFLTGPIPSTIFNMSNIRGISFLGNFFTGSLPADIGLG  494

Query  329  LPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN  150
            LP L+   +  N  +G IP+SLS  S +  L + +NNFSG  PR FGNL +LE L +  N
Sbjct  495  LPNLEELYLGYNNLTGSIPNSLSNASNIFRLGIGYNNFSGPFPRSFGNLKRLEYLNVNDN  554

Query  149  QLT  141
              T
Sbjct  555  HFT  557


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 95/272 (35%), Positives = 146/272 (54%), Gaps = 5/272 (2%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
             L L N    G++  D+   S L  L+LS N F    PR++  L  +  L    ND  G 
Sbjct  282  VLALSNNEFDGQIPLDIDKCSNLQILSLSFNRFTGVIPRKIGNLTMISSLYLGRNDLEGE  341

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG-NLFQL  465
            IP   G L+NL  L + N ++SG LP S+ N++ L +L+L  N L GS+P ++  N+  L
Sbjct  342  IPEEIGYLRNLEILDVQNCSLSGPLPFSISNITSLRLLNLYGNKLSGSLPPDMCLNMPDL  401

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
            +  +L +N FSG+ P +  N + L +L L  N+L GELP+++GN L  L    +  N  +
Sbjct  402  RAFDLGNNQFSGTIPKEFGNCTSLSDLFLRENNLIGELPMEIGN-LFNLGRLDLHYNFLT  460

Query  284  GEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG-NLTKLEKLFLRSNQLTGAIPREIGALS  108
            G IPS++   S ++ +S   N F+G +P + G  L  LE+L+L  N LTG+IP  +   S
Sbjct  461  GPIPSTIFNMSNIRGISFLGNFFTGSLPADIGLGLPNLEELYLGYNNLTGSIPNSLSNAS  520

Query  107  SLLIVDLSNNKLYGTFIQNLDTP*LK*LSYYN  12
            ++  + +  N   G F ++     LK L Y N
Sbjct  521  NIFRLGIGYNNFSGPFPRSFGN--LKRLEYLN  550


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 127/246 (52%), Gaps = 3/246 (1%)
 Frame = -1

Query  797  LVGELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L   +GNLS  L  +  + +    S PRE+  L  L  L    N  SG IPS  G 
Sbjct  587  LDGNLPASVGNLSSSLDYVYAAYSEIRGSMPREIGYLSGLSFLFLQGNYLSGFIPSSIGN  646

Query  620  LQNLRFLYL-GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
            L+NL+ L L GN  ISG +P  L NL  L  L LG N +  SIP  +GN+  L+ + L  
Sbjct  647  LENLQALNLYGNKMISGPIPEELCNLKNLGFLSLGNNEICCSIPACLGNIKSLRYVYLDS  706

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N    S P  + NL+ L +L +S N L   LP ++GN L    +  +  N+ SG IPS++
Sbjct  707  NKLIFSIPPSLWNLNDLLHLDVSSNFLESSLPPEIGN-LKVATLLNVSKNQISGIIPSTI  765

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
                 +  LS   N   G +P   GN+  LE L L  N+L+G IP+ +  LS L  +++S
Sbjct  766  GAMQNMAELSFAENRLEGPIPESLGNMVALESLDLSHNKLSGGIPKSLVGLSHLNYLNVS  825

Query  83   NNKLYG  66
             N+L G
Sbjct  826  YNRLSG  831


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 119/234 (51%), Gaps = 6/234 (3%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNF-HNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G +   +GNL  L +LNL  N       P EL  L+ L  L    N+   +IP+  G 
Sbjct  636  LSGFIPSSIGNLENLQALNLYGNKMISGPIPEELCNLKNLGFLSLGNNEICCSIPACLGN  695

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            +++LR++YL +N +   +P SL+NL+ L  L +  N LE S+P EIGNL    LLN+S N
Sbjct  696  IKSLRYVYLDSNKLIFSIPPSLWNLNDLLHLDVSSNFLESSLPPEIGNLKVATLLNVSKN  755

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              SG  P  I  +  +  LS + N L G +P  LGN +  L+   +  NK SG IP SL 
Sbjct  756  QISGIIPSTIGAMQNMAELSFAENRLEGPIPESLGNMV-ALESLDLSHNKLSGGIPKSLV  814

Query  260  KCSLLQTLSLPFNNFSGHVPR--EFGNLTKLEKLFLRSNQLTGAIPREIGALSS  105
              S L  L++ +N  SG +P    F N +     FL +  L GA   +  A  S
Sbjct  815  GLSHLNYLNVSYNRLSGEIPTGGPFANFSY--DSFLSNEGLCGAARLQTPACRS  866


 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 136/287 (47%), Gaps = 18/287 (6%)
 Frame = -1

Query  866  NWIGVTCNSRHNRVSALNLFNMGL-----VGELTPDLGNLSFLVSLNLSQNNFHN-----  717
            N  G   NS  N   A N+F +G+      G      GNL  L  LN++ N+F       
Sbjct  507  NLTGSIPNSLSN---ASNIFRLGIGYNNFSGPFPRSFGNLKRLEYLNVNDNHFTREPSSP  563

Query  716  --SFPRELSQLRRLKILQCSFNDFSGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNL  546
              +F   L+  R L+ L   +N   GN+P+  G L  +L ++Y   + I G +P  +  L
Sbjct  564  ELTFFDSLTNCRHLRQLWIGYNPLDGNLPASVGNLSSSLDYVYAAYSEIRGSMPREIGYL  623

Query  545  SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF-SGSFPLDIlnlsklenlslsvn  369
            S L  L L  N L G IP  IGNL  L+ LNL  N   SG  P ++ NL  L  LSL  N
Sbjct  624  SGLSFLFLQGNYLSGFIPSSIGNLENLQALNLYGNKMISGPIPEELCNLKNLGFLSLGNN  683

Query  368  sLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG  189
             +   +P  LGN +  L+   + SNK    IP SL   + L  L +  N     +P E G
Sbjct  684  EICCSIPACLGN-IKSLRYVYLDSNKLIFSIPPSLWNLNDLLHLDVSSNFLESSLPPEIG  742

Query  188  NLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            NL     L +  NQ++G IP  IGA+ ++  +  + N+L G   ++L
Sbjct  743  NLKVATLLNVSKNQISGIIPSTIGAMQNMAELSFAENRLEGPIPESL  789



>ref|XP_009799745.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Nicotiana sylvestris]
Length=1209

 Score =   281 bits (720),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 213/312 (68%), Gaps = 1/312 (0%)
 Frame = -1

Query  1001  LCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVS  822
             L L+  A  N+ TD+ ALL+LKS ++ D ++IL  NW+ ++ + C WIGVTC SRH RV+
Sbjct  39    LILSATAEVNLKTDEAALLALKSYLTSDTYNILTSNWT-STTSVCQWIGVTCGSRHQRVT  97

Query  821   ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
             AL++ NMGL+G + P LGNLSFLVSL++S N FH   P++LS L RL+ +  + N FSG+
Sbjct  98    ALDISNMGLIGTIPPHLGNLSFLVSLDISSNRFHGILPQDLSNLHRLEFINVTSNKFSGD  157

Query  641   IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
             IPSWF LL  L+ L+L  N+ +G +P ++FN SKLE L LGVN L+G IP EIGNL  L 
Sbjct  158   IPSWFSLLPELQHLHLAFNSFTGIIPPAIFNASKLESLVLGVNQLQGEIPNEIGNLQGLT  217

Query  461   LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
              L+L  N  +G  PL + N+S L  L L+ NSL G LP+D+ ++LP+L +  + +N+F G
Sbjct  218   WLSLGSNRLTGLVPLSLFNISSLRRLVLTNNSLSGNLPVDICSNLPELMVLALSNNEFDG  277

Query  281   EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
             +IP  + KCS LQ LSL FN F+G +PR+ GNLT +  L+L  N L G IP EIG L +L
Sbjct  278   QIPLDIDKCSNLQILSLSFNRFTGVIPRKIGNLTMISSLYLGRNDLEGEIPEEIGYLRNL  337

Query  101   LIVDLSNNKLYG  66
              I+D+ N  L G
Sbjct  338   EILDVQNCSLSG  349


 Score =   120 bits (300),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 90/258 (35%), Positives = 124/258 (48%), Gaps = 25/258 (10%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            L L N  L G L  D+  NL  L+ L LS N F    P ++ +   L+IL  SFN F+G 
Sbjct  243  LVLTNNSLSGNLPVDICSNLPELMVLALSNNEFDGQIPLDIDKCSNLQILSLSFNRFTGV  302

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IP   G L  +  LYLG N++ G +P  +  L  LE+L +   SL G +P  I N+  L+
Sbjct  303  IPRKIGNLTMISSLYLGRNDLEGEIPEEIGYLRNLEILDVQNCSLSGPLPFSISNITSLR  362

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
            LLNL  N  SGS P D+                          ++P L+ F + +N+FSG
Sbjct  363  LLNLYGNKLSGSLPPDMCL------------------------NMPDLRAFDLGNNQFSG  398

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
             IP     C+ L  L L  NN  G +P E GNL  L +L L  N LTG IP  I  +S++
Sbjct  399  TIPKEFGNCTSLSDLFLRENNLIGELPMEIGNLFNLGRLDLHYNFLTGPIPSTIFNMSNI  458

Query  101  LIVDLSNNKLYGTFIQNL  48
              +    N   G+   ++
Sbjct  459  RGISFLGNFFTGSLPADI  476


 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 89/243 (37%), Positives = 120/243 (49%), Gaps = 25/243 (10%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ---CSF------------  660
             G +   +GNL+ + SL L +N+     P E+  LR L+IL    CS             
Sbjct  300  TGVIPRKIGNLTMISSLYLGRNDLEGEIPEEIGYLRNLEILDVQNCSLSGPLPFSISNIT  359

Query  659  ---------NDFSGNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNS  510
                     N  SG++P    L + +LR   LGNN  SG +P    N + L  L L  N+
Sbjct  360  SLRLLNLYGNKLSGSLPPDMCLNMPDLRAFDLGNNQFSGTIPKEFGNCTSLSDLFLRENN  419

Query  509  LEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNH  330
            L G +P EIGNLF L  L+L  N  +G  P  I N+S +  +S   N   G LP D+G  
Sbjct  420  LIGELPMEIGNLFNLGRLDLHYNFLTGPIPSTIFNMSNIRGISFLGNFFTGSLPADIGLG  479

Query  329  LPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN  150
            LP L+   +  N  +G IP+SLS  S +  L + +NNFSG  PR FGNL +LE L +  N
Sbjct  480  LPNLEELYLGYNNLTGSIPNSLSNASNIFRLGIGYNNFSGPFPRSFGNLKRLEYLNVNDN  539

Query  149  QLT  141
              T
Sbjct  540  HFT  542


 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 95/272 (35%), Positives = 146/272 (54%), Gaps = 5/272 (2%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
             L L N    G++  D+   S L  L+LS N F    PR++  L  +  L    ND  G 
Sbjct  267  VLALSNNEFDGQIPLDIDKCSNLQILSLSFNRFTGVIPRKIGNLTMISSLYLGRNDLEGE  326

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG-NLFQL  465
            IP   G L+NL  L + N ++SG LP S+ N++ L +L+L  N L GS+P ++  N+  L
Sbjct  327  IPEEIGYLRNLEILDVQNCSLSGPLPFSISNITSLRLLNLYGNKLSGSLPPDMCLNMPDL  386

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
            +  +L +N FSG+ P +  N + L +L L  N+L GELP+++GN L  L    +  N  +
Sbjct  387  RAFDLGNNQFSGTIPKEFGNCTSLSDLFLRENNLIGELPMEIGN-LFNLGRLDLHYNFLT  445

Query  284  GEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG-NLTKLEKLFLRSNQLTGAIPREIGALS  108
            G IPS++   S ++ +S   N F+G +P + G  L  LE+L+L  N LTG+IP  +   S
Sbjct  446  GPIPSTIFNMSNIRGISFLGNFFTGSLPADIGLGLPNLEELYLGYNNLTGSIPNSLSNAS  505

Query  107  SLLIVDLSNNKLYGTFIQNLDTP*LK*LSYYN  12
            ++  + +  N   G F ++     LK L Y N
Sbjct  506  NIFRLGIGYNNFSGPFPRSFGN--LKRLEYLN  535


 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 127/246 (52%), Gaps = 3/246 (1%)
 Frame = -1

Query  797  LVGELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L   +GNLS  L  +  + +    S PRE+  L  L  L    N  SG IPS  G 
Sbjct  572  LDGNLPASVGNLSSSLDYVYAAYSEIRGSMPREIGYLSGLSFLFLQGNYLSGFIPSSIGN  631

Query  620  LQNLRFLYL-GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
            L+NL+ L L GN  ISG +P  L NL  L  L LG N +  SIP  +GN+  L+ + L  
Sbjct  632  LENLQALNLYGNKMISGPIPEELCNLKNLGFLSLGNNEICCSIPACLGNIKSLRYVYLDS  691

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N    S P  + NL+ L +L +S N L   LP ++GN L    +  +  N+ SG IPS++
Sbjct  692  NKLIFSIPPSLWNLNDLLHLDVSSNFLESSLPPEIGN-LKVATLLNVSKNQISGIIPSTI  750

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
                 +  LS   N   G +P   GN+  LE L L  N+L+G IP+ +  LS L  +++S
Sbjct  751  GAMQNMAELSFAENRLEGPIPESLGNMVALESLDLSHNKLSGGIPKSLVGLSHLNYLNVS  810

Query  83   NNKLYG  66
             N+L G
Sbjct  811  YNRLSG  816


 Score = 98.6 bits (244),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 119/234 (51%), Gaps = 6/234 (3%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNF-HNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G +   +GNL  L +LNL  N       P EL  L+ L  L    N+   +IP+  G 
Sbjct  621  LSGFIPSSIGNLENLQALNLYGNKMISGPIPEELCNLKNLGFLSLGNNEICCSIPACLGN  680

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            +++LR++YL +N +   +P SL+NL+ L  L +  N LE S+P EIGNL    LLN+S N
Sbjct  681  IKSLRYVYLDSNKLIFSIPPSLWNLNDLLHLDVSSNFLESSLPPEIGNLKVATLLNVSKN  740

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              SG  P  I  +  +  LS + N L G +P  LGN +  L+   +  NK SG IP SL 
Sbjct  741  QISGIIPSTIGAMQNMAELSFAENRLEGPIPESLGNMV-ALESLDLSHNKLSGGIPKSLV  799

Query  260  KCSLLQTLSLPFNNFSGHVPR--EFGNLTKLEKLFLRSNQLTGAIPREIGALSS  105
              S L  L++ +N  SG +P    F N +     FL +  L GA   +  A  S
Sbjct  800  GLSHLNYLNVSYNRLSGEIPTGGPFANFSY--DSFLSNEGLCGAARLQTPACRS  851


 Score = 92.4 bits (228),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 136/287 (47%), Gaps = 18/287 (6%)
 Frame = -1

Query  866  NWIGVTCNSRHNRVSALNLFNMGL-----VGELTPDLGNLSFLVSLNLSQNNFHN-----  717
            N  G   NS  N   A N+F +G+      G      GNL  L  LN++ N+F       
Sbjct  492  NLTGSIPNSLSN---ASNIFRLGIGYNNFSGPFPRSFGNLKRLEYLNVNDNHFTREPSSP  548

Query  716  --SFPRELSQLRRLKILQCSFNDFSGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNL  546
              +F   L+  R L+ L   +N   GN+P+  G L  +L ++Y   + I G +P  +  L
Sbjct  549  ELTFFDSLTNCRHLRQLWIGYNPLDGNLPASVGNLSSSLDYVYAAYSEIRGSMPREIGYL  608

Query  545  SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF-SGSFPLDIlnlsklenlslsvn  369
            S L  L L  N L G IP  IGNL  L+ LNL  N   SG  P ++ NL  L  LSL  N
Sbjct  609  SGLSFLFLQGNYLSGFIPSSIGNLENLQALNLYGNKMISGPIPEELCNLKNLGFLSLGNN  668

Query  368  sLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG  189
             +   +P  LGN +  L+   + SNK    IP SL   + L  L +  N     +P E G
Sbjct  669  EICCSIPACLGN-IKSLRYVYLDSNKLIFSIPPSLWNLNDLLHLDVSSNFLESSLPPEIG  727

Query  188  NLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            NL     L +  NQ++G IP  IGA+ ++  +  + N+L G   ++L
Sbjct  728  NLKVATLLNVSKNQISGIIPSTIGAMQNMAELSFAENRLEGPIPESL  774



>ref|XP_009783409.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Nicotiana sylvestris]
Length=397

 Score =   265 bits (676),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 148/305 (49%), Positives = 205/305 (67%), Gaps = 1/305 (0%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            +I+TD+ ALL+LKS IS DP++ILA NWS +S   C+WIG+TCNSRH+R++AL++ +M  
Sbjct  30   SISTDEAALLALKSHISVDPNNILATNWSSSSPV-CSWIGITCNSRHHRIAALDISSMQF  88

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             G + P LGNLSFL SL +S NNFH  FP EL+ L+RLK+ +CS N+F+G IPS+  LL 
Sbjct  89   HGTIPPHLGNLSFLTSLIISNNNFHGEFPEELAHLQRLKMFRCSKNNFTGAIPSFLSLLS  148

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            NLRF+YL  N   G +P+S  NL++L+ L +  N LEG IPRE+G++  + +L+L DN  
Sbjct  149  NLRFVYLFGNQFFGGIPSSRSNLTQLKELSMSGNYLEGEIPRELGDICYMTILDLQDNKL  208

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
             G  P  I N++ ++ ++LS N+L G+ P  + +HLP L+   +  N   G IP +L KC
Sbjct  209  RGPIPPSIFNITTMQTIALSKNNLTGKFPTTICDHLPNLEGLYISENILDGIIPPNLEKC  268

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              LQ LSL  N+F+G VPRE GNLT L  L L    L G IP+E+GAL  L  + L  N+
Sbjct  269  IKLQILSLSNNDFTGTVPRELGNLTSLTGLALGGQHLEGEIPQELGALRYLTSLYLQENQ  328

Query  74   LYGTF  60
            L G+ 
Sbjct  329  LTGSI  333


 Score = 79.0 bits (193),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 98/222 (44%), Gaps = 49/222 (22%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRE------------------  702
            ++ L+L +  L G + P + N++ + ++ LS+NN    FP                    
Sbjct  198  MTILDLQDNKLRGPIPPSIFNITTMQTIALSKNNLTGKFPTTICDHLPNLEGLYISENIL  257

Query  701  -------LSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLS  543
                   L +  +L+IL  S NDF+G +P   G L +L  L LG  ++ G +P  L  L 
Sbjct  258  DGIIPPNLEKCIKLQILSLSNNDFTGTVPRELGNLTSLTGLALGGQHLEGEIPQELGALR  317

Query  542  KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsL  363
             L  L+L  N L GSIP  I N+  ++ + L+ N+ +                       
Sbjct  318  YLTSLYLQENQLTGSIPPSIFNITTMEKIILTSNNLT-----------------------  354

Query  362  FGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL  237
             G+LP  + +HLP L++  + +N   G IP +L KC  L  +
Sbjct  355  -GKLPTTICDHLPDLEVLAISNNYLDGVIPPNLEKCRKLDIV  395


 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 65/126 (52%), Gaps = 1/126 (1%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            ++  L+L N    G +  +LGNL+ L  L L   +     P+EL  LR L  L    N  
Sbjct  270  KLQILSLSNNDFTGTVPRELGNLTSLTGLALGGQHLEGEIPQELGALRYLTSLYLQENQL  329

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN-LSKLEVLHLGVNSLEGSIPREIGNL  474
            +G+IP     +  +  + L +NN++G LPT++ + L  LEVL +  N L+G IP  +   
Sbjct  330  TGSIPPSIFNITTMEKIILTSNNLTGKLPTTICDHLPDLEVLAISNNYLDGVIPPNLEKC  389

Query  473  FQLKLL  456
             +L ++
Sbjct  390  RKLDIV  395



>emb|CDP18217.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   273 bits (697),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 152/313 (49%), Positives = 201/313 (64%), Gaps = 26/313 (8%)
 Frame = -1

Query  998  CLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSA  819
            CL + + TNI TD+ +LL+L+++ISFDP  ILA NWSV S   C+WIGVTC+S H RV A
Sbjct  15   CLALTS-TNIDTDQSSLLALRAQISFDPQEILAKNWSVASPV-CDWIGVTCSSGHRRVIA  72

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            LN+ NMGL G L P LGNLSFLVSL++ +NNFH   P EL+QL RLK+L    N+ +G +
Sbjct  73   LNISNMGLSGTLPPQLGNLSFLVSLDMRRNNFHGELPPELAQLNRLKVLNLGVNNLNGLL  132

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKL  459
            P+WFG  Q L FL L NN+ +G +P S+ N+S+L +L L  NSLEG IP EI N+  L++
Sbjct  133  PNWFGSFQGLEFLSLRNNSFTGLMPPSISNMSRLAILILVNNSLEGKIPEEIFNISSLEM  192

Query  458  LNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGE  279
            ++L  N  SGS                        LP  +  HLP+L+   +  NKFSG+
Sbjct  193  ISLGVNSLSGS------------------------LPDYMCFHLPRLRFIGLSMNKFSGQ  228

Query  278  IPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLL  99
            IPSSL++CS LQ LS  FN F+G+ P+E GNL KLE ++   N LTG IPREI  L +L 
Sbjct  229  IPSSLAQCSELQALSFSFNKFTGNTPKEIGNLKKLEVIYFAMNSLTGEIPREISNLHNLE  288

Query  98   IVDLSNNKLYGTF  60
             ++L  N + G+ 
Sbjct  289  KLNLGWNTMSGSI  301


 Score =   117 bits (292),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 86/263 (33%), Positives = 125/263 (48%), Gaps = 35/263 (13%)
 Frame = -1

Query  746  LNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFL  567
            + LS N F    P  L+Q   L+ L  SFN F+GN P   G L+ L  +Y   N+++G +
Sbjct  218  IGLSMNKFSGQIPSSLAQCSELQALSFSFNKFTGNTPKEIGNLKKLEVIYFAMNSLTGEI  277

Query  566  PTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklen  387
            P  + NL  LE L+LG N++ GSIP EI NL +LKL++ + N  SG  P  +        
Sbjct  278  PREISNLHNLEKLNLGWNTMSGSIPVEIFNLSRLKLMSHAGNKLSGILPSTVFYGLPNLE  337

Query  386  lslsvnsLF-GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNN---  219
                 ++ F G++P  + N   +L   ++  NKF+G IP S+    LLQ L L  NN   
Sbjct  338  ELYLNDNNFVGDIPESISNS-SRLYFIILSDNKFTGPIPISIGNLRLLQVLDLTSNNLVF  396

Query  218  -----------------------------FSGHVPREFGNL-TKLEKLFLRSNQLTGAIP  129
                                          +G +P   GNL T L+ ++     L   IP
Sbjct  397  CDSSYPELSFISSLANSKNLRKLSVSNNPLNGILPDSVGNLSTSLQTMYAYGCGLRDCIP  456

Query  128  REIGALSSLLIVDLSNNKLYGTF  60
              IG LS+L+I+ L NN+L G+ 
Sbjct  457  DRIGNLSNLIILSLYNNQLTGSL  479


 Score = 91.7 bits (226),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 99/302 (33%), Positives = 142/302 (47%), Gaps = 60/302 (20%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPS--WFG  624
            L GE+  ++ NL  L  LNL  N    S P E+  L RLK++  + N  SG +PS  ++G
Sbjct  273  LTGEIPREISNLHNLEKLNLGWNTMSGSIPVEIFNLSRLKLMSHAGNKLSGILPSTVFYG  332

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
            L  NL  LYL +NN  G +P S+ N S+L  + L  N   G IP  IGNL  L++L+L+ 
Sbjct  333  L-PNLEELYLNDNNFVGDIPESISNSSRLYFIILSDNKFTGPIPISIGNLRLLQVLDLTS  391

Query  443  NHF---SGSFPL-----DIlnlsklenlslsvnsLFGELPLDLGN---------------  333
            N+      S+P       + N   L  LS+S N L G LP  +GN               
Sbjct  392  NNLVFCDSSYPELSFISSLANSKNLRKLSVSNNPLNGILPDSVGNLSTSLQTMYAYGCGL  451

Query  332  ---------HLPKLQIFVMRSNKFSGEIP----------------SSLSKCSL-------  249
                     +L  L I  + +N+ +G +P                + LS+ SL       
Sbjct  452  RDCIPDRIGNLSNLIILSLYNNQLTGSLPITVTGLLKLQAIMLHINKLSQVSLEYFCYFN  511

Query  248  -LQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKL  72
             L  +SL FN   G +P   GN+T L  L+L SN+   A P+ +  L  LL++DLS++ L
Sbjct  512  NLGVISLSFNQIVGSIPECIGNVTSLRYLYLASNKFNFA-PKTLWNLKDLLVLDLSSDSL  570

Query  71   YG  66
             G
Sbjct  571  TG  572



>ref|XP_006367833.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Solanum tuberosum]
Length=409

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 204/310 (66%), Gaps = 1/310 (0%)
 Frame = -1

Query  989  INAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNL  810
            +   TNITTD+ ALLSLKS+IS DP   L ++WS  +I  C W+GVTC SRH RV +LNL
Sbjct  45   VMTQTNITTDQLALLSLKSQISSDPFHYLNESWSP-AINVCRWVGVTCGSRHQRVKSLNL  103

Query  809  FNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSW  630
             +M L G +  DLGNL+FL+SL+L  NNFH + P+E+++L RLK L  SFN F G IPSW
Sbjct  104  SDMTLTGTIPRDLGNLTFLISLDLGSNNFHGNLPQEIARLSRLKFLDLSFNKFRGEIPSW  163

Query  629  FGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
            FG L+ L+ L L +N+ +GF+P SL N S+LE L +  N LEG+IP EIGNL  L LL++
Sbjct  164  FGFLERLQVLNLRSNSFTGFIPPSLSNASRLETLEISANLLEGNIPEEIGNLHNLNLLSI  223

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
              N  +GS P  I N+S +E ++ + NSL G LP  L N LP L+   +  NK  G +P 
Sbjct  224  QHNKLTGSIPFTIFNISSIEVIAFTNNSLSGNLPNGLCNGLPILKELRLSVNKLHGHMPK  283

Query  269  SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVD  90
            SLS CS LQ LSL  N+F G +  E G L+ L+ L+L +N  TG IP+EIG L +L+ + 
Sbjct  284  SLSNCSQLQKLSLSGNDFDGPIHSEIGRLSNLQILYLGANHFTGIIPQEIGNLVNLMKLA  343

Query  89   LSNNKLYGTF  60
            +  N++  + 
Sbjct  344  VEINQITSSI  353


 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +   L N S L  L+LS N+F      E+ +L  L+IL    N F+G IP   G L N
Sbjct  279  GHMPKSLSNCSQLQKLSLSGNDFDGPIHSEIGRLSNLQILYLGANHFTGIIPQEIGNLVN  338

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFS  432
            L  L +  N I+  +P S+FN+S L+ + L  N+L+GS+PREIGNL +++ L L +N F+
Sbjct  339  LMKLAVEINQITSSIPISIFNISSLQEVSLWKNNLKGSLPREIGNLTKMQFLYLEENRFT  398

Query  431  GSFPLDI  411
            G  P +I
Sbjct  399  GEIPKEI  405


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 107/240 (45%), Gaps = 50/240 (21%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            R+  LNL +    G + P L N S L +L +S N    + P E+  L  L +L    N  
Sbjct  169  RLQVLNLRSNSFTGFIPPSLSNASRLETLEISANLLEGNIPEEIGNLHNLNLLSIQHNKL  228

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN--------------------------  549
            +G+IP     + ++  +   NN++SG LP  L N                          
Sbjct  229  TGSIPFTIFNISSIEVIAFTNNSLSGNLPNGLCNGLPILKELRLSVNKLHGHMPKSLSNC  288

Query  548  -----------------------LSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
                                   LS L++L+LG N   G IP+EIGNL  L  L +  N 
Sbjct  289  SQLQKLSLSGNDFDGPIHSEIGRLSNLQILYLGANHFTGIIPQEIGNLVNLMKLAVEINQ  348

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             + S P+ I N+S L+ +SL  N+L G LP ++GN L K+Q   +  N+F+GEIP  + K
Sbjct  349  ITSSIPISIFNISSLQEVSLWKNNLKGSLPREIGN-LTKMQFLYLEENRFTGEIPKEIRK  407



>ref|XP_009604297.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Nicotiana tomentosiformis]
Length=1209

 Score =   275 bits (704),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 211/312 (68%), Gaps = 1/312 (0%)
 Frame = -1

Query  1001  LCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVS  822
             L L+  A  N+ TD+ ALL+LKS ++ D ++IL  NW+ ++ + C WIGVTC SRH RV+
Sbjct  39    LILSATAEVNLKTDEAALLALKSYVTSDTYNILTSNWT-STTSVCKWIGVTCGSRHQRVT  97

Query  821   ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
             AL++ NM L+G + P LGNLSFLVS ++S N FH   P+EL+ L RL+ +  + N F+G+
Sbjct  98    ALDISNMELIGTIPPHLGNLSFLVSFDISSNRFHGILPQELTNLHRLEFINVTSNKFTGD  157

Query  641   IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
             IPSWF LL  L+ L+L  N+ +G +P ++FN SKLE L LGVN L+G IP EIGNL  L 
Sbjct  158   IPSWFSLLPELQHLHLAFNSFTGMIPPAIFNASKLESLVLGVNQLQGEIPNEIGNLQDLT  217

Query  461   LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
              L+L  N  +G  PL + N+S L+ L L+ NSL G LP+D+ ++L +L +  + +N+F G
Sbjct  218   WLSLGSNQLTGLVPLSLFNISSLQRLVLTNNSLSGNLPVDICSNLSELMVLALSNNEFDG  277

Query  281   EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
             +IP  + KCS LQ LSL FN F+G +PR+ GNLT +  L+L  N L G IP EIG L +L
Sbjct  278   QIPLEIDKCSNLQILSLSFNRFTGVIPRKIGNLTMISSLYLGRNDLEGEIPEEIGYLRNL  337

Query  101   LIVDLSNNKLYG  66
              I+D+ N  L G
Sbjct  338   EILDVQNCSLSG  349


 Score =   120 bits (301),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 90/258 (35%), Positives = 124/258 (48%), Gaps = 25/258 (10%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            L L N  L G L  D+  NLS L+ L LS N F    P E+ +   L+IL  SFN F+G 
Sbjct  243  LVLTNNSLSGNLPVDICSNLSELMVLALSNNEFDGQIPLEIDKCSNLQILSLSFNRFTGV  302

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IP   G L  +  LYLG N++ G +P  +  L  LE+L +   SL G +P  I N+  L+
Sbjct  303  IPRKIGNLTMISSLYLGRNDLEGEIPEEIGYLRNLEILDVQNCSLSGPLPSSISNITSLR  362

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             LNL  N  SGS P D+                          ++P L+ F + +N+FSG
Sbjct  363  SLNLYGNKLSGSLPPDMCL------------------------NMPDLRAFDLGNNQFSG  398

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
             IP     C+ L  L L  NN  G +P + GNL  L +L L  N LTG IP  I  +S++
Sbjct  399  TIPKEFGNCTSLSDLFLRENNLIGELPMQIGNLFNLGRLDLHYNFLTGPIPSTIFNMSNI  458

Query  101  LIVDLSNNKLYGTFIQNL  48
              +    N   G+   ++
Sbjct  459  RGISFLGNFFTGSLPADI  476


 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 121/243 (50%), Gaps = 25/243 (10%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ---CSF------------  660
             G +   +GNL+ + SL L +N+     P E+  LR L+IL    CS             
Sbjct  300  TGVIPRKIGNLTMISSLYLGRNDLEGEIPEEIGYLRNLEILDVQNCSLSGPLPSSISNIT  359

Query  659  ---------NDFSGNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNS  510
                     N  SG++P    L + +LR   LGNN  SG +P    N + L  L L  N+
Sbjct  360  SLRSLNLYGNKLSGSLPPDMCLNMPDLRAFDLGNNQFSGTIPKEFGNCTSLSDLFLRENN  419

Query  509  LEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNH  330
            L G +P +IGNLF L  L+L  N  +G  P  I N+S +  +S   N   G LP D+G+ 
Sbjct  420  LIGELPMQIGNLFNLGRLDLHYNFLTGPIPSTIFNMSNIRGISFLGNFFTGSLPADIGHG  479

Query  329  LPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN  150
            LP L+   +  N  +G IP+SLS  S +  L + +NNFSG  PR FGNL +LE L +  N
Sbjct  480  LPNLEELYLGYNNLTGSIPNSLSNASNIFRLGIGYNNFSGPFPRSFGNLRRLEYLNVNDN  539

Query  149  QLT  141
              T
Sbjct  540  HFT  542


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 89/256 (35%), Positives = 139/256 (54%), Gaps = 3/256 (1%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
             L L N    G++  ++   S L  L+LS N F    PR++  L  +  L    ND  G 
Sbjct  267  VLALSNNEFDGQIPLEIDKCSNLQILSLSFNRFTGVIPRKIGNLTMISSLYLGRNDLEGE  326

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG-NLFQL  465
            IP   G L+NL  L + N ++SG LP+S+ N++ L  L+L  N L GS+P ++  N+  L
Sbjct  327  IPEEIGYLRNLEILDVQNCSLSGPLPSSISNITSLRSLNLYGNKLSGSLPPDMCLNMPDL  386

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
            +  +L +N FSG+ P +  N + L +L L  N+L GELP+ +GN L  L    +  N  +
Sbjct  387  RAFDLGNNQFSGTIPKEFGNCTSLSDLFLRENNLIGELPMQIGN-LFNLGRLDLHYNFLT  445

Query  284  GEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGN-LTKLEKLFLRSNQLTGAIPREIGALS  108
            G IPS++   S ++ +S   N F+G +P + G+ L  LE+L+L  N LTG+IP  +   S
Sbjct  446  GPIPSTIFNMSNIRGISFLGNFFTGSLPADIGHGLPNLEELYLGYNNLTGSIPNSLSNAS  505

Query  107  SLLIVDLSNNKLYGTF  60
            ++  + +  N   G F
Sbjct  506  NIFRLGIGYNNFSGPF  521


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 86/234 (37%), Positives = 120/234 (51%), Gaps = 6/234 (3%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNF-HNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G +   +GNL  L +LNL  N       P EL  L+ L  L    N+   +IP+  G 
Sbjct  621  LSGFIPSSIGNLENLQALNLYDNKMISGPIPEELCNLKNLGFLSLGNNEICCSIPACLGN  680

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            +++LR++YL +N +   +P SL+NL+ L  L +  N LE S+P EIGNL    LLN+S N
Sbjct  681  IKSLRYVYLDSNKLIFSIPPSLWNLNDLLHLDVSSNFLESSLPPEIGNLKVATLLNISKN  740

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              SG  P  I  +  +  LS + N L G +P  LGN +  L+   +  NK SG IP SL 
Sbjct  741  RISGIIPSTIGAMQNMAELSFAENRLEGPIPESLGNMV-ALESLDLSHNKLSGGIPKSLV  799

Query  260  KCSLLQTLSLPFNNFSGHVPR--EFGNLTKLEKLFLRSNQLTGAIPREIGALSS  105
              S L  L++ +N  SG +P    F N +     FL +  L GA   +I A  S
Sbjct  800  GLSHLNHLNVSYNRLSGEIPTGGPFANFSY--DSFLSNEALCGAARLQIPACRS  851


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 90/246 (37%), Positives = 126/246 (51%), Gaps = 3/246 (1%)
 Frame = -1

Query  797  LVGELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L   +GNLS  L  +  + +    S P E+  L  L  L    N  SG IPS  G 
Sbjct  572  LDGNLPASVGNLSSSLDYVYAAYSEIRGSMPSEIGYLSGLSFLFLQGNYLSGFIPSSIGN  631

Query  620  LQNLRFLYLGNNN-ISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
            L+NL+ L L +N  ISG +P  L NL  L  L LG N +  SIP  +GN+  L+ + L  
Sbjct  632  LENLQALNLYDNKMISGPIPEELCNLKNLGFLSLGNNEICCSIPACLGNIKSLRYVYLDS  691

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N    S P  + NL+ L +L +S N L   LP ++GN L    +  +  N+ SG IPS++
Sbjct  692  NKLIFSIPPSLWNLNDLLHLDVSSNFLESSLPPEIGN-LKVATLLNISKNRISGIIPSTI  750

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
                 +  LS   N   G +P   GN+  LE L L  N+L+G IP+ +  LS L  +++S
Sbjct  751  GAMQNMAELSFAENRLEGPIPESLGNMVALESLDLSHNKLSGGIPKSLVGLSHLNHLNVS  810

Query  83   NNKLYG  66
             N+L G
Sbjct  811  YNRLSG  816


 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 119/244 (49%), Gaps = 3/244 (1%)
 Frame = -1

Query  773  LGNLSFLVSLNLSQNNFHNSFPRELSQLRR-LKILQCSFNDFSGNIPSWFGLLQNLRFLY  597
            L N   L  L +  N    + P  +  L   L  +  ++++  G++PS  G L  L FL+
Sbjct  556  LTNCRHLRQLWIGYNPLDGNLPASVGNLSSSLDYVYAAYSEIRGSMPSEIGYLSGLSFLF  615

Query  596  LGNNNISGFLPTSLFNLSKLEVLHLGVNSL-EGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
            L  N +SGF+P+S+ NL  L+ L+L  N +  G IP E+ NL  L  L+L +N    S P
Sbjct  616  LQGNYLSGFIPSSIGNLENLQALNLYDNKMISGPIPEELCNLKNLGFLSLGNNEICCSIP  675

Query  419  LDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQT  240
              + N+  L  + L  N L   +P  L N L  L    + SN     +P  +    +   
Sbjct  676  ACLGNIKSLRYVYLDSNKLIFSIPPSLWN-LNDLLHLDVSSNFLESSLPPEIGNLKVATL  734

Query  239  LSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            L++  N  SG +P   G +  + +L    N+L G IP  +G + +L  +DLS+NKL G  
Sbjct  735  LNISKNRISGIIPSTIGAMQNMAELSFAENRLEGPIPESLGNMVALESLDLSHNKLSGGI  794

Query  59   IQNL  48
             ++L
Sbjct  795  PKSL  798



>ref|XP_006358724.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Solanum tuberosum]
Length=1084

 Score =   275 bits (702),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 155/304 (51%), Positives = 207/304 (68%), Gaps = 1/304 (0%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            NI TDK +LL+LKS I  DP++ILA+NWS +S+  C+WIGVTC SRH+RV+AL++ +M L
Sbjct  29   NINTDKASLLALKSHIYSDPNNILANNWS-SSVPVCSWIGVTCGSRHHRVTALDISSMQL  87

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             G + P +GNLSFLVSL++S N FH   P E + LRRLK++  + N+F+G IP +  LL 
Sbjct  88   HGTIPPHIGNLSFLVSLDISDNTFHGGLPEEFAHLRRLKVISVASNNFTGAIPPFLSLLP  147

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            NLRFLYL +N  SG +P+SL NL+KLEVL L  N LEG IPREIG+L  L  L+L DN  
Sbjct  148  NLRFLYLWSNQFSGKIPSSLSNLTKLEVLSLRNNFLEGEIPREIGDLRYLTFLDLQDNQL  207

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            +GS P  I N++ ++N+ LS N+L G+LP  + +HLP L+   +  N  SG IP +L KC
Sbjct  208  TGSIPTSIFNITTMQNIGLSNNNLTGKLPTTICDHLPHLEGLYISKNYLSGVIPPTLEKC  267

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              LQ LSL  N F+G VPRE  NLT L +L++ +  L G IP E+G L  L  + L+ N 
Sbjct  268  RNLQVLSLSLNEFTGTVPRELANLTALTRLYIATLHLEGEIPAELGNLEKLQRLILAENG  327

Query  74   LYGT  63
              G+
Sbjct  328  FTGS  331


 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 93/260 (36%), Positives = 135/260 (52%), Gaps = 5/260 (2%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            ++ L +  + L GE+  +LGNL  L  L L++N F  S P  +  +  LKIL+ S N+ S
Sbjct  294  LTRLYIATLHLEGEIPAELGNLEKLQRLILAENGFTGSVPASIFNMSALKILELSINNLS  353

Query  647  GNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
            G +PS  G  + NL  LY    N++GF+  S+ N SKL  + L VNS  G IP  +GNL 
Sbjct  354  GTLPSDLGRGMPNLEGLYCAATNLTGFISDSISNSSKLREIDLTVNSFTGPIPESLGNLE  413

Query  470  QLKLLNLSDNHF----SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVM  303
             L++L L  N+F      SF   + N   L  L +  N L G LP  +GN    L  F  
Sbjct  414  YLEILGLQTNNFFSDSKMSFLTSLSNCRNLRVLWIGDNPLDGVLPPSVGNLSKSLDSFDG  473

Query  302  RSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPRE  123
               K  G IP  +   + + ++SL  N   GH+P     +  L++L+L SN++ G IP  
Sbjct  474  NGCKLKGAIPQEIGNLTGMTSMSLYNNELIGHIPDTVHGMLSLQELYLLSNKIEGTIPDV  533

Query  122  IGALSSLLIVDLSNNKLYGT  63
            I +L +L  +DLS N   G+
Sbjct  534  ICSLKNLGALDLSENHFSGS  553


 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 127/245 (52%), Gaps = 2/245 (1%)
 Frame = -1

Query  797  LVGELTPDLGNLS-FLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L P +GNLS  L S + +      + P+E+  L  +  +    N+  G+IP     
Sbjct  453  LDGVLPPSVGNLSKSLDSFDGNGCKLKGAIPQEIGNLTGMTSMSLYNNELIGHIPDTVHG  512

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            + +L+ LYL +N I G +P  + +L  L  L L  N   GS+P  +GN+  L+ L+L++N
Sbjct  513  MLSLQELYLLSNKIEGTIPDVICSLKNLGALDLSENHFSGSVPSCLGNVTSLRKLHLANN  572

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
            +     P  + +L  L    +S N L GE+PL+ GN L    +  +  N FSG+IPS+L 
Sbjct  573  NLDSRLPSSLGSLQDLIEFDISSNLLSGEIPLESGN-LKAATLIDLSRNYFSGKIPSTLG  631

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
                L  LSL  N   G +P  FG +  LE L L  N L+G IP+ + AL  L  ++ S 
Sbjct  632  GLDKLINLSLAHNRLEGPIPESFGKMLSLEYLDLSYNNLSGQIPKSLEALVYLKNMNFSF  691

Query  80   NKLYG  66
            NKL G
Sbjct  692  NKLSG  696


 Score =   107 bits (268),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 141/296 (48%), Gaps = 30/296 (10%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLKI  675
            S  +++  ++L      G +   LGNL +L  L L  NNF +    SF   LS  R L++
Sbjct  386  SNSSKLREIDLTVNSFTGPIPESLGNLEYLEILGLQTNNFFSDSKMSFLTSLSNCRNLRV  445

Query  674  L------------------QCSFNDFSGN-------IPSWFGLLQNLRFLYLGNNNISGF  570
            L                    S + F GN       IP   G L  +  + L NN + G 
Sbjct  446  LWIGDNPLDGVLPPSVGNLSKSLDSFDGNGCKLKGAIPQEIGNLTGMTSMSLYNNELIGH  505

Query  569  LPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlskle  390
            +P ++  +  L+ L+L  N +EG+IP  I +L  L  L+LS+NHFSGS P  + N++ L 
Sbjct  506  IPDTVHGMLSLQELYLLSNKIEGTIPDVICSLKNLGALDLSENHFSGSVPSCLGNVTSLR  565

Query  389  nlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSG  210
             L L+ N+L   LP  LG+ L  L  F + SN  SGEIP           + L  N FSG
Sbjct  566  KLHLANNNLDSRLPSSLGS-LQDLIEFDISSNLLSGEIPLESGNLKAATLIDLSRNYFSG  624

Query  209  HVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
             +P   G L KL  L L  N+L G IP   G + SL  +DLS N L G   ++L+ 
Sbjct  625  KIPSTLGGLDKLINLSLAHNRLEGPIPESFGKMLSLEYLDLSYNNLSGQIPKSLEA  680


 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 76/233 (33%), Positives = 113/233 (48%), Gaps = 25/233 (11%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +++++L+N  L+G +   +  +  L  L L  N    + P  +  L+ L  L  S N FS
Sbjct  492  MTSMSLYNNELIGHIPDTVHGMLSLQELYLLSNKIEGTIPDVICSLKNLGALDLSENHFS  551

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G++PS  G + +LR L+L NNN+   LP+SL +L  L    +  N L G IP E GNL  
Sbjct  552  GSVPSCLGNVTSLRKLHLANNNLDSRLPSSLGSLQDLIEFDISSNLLSGEIPLESGNLKA  611

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
              L++LS N+FSG                        ++P  LG  L KL    +  N+ 
Sbjct  612  ATLIDLSRNYFSG------------------------KIPSTLGG-LDKLINLSLAHNRL  646

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             G IP S  K   L+ L L +NN SG +P+    L  L+ +    N+L+G IP
Sbjct  647  EGPIPESFGKMLSLEYLDLSYNNLSGQIPKSLEALVYLKNMNFSFNKLSGEIP  699


 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 87/281 (31%), Positives = 125/281 (44%), Gaps = 30/281 (11%)
 Frame = -1

Query  818  LNLFNMGLVGEL-TPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            + L N  L G+L T    +L  L  L +S+N      P  L + R L++L  S N+F+G 
Sbjct  224  IGLSNNNLTGKLPTTICDHLPHLEGLYISKNYLSGVIPPTLEKCRNLQVLSLSLNEFTGT  283

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            +P     L  L  LY+   ++ G +P  L NL KL+ L L  N   GS+P  I N+  LK
Sbjct  284  VPRELANLTALTRLYIATLHLEGEIPAELGNLEKLQRLILAENGFTGSVPASIFNMSALK  343

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
            +L LS N+ SG+ P D+              +       D  ++  KL+   +  N F+G
Sbjct  344  ILELSINNLSGTLPSDLGRGMPNLEGLYCAATNLTGFISDSISNSSKLREIDLTVNSFTG  403

Query  281  EIPSSLSKCSLLQTLSLPFNNF----------------------------SGHVPREFGN  186
             IP SL     L+ L L  NNF                             G +P   GN
Sbjct  404  PIPESLGNLEYLEILGLQTNNFFSDSKMSFLTSLSNCRNLRVLWIGDNPLDGVLPPSVGN  463

Query  185  LTK-LEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            L+K L+       +L GAIP+EIG L+ +  + L NN+L G
Sbjct  464  LSKSLDSFDGNGCKLKGAIPQEIGNLTGMTSMSLYNNELIG  504


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 68/144 (47%), Gaps = 0/144 (0%)
 Frame = -1

Query  851  TCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKIL  672
            +C      +  L+L N  L   L   LG+L  L+  ++S N      P E   L+   ++
Sbjct  556  SCLGNVTSLRKLHLANNNLDSRLPSSLGSLQDLIEFDISSNLLSGEIPLESGNLKAATLI  615

Query  671  QCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIP  492
              S N FSG IPS  G L  L  L L +N + G +P S   +  LE L L  N+L G IP
Sbjct  616  DLSRNYFSGKIPSTLGGLDKLINLSLAHNRLEGPIPESFGKMLSLEYLDLSYNNLSGQIP  675

Query  491  REIGNLFQLKLLNLSDNHFSGSFP  420
            + +  L  LK +N S N  SG  P
Sbjct  676  KSLEALVYLKNMNFSFNKLSGEIP  699



>emb|CDO96823.1| unnamed protein product [Coffea canephora]
Length=1015

 Score =   273 bits (699),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 167/336 (50%), Positives = 216/336 (64%), Gaps = 2/336 (1%)
 Frame = -1

Query  1055  EITRHYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSI  876
             +++  YF L +F   S + CL +    NITTD+ ALLSLK+KI+ DPH ILA NWS  S 
Sbjct  3     KLSHLYFALGLFLLGSFLSCLAMTT-PNITTDQSALLSLKAKITGDPHEILASNWSATS-  60

Query  875   TPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELS  696
             + C+W GVTC SRH RV+ALN+ N+GL G + P LGNLSFL+SL++S+NNF+   P EL 
Sbjct  61    SVCDWRGVTCGSRHRRVTALNISNLGLTGTIPPQLGNLSFLMSLDMSRNNFYGELPHELI  120

Query  695   QLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGV  516
              LRRL++L    N  SG+IPSW G  Q LR   L NN+ +GF+P S+ N+SKLE  +L  
Sbjct  121   CLRRLRVLGLGINMLSGSIPSWVGSFQQLRHFSLKNNSFTGFIPPSISNMSKLETFNLQF  180

Query  515   NSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
             NSL+G+IP EIG L +LK + L  N  SG  PL + N+S LE ++L  NSL G LP  + 
Sbjct  181   NSLQGAIPMEIGKLNKLKQIVLDYNQLSGFLPLGMFNISSLEVIALQNNSLSGSLPSSIC  240

Query  335   NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
               L  L    +  NK SG IP SLS+CS LQ L L  NNFSG +P E GNLT L++L+L 
Sbjct  241   PRLQGLTWLDLSLNKLSGAIPPSLSECSKLQVLRLGGNNFSGVMPEEVGNLTALQELYLG  300

Query  155   SNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
              N L G IP   G L++   + L+ N L G+  Q L
Sbjct  301   ENNLIGVIPEGFGNLTAFKRLYLNENNLIGSIPQEL  336


 Score =   120 bits (300),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 88/246 (36%), Positives = 118/246 (48%), Gaps = 5/246 (2%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G + P L   S L  L L  NNF    P E+  L  L+ L    N+  G IP  FG L
Sbjct  256  LSGAIPPSLSECSKLQVLRLGGNNFSGVMPEEVGNLTALQELYLGENNLIGVIPEGFGNL  315

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
               + LYL  NN+ G +P  L  L  LE L LG NSL GSIP +I N+  L+ L L +N 
Sbjct  316  TAFKRLYLNENNLIGSIPQELGRLKHLEQLDLGSNSLTGSIPAQIFNISTLRQLGLENNR  375

Query  437  FSGSFPLDIlnlsklenlslsvnsLF----GELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
             SG  P     +  L        +      G +P  +GN L  L I V+  N  SG +PS
Sbjct  376  LSGRLPSSTGCVGNLSTSMERFYAYGCGIKGSIPDGIGN-LSSLMILVLGGNHLSGPVPS  434

Query  269  SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVD  90
            ++     LQ LSL  N  SG +P       +L +++L  NQ  G++P  +  +SSL  +D
Sbjct  435  TMKYLQNLQGLSLSDNQLSGSIPDCICKFKRLYQIYLGQNQFRGSMPSCLNNISSLRGID  494

Query  89   LSNNKL  72
             + N L
Sbjct  495  FAGNLL  500


 Score =   104 bits (259),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 101/317 (32%), Positives = 142/317 (45%), Gaps = 53/317 (17%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCS  663
            S  +++  L L      G +  ++GNL+ L  L L +NN     P     L   K L  +
Sbjct  265  SECSKLQVLRLGGNNFSGVMPEEVGNLTALQELYLGENNLIGVIPEGFGNLTAFKRLYLN  324

Query  662  FNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSL--------  507
             N+  G+IP   G L++L  L LG+N+++G +P  +FN+S L  L L  N L        
Sbjct  325  ENNLIGSIPQELGRLKHLEQLDLGSNSLTGSIPAQIFNISTLRQLGLENNRLSGRLPSST  384

Query  506  --------------------EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklen  387
                                +GSIP  IGNL  L +L L  NH SG  P  +  L  L+ 
Sbjct  385  GCVGNLSTSMERFYAYGCGIKGSIPDGIGNLSSLMILVLGGNHLSGPVPSTMKYLQNLQG  444

Query  386  lslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL---------S  234
            LSLS N L G +P D      +L    +  N+F G +PS L+  S L+ +         S
Sbjct  445  LSLSDNQLSGSIP-DCICKFKRLYQIYLGQNQFRGSMPSCLNNISSLRGIDFAGNLLDSS  503

Query  233  LP---------------FNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLL  99
            +P               +N+ SG +P E GNL  +  L L  NQL G IP  +G L SL 
Sbjct  504  IPGSLWNLTDLLTLNLSYNSLSGSLPYETGNLKVVTLLDLSGNQLNGNIPSSLGGLQSLA  563

Query  98   IVDLSNNKLYGTFIQNL  48
             + L+ NKL G    +L
Sbjct  564  TLSLAQNKLQGPIPDSL  580


 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 102/304 (34%), Positives = 143/304 (47%), Gaps = 53/304 (17%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L+G +    GNL+    L L++NN   S P+EL +L+ L+ L    N  +G+IP+    +
Sbjct  304  LIGVIPEGFGNLTAFKRLYLNENNLIGSIPQELGRLKHLEQLDLGSNSLTGSIPAQIFNI  363

Query  617  QNLRFLYLGNNNISGFLPTS---LFNLS-KLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
              LR L L NN +SG LP+S   + NLS  +E  +     ++GSIP  IGNL  L +L L
Sbjct  364  STLRQLGLENNRLSGRLPSSTGCVGNLSTSMERFYAYGCGIKGSIPDGIGNLSSLMILVL  423

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
              NH SG  P  +  L  L+ LSLS N L G +P D      +L    +  N+F G +PS
Sbjct  424  GGNHLSGPVPSTMKYLQNLQGLSLSDNQLSGSIP-DCICKFKRLYQIYLGQNQFRGSMPS  482

Query  269  SLSKCSLLQTL---------SLP---------------FNNFSGHVPREFGNLTKLEKLF  162
             L+  S L+ +         S+P               +N+ SG +P E GNL  +  L 
Sbjct  483  CLNNISSLRGIDFAGNLLDSSIPGSLWNLTDLLTLNLSYNSLSGSLPYETGNLKVVTLLD  542

Query  161  LRSNQLTGAIPREIGALSSLLIV------------------------DLSNNKLYGTFIQ  54
            L  NQL G IP  +G L SL  +                        DLSNN L G   +
Sbjct  543  LSGNQLNGNIPSSLGGLQSLATLSLAQNKLQGPIPDSLSHMLSLQFLDLSNNNLSGPIPK  602

Query  53   NLDT  42
            +L+T
Sbjct  603  SLET  606


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 86/227 (38%), Positives = 113/227 (50%), Gaps = 1/227 (0%)
 Frame = -1

Query  809  FNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSW  630
            +  G+ G +   +GNLS L+ L L  N+     P  +  L+ L+ L  S N  SG+IP  
Sbjct  400  YGCGIKGSIPDGIGNLSSLMILVLGGNHLSGPVPSTMKYLQNLQGLSLSDNQLSGSIPDC  459

Query  629  FGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
                + L  +YLG N   G +P+ L N+S L  +    N L+ SIP  + NL  L  LNL
Sbjct  460  ICKFKRLYQIYLGQNQFRGSMPSCLNNISSLRGIDFAGNLLDSSIPGSLWNLTDLLTLNL  519

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
            S N  SGS P +  NL  +  L LS N L G +P  LG  L  L    +  NK  G IP 
Sbjct  520  SYNSLSGSLPYETGNLKVVTLLDLSGNQLNGNIPSSLGG-LQSLATLSLAQNKLQGPIPD  578

Query  269  SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
            SLS    LQ L L  NN SG +P+    L  L+ + L  N+L G IP
Sbjct  579  SLSHMLSLQFLDLSNNNLSGPIPKSLETLLYLKHINLSFNRLRGEIP  625


 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 79/162 (49%), Gaps = 7/162 (4%)
 Frame = -1

Query  905  LADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNN  726
            L+DN    SI  C      C  +  R+  + L      G +   L N+S L  ++ + N 
Sbjct  447  LSDNQLSGSIPDC-----IC--KFKRLYQIYLGQNQFRGSMPSCLNNISSLRGIDFAGNL  499

Query  725  FHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNL  546
              +S P  L  L  L  L  S+N  SG++P   G L+ +  L L  N ++G +P+SL  L
Sbjct  500  LDSSIPGSLWNLTDLLTLNLSYNSLSGSLPYETGNLKVVTLLDLSGNQLNGNIPSSLGGL  559

Query  545  SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
              L  L L  N L+G IP  + ++  L+ L+LS+N+ SG  P
Sbjct  560  QSLATLSLAQNKLQGPIPDSLSHMLSLQFLDLSNNNLSGPIP  601



>ref|XP_010316828.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Solanum lycopersicum]
Length=1190

 Score =   273 bits (699),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 155/324 (48%), Positives = 214/324 (66%), Gaps = 2/324 (1%)
 Frame = -1

Query  1037  FCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWI  858
             F L +  +H L++ L+  A  N+ TD+ +LL+LKS ++ D ++IL+ NW+ ++ + CNWI
Sbjct  13    FPLLVSIWHHLLI-LSATAEVNLKTDEASLLALKSYVTSDTYNILSSNWT-STTSVCNWI  70

Query  857   GVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLK  678
             GVTC SRH RV  L++ +MGLVG + P LGNLSFLVSL++S N+F    PREL+ L RL+
Sbjct  71    GVTCGSRHQRVITLDISDMGLVGTIPPHLGNLSFLVSLDISSNSFQGILPRELANLHRLE  130

Query  677   ILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGS  498
              +  + N F+G+IPSWF LL  L+ L+L  N+ +G +P  + N SKLE L LG N L+G 
Sbjct  131   FINVTSNKFTGDIPSWFSLLPELQHLHLAFNSFTGIIPPDICNASKLESLVLGFNQLQGE  190

Query  497   IPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKL  318
             IP EIGNL  L  L+L  N  +GS PL + N+S L+ L L+ N L G LP+D+ + LP+L
Sbjct  191   IPNEIGNLQNLTWLSLGSNQLTGSVPLSLYNISSLQRLVLTKNRLSGNLPVDICSSLPQL  250

Query  317   QIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
              +  +  N+F G+IP  + KCS LQ LSL FN FSG +P++ GNL  L  L+L  N L G
Sbjct  251   LVLAVSDNEFDGQIPLGIDKCSKLQILSLSFNKFSGLIPKQIGNLNMLSILYLGRNDLKG  310

Query  137   AIPREIGALSSLLIVDLSNNKLYG  66
              IP EIG L +L I+D  N  L G
Sbjct  311   EIPEEIGNLRNLEILDAQNCSLSG  334


 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 90/251 (36%), Positives = 121/251 (48%), Gaps = 25/251 (10%)
 Frame = -1

Query  797  LVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L  D+  +L  L+ L +S N F    P  + +  +L+IL  SFN FSG IP   G 
Sbjct  235  LSGNLPVDICSSLPQLLVLAVSDNEFDGQIPLGIDKCSKLQILSLSFNKFSGLIPKQIGN  294

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            L  L  LYLG N++ G +P  + NL  LE+L     SL G +P  I NL  L+ LNL  N
Sbjct  295  LNMLSILYLGRNDLKGEIPEEIGNLRNLEILDAQNCSLSGPLPSSISNLTSLQSLNLYGN  354

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
            + SG+   DI                          ++P L+ F + +N FSG IP    
Sbjct  355  NLSGTLSRDICL------------------------NMPYLRAFDLGNNLFSGSIPKEFG  390

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
             CS L  L L  NN +G +PRE GNL  L +L L  N LTG IP  I  +S++  +    
Sbjct  391  NCSSLSDLFLRENNLTGELPREIGNLFNLGRLDLHYNFLTGPIPSTIFNMSNIRGISFLG  450

Query  80   NKLYGTFIQNL  48
            N   GT   ++
Sbjct  451  NFFTGTLPSDI  461


 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 145/312 (46%), Gaps = 52/312 (17%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL-SQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G +   L N+S L  L L++N    + P ++ S L +L +L  S N+F G IP     
Sbjct  211  LTGSVPLSLYNISSLQRLVLTKNRLSGNLPVDICSSLPQLLVLAVSDNEFDGQIPLGIDK  270

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
               L+ L L  N  SG +P  + NL+ L +L+LG N L+G IP EIGNL  L++L+  + 
Sbjct  271  CSKLQILSLSFNKFSGLIPKQIGNLNMLSILYLGRNDLKGEIPEEIGNLRNLEILDAQNC  330

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              SG  P  I NL+ L++L+L  N+L G L  D+  ++P L+ F + +N FSG IP    
Sbjct  331  SLSGPLPSSISNLTSLQSLNLYGNNLSGTLSRDICLNMPYLRAFDLGNNLFSGSIPKEFG  390

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNL----------------------------------  183
             CS L  L L  NN +G +PRE GNL                                  
Sbjct  391  NCSSLSDLFLRENNLTGELPREIGNLFNLGRLDLHYNFLTGPIPSTIFNMSNIRGISFLG  450

Query  182  ---------------TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
                             LE+L+L  N LTGAIP  +   S++  + +  N   G F ++ 
Sbjct  451  NFFTGTLPSDIGLGLPNLEELYLGYNNLTGAIPNSLSNASNIFWLGIGYNDFSGPFPKSF  510

Query  47   DTP*LK*LSYYN  12
                L+ L Y N
Sbjct  511  GN--LRRLEYLN  520


 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 128/244 (52%), Gaps = 3/244 (1%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNN-FHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            G L P +GNLS  +    + N+      P E+  L  L  L    N  SG IP   G  +
Sbjct  559  GYLPPSVGNLSSSLDYIYAANSEIRGYIPSEIGNLSGLSFLFLQGNHLSGFIPRTIGNSK  618

Query  614  NLRFLYLGNNN-ISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            N + L L +N  ISG +P  L NL KL  L LG N L  SIP  +GN+  L+ + L  N 
Sbjct  619  NFQALNLYDNKMISGPIPEELCNLKKLGFLSLGNNELCCSIPACLGNITSLRYIYLGSNK  678

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             + S P  + NL+ L +L +S NSL   LP ++GN L    +  +  N+ SG IPS++  
Sbjct  679  LTFSIPPSLWNLNDLLHLDVSSNSLKSSLPPEIGN-LKVATLLNISKNQISGSIPSTIGG  737

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
               +  LS   N   G +P   GN+  LE L L +N+L+G IP+ + ALS L  +++SNN
Sbjct  738  MQNMAELSFAENRLEGPIPESMGNMVALESLDLSNNKLSGGIPKTLVALSHLNYLNVSNN  797

Query  77   KLYG  66
            +L G
Sbjct  798  RLSG  801


 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 144/287 (50%), Gaps = 18/287 (6%)
 Frame = -1

Query  866  NWIGVTCNSRHNRVSALNLFNMGL-----VGELTPDLGNLSFLVSLNLSQNNF--HNSFP  708
            N  G   NS  N   A N+F +G+      G      GNL  L  LN+++N+F    S P
Sbjct  477  NLTGAIPNSLSN---ASNIFWLGIGYNDFSGPFPKSFGNLRRLEYLNVNRNHFTREPSSP  533

Query  707  R-----ELSQLRRLKILQCSFNDFSGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNL  546
            R      L+  R L+ L   +N  +G +P   G L  +L ++Y  N+ I G++P+ + NL
Sbjct  534  RLTFFDSLTNCRHLRQLWIGYNPLNGYLPPSVGNLSSSLDYIYAANSEIRGYIPSEIGNL  593

Query  545  SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF-SGSFPLDIlnlsklenlslsvn  369
            S L  L L  N L G IPR IGN    + LNL DN   SG  P ++ NL KL  LSL  N
Sbjct  594  SGLSFLFLQGNHLSGFIPRTIGNSKNFQALNLYDNKMISGPIPEELCNLKKLGFLSLGNN  653

Query  368  sLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG  189
             L   +P  LGN +  L+   + SNK +  IP SL   + L  L +  N+    +P E G
Sbjct  654  ELCCSIPACLGN-ITSLRYIYLGSNKLTFSIPPSLWNLNDLLHLDVSSNSLKSSLPPEIG  712

Query  188  NLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            NL     L +  NQ++G+IP  IG + ++  +  + N+L G   +++
Sbjct  713  NLKVATLLNISKNQISGSIPSTIGGMQNMAELSFAENRLEGPIPESM  759


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 88/251 (35%), Positives = 126/251 (50%), Gaps = 9/251 (4%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL-  621
            L GEL  ++GNL  L  L+L  N      P  +  +  ++ +    N F+G +PS  GL 
Sbjct  405  LTGELPREIGNLFNLGRLDLHYNFLTGPIPSTIFNMSNIRGISFLGNFFTGTLPSDIGLG  464

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            L NL  LYLG NN++G +P SL N S +  L +G N   G  P+  GNL +L+ LN++ N
Sbjct  465  LPNLEELYLGYNNLTGAIPNSLSNASNIFWLGIGYNDFSGPFPKSFGNLRRLEYLNVNRN  524

Query  440  HFSG-------SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
            HF+        +F   + N   L  L +  N L G LP  +GN    L      +++  G
Sbjct  525  HFTREPSSPRLTFFDSLTNCRHLRQLWIGYNPLNGYLPPSVGNLSSSLDYIYAANSEIRG  584

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQL-TGAIPREIGALSS  105
             IPS +   S L  L L  N+ SG +PR  GN    + L L  N++ +G IP E+  L  
Sbjct  585  YIPSEIGNLSGLSFLFLQGNHLSGFIPRTIGNSKNFQALNLYDNKMISGPIPEELCNLKK  644

Query  104  LLIVDLSNNKL  72
            L  + L NN+L
Sbjct  645  LGFLSLGNNEL  655


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 109/200 (55%), Gaps = 2/200 (1%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNF-HNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G +   +GN     +LNL  N       P EL  L++L  L    N+   +IP+  G 
Sbjct  606  LSGFIPRTIGNSKNFQALNLYDNKMISGPIPEELCNLKKLGFLSLGNNELCCSIPACLGN  665

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            + +LR++YLG+N ++  +P SL+NL+ L  L +  NSL+ S+P EIGNL    LLN+S N
Sbjct  666  ITSLRYIYLGSNKLTFSIPPSLWNLNDLLHLDVSSNSLKSSLPPEIGNLKVATLLNISKN  725

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              SGS P  I  +  +  LS + N L G +P  +GN +  L+   + +NK SG IP +L 
Sbjct  726  QISGSIPSTIGGMQNMAELSFAENRLEGPIPESMGNMV-ALESLDLSNNKLSGGIPKTLV  784

Query  260  KCSLLQTLSLPFNNFSGHVP  201
              S L  L++  N  SG +P
Sbjct  785  ALSHLNYLNVSNNRLSGEIP  804


 Score = 98.2 bits (243),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 110/227 (48%), Gaps = 25/227 (11%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELS-QLRRLKILQCSFNDFSGN  642
            L+  N  L G L   + NL+ L SLNL  NN   +  R++   +  L+      N FSG+
Sbjct  325  LDAQNCSLSGPLPSSISNLTSLQSLNLYGNNLSGTLSRDICLNMPYLRAFDLGNNLFSGS  384

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IP  FG   +L  L+L  NN++G LP  + NL  L  L L  N L G IP  I N+  ++
Sbjct  385  IPKEFGNCSSLSDLFLRENNLTGELPREIGNLFNLGRLDLHYNFLTGPIPSTIFNMSNIR  444

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             ++   N F+G+                        LP D+G  LP L+   +  N  +G
Sbjct  445  GISFLGNFFTGT------------------------LPSDIGLGLPNLEELYLGYNNLTG  480

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
             IP+SLS  S +  L + +N+FSG  P+ FGNL +LE L +  N  T
Sbjct  481  AIPNSLSNASNIFWLGIGYNDFSGPFPKSFGNLRRLEYLNVNRNHFT  527


 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 69/123 (56%), Gaps = 0/123 (0%)
 Frame = -1

Query  785  LTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLR  606
            + P L NL+ L+ L++S N+  +S P E+  L+   +L  S N  SG+IPS  G +QN+ 
Sbjct  683  IPPSLWNLNDLLHLDVSSNSLKSSLPPEIGNLKVATLLNISKNQISGSIPSTIGGMQNMA  742

Query  605  FLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGS  426
             L    N + G +P S+ N+  LE L L  N L G IP+ +  L  L  LN+S+N  SG 
Sbjct  743  ELSFAENRLEGPIPESMGNMVALESLDLSNNKLSGGIPKTLVALSHLNYLNVSNNRLSGE  802

Query  425  FPL  417
             P+
Sbjct  803  IPI  805


 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 77/149 (52%), Gaps = 25/149 (17%)
 Frame = -1

Query  509  LEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNH  330
            L G+IP  +GNL  L  L++S N F G  P ++                          +
Sbjct  91   LVGTIPPHLGNLSFLVSLDISSNSFQGILPRELA-------------------------N  125

Query  329  LPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN  150
            L +L+   + SNKF+G+IPS  S    LQ L L FN+F+G +P +  N +KLE L L  N
Sbjct  126  LHRLEFINVTSNKFTGDIPSWFSLLPELQHLHLAFNSFTGIIPPDICNASKLESLVLGFN  185

Query  149  QLTGAIPREIGALSSLLIVDLSNNKLYGT  63
            QL G IP EIG L +L  + L +N+L G+
Sbjct  186  QLQGEIPNEIGNLQNLTWLSLGSNQLTGS  214


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 85/168 (51%), Gaps = 2/168 (1%)
 Frame = -1

Query  848  CNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ  669
            CN +  ++  L+L N  L   +   LGN++ L  + L  N    S P  L  L  L  L 
Sbjct  640  CNLK--KLGFLSLGNNELCCSIPACLGNITSLRYIYLGSNKLTFSIPPSLWNLNDLLHLD  697

Query  668  CSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR  489
             S N    ++P   G L+    L +  N ISG +P+++  +  +  L    N LEG IP 
Sbjct  698  VSSNSLKSSLPPEIGNLKVATLLNISKNQISGSIPSTIGGMQNMAELSFAENRLEGPIPE  757

Query  488  EIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPL  345
             +GN+  L+ L+LS+N  SG  P  ++ LS L  L++S N L GE+P+
Sbjct  758  SMGNMVALESLDLSNNKLSGGIPKTLVALSHLNYLNVSNNRLSGEIPI  805



>emb|CDP06347.1| unnamed protein product [Coffea canephora]
Length=308

 Score =   256 bits (655),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 154/306 (50%), Positives = 199/306 (65%), Gaps = 5/306 (2%)
 Frame = -1

Query  1043  HYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKI--SFDPHSILADNWSVNSITP  870
             HYF L    F  + L +   +++NITTD+ ALL+L+ ++  S +P  ILA NWSV S + 
Sbjct  5     HYFFL--LKFSMVFLAVGAASNSNITTDQSALLALRDRMIASSEPQEILAKNWSVTS-SV  61

Query  869   CNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQL  690
             C+W+GVTC  RH RV+ALN+ NM L G+L P LGNLSFLVSL+LS NNFH   PREL+ L
Sbjct  62    CDWMGVTCGPRHRRVTALNISNMKLTGDLPPQLGNLSFLVSLDLSSNNFHGELPRELAHL  121

Query  689   RRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNS  510
             RRL+ L    N+  G +PSWFG L  L+ L L NN+ SG LP S+ N+SKLE L L  NS
Sbjct  122   RRLRYLYLGINNLGGELPSWFGYLHKLQQLTLSNNSFSGSLPPSISNMSKLESLWLTDNS  181

Query  509   LEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNH  330
             +EG+IP E  NL  LK+L +  N  SG  PL   N+S L+ +SL  NSL G LP  + + 
Sbjct  182   IEGTIPIEFQNLHSLKILIIDRNQLSGPLPLHTFNISSLQIISLFQNSLSGILPDTICHA  241

Query  329   LPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN  150
             L KL    +  N   G++PS+LS+CS+LQTL+LP N   G +P+  GNLT LE L L SN
Sbjct  242   LHKLTYLGLGGNNLIGQMPSTLSECSMLQTLALPLNYLRGPIPKAIGNLTVLETLALESN  301

Query  149   QLTGAI  132
              L G +
Sbjct  302   NLRGKM  307


 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 97/200 (49%), Gaps = 30/200 (15%)
 Frame = -1

Query  650  SGNIPSWFGLL-----QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            + ++  W G+      + +  L + N  ++G LP  L NLS L  L L  N+  G +PRE
Sbjct  58   TSSVCDWMGVTCGPRHRRVTALNISNMKLTGDLPPQLGNLSFLVSLDLSSNNFHGELPRE  117

Query  485  IGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
            + +L +L+ L L  N+  G  P                 S FG        +L KLQ   
Sbjct  118  LAHLRRLRYLYLGINNLGGELP-----------------SWFG--------YLHKLQQLT  152

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
            + +N FSG +P S+S  S L++L L  N+  G +P EF NL  L+ L +  NQL+G +P 
Sbjct  153  LSNNSFSGSLPPSISNMSKLESLWLTDNSIEGTIPIEFQNLHSLKILIIDRNQLSGPLPL  212

Query  125  EIGALSSLLIVDLSNNKLYG  66
                +SSL I+ L  N L G
Sbjct  213  HTFNISSLQIISLFQNSLSG  232


 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 1/100 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G+LP  LGN L  L    + SN F GE+P  L+    L+ L L  NN  G +P  FG L 
Sbjct  88   GDLPPQLGN-LSFLVSLDLSSNNFHGELPRELAHLRRLRYLYLGINNLGGELPSWFGYLH  146

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            KL++L L +N  +G++P  I  +S L  + L++N + GT 
Sbjct  147  KLQQLTLSNNSFSGSLPPSISNMSKLESLWLTDNSIEGTI  186


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = -1

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGA  114
            K +G++P  L   S L +L L  NNF G +PRE  +L +L  L+L  N L G +P   G 
Sbjct  85   KLTGDLPPQLGNLSFLVSLDLSSNNFHGELPRELAHLRRLRYLYLGINNLGGELPSWFGY  144

Query  113  LSSLLIVDLSNNKLYGTF  60
            L  L  + LSNN   G+ 
Sbjct  145  LHKLQQLTLSNNSFSGSL  162



>ref|XP_006358154.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Solanum tuberosum]
Length=1191

 Score =   271 bits (694),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 155/324 (48%), Positives = 211/324 (65%), Gaps = 3/324 (1%)
 Frame = -1

Query  1037  FCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWI  858
               +S+ + H L+L  T  A  N+ TD+ ALL+ KS ++ D ++IL  NW+ ++ + CNWI
Sbjct  11    LVVSVIWHHLLILSAT--AEVNLKTDEAALLASKSYVTSDTYNILTSNWT-STTSVCNWI  67

Query  857   GVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLK  678
             GVTC SRH R+  L++ NMGL+G + P LGNLSFLVSL++S N F    PREL+ L RL+
Sbjct  68    GVTCGSRHQRIITLDISNMGLIGTIPPHLGNLSFLVSLDISSNGFQGILPRELANLHRLE  127

Query  677   ILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGS  498
              +  + N F+G+IPSWF LL  L+ L+L  N+ +G +P  + N SKLE L LG N L+G 
Sbjct  128   FINVTSNKFTGDIPSWFSLLPELQHLHLAFNSFTGIIPPDICNASKLESLVLGFNQLQGE  187

Query  497   IPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKL  318
             IP EIGNL  L  L+L  N  +GS PL + N+S L+ L L+ NSL G LP+D+  +LP+L
Sbjct  188   IPNEIGNLQNLTWLSLGSNQLTGSVPLSLYNISSLQRLVLTKNSLSGNLPVDICLNLPEL  247

Query  317   QIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
              +  +  N+F G+IP  + KCS LQ LSL FN FSG +P++ GNL  L  L+L  N L G
Sbjct  248   MVLALSDNEFDGQIPLGIDKCSKLQILSLSFNKFSGLIPKQIGNLNVLSILYLGCNDLKG  307

Query  137   AIPREIGALSSLLIVDLSNNKLYG  66
              IP EIG L +L I+D  N  L G
Sbjct  308   EIPEEIGNLRNLEILDAQNCSLSG  331


 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 121/251 (48%), Gaps = 25/251 (10%)
 Frame = -1

Query  797  LVGELTPDLG-NLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L  D+  NL  L+ L LS N F    P  + +  +L+IL  SFN FSG IP   G 
Sbjct  232  LSGNLPVDICLNLPELMVLALSDNEFDGQIPLGIDKCSKLQILSLSFNKFSGLIPKQIGN  291

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            L  L  LYLG N++ G +P  + NL  LE+L     SL G +P  I N+  L+ LNL  N
Sbjct  292  LNVLSILYLGCNDLKGEIPEEIGNLRNLEILDAQNCSLSGPLPSSISNITSLQSLNLYGN  351

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
            + SG+ P  I                          ++P L+ F + +N FSG IP    
Sbjct  352  NLSGTLPRYICL------------------------NMPDLRAFDLGNNLFSGNIPKEFG  387

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
             C+ L  L L  NN +G +PRE GNL  L +L L  N LTG IP  I  +S++  +    
Sbjct  388  NCTSLTDLFLRENNLTGELPREIGNLFNLGRLDLHYNFLTGPIPSTIFNMSNIRGISFLG  447

Query  80   NKLYGTFIQNL  48
            N   G+   ++
Sbjct  448  NFFTGSLPSDI  458


 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 122/232 (53%), Gaps = 1/232 (0%)
 Frame = -1

Query  833  NRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND  654
            N +S L L    L GE+  ++GNL  L  L+    +     P  +S +  L+ L    N+
Sbjct  293  NVLSILYLGCNDLKGEIPEEIGNLRNLEILDAQNCSLSGPLPSSISNITSLQSLNLYGNN  352

Query  653  FSGNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN  477
             SG +P +  L + +LR   LGNN  SG +P    N + L  L L  N+L G +PREIGN
Sbjct  353  LSGTLPRYICLNMPDLRAFDLGNNLFSGNIPKEFGNCTSLTDLFLRENNLTGELPREIGN  412

Query  476  LFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRS  297
            LF L  L+L  N  +G  P  I N+S +  +S   N   G LP D+G  LP L+   +  
Sbjct  413  LFNLGRLDLHYNFLTGPIPSTIFNMSNIRGISFLGNFFTGSLPSDIGLGLPNLEELYLGY  472

Query  296  NKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
            N  +G IP+SLS  S +  L + +N+FSGH PR FGNL  LE L +  N  T
Sbjct  473  NNLTGAIPNSLSNASNIFRLGIGYNDFSGHFPRSFGNLRCLEYLNVNGNHFT  524


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 98/312 (31%), Positives = 144/312 (46%), Gaps = 52/312 (17%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELS-QLRRLKILQCSFNDFSGNIPSWFGL  621
            L G +   L N+S L  L L++N+   + P ++   L  L +L  S N+F G IP     
Sbjct  208  LTGSVPLSLYNISSLQRLVLTKNSLSGNLPVDICLNLPELMVLALSDNEFDGQIPLGIDK  267

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
               L+ L L  N  SG +P  + NL+ L +L+LG N L+G IP EIGNL  L++L+  + 
Sbjct  268  CSKLQILSLSFNKFSGLIPKQIGNLNVLSILYLGCNDLKGEIPEEIGNLRNLEILDAQNC  327

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              SG  P  I N++ L++L+L  N+L G LP  +  ++P L+ F + +N FSG IP    
Sbjct  328  SLSGPLPSSISNITSLQSLNLYGNNLSGTLPRYICLNMPDLRAFDLGNNLFSGNIPKEFG  387

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNL----------------------------------  183
             C+ L  L L  NN +G +PRE GNL                                  
Sbjct  388  NCTSLTDLFLRENNLTGELPREIGNLFNLGRLDLHYNFLTGPIPSTIFNMSNIRGISFLG  447

Query  182  ---------------TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
                             LE+L+L  N LTGAIP  +   S++  + +  N   G F ++ 
Sbjct  448  NFFTGSLPSDIGLGLPNLEELYLGYNNLTGAIPNSLSNASNIFRLGIGYNDFSGHFPRSF  507

Query  47   DTP*LK*LSYYN  12
                L+ L Y N
Sbjct  508  GN--LRCLEYLN  517


 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 130/247 (53%), Gaps = 9/247 (4%)
 Frame = -1

Query  791  GELTPDLGNLS----FLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
            G L   +GNLS    ++ ++N   +      P E+  L  L  L    N  SG IP   G
Sbjct  556  GNLPASIGNLSSSLDYIYAVN---SEIRGYIPSEIGNLSGLSFLLLQGNYLSGFIPRTIG  612

Query  623  LLQNLRFLYLGNNN-ISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
             L+NL+ L L +N  ISG +P  L NL KL  L LG N L  SIP  +GN+  L+ + L 
Sbjct  613  NLKNLQALNLYDNKMISGPIPEELCNLKKLGFLSLGNNELCCSIPACLGNITSLRYIYLG  672

Query  446  DNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSS  267
             N  + S P  + NL+ L +L +S NSL   LP ++GN L    +  +  N+ SG IPS+
Sbjct  673  SNKLTFSIPPSLWNLNDLLHLDVSSNSLKSSLPPEIGN-LKVATLLNISKNQISGSIPST  731

Query  266  LSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDL  87
            +     +  LS   N   G +P   GN+  LE L L  N+L+G IP+ + ALS L  +++
Sbjct  732  IGGMQNMAELSFAENRLEGPIPESMGNMIALESLDLSHNKLSGGIPKSLVALSHLNYLNV  791

Query  86   SNNKLYG  66
            SNN+L G
Sbjct  792  SNNRLSG  798


 Score =   104 bits (259),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 121/232 (52%), Gaps = 2/232 (1%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNF-HNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G +   +GNL  L +LNL  N       P EL  L++L  L    N+   +IP+  G 
Sbjct  603  LSGFIPRTIGNLKNLQALNLYDNKMISGPIPEELCNLKKLGFLSLGNNELCCSIPACLGN  662

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            + +LR++YLG+N ++  +P SL+NL+ L  L +  NSL+ S+P EIGNL    LLN+S N
Sbjct  663  ITSLRYIYLGSNKLTFSIPPSLWNLNDLLHLDVSSNSLKSSLPPEIGNLKVATLLNISKN  722

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              SGS P  I  +  +  LS + N L G +P  +GN +  L+   +  NK SG IP SL 
Sbjct  723  QISGSIPSTIGGMQNMAELSFAENRLEGPIPESMGNMI-ALESLDLSHNKLSGGIPKSLV  781

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSS  105
              S L  L++  N  SG +P     +      FL +  L GA   +I A  S
Sbjct  782  ALSHLNYLNVSNNRLSGEIPIGGPFVNFSYDSFLSNEALCGAARLQIPACRS  833


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 146/311 (47%), Gaps = 42/311 (14%)
 Frame = -1

Query  866  NWIGVTCNSRHNRVSALNLFNMGL-----VGELTPDLGNLSFLVSLNLSQNNFHNS----  714
            N  G   NS  N   A N+F +G+      G      GNL  L  LN++ N+F       
Sbjct  474  NLTGAIPNSLSN---ASNIFRLGIGYNDFSGHFPRSFGNLRCLEYLNVNGNHFTREPSSP  530

Query  713  ---FPRELSQLRRLKILQCSFNDFSGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNL  546
               F   L+  R L+ L   +N  +GN+P+  G L  +L ++Y  N+ I G++P+ + NL
Sbjct  531  GLIFFDSLTNCRHLRKLWIGYNPLNGNLPASIGNLSSSLDYIYAVNSEIRGYIPSEIGNL  590

Query  545  SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF-SGSFPLDIlnlsklenlslsvn  369
            S L  L L  N L G IPR IGNL  L+ LNL DN   SG  P ++ NL KL  LSL  N
Sbjct  591  SGLSFLLLQGNYLSGFIPRTIGNLKNLQALNLYDNKMISGPIPEELCNLKKLGFLSLGNN  650

Query  368  sLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL------------------------S  261
             L   +P  LGN +  L+   + SNK +  IP SL                         
Sbjct  651  ELCCSIPACLGN-ITSLRYIYLGSNKLTFSIPPSLWNLNDLLHLDVSSNSLKSSLPPEIG  709

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
               +   L++  N  SG +P   G +  + +L    N+L G IP  +G + +L  +DLS+
Sbjct  710  NLKVATLLNISKNQISGSIPSTIGGMQNMAELSFAENRLEGPIPESMGNMIALESLDLSH  769

Query  80   NKLYGTFIQNL  48
            NKL G   ++L
Sbjct  770  NKLSGGIPKSL  780


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 83/159 (52%), Gaps = 28/159 (18%)
 Frame = -1

Query  539  LEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLF  360
            L++ ++G   L G+IP  +GNL  L  L++S N F G  P ++                 
Sbjct  81   LDISNMG---LIGTIPPHLGNLSFLVSLDISSNGFQGILPRELA----------------  121

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
                     +L +L+   + SNKF+G+IPS  S    LQ L L FN+F+G +P +  N +
Sbjct  122  ---------NLHRLEFINVTSNKFTGDIPSWFSLLPELQHLHLAFNSFTGIIPPDICNAS  172

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGT  63
            KLE L L  NQL G IP EIG L +L  + L +N+L G+
Sbjct  173  KLESLVLGFNQLQGEIPNEIGNLQNLTWLSLGSNQLTGS  211


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 84/168 (50%), Gaps = 2/168 (1%)
 Frame = -1

Query  848  CNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ  669
            CN +  ++  L+L N  L   +   LGN++ L  + L  N    S P  L  L  L  L 
Sbjct  637  CNLK--KLGFLSLGNNELCCSIPACLGNITSLRYIYLGSNKLTFSIPPSLWNLNDLLHLD  694

Query  668  CSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR  489
             S N    ++P   G L+    L +  N ISG +P+++  +  +  L    N LEG IP 
Sbjct  695  VSSNSLKSSLPPEIGNLKVATLLNISKNQISGSIPSTIGGMQNMAELSFAENRLEGPIPE  754

Query  488  EIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPL  345
             +GN+  L+ L+LS N  SG  P  ++ LS L  L++S N L GE+P+
Sbjct  755  SMGNMIALESLDLSHNKLSGGIPKSLVALSHLNYLNVSNNRLSGEIPI  802



>emb|CDP21851.1| unnamed protein product, partial [Coffea canephora]
Length=319

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 151/304 (50%), Positives = 202/304 (66%), Gaps = 4/304 (1%)
 Frame = -1

Query  1043  HYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSK-ISFDPHSILADNWSVNSITPC  867
             HY  L  F   SL +    N+  N+TTD+ ALL+L+ + I+ +P  ILA NWS+ S + C
Sbjct  7     HYLFLINFSLVSLAMMAAGNS--NVTTDQLALLALRDRMINSEPREILAKNWSITS-SVC  63

Query  866   NWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLR  687
             +WIGVTC SRH+RV+ALN+ NM L G L P LGNLSFLVSLN+S+NNFH   PREL  LR
Sbjct  64    DWIGVTCGSRHHRVTALNISNMNLTGTLPPQLGNLSFLVSLNISKNNFHGELPRELVHLR  123

Query  686   RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSL  507
             RL+ L    N+  G +PS FG L  L++L L NN+ SG +P S+ N+SKLE L+L  NS+
Sbjct  124   RLRYLNFKINNLGGELPSCFGYLHKLQYLSLANNSFSGSIPPSISNMSKLETLYLSFNSI  183

Query  506   EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
             EG+IP E  NL  LK L +  N  SG  PL + N+S LEN++   N+L+G LP D+   L
Sbjct  184   EGTIPTEFQNLHNLKTLIIEWNQLSGPLPLHVFNISSLENIAFWNNNLYGTLPDDICQRL  243

Query  326   PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ  147
              KL    +  N   G IPS++S+CSLL+ L L  N+F+G +P   GNLT LE++ L++N+
Sbjct  244   KKLTWLNLADNNLIGRIPSTVSQCSLLRYLCLSGNHFTGPIPMGIGNLTMLEEILLQTNK  303

Query  146   LTGA  135
             LTG+
Sbjct  304   LTGS  307


 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 112/229 (49%), Gaps = 39/229 (17%)
 Frame = -1

Query  719  NSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRF-----LYLGNNNISGFLPTSL  555
            NS PRE        IL  ++   + ++  W G+    R      L + N N++G LP  L
Sbjct  45   NSEPRE--------ILAKNW-SITSSVCDWIGVTCGSRHHRVTALNISNMNLTGTLPPQL  95

Query  554  FNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlsls  375
             NLS L  L++  N+  G +PRE+ +L +L+ LN   N+  G  P               
Sbjct  96   GNLSFLVSLNISKNNFHGELPRELVHLRRLRYLNFKINNLGGELP---------------  140

Query  374  vnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPRE  195
              S FG        +L KLQ   + +N FSG IP S+S  S L+TL L FN+  G +P E
Sbjct  141  --SCFG--------YLHKLQYLSLANNSFSGSIPPSISNMSKLETLYLSFNSIEGTIPTE  190

Query  194  FGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            F NL  L+ L +  NQL+G +P  +  +SSL  +   NN LYGT   ++
Sbjct  191  FQNLHNLKTLIIEWNQLSGPLPLHVFNISSLENIAFWNNNLYGTLPDDI  239



>emb|CDP08225.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/333 (45%), Positives = 203/333 (61%), Gaps = 28/333 (8%)
 Frame = -1

Query  971  ITTDKHALLSLKSKISFDPHSILADNWSVNSITP--CNWIGVTCNSRHNRVSALNLFNMG  798
            + TD+ ALL+LK+ I+ + H  L+ NWS  +     C+WIGV C+SRH RV+ALN+ NMG
Sbjct  6    LGTDQSALLALKAHITSEQHEFLSKNWSSTAAASSVCDWIGVQCSSRHQRVTALNISNMG  65

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G + PDLGNLSFLVSL+L  N+FH + P ELS LRRL+ +  S N F+G IP WFG  
Sbjct  66   LTGTIPPDLGNLSFLVSLDLRNNSFHGNLPEELSHLRRLRFILFSNNRFTGEIPMWFGHF  125

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
              LRFL+L NN  SGF+P+S+ N SK+E L L  N LEG+IP ++GNL  LK L+LS N+
Sbjct  126  PELRFLFLDNNGFSGFIPSSISNSSKVETLTLRGNFLEGNIPEKMGNLSVLKDLSLSGNY  185

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGN-------------------------  333
              G  PL +   S+L++L LS     G +P ++GN                         
Sbjct  186  LVGQIPLSLCKFSELQSLDLSSTRFSGHIPKEIGNLEKLTYLSLMNNNFTGNAFALPSKI  245

Query  332  -HLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
             +L KL    + +N F+G IP  + K   L+ L L  NN +G +PRE GNL  L++L L 
Sbjct  246  GNLEKLTYLSLMTNNFTGVIPREIGKLHGLKVLVLGRNNLTGTIPREMGNLQNLQRLDLE  305

Query  155  SNQLTGAIPREIGALSSLLIVDLSNNKLYGTFI  57
             NQ+TG+IPREIG L+ L  +  +NN L G ++
Sbjct  306  WNQITGSIPREIGNLTMLTELYFTNNSLIGKYV  338


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 52/104 (50%), Gaps = 1/104 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P DLGN L  L    +R+N F G +P  LS    L+ +    N F+G +P  FG+  
Sbjct  68   GTIPPDLGN-LSFLVSLDLRNNSFHGNLPEELSHLRRLRFILFSNNRFTGEIPMWFGHFP  126

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            +L  LFL +N  +G IP  I   S +  + L  N L G   + +
Sbjct  127  ELRFLFLDNNGFSGFIPSSISNSSKVETLTLRGNFLEGNIPEKM  170



>ref|XP_009589616.1| PREDICTED: receptor-like protein kinase [Nicotiana tomentosiformis]
Length=366

 Score =   253 bits (645),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 153/308 (50%), Positives = 204/308 (66%), Gaps = 5/308 (2%)
 Frame = -1

Query  998  CLTINAHTNITTDKHALLSLKSKIS-FDPHSILADNWSVNSITPCNWIGVTCNSRHNRVS  822
            CL+I    NITTD+ ALL+L+S+ S ++ H +LA NWS+ + T C+WIGVTC SRH RV+
Sbjct  21   CLSI---ANITTDQTALLTLRSQFSLYNSHHLLARNWSIFTPT-CSWIGVTCGSRHQRVT  76

Query  821  ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            ALNL +M L G + P LGNLSFL+SL++  N+F+ S P EL++LRRLK++    N+F+G 
Sbjct  77   ALNLSSMNLKGMVPPQLGNLSFLISLDIRNNSFYGSLPEELARLRRLKMINVMNNNFTGA  136

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IPS+FGLL NL  LYL  N  SG +P SLFN++KL+ L L  N L G IP+EI  L  L 
Sbjct  137  IPSFFGLLPNLHSLYLSFNQFSGNIPPSLFNITKLKYLRLRGNFLGGEIPQEISRLCCLT  196

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             ++L DN   GS P  + N S L+ + L+ N+L+G+LP ++ ++LP L+   + SN+F G
Sbjct  197  SIDLQDNKLIGSIPPTMFNQSSLKQIGLTKNNLYGKLPGNICDNLPDLEALALSSNRFDG  256

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
             IP +L  CS LQ LSL  N+F+G +P E GNLT L  L L    L G IP EIG L  L
Sbjct  257  LIPPNLQNCSKLQILSLSQNDFTGTIPTEIGNLTMLTALQLGVTYLKGEIPMEIGYLQKL  316

Query  101  LIVDLSNN  78
             I  L  N
Sbjct  317  QIFGLYQN  324


 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 97/201 (48%), Gaps = 30/201 (15%)
 Frame = -1

Query  635  SWFGLL-----QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
            SW G+      Q +  L L + N+ G +P  L NLS L  L +  NS  GS+P E+  L 
Sbjct  62   SWIGVTCGSRHQRVTALNLSSMNLKGMVPPQLGNLSFLISLDIRNNSFYGSLPEELARLR  121

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
            +LK++N+ +N+F+G+ P                 S FG         LP L    +  N+
Sbjct  122  RLKMINVMNNNFTGAIP-----------------SFFG--------LLPNLHSLYLSFNQ  156

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
            FSG IP SL   + L+ L L  N   G +P+E   L  L  + L+ N+L G+IP  +   
Sbjct  157  FSGNIPPSLFNITKLKYLRLRGNFLGGEIPQEISRLCCLTSIDLQDNKLIGSIPPTMFNQ  216

Query  110  SSLLIVDLSNNKLYGTFIQNL  48
            SSL  + L+ N LYG    N+
Sbjct  217  SSLKQIGLTKNNLYGKLPGNI  237


 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 73/136 (54%), Gaps = 1/136 (1%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQ-LRRLKILQC  666
            SR   +++++L +  L+G + P + N S L  + L++NN +   P  +   L  L+ L  
Sbjct  190  SRLCCLTSIDLQDNKLIGSIPPTMFNQSSLKQIGLTKNNLYGKLPGNICDNLPDLEALAL  249

Query  665  SFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            S N F G IP        L+ L L  N+ +G +PT + NL+ L  L LGV  L+G IP E
Sbjct  250  SSNRFDGLIPPNLQNCSKLQILSLSQNDFTGTIPTEIGNLTMLTALQLGVTYLKGEIPME  309

Query  485  IGNLFQLKLLNLSDNH  438
            IG L +L++  L  N+
Sbjct  310  IGYLQKLQIFGLYQNN  325



>ref|XP_006362615.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Solanum tuberosum]
Length=1082

 Score =   266 bits (681),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 155/327 (47%), Positives = 216/327 (66%), Gaps = 7/327 (2%)
 Frame = -1

Query  1037  FCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNW  861
             F L +F    ++L  + +   NI+TD+ ALL+LKS ISF P++ILA NWS  S TP C W
Sbjct  9     FALVVF----ILLHTSFSTVPNISTDEAALLALKSHISFSPNNILATNWS--SSTPVCTW  62

Query  860   IGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRL  681
             IG+TC SRH+RV+AL++ +M L G + P LGNLSFLVSLN++ N FH + P+EL+ L+RL
Sbjct  63    IGITCTSRHHRVTALDISSMQLHGTIPPHLGNLSFLVSLNINNNRFHGNLPQELAHLQRL  122

Query  680   KILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEG  501
             K++  + N+ +G IP+  GLL +LR L L +N  SG +P+SL NL+KLEVL +  N LEG
Sbjct  123   KLIDVTSNNLTGAIPTSLGLLVDLRILRLSSNQFSGKIPSSLSNLTKLEVLRITGNFLEG  182

Query  500   SIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPK  321
              IPRE+G+L  +  LNL  NH +GS P  I N++ +  + L+ N+L GELP  + ++LP 
Sbjct  183   EIPRELGDLHYMTALNLESNHLTGSIPPSIYNITTMRIIGLTNNNLTGELPTTICDYLPN  242

Query  320   LQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
             L+   + +N   G IP +L KC  L+ LSL  N F+G +PRE GN+T L +L+L      
Sbjct  243   LEGLHLSTNILGGIIPPNLEKCKKLKVLSLSVNEFTGTIPRELGNITNLAELYLGLLHFE  302

Query  140   GAIPREIGALSSLLIVDLSNNKLYGTF  60
             G IP E+G L  L I+ LS  KL G+ 
Sbjct  303   GEIPVELGNLKKLQILSLSGCKLTGSI  329


 Score =   107 bits (268),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 111/224 (50%), Gaps = 25/224 (11%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGN-LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            + L N  L GEL   + + L  L  L+LS N      P  L + ++LK+L  S N+F+G 
Sbjct  221  IGLTNNNLTGELPTTICDYLPNLEGLHLSTNILGGIIPPNLEKCKKLKVLSLSVNEFTGT  280

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IP   G + NL  LYLG  +  G +P  L NL KL++L L    L GSIP  I N+  L+
Sbjct  281  IPRELGNITNLAELYLGLLHFEGEIPVELGNLKKLQILSLSGCKLTGSIPTSIFNMSALR  340

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             + L +N  SG+                        LP DLG+ +P L+     +N  SG
Sbjct  341  AVVLDENMLSGN------------------------LPADLGSGIPSLETLFCANNYLSG  376

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN  150
             I +++S  S L  + L  N+F+G +P+  GNL  LE L L+ N
Sbjct  377  FISATISNASRLSEIDLSINSFTGPIPQSLGNLENLEVLDLQVN  420


 Score =   104 bits (260),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 86/256 (34%), Positives = 125/256 (49%), Gaps = 6/256 (2%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF-SGNIPSWFGL  621
            L G ++  + N S L  ++LS N+F    P+ L  L  L++L    N+F S +  S+   
Sbjct  374  LSGFISATISNASRLSEIDLSINSFTGPIPQSLGNLENLEVLDLQVNNFVSDSALSFLTS  433

Query  620  L---QNLRFLYLGNNNISGFLPTSLFNLSK-LEVLHLGVNSLEGSIPREIGNLFQLKLLN  453
            L   + LR L    N + GF P S+ N S  L+        L+GSIP EIGNL  +  +N
Sbjct  434  LTHCRKLRELTFAKNPLEGFFPASIGNFSDFLQFFEGWTCKLKGSIPGEIGNLTGVIRIN  493

Query  452  LSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIP  273
             S N  +G  P  I  +  L+   L  N + G +P  + N L  L    +  N+FSG +P
Sbjct  494  FSQNDLTGHIPKTIQGMLNLQEFYLESNKIEGVIPDSICN-LKNLGALFLSGNQFSGRVP  552

Query  272  SSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIV  93
              L K + ++ LSL  N  +  +P   G+L  L +    SN L G IP EIG L S  ++
Sbjct  553  PCLGKVTSMRYLSLADNMLNSSLPESLGSLPDLIEFNFSSNLLHGKIPIEIGNLKSATLI  612

Query  92   DLSNNKLYGTFIQNLD  45
            DLS N  +G     L+
Sbjct  613  DLSKNDFFGMIPSTLE  628


 Score =   104 bits (259),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 113/217 (52%), Gaps = 1/217 (0%)
 Frame = -1

Query  716  SFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKL  537
            S P E+  L  +  +  S ND +G+IP     + NL+  YL +N I G +P S+ NL  L
Sbjct  478  SIPGEIGNLTGVIRINFSQNDLTGHIPKTIQGMLNLQEFYLESNKIEGVIPDSICNLKNL  537

Query  536  EVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFG  357
              L L  N   G +P  +G +  ++ L+L+DN  + S P  + +L  L   + S N L G
Sbjct  538  GALFLSGNQFSGRVPPCLGKVTSMRYLSLADNMLNSSLPESLGSLPDLIEFNFSSNLLHG  597

Query  356  ELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTK  177
            ++P+++GN L    +  +  N F G IPS+L     L +LSL  N   G +P  F  +  
Sbjct  598  KIPIEIGN-LKSATLIDLSKNDFFGMIPSTLEGLDRLISLSLAHNKLDGPIPDSFRKILA  656

Query  176  LEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            LE L L SN L+G IP+ + AL  L  ++ S N+  G
Sbjct  657  LEYLDLSSNNLSGEIPKSLEALVYLKYLNFSFNEFSG  693


 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 89/295 (30%), Positives = 130/295 (44%), Gaps = 53/295 (18%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL-LQ  615
            GE+  +LGNL  L  L+LS      S P  +  +  L+ +    N  SGN+P+  G  + 
Sbjct  303  GEIPVELGNLKKLQILSLSGCKLTGSIPTSIFNMSALRAVVLDENMLSGNLPADLGSGIP  362

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            +L  L+  NN +SGF+  ++ N S+L  + L +NS  G IP+ +GNL  L++L+L  N+F
Sbjct  363  SLETLFCANNYLSGFISATISNASRLSEIDLSINSFTGPIPQSLGNLENLEVLDLQVNNF  422

Query  434  ----------------------------SGSFPLDIlnlsklenlslsvnsLF-GELPLD  342
                                         G FP  I N S              G +P +
Sbjct  423  VSDSALSFLTSLTHCRKLRELTFAKNPLEGFFPASIGNFSDFLQFFEGWTCKLKGSIPGE  482

Query  341  LGN----------------HLPK-------LQIFVMRSNKFSGEIPSSLSKCSLLQTLSL  231
            +GN                H+PK       LQ F + SNK  G IP S+     L  L L
Sbjct  483  IGNLTGVIRINFSQNDLTGHIPKTIQGMLNLQEFYLESNKIEGVIPDSICNLKNLGALFL  542

Query  230  PFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
              N FSG VP   G +T +  L L  N L  ++P  +G+L  L+  + S+N L+G
Sbjct  543  SGNQFSGRVPPCLGKVTSMRYLSLADNMLNSSLPESLGSLPDLIEFNFSSNLLHG  597


 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 84/250 (34%), Positives = 130/250 (52%), Gaps = 7/250 (3%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G + P+L     L  L+LS N F  + PREL  +  L  L      F G IP   G L
Sbjct  253  LGGIIPPNLEKCKKLKVLSLSVNEFTGTIPRELGNITNLAELYLGLLHFEGEIPVELGNL  312

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN-LFQLKLLNLSDN  441
            + L+ L L    ++G +PTS+FN+S L  + L  N L G++P ++G+ +  L+ L  ++N
Sbjct  313  KKLQILSLSGCKLTGSIPTSIFNMSALRAVVLDENMLSGNLPADLGSGIPSLETLFCANN  372

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIP----  273
            + SG     I N S+L  + LS+NS  G +P  LGN L  L++  ++ N F  +      
Sbjct  373  YLSGFISATISNASRLSEIDLSINSFTGPIPQSLGN-LENLEVLDLQVNNFVSDSALSFL  431

Query  272  SSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR-SNQLTGAIPREIGALSSLLI  96
            +SL+ C  L+ L+   N   G  P   GN +   + F   + +L G+IP EIG L+ ++ 
Sbjct  432  TSLTHCRKLRELTFAKNPLEGFFPASIGNFSDFLQFFEGWTCKLKGSIPGEIGNLTGVIR  491

Query  95   VDLSNNKLYG  66
            ++ S N L G
Sbjct  492  INFSQNDLTG  501


 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 106/223 (48%), Gaps = 1/223 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +  ++GNL+ ++ +N SQN+     P+ +  +  L+      N   G IP     L
Sbjct  475  LKGSIPGEIGNLTGVIRINFSQNDLTGHIPKTIQGMLNLQEFYLESNKIEGVIPDSICNL  534

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            +NL  L+L  N  SG +P  L  ++ +  L L  N L  S+P  +G+L  L   N S N 
Sbjct  535  KNLGALFLSGNQFSGRVPPCLGKVTSMRYLSLADNMLNSSLPESLGSLPDLIEFNFSSNL  594

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
              G  P++I NL     + LS N  FG +P  L   L +L    +  NK  G IP S  K
Sbjct  595  LHGKIPIEIGNLKSATLIDLSKNDFFGMIPSTL-EGLDRLISLSLAHNKLDGPIPDSFRK  653

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
               L+ L L  NN SG +P+    L  L+ L    N+ +G IP
Sbjct  654  ILALEYLDLSSNNLSGEIPKSLEALVYLKYLNFSFNEFSGEIP  696


 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 77/162 (48%), Gaps = 7/162 (4%)
 Frame = -1

Query  905  LADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNN  726
            L+ N     + PC  +G   + R+     L+L +  L   L   LG+L  L+  N S N 
Sbjct  542  LSGNQFSGRVPPC--LGKVTSMRY-----LSLADNMLNSSLPESLGSLPDLIEFNFSSNL  594

Query  725  FHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNL  546
             H   P E+  L+   ++  S NDF G IPS    L  L  L L +N + G +P S   +
Sbjct  595  LHGKIPIEIGNLKSATLIDLSKNDFFGMIPSTLEGLDRLISLSLAHNKLDGPIPDSFRKI  654

Query  545  SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
              LE L L  N+L G IP+ +  L  LK LN S N FSG  P
Sbjct  655  LALEYLDLSSNNLSGEIPKSLEALVYLKYLNFSFNEFSGEIP  696


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = -1

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
            + S +  G IP  L   S L +L++  N F G++P+E  +L +L+ + + SN LTGAIP 
Sbjct  79   ISSMQLHGTIPPHLGNLSFLVSLNINNNRFHGNLPQELAHLQRLKLIDVTSNNLTGAIPT  138

Query  125  EIGALSSLLIVDLSNNKLYGTFIQNL  48
             +G L  L I+ LS+N+  G    +L
Sbjct  139  SLGLLVDLRILRLSSNQFSGKIPSSL  164


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 53/104 (51%), Gaps = 1/104 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P  LGN L  L    + +N+F G +P  L+    L+ + +  NN +G +P   G L 
Sbjct  86   GTIPPHLGN-LSFLVSLNINNNRFHGNLPQELAHLQRLKLIDVTSNNLTGAIPTSLGLLV  144

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             L  L L SNQ +G IP  +  L+ L ++ ++ N L G   + L
Sbjct  145  DLRILRLSSNQFSGKIPSSLSNLTKLEVLRITGNFLEGEIPREL  188



>emb|CDO96824.1| unnamed protein product [Coffea canephora]
Length=1165

 Score =   266 bits (681),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 204/306 (67%), Gaps = 1/306 (0%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            NITTD+ ALLSLK+KI+ DPH ILA NWS  S + C+W GVTC SRH+RV+ALN+ N+GL
Sbjct  29   NITTDQSALLSLKAKITGDPHEILASNWSATS-SVCDWRGVTCGSRHSRVTALNISNLGL  87

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             G + P LGNLSFL+SL++S NNF+   P EL +L RL++L    N  SGNIP W G  Q
Sbjct  88   TGTIPPQLGNLSFLMSLDMSGNNFYGELPHELIRLSRLRVLSLGINMLSGNIPPWVGSFQ  147

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             LR   L NN+ +GF+P S+ N+SKLE  +L VNSL+G+IP EIG L  LK + L  N  
Sbjct  148  QLRHFSLKNNSFTGFIPPSISNMSKLETFNLQVNSLQGAIPLEIGKLKMLKRIVLDYNQL  207

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            SGS P ++ N+S LE + L  NSL G L  ++ + L  L    +  N+ SG IP+SLS+C
Sbjct  208  SGSLPSEMFNISSLEAIGLQNNSLSGSLSSNICSRLQGLTWLDLSINELSGMIPASLSEC  267

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
            S L+ L L +NNFSG +P E GNLT L++L+L  N L G IP   G L++L  + L  N 
Sbjct  268  SKLRVLGLSYNNFSGVMPEEVGNLTALQELYLSENNLIGVIPEGFGNLTALKRLYLRRNN  327

Query  74   LYGTFI  57
            L GT +
Sbjct  328  LIGTIL  333


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 115/217 (53%), Gaps = 1/217 (0%)
 Frame = -1

Query  716  SFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKL  537
            S P  +  L  L +L    N  SG +PS    LQNL+ L+L +N +SG +P  +  L +L
Sbjct  557  SIPDGIGNLSSLIVLNLGGNHLSGPVPSTMEYLQNLQALFLSDNQLSGSIPDRICKLKRL  616

Query  536  EVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFG  357
              ++LG N   GS+P  + N+  L+ ++ + N    S P  + NL+ L  L+LS NSL G
Sbjct  617  YQIYLGQNQFRGSMPSCLNNISSLREIDFAGNLLDSSIPASLWNLTDLLTLNLSYNSLSG  676

Query  356  ELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTK  177
             LP + GN L  + +F +  N  +G IPSSL     L  LSL  N   G VP     +  
Sbjct  677  SLPYETGN-LKVVTLFDLSGNHLNGNIPSSLGGLQSLAKLSLAQNKLQGPVPDSLNQMLS  735

Query  176  LEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            LE L L +N L+G IP+ +  L  L  ++LS N+L G
Sbjct  736  LEFLDLSNNNLSGPIPKSLETLLYLKYINLSFNRLRG  772


 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 134/291 (46%), Gaps = 32/291 (11%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCS  663
            SR   ++ L+L    L G +   L   S L  L LS NNF    P E+  L  L+ L  S
Sbjct  241  SRLQGLTWLDLSINELSGMIPASLSECSKLRVLGLSYNNFSGVMPEEVGNLTALQELYLS  300

Query  662  FNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEG------  501
             N+  G IP  FG L  L+ LYL  NN+ G +    F     +     +NSL G      
Sbjct  301  ENNLIGVIPEGFGNLTALKRLYLRRNNLIGTILALEFEQISYKCASRNINSLRGTILIEI  360

Query  500  -------------------SIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlsl  378
                               SIP E+GNL  L+  NL  N  +GS P  I N+S L+ L L
Sbjct  361  RNLNKPKIASLFLKKKFLCSIPHELGNLRHLEGFNLGFNSLTGSIPAQIFNISTLQVLDL  420

Query  377  svnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPR  198
            S N+L G LP + G  L  L + V+ SN+F G IP+S+S  S L  L L  N FSG +P 
Sbjct  421  SNNTLSGTLPSNTGYGLINLAMLVLFSNEFDGVIPTSISNASKLTFLELAGNRFSGPIPN  480

Query  197  EFGNLTKLEKLFLRSNQLTGA-IPREIGALSSLL------IVDLSNNKLYG  66
              GNL  L  L L  N LT     RE+  +S L       I+D   N L+G
Sbjct  481  SLGNLRLLRYLDLHDNHLTTEPSSRELSFISYLTNCKYLKILDFYENPLHG  531


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 103/321 (32%), Positives = 144/321 (45%), Gaps = 64/321 (20%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLG----NLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSF  660
            +  L+L N  L G L  + G    NL+ LV   L  N F    P  +S   +L  L+ + 
Sbjct  415  LQVLDLSNNTLSGTLPSNTGYGLINLAMLV---LFSNEFDGVIPTSISNASKLTFLELAG  471

Query  659  NDFSGNIPSWFGLLQNLRFLYLGNNNIS-------------------------------G  573
            N FSG IP+  G L+ LR+L L +N+++                               G
Sbjct  472  NRFSGPIPNSLGNLRLLRYLDLHDNHLTTEPSSRELSFISYLTNCKYLKILDFYENPLHG  531

Query  572  FLPTSLFNLS-KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsk  396
            FLP S+ NLS  +E  +     ++GSIP  IGNL  L +LNL  NH SG  P  +  L  
Sbjct  532  FLPMSVGNLSTSMEGFYAYGCGIKGSIPDGIGNLSSLIVLNLGGNHLSGPVPSTMEYLQN  591

Query  395  lenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL-------  237
            L+ L LS N L G +P D    L +L    +  N+F G +PS L+  S L+ +       
Sbjct  592  LQALFLSDNQLSGSIP-DRICKLKRLYQIYLGQNQFRGSMPSCLNNISSLREIDFAGNLL  650

Query  236  --SLP---------------FNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALS  108
              S+P               +N+ SG +P E GNL  +    L  N L G IP  +G L 
Sbjct  651  DSSIPASLWNLTDLLTLNLSYNSLSGSLPYETGNLKVVTLFDLSGNHLNGNIPSSLGGLQ  710

Query  107  SLLIVDLSNNKLYGTFIQNLD  45
            SL  + L+ NKL G    +L+
Sbjct  711  SLAKLSLAQNKLQGPVPDSLN  731


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 76/233 (33%), Positives = 112/233 (48%), Gaps = 29/233 (12%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            + AL L +  L G +   +  L  L  + L QN F  S P  L+ +  L+ +     DF+
Sbjct  592  LQALFLSDNQLSGSIPDRICKLKRLYQIYLGQNQFRGSMPSCLNNISSLREI-----DFA  646

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            GN+                   +   +P SL+NL+ L  L+L  NSL GS+P E GNL  
Sbjct  647  GNL-------------------LDSSIPASLWNLTDLLTLNLSYNSLSGSLPYETGNLKV  687

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
            + L +LS NH +G+ P  +  L  L  LSL+ N L G +P  L N +  L+   + +N  
Sbjct  688  VTLFDLSGNHLNGNIPSSLGGLQSLAKLSLAQNKLQGPVPDSL-NQMLSLEFLDLSNNNL  746

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPRE--FGNLTKLEKLFLRSNQLTGA  135
            SG IP SL     L+ ++L FN   G +P    F N T   + F+ ++ L GA
Sbjct  747  SGPIPKSLETLLYLKYINLSFNRLRGEIPSSGPFKNFTY--ESFMSNDDLCGA  797



>ref|XP_011091709.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1195

 Score =   266 bits (679),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/312 (48%), Positives = 209/312 (67%), Gaps = 1/312 (0%)
 Frame = -1

Query  995  LTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSAL  816
            LT + + NITTD+ +LLSLKS++  +P  IL+ NWS+ S   C WIGV+C+ RH+R++AL
Sbjct  5    LTSSKNLNITTDQTSLLSLKSRLHLEPSHILSQNWSIPSDV-CTWIGVSCSRRHHRITAL  63

Query  815  NLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIP  636
            N+ +MGL G + P LGNLSFLVS+++  N+F  + P EL+QLRRL+ L  S N+F+G+IP
Sbjct  64   NISDMGLKGTIPPHLGNLSFLVSIDMKGNSFQGNLPVELAQLRRLRFLDLSSNNFTGHIP  123

Query  635  SWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLL  456
            +  G L  ++ L L NNN SGF+P ++FNLSKLE+L L  NSL G +P +IG L  L +L
Sbjct  124  ASLGFLSKIQGLSLRNNNFSGFIPATIFNLSKLEMLDLSFNSLGGKLPEQIGKLQNLMVL  183

Query  455  NLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEI  276
            ++ +N  +GS P ++ N+SKLE L+L+ N L GELP D+   LP LQ   +  N  SG I
Sbjct  184  SIQNNQLTGSIPFELYNVSKLEMLALTRNRLSGELPDDICGRLPGLQTISLSWNALSGRI  243

Query  275  PSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLI  96
            P S  +C  L  LSL  N F+G +PRE GN+T LE L+L +N LTG +P EIG L  L  
Sbjct  244  PVSFPECRRLTLLSLSNNAFAGPIPREIGNVTMLETLYLGANNLTGDVPEEIGNLRRLQQ  303

Query  95   VDLSNNKLYGTF  60
            + +  N   G+ 
Sbjct  304  LGMGKNIFSGSI  315


 Score =   156 bits (395),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 107/259 (41%), Positives = 150/259 (58%), Gaps = 1/259 (0%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL-SQLRRLKILQCSFNDFSG  645
             L++ N  L G +  +L N+S L  L L++N      P ++  +L  L+ +  S+N  SG
Sbjct  182  VLSIQNNQLTGSIPFELYNVSKLEMLALTRNRLSGELPDDICGRLPGLQTISLSWNALSG  241

Query  644  NIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQL  465
             IP  F   + L  L L NN  +G +P  + N++ LE L+LG N+L G +P EIGNL +L
Sbjct  242  RIPVSFPECRRLTLLSLSNNAFAGPIPREIGNVTMLETLYLGANNLTGDVPEEIGNLRRL  301

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
            + L +  N FSGS PL I N+S L  L+L+ + L G LP  + +HLP LQ   + +N   
Sbjct  302  QQLGMGKNIFSGSIPLSIFNISSLVLLNLAWSGLSGTLPSHMCSHLPNLQFLNLYNNYLY  361

Query  284  GEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSS  105
            G IPS+   CS LQ LSL  N F+G +PRE GNLT L  L L  N+LTG IPRE+G L  
Sbjct  362  GPIPSTWDGCSRLQDLSLRDNKFTGFIPREIGNLTMLRTLRLFHNRLTGEIPRELGKLQQ  421

Query  104  LLIVDLSNNKLYGTFIQNL  48
            L  + L+ N L G+  + +
Sbjct  422  LEQLHLAANLLNGSIPEEI  440


 Score =   127 bits (318),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 99/280 (35%), Positives = 142/280 (51%), Gaps = 49/280 (18%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            R++ L+L N    G +  ++GN++ L +L L  NN     P E+  LRRL+ L    N F
Sbjct  252  RLTLLSLSNNAFAGPIPREIGNVTMLETLYLGANNLTGDVPEEIGNLRRLQQLGMGKNIF  311

Query  650  SGNIP--------------SWFGL-----------LQNLRFLYLGN--------------  588
            SG+IP              +W GL           L NL+FL L N              
Sbjct  312  SGSIPLSIFNISSLVLLNLAWSGLSGTLPSHMCSHLPNLQFLNLYNNYLYGPIPSTWDGC  371

Query  587  ----------NNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
                      N  +GF+P  + NL+ L  L L  N L G IPRE+G L QL+ L+L+ N 
Sbjct  372  SRLQDLSLRDNKFTGFIPREIGNLTMLRTLRLFHNRLTGEIPRELGKLQQLEQLHLAANL  431

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             +GS P +I N+S L  L+L+ N L G LP  +G+ LP L +  + +N  SG IP S++ 
Sbjct  432  LNGSIPEEIANISTLTLLALTANRLSGSLPKSIGSRLPDLDLISLETNLLSGHIPDSIAN  491

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
             S L  ++L  N+FSG +P + G+L  L++LF+  N LTG
Sbjct  492  SSKLTYINLGNNHFSGTIPSKLGSLRLLQRLFVHGNNLTG  531


 Score =   109 bits (272),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 92/293 (31%), Positives = 146/293 (50%), Gaps = 32/293 (11%)
 Frame = -1

Query  872  PCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQ  693
            P  W G +      R+  L+L +    G +  ++GNL+ L +L L  N      PREL +
Sbjct  365  PSTWDGCS------RLQDLSLRDNKFTGFIPREIGNLTMLRTLRLFHNRLTGEIPRELGK  418

Query  692  LRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN-LSKLEVLHLGV  516
            L++L+ L  + N  +G+IP     +  L  L L  N +SG LP S+ + L  L+++ L  
Sbjct  419  LQQLEQLHLAANLLNGSIPEEIANISTLTLLALTANRLSGSLPKSIGSRLPDLDLISLET  478

Query  515  NSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGE------  354
            N L G IP  I N  +L  +NL +NHFSG+ P  + +L  L+ L +  N+L G       
Sbjct  479  NLLSGHIPDSIANSSKLTYINLGNNHFSGTIPSKLGSLRLLQRLFVHGNNLTGLSFITSL  538

Query  353  -------------------LPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSL  231
                               LP  +GN    L++F+  ++   G IP+ +S  + L  L L
Sbjct  539  ANCRFLTDFWMHNNRADDFLPPSIGNLSTSLRVFLAWNSTIKGSIPNEISNLTSLVELDL  598

Query  230  PFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKL  72
              N+ SG +P   G+L  L+ L L  N+++G+IP  I  L++L  + LSNN++
Sbjct  599  SSNDLSGFLPSGLGSLALLQGLSLSDNRISGSIPAGICELTNLGELRLSNNQI  651


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 122/241 (51%), Gaps = 2/241 (1%)
 Frame = -1

Query  785  LTPDLGNLSFLVSLNLSQNN-FHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNL  609
            L P +GNLS  + + L+ N+    S P E+S L  L  L  S ND SG +PS  G L  L
Sbjct  558  LPPSIGNLSTSLRVFLAWNSTIKGSIPNEISNLTSLVELDLSSNDLSGFLPSGLGSLALL  617

Query  608  RFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSG  429
            + L L +N ISG +P  +  L+ L  L L  N +   IP  IGN   L+ L L  N  S 
Sbjct  618  QGLSLSDNRISGSIPAGICELTNLGELRLSNNQISSQIPGCIGNGISLRQLYLDTNRLSW  677

Query  428  SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSL  249
              P  + +L  L  L+LS N L G L   +GN L    +  +  N+F+  IP ++   + 
Sbjct  678  GIPSSLWSLKNLLELNLSSNLLNGSLSPQIGN-LEAAVLIDLSFNQFTQNIPITVGGLNN  736

Query  248  LQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLY  69
            L   SL  N   G +P   GN+  LE L L  N L+G+IP+ + AL  L I ++S N L 
Sbjct  737  LINFSLSHNRLLGSIPNTTGNMISLEVLDLAHNNLSGSIPKSLEALKHLEIFNVSYNSLS  796

Query  68   G  66
            G
Sbjct  797  G  797


 Score = 85.9 bits (211),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 99/314 (32%), Positives = 144/314 (46%), Gaps = 57/314 (18%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +   + N S L  +NL  N+F  + P +L  LR L+ L    N+ +G   S+   L
Sbjct  481  LSGHIPDSIANSSKLTYINLGNNHFSGTIPSKLGSLRLLQRLFVHGNNLTG--LSFITSL  538

Query  617  QNLRFL---YLGNNNISGFLPTSLFNLSKLEVLHLGVNS-LEGSIPREIGNLFQL-----  465
             N RFL   ++ NN    FLP S+ NLS    + L  NS ++GSIP EI NL  L     
Sbjct  539  ANCRFLTDFWMHNNRADDFLPPSIGNLSTSLRVFLAWNSTIKGSIPNEISNLTSLVELDL  598

Query  464  -------------------KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLD  342
                               + L+LSDN  SGS P  I  L+ L  L LS N +  ++P  
Sbjct  599  SSNDLSGFLPSGLGSLALLQGLSLSDNRISGSIPAGICELTNLGELRLSNNQISSQIPGC  658

Query  341  LGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQT------------------------LS  234
            +GN +   Q++ + +N+ S  IPSSL     L                          + 
Sbjct  659  IGNGISLRQLY-LDTNRLSWGIPSSLWSLKNLLELNLSSNLLNGSLSPQIGNLEAAVLID  717

Query  233  LPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQ  54
            L FN F+ ++P   G L  L    L  N+L G+IP   G + SL ++DL++N L G+  +
Sbjct  718  LSFNQFTQNIPITVGGLNNLINFSLSHNRLLGSIPNTTGNMISLEVLDLAHNNLSGSIPK  777

Query  53   NLDTP*LK*LSYYN  12
            +L+   LK L  +N
Sbjct  778  SLEA--LKHLEIFN  789


 Score = 79.7 bits (195),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 118/221 (53%), Gaps = 3/221 (1%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            L+L +  L G L   LG+L+ L  L+LS N    S P  + +L  L  L+ S N  S  I
Sbjct  596  LDLSSNDLSGFLPSGLGSLALLQGLSLSDNRISGSIPAGICELTNLGELRLSNNQISSQI  655

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKL  459
            P   G   +LR LYL  N +S  +P+SL++L  L  L+L  N L GS+  +IGNL    L
Sbjct  656  PGCIGNGISLRQLYLDTNRLSWGIPSSLWSLKNLLELNLSSNLLNGSLSPQIGNLEAAVL  715

Query  458  LNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGE  279
            ++LS N F+ + P+ +  L+ L N SLS N L G +P   GN +  L++  +  N  SG 
Sbjct  716  IDLSFNQFTQNIPITVGGLNNLINFSLSHNRLLGSIPNTTGNMI-SLEVLDLAHNNLSGS  774

Query  278  IPSSLSKCSLLQTLSLPFNNFSGHVP--REFGNLTKLEKLF  162
            IP SL     L+  ++ +N+ SG +P    F N T+   +F
Sbjct  775  IPKSLEALKHLEIFNVSYNSLSGEIPPGGPFVNFTRQSFMF  815



>ref|XP_006358153.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Solanum tuberosum]
Length=817

 Score =   262 bits (669),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 216/333 (65%), Gaps = 2/333 (1%)
 Frame = -1

Query  1058  MEITRHYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNS  879
             ME +  Y  L+      ++  L I   TNIT D+ ALLSLKS+I  DP  +L+ +WS ++
Sbjct  4     MEKSLFYSQLAFLLLQCIVTSLAIKTETNITADQFALLSLKSQIISDPFQLLSKSWSRDT  63

Query  878   ITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL  699
              + CNWIGVTC SRHNRV++LN+ NMG+ G +    GNL+FLVSL+L+ NNF+ + P+E+
Sbjct  64    -SVCNWIGVTCGSRHNRVTSLNISNMGITGTIPQLFGNLTFLVSLDLTSNNFYGNLPQEM  122

Query  698   SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG  519
               LRRLK+++ S+N+FSG +PSWFG L  L+ L L NN+ +G +P+SL N+S LE L L 
Sbjct  123   VHLRRLKLMRLSYNNFSGEVPSWFGFLAQLQVLTLKNNSFTGLIPSSLSNISNLEALDLA  182

Query  518   VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL  339
              N+LEG+IP++IGNL  L+ LNL +N+ +G  P DI NLS L  L L  N L G +P  L
Sbjct  183   FNALEGNIPKDIGNLKNLRGLNLGNNNLTGGIPNDIGNLSSLIYLYLYGNRLTGPIPGTL  242

Query  338   GNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFL  159
              + L +LQ   + +N+  G I  SL K   L  + L  N FSG VP+  GN+T L  + L
Sbjct  243   -DRLGRLQELSLANNRLKGSIGDSLCKLQNLGNIYLGENQFSGLVPKCLGNVTSLRGIKL  301

Query  158   RSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
              SN+L+  IP  +G L  LL ++LS+N + G+ 
Sbjct  302   NSNRLSSNIPLSLGNLKDLLELNLSSNNMSGSL  334


 Score =   107 bits (268),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 113/231 (49%), Gaps = 1/231 (0%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
             LNL N  L G +  D+GNLS L+ L L  N      P  L +L RL+ L  + N   G+
Sbjct  202  GLNLGNNNLTGGIPNDIGNLSSLIYLYLYGNRLTGPIPGTLDRLGRLQELSLANNRLKGS  261

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            I      LQNL  +YLG N  SG +P  L N++ L  + L  N L  +IP  +GNL  L 
Sbjct  262  IGDSLCKLQNLGNIYLGENQFSGLVPKCLGNVTSLRGIKLNSNRLSSNIPLSLGNLKDLL  321

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             LNLS N+ SGS P +I NL     + LS N     +P ++G+ +  L    +  NK  G
Sbjct  322  ELNLSSNNMSGSLPAEIGNLKVAIRIDLSHNQFSNGIPREIGD-MQNLIHLSLAQNKLQG  380

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             IP S+     L+ L L  NN SG +P     L  L    +  N L G IP
Sbjct  381  SIPDSIGSIPSLEFLDLSNNNLSGSIPMSLEKLRYLNYFNVSFNSLQGEIP  431


 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 75/205 (37%), Positives = 108/205 (53%), Gaps = 30/205 (15%)
 Frame = -1

Query  644  NIPSWFGLLQNLRF-----LYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG  480
            ++ +W G+    R      L + N  I+G +P    NL+ L  L L  N+  G++P+E+ 
Sbjct  64   SVCNWIGVTCGSRHNRVTSLNISNMGITGTIPQLFGNLTFLVSLDLTSNNFYGNLPQEMV  123

Query  479  NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMR  300
            +L +LKL+ LS N+FSG  P                 S FG         L +LQ+  ++
Sbjct  124  HLRRLKLMRLSYNNFSGEVP-----------------SWFG--------FLAQLQVLTLK  158

Query  299  SNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREI  120
            +N F+G IPSSLS  S L+ L L FN   G++P++ GNL  L  L L +N LTG IP +I
Sbjct  159  NNSFTGLIPSSLSNISNLEALDLAFNALEGNIPKDIGNLKNLRGLNLGNNNLTGGIPNDI  218

Query  119  GALSSLLIVDLSNNKLYGTFIQNLD  45
            G LSSL+ + L  N+L G     LD
Sbjct  219  GNLSSLIYLYLYGNRLTGPIPGTLD  243


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/240 (31%), Positives = 108/240 (45%), Gaps = 30/240 (13%)
 Frame = -1

Query  839  RHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSF  660
            R  R+  L+L N  L G +   L  L  L ++ L +N F    P+ L  +  L+ ++ + 
Sbjct  244  RLGRLQELSLANNRLKGSIGDSLCKLQNLGNIYLGENQFSGLVPKCLGNVTSLRGIKLNS  303

Query  659  NDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG  480
            N  S NIP   G L++L  L L +NN+SG LP  + NL     + L  N     IPREIG
Sbjct  304  NRLSSNIPLSLGNLKDLLELNLSSNNMSGSLPAEIGNLKVAIRIDLSHNQFSNGIPREIG  363

Query  479  NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMR  300
            ++  L  L+L+ N   GS P  I                           +P L+   + 
Sbjct  364  DMQNLIHLSLAQNKLQGSIPDSI-------------------------GSIPSLEFLDLS  398

Query  299  SNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVP--REFGNLTKLEKLFLRSNQLTGAIPR  126
            +N  SG IP SL K   L   ++ FN+  G +P    F NL+   + F+ +  L GA PR
Sbjct  399  NNNLSGSIPMSLEKLRYLNYFNVSFNSLQGEIPFSGPFKNLS--SQSFMFNKALCGA-PR  455



>ref|XP_010316829.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Solanum lycopersicum]
Length=1212

 Score =   265 bits (676),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 226/385 (59%), Gaps = 49/385 (13%)
 Frame = -1

Query  1058  MEITRHYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNS  879
             ME +  Y  L+      ++  L I   TNITTD+ ALLSLKS I  DP  +L+ +WS ++
Sbjct  4     MEKSLFYSQLAFLLLQCIVTSLAIKTETNITTDQSALLSLKSHIISDPFQLLSKSWSQDT  63

Query  878   ITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL  699
              + CNWIGVTC SRHNRV++LN+ NMG+ G +    GNL+FLVSL+L  NNF  + P+E+
Sbjct  64    -SVCNWIGVTCGSRHNRVTSLNISNMGITGTIPQLFGNLTFLVSLDLDSNNFFGNLPQEM  122

Query  698   SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG  519
              +LRRLK+++ S+N+FSG +PSWFG L  L  L L NN+ +G +P+SL N+S LE L L 
Sbjct  123   VRLRRLKLMKLSYNNFSGEVPSWFGFLAQLEVLTLKNNSFTGLIPSSLSNISNLEALDLA  182

Query  518   VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL  339
              N+LEG+IP++IGNL  L+ LNL  N+ +G+ P    N +KLE L LS N L G +P ++
Sbjct  183   FNTLEGNIPKDIGNLKNLRGLNLGHNNLTGTVPPSFSNATKLEKLILSYNFLHGNIPNEM  242

Query  338   G------------------------------------------------NHLPKLQIFVM  303
             G                                                +HLP L+   +
Sbjct  243   GDLQNLNWLIIENNQLTGSIPFSIFNISTLESIGFSQNGLSGDLPDDLCDHLPILKGLYL  302

Query  302   RSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPRE  123
               NK  G +P SLS+C  LQ LSL  N+F G +P E G L+ L+ L+L  N+ TG IP+E
Sbjct  303   SFNKLQGHMPQSLSRCYELQLLSLSNNDFDGPIPSEIGMLSNLQTLYLGFNRFTGEIPQE  362

Query  122   IGALSSLLIVDLSNNKLYGTFIQNL  48
             IG L +L+++ +  N+L G+  +++
Sbjct  363   IGDLVNLVMIGMERNQLTGSIPKSI  387


 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/281 (38%), Positives = 155/281 (55%), Gaps = 26/281 (9%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            + AL+L    L G +  D+GNL  L  LNL  NN   + P   S   +L+ L  S+N   
Sbjct  176  LEALDLAFNTLEGNIPKDIGNLKNLRGLNLGHNNLTGTVPPSFSNATKLEKLILSYNFLH  235

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEV---------------------  531
            GNIP+  G LQNL +L + NN ++G +P S+FN+S LE                      
Sbjct  236  GNIPNEMGDLQNLNWLIIENNQLTGSIPFSIFNISTLESIGFSQNGLSGDLPDDLCDHLP  295

Query  530  ----LHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsL  363
                L+L  N L+G +P+ +   ++L+LL+LS+N F G  P +I  LS L+ L L  N  
Sbjct  296  ILKGLYLSFNKLQGHMPQSLSRCYELQLLSLSNNDFDGPIPSEIGMLSNLQTLYLGFNRF  355

Query  362  FGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNL  183
             GE+P ++G+ L  L +  M  N+ +G IP S+   S LQ LSL  NNF+G + RE GNL
Sbjct  356  TGEIPQEIGD-LVNLVMIGMERNQLTGSIPKSIFNISSLQLLSLQNNNFTGSLSREIGNL  414

Query  182  TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            T L+ L+L  N LTG IP+E+  L  L+ +DL +N+  G+F
Sbjct  415  TMLQGLYLGQNMLTGEIPKEVSNLIELVDIDLGSNRFSGSF  455


 Score =   123 bits (309),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 106/316 (34%), Positives = 152/316 (48%), Gaps = 57/316 (18%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCS  663
            SR   +  L+L N    G +  ++G LS L +L L  N F    P+E+  L  L ++   
Sbjct  316  SRCYELQLLSLSNNDFDGPIPSEIGMLSNLQTLYLGFNRFTGEIPQEIGDLVNLVMIGME  375

Query  662  FNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREI  483
             N  +G+IP     + +L+ L L NNN +G L   + NL+ L+ L+LG N L G IP+E+
Sbjct  376  RNQLTGSIPKSIFNISSLQLLSLQNNNFTGSLSREIGNLTMLQGLYLGQNMLTGEIPKEV  435

Query  482  GNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVM  303
             NL +L  ++L  N FSGSFP+ I N+S L  + L+ N+L G LP  +G+ LP +++  +
Sbjct  436  SNLIELVDIDLGSNRFSGSFPMGIFNISGLRLIDLTDNTLSGTLPSSIGSMLPNIELLYL  495

Query  302  RS-------------------------NKFSGEIPSSLSKCSLLQT--------------  240
                                       NK SG IP+SL   +LLQT              
Sbjct  496  GGLTNLAGSMPHSLSNCSRLTALDLSLNKLSGSIPNSLGDLTLLQTLNLMENNLSSDQSS  555

Query  239  -----------------LSLPFNNFSGHVPREFGNL-TKLEKLFLRSNQLTGAIPREIGA  114
                             LSL FN  +G +P   GNL T LEK+     Q+ G IP +IG 
Sbjct  556  QELNFLTSLTNCRNLKQLSLSFNPLNGMLPPSVGNLSTSLEKILASDCQIKGDIPNDIGN  615

Query  113  LSSLLIVDLSNNKLYG  66
            LSSL+ + L  N+L G
Sbjct  616  LSSLIYLFLYGNRLTG  631


 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 141/250 (56%), Gaps = 4/250 (2%)
 Frame = -1

Query  800  GLVGELTPDLGN-LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
            GL G+L  DL + L  L  L LS N      P+ LS+   L++L  S NDF G IPS  G
Sbjct  281  GLSGDLPDDLCDHLPILKGLYLSFNKLQGHMPQSLSRCYELQLLSLSNNDFDGPIPSEIG  340

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
            +L NL+ LYLG N  +G +P  + +L  L ++ +  N L GSIP+ I N+  L+LL+L +
Sbjct  341  MLSNLQTLYLGFNRFTGEIPQEIGDLVNLVMIGMERNQLTGSIPKSIFNISSLQLLSLQN  400

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N+F+GS   +I NL+ L+ L L  N L GE+P ++ N L +L    + SN+FSG  P  +
Sbjct  401  NNFTGSLSREIGNLTMLQGLYLGQNMLTGEIPKEVSN-LIELVDIDLGSNRFSGSFPMGI  459

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGN-LTKLEKLFLRS-NQLTGAIPREIGALSSLLIVD  90
               S L+ + L  N  SG +P   G+ L  +E L+L     L G++P  +   S L  +D
Sbjct  460  FNISGLRLIDLTDNTLSGTLPSSIGSMLPNIELLYLGGLTNLAGSMPHSLSNCSRLTALD  519

Query  89   LSNNKLYGTF  60
            LS NKL G+ 
Sbjct  520  LSLNKLSGSI  529


 Score =   111 bits (277),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 101/309 (33%), Positives = 155/309 (50%), Gaps = 35/309 (11%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNS-------FPRELSQLRR  684
            S  +R++AL+L    L G +   LG+L+ L +LNL +NN  +        F   L+  R 
Sbjct  510  SNCSRLTALDLSLNKLSGSIPNSLGDLTLLQTLNLMENNLSSDQSSQELNFLTSLTNCRN  569

Query  683  LKILQCSFN-------------------------DFSGNIPSWFGLLQNLRFLYLGNNNI  579
            LK L  SFN                            G+IP+  G L +L +L+L  N +
Sbjct  570  LKQLSLSFNPLNGMLPPSVGNLSTSLEKILASDCQIKGDIPNDIGNLSSLIYLFLYGNRL  629

Query  578  SGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnls  399
            +G +P +L +L +L+   L  N L+GSI   +  +  L  + L +N FSG  P  + N++
Sbjct  630  TGPIPGTLGSLGRLQEFSLANNRLKGSIGDSLCKMQNLGNIYLGENQFSGLVPNCLGNVT  689

Query  398  klenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNN  219
             L  + L+ N L   +PL LGN L  L    + SN  SG +P+ +    +   + L  N 
Sbjct  690  SLRGIKLNSNRLSSNIPLSLGN-LKDLLELDLSSNNMSGSLPAEIGNLRVAIRIDLSHNQ  748

Query  218  FSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDTP  39
            FS  +PRE G++  L  L L  N+L G+IP  IG++ SL  +DLSNN L G+   +L+  
Sbjct  749  FSNGIPREIGDMQNLIYLSLAQNKLQGSIPDSIGSIPSLEFLDLSNNNLSGSIPMSLEK-  807

Query  38   *LK*LSYYN  12
             L+ L+Y+N
Sbjct  808  -LRYLNYFN  815


 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 107/221 (48%), Gaps = 1/221 (0%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G++  D+GNLS L+ L L  N      P  L  L RL+    + N   G+I      +QN
Sbjct  607  GDIPNDIGNLSSLIYLFLYGNRLTGPIPGTLGSLGRLQEFSLANNRLKGSIGDSLCKMQN  666

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFS  432
            L  +YLG N  SG +P  L N++ L  + L  N L  +IP  +GNL  L  L+LS N+ S
Sbjct  667  LGNIYLGENQFSGLVPNCLGNVTSLRGIKLNSNRLSSNIPLSLGNLKDLLELDLSSNNMS  726

Query  431  GSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCS  252
            GS P +I NL     + LS N     +P ++G+ +  L    +  NK  G IP S+    
Sbjct  727  GSLPAEIGNLRVAIRIDLSHNQFSNGIPREIGD-MQNLIYLSLAQNKLQGSIPDSIGSIP  785

Query  251  LLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             L+ L L  NN SG +P     L  L    +  N L G IP
Sbjct  786  SLEFLDLSNNNLSGSIPMSLEKLRYLNYFNVSFNSLQGEIP  826


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 88/254 (35%), Positives = 129/254 (51%), Gaps = 8/254 (3%)
 Frame = -1

Query  875  TPCNWIGVTCNSRHNRVSALNLFNMG--LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRE  702
            + C   G   N   N  S + LF  G  L G +   LG+L  L   +L+ N    S    
Sbjct  601  SDCQIKGDIPNDIGNLSSLIYLFLYGNRLTGPIPGTLGSLGRLQEFSLANNRLKGSIGDS  660

Query  701  LSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHL  522
            L +++ L  +    N FSG +P+  G + +LR + L +N +S  +P SL NL  L  L L
Sbjct  661  LCKMQNLGNIYLGENQFSGLVPNCLGNVTSLRGIKLNSNRLSSNIPLSLGNLKDLLELDL  720

Query  521  GVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLD  342
              N++ GS+P EIGNL     ++LS N FS   P +I ++  L  LSL+ N L G +P  
Sbjct  721  SSNNMSGSLPAEIGNLRVAIRIDLSHNQFSNGIPREIGDMQNLIYLSLAQNKLQGSIPDS  780

Query  341  LGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVP--REFGNLTKLEK  168
            +G+ +P L+   + +N  SG IP SL K   L   ++ FN+  G +P    F NL+ L  
Sbjct  781  IGS-IPSLEFLDLSNNNLSGSIPMSLEKLRYLNYFNVSFNSLQGEIPFSGPFKNLSSLS-  838

Query  167  LFLRSNQLTGAIPR  126
             F+ +  L GA PR
Sbjct  839  -FMFNEALCGA-PR  850



>ref|XP_006358717.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Solanum tuberosum]
Length=1082

 Score =   263 bits (672),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 148/309 (48%), Positives = 209/309 (68%), Gaps = 1/309 (0%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            NI+TD+ ALL+LKS IS  P+ ILA NWS +S   C+WIG+TC+SR++RV+AL++ +M L
Sbjct  28   NISTDEAALLALKSHISSYPNIILASNWSSSSPV-CSWIGITCSSRYHRVTALDISSMQL  86

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             G + P LGNLSFLVSL++S N FH   P EL+ L+RLK++    N+F+G IPS+  LL 
Sbjct  87   HGTIPPHLGNLSFLVSLDISNNTFHGDLPVELAHLQRLKLINVRSNNFTGTIPSFLSLLP  146

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            NLRF YL +N  SG +P+S+ NL+KLE+L +  N LEG IP+EIG+L  L +LN+ DN  
Sbjct  147  NLRFAYLSSNQFSGKIPSSISNLTKLELLTIHTNFLEGEIPKEIGDLRYLIVLNMQDNQL  206

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            +GS P  I N++ ++ ++L+ N+L G LP  + + LP L+   + SN   G IP +L KC
Sbjct  207  TGSIPPSIFNITTMQVIALTDNNLTGNLPRTICDRLPNLEGLHLSSNYLGGVIPPNLEKC  266

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              LQ LSL +N F+G VPRE  NLT L +L+L    L G IP E+G L  L ++ L  N+
Sbjct  267  RKLQILSLSYNEFTGTVPRELSNLTALTELYLGIQHLEGEIPAELGNLKKLQLLMLDQNE  326

Query  74   LYGTFIQNL  48
              G+  +++
Sbjct  327  FTGSIPESI  335


 Score =   110 bits (275),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 100/298 (34%), Positives = 147/298 (49%), Gaps = 35/298 (12%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLKI  675
            S  +R+   +L +    G +   LGNL +L  LNL  NNF +    SF   L+  R+L+ 
Sbjct  385  SNSSRLRMADLSDNSFTGVIPESLGNLEYLEVLNLELNNFISDSSLSFLTSLTNCRKLRA  444

Query  674  LQCSFND--------------------FSGN-------IPSWFGLLQNLRFLYLGNNNIS  576
            L+  FND                    F GN       IP   G L  + ++ L  N ++
Sbjct  445  LR--FNDNALDGALPASVGNFSNSLQNFQGNGCKLKGVIPREIGNLTGVIYMSLYKNELT  502

Query  575  GFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsk  396
            G +P ++ ++  L+  +L  N +EG+IP  + +L  L  L+LS NH SG  P  + N++ 
Sbjct  503  GHIPNTVQDMLNLQEFYLQSNEIEGTIPNVLCSLKDLGALDLSGNHISGLVPC-LGNVTS  561

Query  395  lenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNF  216
            L  L+L+ N L   LP +LGN L  L  F + SN  SG IP  L     +  + L  N+F
Sbjct  562  LRKLNLAYNRLNSRLPANLGN-LQDLIEFNVSSNSLSGHIPLELGNLKAVTLIDLSKNDF  620

Query  215  SGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
            SG +P   G L +L  LFL  N+L GAIP   G + SL  +DLS N + G   ++L+ 
Sbjct  621  SGKIPSTLGGLAELTDLFLTHNRLDGAIPDSFGKMLSLEYLDLSYNNISGEIPKSLEA  678


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 90/258 (35%), Positives = 133/258 (52%), Gaps = 7/258 (3%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNN---FHNSFPRELSQLRRLKILQCSF  660
            ++ AL   +  L G L   +GN S   SL   Q N        PRE+  L  +  +    
Sbjct  441  KLRALRFNDNALDGALPASVGNFSN--SLQNFQGNGCKLKGVIPREIGNLTGVIYMSLYK  498

Query  659  NDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG  480
            N+ +G+IP+    + NL+  YL +N I G +P  L +L  L  L L  N + G +P  +G
Sbjct  499  NELTGHIPNTVQDMLNLQEFYLQSNEIEGTIPNVLCSLKDLGALDLSGNHISGLVPC-LG  557

Query  479  NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMR  300
            N+  L+ LNL+ N  +   P ++ NL  L   ++S NSL G +PL+LGN L  + +  + 
Sbjct  558  NVTSLRKLNLAYNRLNSRLPANLGNLQDLIEFNVSSNSLSGHIPLELGN-LKAVTLIDLS  616

Query  299  SNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREI  120
             N FSG+IPS+L   + L  L L  N   G +P  FG +  LE L L  N ++G IP+ +
Sbjct  617  KNDFSGKIPSTLGGLAELTDLFLTHNRLDGAIPDSFGKMLSLEYLDLSYNNISGEIPKSL  676

Query  119  GALSSLLIVDLSNNKLYG  66
             AL  L  ++ S NKL G
Sbjct  677  EALVYLKYMNFSFNKLSG  694


 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 117/259 (45%), Gaps = 29/259 (11%)
 Frame = -1

Query  755  LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNIS  576
            L  L+LS N      P  L + R+L+IL  S+N+F+G +P     L  L  LYLG  ++ 
Sbjct  245  LEGLHLSSNYLGGVIPPNLEKCRKLQILSLSYNEFTGTVPRELSNLTALTELYLGIQHLE  304

Query  575  GFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsk  396
            G +P  L NL KL++L L  N   GSIP  I N+  +++L+ S N  SG+ P D+     
Sbjct  305  GEIPAELGNLKKLQLLMLDQNEFTGSIPESIFNISAMQILDFSMNKLSGTLPSDLGRGMP  364

Query  395  lenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNF  216
                     +       D  ++  +L++  +  N F+G IP SL     L+ L+L  NNF
Sbjct  365  NLEELYCGGNNLSGFISDSISNSSRLRMADLSDNSFTGVIPESLGNLEYLEVLNLELNNF  424

Query  215  ----------------------------SGHVPREFGNLT-KLEKLFLRSNQLTGAIPRE  123
                                         G +P   GN +  L+       +L G IPRE
Sbjct  425  ISDSSLSFLTSLTNCRKLRALRFNDNALDGALPASVGNFSNSLQNFQGNGCKLKGVIPRE  484

Query  122  IGALSSLLIVDLSNNKLYG  66
            IG L+ ++ + L  N+L G
Sbjct  485  IGNLTGVIYMSLYKNELTG  503


 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 90/315 (29%), Positives = 139/315 (44%), Gaps = 53/315 (17%)
 Frame = -1

Query  851  TCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKIL  672
            T   R   +  L+L +  L G + P+L     L  L+LS N F  + PRELS L  L  L
Sbjct  237  TICDRLPNLEGLHLSSNYLGGVIPPNLEKCRKLQILSLSYNEFTGTVPRELSNLTALTEL  296

Query  671  QCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIP  492
                    G IP+  G L+ L+ L L  N  +G +P S+FN+S +++L   +N L G++P
Sbjct  297  YLGIQHLEGEIPAELGNLKKLQLLMLDQNEFTGSIPESIFNISAMQILDFSMNKLSGTLP  356

Query  491  REIG-------------------------NLFQLKLLNLSDNHFSGSFP-----------  420
             ++G                         N  +L++ +LSDN F+G  P           
Sbjct  357  SDLGRGMPNLEELYCGGNNLSGFISDSISNSSRLRMADLSDNSFTGVIPESLGNLEYLEV  416

Query  419  -----------------LDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
                               + N  KL  L  + N+L G LP  +GN    LQ F     K
Sbjct  417  LNLELNNFISDSSLSFLTSLTNCRKLRALRFNDNALDGALPASVGNFSNSLQNFQGNGCK  476

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
              G IP  +   + +  +SL  N  +GH+P    ++  L++ +L+SN++ G IP  + +L
Sbjct  477  LKGVIPREIGNLTGVIYMSLYKNELTGHIPNTVQDMLNLQEFYLQSNEIEGTIPNVLCSL  536

Query  110  SSLLIVDLSNNKLYG  66
              L  +DLS N + G
Sbjct  537  KDLGALDLSGNHISG  551


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 114/223 (51%), Gaps = 2/223 (1%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +  ++GNL+ ++ ++L +N      P  +  +  L+      N+  G IP+    L
Sbjct  477  LKGVIPREIGNLTGVIYMSLYKNELTGHIPNTVQDMLNLQEFYLQSNEIEGTIPNVLCSL  536

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            ++L  L L  N+ISG +P  L N++ L  L+L  N L   +P  +GNL  L   N+S N 
Sbjct  537  KDLGALDLSGNHISGLVPC-LGNVTSLRKLNLAYNRLNSRLPANLGNLQDLIEFNVSSNS  595

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             SG  PL++ NL  +  + LS N   G++P  LG  L +L    +  N+  G IP S  K
Sbjct  596  LSGHIPLELGNLKAVTLIDLSKNDFSGKIPSTLGG-LAELTDLFLTHNRLDGAIPDSFGK  654

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
               L+ L L +NN SG +P+    L  L+ +    N+L+G IP
Sbjct  655  MLSLEYLDLSYNNISGEIPKSLEALVYLKYMNFSFNKLSGEIP  697


 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 73/145 (50%), Gaps = 0/145 (0%)
 Frame = -1

Query  854  VTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKI  675
            V C      +  LNL    L   L  +LGNL  L+  N+S N+     P EL  L+ + +
Sbjct  553  VPCLGNVTSLRKLNLAYNRLNSRLPANLGNLQDLIEFNVSSNSLSGHIPLELGNLKAVTL  612

Query  674  LQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSI  495
            +  S NDFSG IPS  G L  L  L+L +N + G +P S   +  LE L L  N++ G I
Sbjct  613  IDLSKNDFSGKIPSTLGGLAELTDLFLTHNRLDGAIPDSFGKMLSLEYLDLSYNNISGEI  672

Query  494  PREIGNLFQLKLLNLSDNHFSGSFP  420
            P+ +  L  LK +N S N  SG  P
Sbjct  673  PKSLEALVYLKYMNFSFNKLSGEIP  697



>ref|XP_010321910.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Solanum lycopersicum]
Length=834

 Score =   260 bits (665),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 218/331 (66%), Gaps = 10/331 (3%)
 Frame = -1

Query  1037  FCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWI  858
             F L++F    +ML    ++  NI+TD+ ALL+LKS IS DP++ILA NWS +S   C+WI
Sbjct  9     FALAVF----IMLHHHTSSLANISTDEAALLALKSHISSDPNNILARNWSSSSPV-CSWI  63

Query  857   GVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLK  678
             G+TC+SRH+RV+AL++ +M L G + P LGNLSFLVSLN+  N FH  FP+EL+ L+RLK
Sbjct  64    GITCSSRHHRVTALDISSMQLHGTIPPHLGNLSFLVSLNIHNNTFHGDFPKELTHLKRLK  123

Query  677   ILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGS  498
              +  + N+F+G I S   LL NLRF+YL  N  SG +P+S+ N++KLEVL +  N LEG 
Sbjct  124   SISVTRNNFTGAILSSLSLLPNLRFVYLSMNQFSGEIPSSVSNITKLEVLSMQSNFLEGE  183

Query  497   IPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKL  318
             IPRE G+L  L  L+L  N  SGS P  I N++ ++ L L+ N+L G+LP  + NHLP L
Sbjct  184   IPREFGDLRYLTFLDLQYNQLSGSIPTSIFNITTMKILGLTYNNLTGQLPTTICNHLPNL  243

Query  317   QIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRS-----  153
             +   +  N   G IP +L  C  LQ LSL +N F G VPRE  NLT L +L++R+     
Sbjct  244   EGLYLSKNYIGGVIPPNLENCRKLQNLSLSYNEFIGIVPRELANLTALTQLYIRALHLEE  303

Query  152   NQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             NQ +G++P  I  +S+L ++ L+ NK  GT 
Sbjct  304   NQFSGSVPPTIFNMSALQLLGLTENKFSGTL  334


 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 94/277 (34%), Positives = 135/277 (49%), Gaps = 11/277 (4%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLKI  675
            S  +R+  L+L      G +   LGNL  L  L+ S +NF +    SF   L+  R L++
Sbjct  364  SNSSRLRMLDLSGNSFTGPIPGSLGNLEHLEVLSFSGDNFVSDSTLSFLTSLTNCRNLRV  423

Query  674  LQCSFNDF------SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVN  513
            L    N        SG IP   G L  +  + L NN ++G +P ++  +  L+ L+L  N
Sbjct  424  LWFDGNPLDGVLPASGVIPREIGNLTGVTRIDLYNNELTGHIPNTVQGMLSLQELYLQRN  483

Query  512  SLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGN  333
             +EG IP  I  L  L  L+LS N FSGS P  + +++ L  L L+ N L   LP  LG 
Sbjct  484  KIEGRIPEVICGLNNLGALDLSRNQFSGSVPPCLGSVTSLRTLYLAYNRLNSRLPASLGG  543

Query  332  HLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRS  153
             L  L    + SN  SGEIP  +        + L  N+FSG +P   G L  L  L L  
Sbjct  544  -LHDLIELKISSNLLSGEIPFEIGNLKAATLIDLSKNDFSGKIPSTLGGLDNLINLSLAH  602

Query  152  NQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
            N+L G+IP   G + +L  +DL +N L G   ++L+ 
Sbjct  603  NRLEGSIPDSFGKMLALEFLDLCDNNLSGEIPKSLEA  639


 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 111/224 (50%), Gaps = 3/224 (1%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            V+ ++L+N  L G +   +  +  L  L L +N      P  +  L  L  L  S N FS
Sbjct  451  VTRIDLYNNELTGHIPNTVQGMLSLQELYLQRNKIEGRIPEVICGLNNLGALDLSRNQFS  510

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G++P   G + +LR LYL  N ++  LP SL  L  L  L +  N L G IP EIGNL  
Sbjct  511  GSVPPCLGSVTSLRTLYLAYNRLNSRLPASLGGLHDLIELKISSNLLSGEIPFEIGNLKA  570

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
              L++LS N FSG  P  +  L  L NLSL+ N L G +P   G  L  L+   +  N  
Sbjct  571  ATLIDLSKNDFSGKIPSTLGGLDNLINLSLAHNRLEGSIPDSFGKML-ALEFLDLCDNNL  629

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVP--REFGNLTKLEKLF  162
            SGEIP SL     L+ ++  FN  SG +P    F N+T    LF
Sbjct  630  SGEIPKSLEALVYLKYMNFSFNKLSGEIPIGGPFANITSQSFLF  673


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 138/290 (48%), Gaps = 38/290 (13%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL-----------------  699
            + AL+L      G + P + N+S L  L L++N F  + P +L                 
Sbjct  296  IRALHLEENQFSGSVPPTIFNMSALQLLGLTENKFSGTLPLDLGCGMPSLEQLLFGVNNL  355

Query  698  --------SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFL-YLGNNNIS----GFLPTS  558
                    S   RL++L  S N F+G IP   G L++L  L + G+N +S     FL TS
Sbjct  356  SGFISDSISNSSRLRMLDLSGNSFTGPIPGSLGNLEHLEVLSFSGDNFVSDSTLSFL-TS  414

Query  557  LFNLSKLEVLHLGVNSLEGS------IPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsk  396
            L N   L VL    N L+G       IPREIGNL  +  ++L +N  +G  P  +  +  
Sbjct  415  LTNCRNLRVLWFDGNPLDGVLPASGVIPREIGNLTGVTRIDLYNNELTGHIPNTVQGMLS  474

Query  395  lenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNF  216
            L+ L L  N + G +P ++   L  L    +  N+FSG +P  L   + L+TL L +N  
Sbjct  475  LQELYLQRNKIEGRIP-EVICGLNNLGALDLSRNQFSGSVPPCLGSVTSLRTLYLAYNRL  533

Query  215  SGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            +  +P   G L  L +L + SN L+G IP EIG L +  ++DLS N   G
Sbjct  534  NSRLPASLGGLHDLIELKISSNLLSGEIPFEIGNLKAATLIDLSKNDFSG  583


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 87/283 (31%), Positives = 135/283 (48%), Gaps = 41/283 (14%)
 Frame = -1

Query  794  VGELTPDLGNLS-----FLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSW  630
            +G +  +L NL+     ++ +L+L +N F  S P  +  +  L++L  + N FSG +P  
Sbjct  278  IGIVPRELANLTALTQLYIRALHLEENQFSGSVPPTIFNMSALQLLGLTENKFSGTLPLD  337

Query  629  FGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLN  453
             G  + +L  L  G NN+SGF+  S+ N S+L +L L  NS  G IP  +GNL  L++L+
Sbjct  338  LGCGMPSLEQLLFGVNNLSGFISDSISNSSRLRMLDLSGNSFTGPIPGSLGNLEHLEVLS  397

Query  452  LSDNHF----------------------------------SGSFPLDIlnlsklenlsls  375
             S ++F                                  SG  P +I NL+ +  + L 
Sbjct  398  FSGDNFVSDSTLSFLTSLTNCRNLRVLWFDGNPLDGVLPASGVIPREIGNLTGVTRIDLY  457

Query  374  vnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPRE  195
             N L G +P  +   L  LQ   ++ NK  G IP  +   + L  L L  N FSG VP  
Sbjct  458  NNELTGHIPNTVQGML-SLQELYLQRNKIEGRIPEVICGLNNLGALDLSRNQFSGSVPPC  516

Query  194  FGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             G++T L  L+L  N+L   +P  +G L  L+ + +S+N L G
Sbjct  517  LGSVTSLRTLYLAYNRLNSRLPASLGGLHDLIELKISSNLLSG  559


 Score = 76.3 bits (186),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 86/163 (53%), Gaps = 0/163 (0%)
 Frame = -1

Query  833  NRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND  654
            N + AL+L      G + P LG+++ L +L L+ N  ++  P  L  L  L  L+ S N 
Sbjct  497  NNLGALDLSRNQFSGSVPPCLGSVTSLRTLYLAYNRLNSRLPASLGGLHDLIELKISSNL  556

Query  653  FSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
             SG IP   G L+    + L  N+ SG +P++L  L  L  L L  N LEGSIP   G +
Sbjct  557  LSGEIPFEIGNLKAATLIDLSKNDFSGKIPSTLGGLDNLINLSLAHNRLEGSIPDSFGKM  616

Query  473  FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPL  345
              L+ L+L DN+ SG  P  +  L  L+ ++ S N L GE+P+
Sbjct  617  LALEFLDLCDNNLSGEIPKSLEALVYLKYMNFSFNKLSGEIPI  659



>ref|XP_008225251.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=930

 Score =   261 bits (667),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 221/344 (64%), Gaps = 13/344 (4%)
 Frame = -1

Query  1070  MCHTMEITRHYFCLSIFF-----FHSLMLC-LTINA---HTNITTDKHALLSLKSKISFD  918
             +   ME  R +F LSI F     + SL +  LTI+     TNITTD+ ALL+L+S I+ D
Sbjct  10    LTQKME-ERSHFLLSITFLLVVQYSSLYMAELTISTDATQTNITTDQSALLTLRSHITSD  68

Query  917   PHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNL  738
             PH+IL  NWS  + + CNW GVTC +RH RV++LNL  MG +G + P LGNLSFLV+L+ 
Sbjct  69    PHNILV-NWSTTT-SVCNWFGVTCGARHLRVASLNLSYMGFIGTIPPHLGNLSFLVALSF  126

Query  737   SQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTS  558
             + N+FH + P ELS LRRLK +   +N+F G+IPSWFG    L+  YL  N  SGF+P++
Sbjct  127   NNNSFHGTLPHELSYLRRLKFINFGYNNFMGSIPSWFGSFPKLQSFYLYGNQFSGFIPST  186

Query  557   LFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlsl  378
             +FNLS L++++L  N L   IP EIG+L QL +L +  N   G  P+ + NLS L  L+L
Sbjct  187   IFNLSTLQIIYLNNNQLS-EIPNEIGSLDQLGMLTVQMNALKGHVPVTVFNLSSLIILNL  245

Query  377   svnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPR  198
               N+L G LP ++  HLP +Q+  +  N+F G +PS L +C  L  LSL  NNFSG +PR
Sbjct  246   YGNNLSGGLPDNICQHLPSVQVVNLGRNQFDGLLPSKLWQCKELLILSLENNNFSGSIPR  305

Query  197   EFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             + GNLT L  L L  NQL+G+IP  +G L +L  + L +NKL G
Sbjct  306   DIGNLTHLLTLDLEKNQLSGSIPTSLGRLGNLQGLWLDDNKLQG  349


 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 99/256 (39%), Positives = 139/256 (54%), Gaps = 4/256 (2%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            V  +NL      G L   L     L+ L+L  NNF  S PR++  L  L  L    N  S
Sbjct  265  VQVVNLGRNQFDGLLPSKLWQCKELLILSLENNNFSGSIPRDIGNLTHLLTLDLEKNQLS  324

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF-  471
            G+IP+  G L NL+ L+L +N + G++P  L  L KL  L+LG N L GSIP  +G+L  
Sbjct  325  GSIPTSLGRLGNLQGLWLDDNKLQGYIPYQLCQLDKLVELYLGSNQLSGSIPSCLGSLAT  384

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV-MRSN  294
             L+ L+L  N  S + P     L+ + +L+LS NSL G L  D+GN   K+ I V + +N
Sbjct  385  SLRTLSLESNSLSFTIPSTFWRLAYILHLNLSSNSLIGPLSQDIGNL--KVVIDVDLSNN  442

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGA  114
            +  G +PS++     L TLSL  N+  G +P  F +L  L+ L L  N L+G IP+ + A
Sbjct  443  QLFGILPSTIGALRDLVTLSLANNDLEGPIPSSFQDLLSLQFLNLSKNNLSGMIPKSLEA  502

Query  113  LSSLLIVDLSNNKLYG  66
            L  L  +DLS N+L G
Sbjct  503  LLVLKYLDLSFNRLQG  518


 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 92/263 (35%), Positives = 131/263 (50%), Gaps = 7/263 (3%)
 Frame = -1

Query  833  NRVSALNLFNM------GLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQ-LRRLKI  675
            N + +L+   M       L G +   + NLS L+ LNL  NN     P  + Q L  +++
Sbjct  208  NEIGSLDQLGMLTVQMNALKGHVPVTVFNLSSLIILNLYGNNLSGGLPDNICQHLPSVQV  267

Query  674  LQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSI  495
            +    N F G +PS     + L  L L NNN SG +P  + NL+ L  L L  N L GSI
Sbjct  268  VNLGRNQFDGLLPSKLWQCKELLILSLENNNFSGSIPRDIGNLTHLLTLDLEKNQLSGSI  327

Query  494  PREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQ  315
            P  +G L  L+ L L DN   G  P  +  L KL  L L  N L G +P  LG+    L+
Sbjct  328  PTSLGRLGNLQGLWLDDNKLQGYIPYQLCQLDKLVELYLGSNQLSGSIPSCLGSLATSLR  387

Query  314  IFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGA  135
               + SN  S  IPS+  + + +  L+L  N+  G + ++ GNL  +  + L +NQL G 
Sbjct  388  TLSLESNSLSFTIPSTFWRLAYILHLNLSSNSLIGPLSQDIGNLKVVIDVDLSNNQLFGI  447

Query  134  IPREIGALSSLLIVDLSNNKLYG  66
            +P  IGAL  L+ + L+NN L G
Sbjct  448  LPSTIGALRDLVTLSLANNDLEG  470


 Score = 85.9 bits (211),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 97/200 (49%), Gaps = 31/200 (16%)
 Frame = -1

Query  632  WFGLLQNLRFLYLGNNNIS-----GFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            WFG+    R L + + N+S     G +P  L NLS L  L    NS  G++P E+  L +
Sbjct  85   WFGVTCGARHLRVASLNLSYMGFIGTIPPHLGNLSFLVALSFNNNSFHGTLPHELSYLRR  144

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
            LK +N   N+F GS P                 S FG  P        KLQ F +  N+F
Sbjct  145  LKFINFGYNNFMGSIP-----------------SWFGSFP--------KLQSFYLYGNQF  179

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALS  108
            SG IPS++   S LQ + L  N  S  +P E G+L +L  L ++ N L G +P  +  LS
Sbjct  180  SGFIPSTIFNLSTLQIIYLNNNQLS-EIPNEIGSLDQLGMLTVQMNALKGHVPVTVFNLS  238

Query  107  SLLIVDLSNNKLYGTFIQNL  48
            SL+I++L  N L G    N+
Sbjct  239  SLIILNLYGNNLSGGLPDNI  258


 Score = 76.6 bits (187),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            LNL +  L+G L+ D+GNL  ++ ++LS N      P  +  LR L  L  + ND  G I
Sbjct  413  LNLSSNSLIGPLSQDIGNLKVVIDVDLSNNQLFGILPSTIGALRDLVTLSLANNDLEGPI  472

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            PS F  L +L+FL L  NN+SG +P SL  L  L+ L L  N L+G IP   G  FQ
Sbjct  473  PSSFQDLLSLQFLNLSKNNLSGMIPKSLEALLVLKYLDLSFNRLQGEIP--TGGPFQ  527


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 65/115 (57%), Gaps = 0/115 (0%)
 Frame = -1

Query  764  LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNN  585
            L++++ LNLS N+      +++  L+ +  +  S N   G +PS  G L++L  L L NN
Sbjct  407  LAYILHLNLSSNSLIGPLSQDIGNLKVVIDVDLSNNQLFGILPSTIGALRDLVTLSLANN  466

Query  584  NISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
            ++ G +P+S  +L  L+ L+L  N+L G IP+ +  L  LK L+LS N   G  P
Sbjct  467  DLEGPIPSSFQDLLSLQFLNLSKNNLSGMIPKSLEALLVLKYLDLSFNRLQGEIP  521



>ref|XP_009613027.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Nicotiana tomentosiformis]
Length=353

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 206/315 (65%), Gaps = 11/315 (3%)
 Frame = -1

Query  1058  MEITRHYFCLS--IFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSV  885
             ME T+    L+  + FF +    L IN +     D+  LL+ KS IS DP+++L  N SV
Sbjct  1     MERTKGILMLAFAVVFFTA---SLAINPN-----DEAVLLAFKSHISSDPNNLLQSNRSV  52

Query  884   NSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPR  705
             ++   C+WIG+TC+SRH+RV+AL++ +M L G + P LGNLSFLVSL++S ++FH   P 
Sbjct  53    SAPV-CSWIGITCSSRHHRVTALDISSMQLRGTIPPHLGNLSFLVSLDISNSSFHGDLPE  111

Query  704   ELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLH  525
             ELS L+RLK++  + N+FSG  PS   LL NLRFLYL +N  SG +P+S  NL+KL+ L 
Sbjct  112   ELSHLQRLKLIDVTRNNFSGPSPSVLSLLPNLRFLYLSSNQFSGEIPSSFSNLTKLQQLR  171

Query  524   LGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPL  345
             +  NSL+G IP EIGNL  L +L+L  N F+GS P  I N++ L  L++  N L G+LP+
Sbjct  172   MQRNSLQGKIPPEIGNLRYLTMLDLQGNRFTGSIPPSIFNMTSLRQLAIIRNRLTGKLPV  231

Query  344   DLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKL  165
             D+ N+LP L++  + SN   G IP +L KCS L+ L+L  N F+G +PR+ GNLT L  L
Sbjct  232   DICNNLPNLEVLFLSSNILDGLIPPNLEKCSKLKNLTLSGNQFTGTIPRKLGNLTMLTML  291

Query  164   FLRSNQLTGAIPREI  120
              L  N L G IP EI
Sbjct  292   HLGENLLEGEIPVEI  306


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 60/115 (52%), Gaps = 1/115 (1%)
 Frame = -1

Query  797  LVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G+L  D+  NL  L  L LS N      P  L +  +LK L  S N F+G IP   G 
Sbjct  225  LTGKLPVDICNNLPNLEVLFLSSNILDGLIPPNLEKCSKLKNLTLSGNQFTGTIPRKLGN  284

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLL  456
            L  L  L+LG N + G +P  + NL  L++L L   +L GSIP  I N+  LK+L
Sbjct  285  LTMLTMLHLGENLLEGEIPVEIGNLQNLQLLGLKATNLSGSIPANIFNISALKIL  339



>ref|XP_009799747.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana sylvestris]
Length=1219

 Score =   263 bits (671),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 205/310 (66%), Gaps = 1/310 (0%)
 Frame = -1

Query  977  TNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMG  798
            TNI+TD+ ALL+LKS+++ +    L  NWS  S + C+WIGVTC SRH+RV ALN+ NM 
Sbjct  25   TNISTDQSALLALKSRVTLNSSHPLTQNWSSQS-SVCDWIGVTCGSRHHRVRALNISNMD  83

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            +VG + P LGNLSFLVSL++S+NNF    P++LS+LRRLK++   +N+FSG IP WFG  
Sbjct  84   IVGTIPPQLGNLSFLVSLDMSKNNFLGDIPQDLSRLRRLKVIDLGYNNFSGEIPMWFGFF  143

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
              L+ L L NN  +   P S+ NLSKLE L +  N L+GS P++IGNL  LK L L  N 
Sbjct  144  SELQILILDNNGFTAIPPASISNLSKLETLSVSNNHLQGSFPKDIGNLQSLKELVLVSNQ  203

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             +GS P  I N+S LE L+L+ N L G LP D+   L K++   + SN+ SG IP+SLS 
Sbjct  204  LTGSIPYSIFNISSLETLALTYNQLSGSLPADICRGLQKIKSISIISNQLSGHIPASLSN  263

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
            C+ L  LSL +NNF+G +P E  NL +LE L L  N L G IP +IG L +L  + L NN
Sbjct  264  CTQLYDLSLSYNNFNGIIPPEIVNLERLEFLNLGGNHLQGIIPAKIGNLRNLQQLQLENN  323

Query  77   KLYGTFIQNL  48
             + G+  +++
Sbjct  324  GIVGSIPRSI  333


 Score =   144 bits (363),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 102/258 (40%), Positives = 154/258 (60%), Gaps = 2/258 (1%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            ++ ++++ +  L G +   L N + L  L+LS NNF+   P E+  L RL+ L    N  
Sbjct  242  KIKSISIISNQLSGHIPASLSNCTQLYDLSLSYNNFNGIIPPEIVNLERLEFLNLGGNHL  301

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
             G IP+  G L+NL+ L L NN I G +P S+ N++ L +L+   N+L G IP EIGNL 
Sbjct  302  QGIIPAKIGNLRNLQQLQLENNGIVGSIPRSIRNMTSLWILNFNTNNLTGVIPEEIGNLH  361

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
            +L+ L L  N  SGS P ++ N+S L  +SLS N++ G +P ++G+ L KL+   ++ NK
Sbjct  362  KLETLYLQFNKLSGSIPEELFNISTLTRVSLSTNNIGGVIPREIGS-LHKLETLYLQFNK  420

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN-QLTGAIPREIGA  114
             SG IP  L   S L  +SL  NN  G +PR+ G+L KLE L L  N +L+G+IP E+  
Sbjct  421  LSGSIPEELFNISTLTRVSLSRNNIGGVIPRKIGSLHKLETLDLAENYKLSGSIPEELFN  480

Query  113  LSSLLIVDLSNNKLYGTF  60
            +S+L ++ L+ N L G+ 
Sbjct  481  ISTLRVMSLAFNNLSGSL  498


 Score =   126 bits (317),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 148/288 (51%), Gaps = 8/288 (3%)
 Frame = -1

Query  908  ILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQN  729
            ++ DN    +I P +       S  +++  L++ N  L G    D+GNL  L  L L  N
Sbjct  149  LILDNNGFTAIPPASI------SNLSKLETLSVSNNHLQGSFPKDIGNLQSLKELVLVSN  202

Query  728  NFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLF  552
                S P  +  +  L+ L  ++N  SG++P+     LQ ++ + + +N +SG +P SL 
Sbjct  203  QLTGSIPYSIFNISSLETLALTYNQLSGSLPADICRGLQKIKSISIISNQLSGHIPASLS  262

Query  551  NLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsv  372
            N ++L  L L  N+  G IP EI NL +L+ LNL  NH  G  P  I NL  L+ L L  
Sbjct  263  NCTQLYDLSLSYNNFNGIIPPEIVNLERLEFLNLGGNHLQGIIPAKIGNLRNLQQLQLEN  322

Query  371  nsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREF  192
            N + G +P  + N +  L I    +N  +G IP  +     L+TL L FN  SG +P E 
Sbjct  323  NGIVGSIPRSIRN-MTSLWILNFNTNNLTGVIPEEIGNLHKLETLYLQFNKLSGSIPEEL  381

Query  191  GNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             N++ L ++ L +N + G IPREIG+L  L  + L  NKL G+  + L
Sbjct  382  FNISTLTRVSLSTNNIGGVIPREIGSLHKLETLYLQFNKLSGSIPEEL  429


 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 129/253 (51%), Gaps = 26/253 (10%)
 Frame = -1

Query  797  LVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L  D+   L  + S+++  N      P  LS   +L  L  S+N+F+G IP     
Sbjct  228  LSGSLPADICRGLQKIKSISIISNQLSGHIPASLSNCTQLYDLSLSYNNFNGIIPPEIVN  287

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            L+ L FL LG N++ G +P  + NL  L+ L L  N + GSIPR I N+  L +LN + N
Sbjct  288  LERLEFLNLGGNHLQGIIPAKIGNLRNLQQLQLENNGIVGSIPRSIRNMTSLWILNFNTN  347

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
            + +G  P +I                        GN L KL+   ++ NK SG IP  L 
Sbjct  348  NLTGVIPEEI------------------------GN-LHKLETLYLQFNKLSGSIPEELF  382

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
              S L  +SL  NN  G +PRE G+L KLE L+L+ N+L+G+IP E+  +S+L  V LS 
Sbjct  383  NISTLTRVSLSTNNIGGVIPREIGSLHKLETLYLQFNKLSGSIPEELFNISTLTRVSLSR  442

Query  80   NKLYGTFIQNLDT  42
            N + G   + + +
Sbjct  443  NNIGGVIPRKIGS  455


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 123/243 (51%), Gaps = 3/243 (1%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLN-LSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            G L   +GNLS  + L  L +       P  +  L  L     S ND +G++P  F  L 
Sbjct  596  GVLPDSIGNLSGSLELFFLDETEIRGQIPLGIGNLSNLNTFSISGNDLTGSMPRTFCDLH  655

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            NL+ LYL  N +S  LP  L  LS L ++ L  N + G IP  IGN+  L+ + L+ N  
Sbjct  656  NLQVLYLDQNRLSRPLPECLCKLSGLGLVRLSYNQISGPIPYCIGNVTSLRNIYLNSNRL  715

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            + + P+ + +L  L  L LS NSL G LP   GN L  + +  +  N  SG IP+++   
Sbjct  716  T-NIPMSLWSLKDLVELDLSNNSLVGSLPPKFGN-LDAITLVDLSRNHLSGSIPTTVGDL  773

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              L  LSL FN   G +P   G +  LE + L +N L+G IP+ + AL  L   ++S N+
Sbjct  774  LKLIYLSLAFNELQGSIPESLGKMISLESVILSNNILSGMIPKSLEALRYLKDFNVSFNR  833

Query  74   LYG  66
            L G
Sbjct  834  LEG  836


 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 141/249 (57%), Gaps = 6/249 (2%)
 Frame = -1

Query  794  VGELTP-DLGNLSFLVSLNLSQN-NFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            +G + P  +G+L  L +L+L++N     S P EL  +  L+++  +FN+ SG++PS    
Sbjct  445  IGGVIPRKIGSLHKLETLDLAENYKLSGSIPEELFNISTLRVMSLAFNNLSGSLPSASSY  504

Query  620  LQ-NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
             + NL FL+LGNN+I G +P+S+ N S L+ L L  N   G IP  +G+L QL+ L L +
Sbjct  505  WETNLNFLHLGNNSIDGVIPSSISNSSNLKGLILNNNKFNGPIPNSLGDLRQLERLMLFE  564

Query  443  NHFSG---SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIP  273
            N+ S    S    + N   L+ + +S N L G LP  +GN    L++F +   +  G+IP
Sbjct  565  NNLSSPHLSILTSLANCRSLKEIVISDNPLNGVLPDSIGNLSGSLELFFLDETEIRGQIP  624

Query  272  SSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIV  93
              +   S L T S+  N+ +G +PR F +L  L+ L+L  N+L+  +P  +  LS L +V
Sbjct  625  LGIGNLSNLNTFSISGNDLTGSMPRTFCDLHNLQVLYLDQNRLSRPLPECLCKLSGLGLV  684

Query  92   DLSNNKLYG  66
             LS N++ G
Sbjct  685  RLSYNQISG  693


 Score = 87.0 bits (214),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 125/252 (50%), Gaps = 6/252 (2%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNF---HNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG-  624
            G +   LG+L  L  L L +NN    H S    L+  R LK +  S N  +G +P   G 
Sbjct  545  GPIPNSLGDLRQLERLMLFENNLSSPHLSILTSLANCRSLKEIVISDNPLNGVLPDSIGN  604

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
            L  +L   +L    I G +P  + NLS L    +  N L GS+PR   +L  L++L L  
Sbjct  605  LSGSLELFFLDETEIRGQIPLGIGNLSNLNTFSISGNDLTGSMPRTFCDLHNLQVLYLDQ  664

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N  S   P  +  LS L  + LS N + G +P  +GN +  L+   + SN+ +  IP SL
Sbjct  665  NRLSRPLPECLCKLSGLGLVRLSYNQISGPIPYCIGN-VTSLRNIYLNSNRLT-NIPMSL  722

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
                 L  L L  N+  G +P +FGNL  +  + L  N L+G+IP  +G L  L+ + L+
Sbjct  723  WSLKDLVELDLSNNSLVGSLPPKFGNLDAITLVDLSRNHLSGSIPTTVGDLLKLIYLSLA  782

Query  83   NNKLYGTFIQNL  48
             N+L G+  ++L
Sbjct  783  FNELQGSIPESL  794


 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 0/111 (0%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            L+L N  LVG L P  GNL  +  ++LS+N+   S P  +  L +L  L  +FN+  G+I
Sbjct  731  LDLSNNSLVGSLPPKFGNLDAITLVDLSRNHLSGSIPTTVGDLLKLIYLSLAFNELQGSI  790

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            P   G + +L  + L NN +SG +P SL  L  L+  ++  N LEG IP +
Sbjct  791  PESLGKMISLESVILSNNILSGMIPKSLEALRYLKDFNVSFNRLEGEIPTK  841



>ref|XP_006367834.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Solanum tuberosum]
Length=558

 Score =   253 bits (647),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 148/329 (45%), Positives = 208/329 (63%), Gaps = 2/329 (1%)
 Frame = -1

Query  1046  RHYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPC  867
             R +    +  FH +M    +   TN++TD+  LLSLKS+IS DP   L ++WS  +   C
Sbjct  6     RSFLLTLLLLFHYVMPTSAM-TRTNVSTDQLTLLSLKSQISSDPFHYLDESWSPATYV-C  63

Query  866   NWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLR  687
             +W+GVT + RH RV +LNL NM L G +  D GNL+FLVSL+L +N FH + P+E+  LR
Sbjct  64    HWVGVTYDYRHQRVKSLNLSNMILTGTIPRDFGNLTFLVSLDLRRNKFHGNLPQEMVHLR  123

Query  686   RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSL  507
             +LK L  S N FSG +PSWFG L  L++LYL  N+ +G +P SL N S+LE L +  N L
Sbjct  124   QLKFLDLSLNKFSGEVPSWFGFLDQLQYLYLRYNSFTGSIPPSLSNASRLETLVISANLL  183

Query  506   EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
             EG+IP EIGNL  LK L++  N  +GS P  I N+S++E ++ + N L G+LP  L N L
Sbjct  184   EGNIPEEIGNLHNLKYLSMEINQLTGSIPFTIFNISRIEVIAFTDNRLSGDLPNGLCNRL  243

Query  326   PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ  147
             P L+   +  NK  G +P+SLS CS LQ L L  N F   +  E G L+ L++L+L SN 
Sbjct  244   PLLKGLHLTGNKLHGHMPTSLSNCSQLQILDLSGNEFDRRIRTEIGRLSNLQELYLGSNH  303

Query  146   LTGAIPREIGALSSLLIVDLSNNKLYGTF  60
              TG IP+EIG L +L+ + + +N++ G+ 
Sbjct  304   FTGIIPQEIGNLVNLVELGVESNQITGSI  332


 Score =   106 bits (265),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 94/269 (35%), Positives = 137/269 (51%), Gaps = 24/269 (9%)
 Frame = -1

Query  848  CNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ  669
            CN R   +  L+L    L G +   L N S L  L+LS N F      E+ +L  L+ L 
Sbjct  240  CN-RLPLLKGLHLTGNKLHGHMPTSLSNCSQLQILDLSGNEFDRRIRTEIGRLSNLQELY  298

Query  668  CSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR  489
               N F+G IP   G L NL  L + +N I+G +P S+FN+S L+++ L  N+L+GS+PR
Sbjct  299  LGSNHFTGIIPQEIGNLVNLVELGVESNQITGSIPISIFNISSLQIVLLRENNLKGSLPR  358

Query  488  EIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIF  309
            EIG+L +++LL L +N F+                 LS N L G +P  LG +L  L   
Sbjct  359  EIGHLTKMQLLYLDENRFT----------------ELSGNKLSGLIPNSLG-YLTHLHFL  401

Query  308  VMRSNKFSGEIPS-----SLSKCSLLQTLSLPFNNFSGHVPREFGNLTK-LEKLFLRSNQ  147
             +  N  +    S     SL+ C  L  LSL  N  +G +P    N +K L   +  +  
Sbjct  402  NLGGNNLTSSDSSLSFLTSLTNCRRLTVLSLSLNPLNGMLPVSVRNFSKSLVNFYAAACN  461

Query  146  LTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            + G IP E+G L++L+ +DLSNN L G+ 
Sbjct  462  INGQIPNEVGNLTNLIDLDLSNNNLIGSI  490


 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 82/252 (33%), Positives = 123/252 (49%), Gaps = 13/252 (5%)
 Frame = -1

Query  776  DLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLY  597
            ++G LS L  L L  N+F    P+E+  L  L  L    N  +G+IP     + +L+ + 
Sbjct  287  EIGRLSNLQELYLGSNHFTGIIPQEIGNLVNLVELGVESNQITGSIPISIFNISSLQIVL  346

Query  596  LGNNNISGFLPTSLFNLSKLEVLHLGV--------NSLEGSIPREIGNLFQLKLLNLSDN  441
            L  NN+ G LP  + +L+K+++L+L          N L G IP  +G L  L  LNL  N
Sbjct  347  LRENNLKGSLPREIGHLTKMQLLYLDENRFTELSGNKLSGLIPNSLGYLTHLHFLNLGGN  406

Query  440  HFSG-----SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEI  276
            + +      SF   + N  +L  LSLS+N L G LP+ + N    L  F   +   +G+I
Sbjct  407  NLTSSDSSLSFLTSLTNCRRLTVLSLSLNPLNGMLPVSVRNFSKSLVNFYAAACNINGQI  466

Query  275  PSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLI  96
            P+ +   + L  L L  NN  G +P    NL  L+ +    N+LTG I   I  L  L +
Sbjct  467  PNEVGNLTNLIDLDLSNNNLIGSIPTSIHNLRNLQGMSFPCNKLTGFIGDHIRKLQHLGV  526

Query  95   VDLSNNKLYGTF  60
            +DL  N+L G+ 
Sbjct  527  IDLDQNQLSGSL  538


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P D GN L  L    +R NKF G +P  +     L+ L L  N FSG VP  FG L 
Sbjct  89   GTIPRDFGN-LTFLVSLDLRRNKFHGNLPQEMVHLRQLKFLDLSLNKFSGEVPSWFGFLD  147

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            +L+ L+LR N  TG+IP  +   S L  + +S N L G   + +
Sbjct  148  QLQYLYLRYNSFTGSIPPSLSNASRLETLVISANLLEGNIPEEI  191


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 68/156 (44%), Gaps = 30/156 (19%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNS-----FPRELSQLRRLKILQCSFN--------  657
            L G +   LG L+ L  LNL  NN  +S     F   L+  RRL +L  S N        
Sbjct  384  LSGLIPNSLGYLTHLHFLNLGGNNLTSSDSSLSFLTSLTNCRRLTVLSLSLNPLNGMLPV  443

Query  656  -----------------DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVL  528
                             + +G IP+  G L NL  L L NNN+ G +PTS+ NL  L+ +
Sbjct  444  SVRNFSKSLVNFYAAACNINGQIPNEVGNLTNLIDLDLSNNNLIGSIPTSIHNLRNLQGM  503

Query  527  HLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
                N L G I   I  L  L +++L  N  SGS P
Sbjct  504  SFPCNKLTGFIGDHIRKLQHLGVIDLDQNQLSGSLP  539



>ref|XP_006358723.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Solanum tuberosum]
Length=924

 Score =   260 bits (664),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 158/330 (48%), Positives = 217/330 (66%), Gaps = 5/330 (2%)
 Frame = -1

Query  1037  FCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWI  858
             F L+IF    +ML    ++   I+TDK ALLSLKS+ISFDP++ILA NWS +S   C+WI
Sbjct  9     FALAIF----IMLHRHTSSLATISTDKAALLSLKSQISFDPNNILARNWSSSSPV-CSWI  63

Query  857   GVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLK  678
             G+TC+SRH+RV+ALN+ +M L G ++P LGNLSFLVSLN+S N F+   P EL+ L+RLK
Sbjct  64    GITCSSRHHRVTALNISSMQLHGTISPHLGNLSFLVSLNISYNAFYGDLPVELAHLQRLK  123

Query  677   ILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGS  498
              +  + N+F+G I S   LL NLRF YL  N  SG +P+ + N++KLEVL +  N L+G 
Sbjct  124   FISATSNNFTGAILSSLSLLPNLRFAYLSMNQFSGEVPSFISNITKLEVLSMQNNFLKGE  183

Query  497   IPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKL  318
             IPRE+G+L  L  L+L  N  SGS P  I N++ ++N+ L+ N+L G+LP  + +HLP L
Sbjct  184   IPRELGDLCYLTYLDLQFNELSGSIPASIFNITTMKNIGLTYNNLTGQLPTTICDHLPNL  243

Query  317   QIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
             +   +  N   G IP +L KC  LQ LSL +N F+G VPRE  NLT L KL++    L G
Sbjct  244   KGLYLSRNYLGGVIPPNLEKCRKLQFLSLTYNEFTGTVPRELANLTALTKLYVGGLHLEG  303

Query  137   AIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
              IP E+G L  L  + LS ++  G+   N+
Sbjct  304   EIPVELGNLKKLQALGLSGSRFSGSVPANI  333


 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 125/248 (50%), Gaps = 2/248 (1%)
 Frame = -1

Query  797  LVGELTPDLGNLS-FLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L   +GN S  L +          + PRE+  L  +  +   +N+ +G+IP+    
Sbjct  450  LDGVLPASVGNFSNSLQTFGGDGCKLKGTIPREIGNLTGVTRIDLQYNELTGHIPNTVQG  509

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            + +L+ LYL +N I G +P  + +L  L  L L  N   GS+P  +GN+  L+ L L+ N
Sbjct  510  MLSLQELYLQSNKIEGTIPDVMCSLKNLGALDLSRNRFSGSVPPCLGNVASLRTLYLAVN  569

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              +   P  +  L  L   ++S N L GE+P ++GN L    +  +  N FSG+IPS+L 
Sbjct  570  RLNSRLPASLGGLRDLIEFNISSNLLSGEIPFEIGN-LKAATLIDLSKNDFSGKIPSTLG  628

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
                L  LSL  N   G +P  FG +  LE L L  N L+G IP+ + AL  L  ++ S 
Sbjct  629  GLDKLINLSLAHNRLEGPIPDSFGKMLALEFLDLCYNYLSGQIPKSLEALVYLKYMNFSF  688

Query  80   NKLYGTFI  57
            NKL G  +
Sbjct  689  NKLSGEIL  696


 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 85/296 (29%), Positives = 124/296 (42%), Gaps = 75/296 (25%)
 Frame = -1

Query  755  LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNIS  576
            L  L LS+N      P  L + R+L+ L  ++N+F+G +P     L  L  LY+G  ++ 
Sbjct  243  LKGLYLSRNYLGGVIPPNLEKCRKLQFLSLTYNEFTGTVPRELANLTALTKLYVGGLHLE  302

Query  575  GFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsk  396
            G +P  L NL KL+ L L  +   GS+P  I N+  L+ L+++ N  SG+ P D+     
Sbjct  303  GEIPVELGNLKKLQALGLSGSRFSGSVPANIFNMSSLQALDIAQNKLSGTLPSDLGCAMP  362

Query  395  lenlslsvnsLFGELPLDLGNHL-----------PKLQIFVMRSNKFSGEIPSSLSKCSL  249
                         E  L  GNHL            +L+I  +  N F+G IP SL K   
Sbjct  363  NL-----------EKFLCGGNHLSGFISPTISNSSRLRILELSGNSFTGSIPGSLGKLEY  411

Query  248  LQTLSLPFNNF-------------------------------------------------  216
            L+ LSL  NNF                                                 
Sbjct  412  LEFLSLWGNNFVGDSTLSFLTSLTKCRKLRSLWFDRNPLDGVLPASVGNFSNSLQTFGGD  471

Query  215  ----SGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
                 G +PRE GNLT + ++ L+ N+LTG IP  +  + SL  + L +NK+ GT 
Sbjct  472  GCKLKGTIPREIGNLTGVTRIDLQYNELTGHIPNTVQGMLSLQELYLQSNKIEGTI  527


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 97/296 (33%), Positives = 139/296 (47%), Gaps = 30/296 (10%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLK-  678
            S  +R+  L L      G +   LG L +L  L+L  NNF      SF   L++ R+L+ 
Sbjct  383  SNSSRLRILELSGNSFTGSIPGSLGKLEYLEFLSLWGNNFVGDSTLSFLTSLTKCRKLRS  442

Query  677  ----------ILQCSFNDFS--------------GNIPSWFGLLQNLRFLYLGNNNISGF  570
                      +L  S  +FS              G IP   G L  +  + L  N ++G 
Sbjct  443  LWFDRNPLDGVLPASVGNFSNSLQTFGGDGCKLKGTIPREIGNLTGVTRIDLQYNELTGH  502

Query  569  LPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlskle  390
            +P ++  +  L+ L+L  N +EG+IP  + +L  L  L+LS N FSGS P  + N++ L 
Sbjct  503  IPNTVQGMLSLQELYLQSNKIEGTIPDVMCSLKNLGALDLSRNRFSGSVPPCLGNVASLR  562

Query  389  nlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSG  210
             L L+VN L   LP  LG  L  L  F + SN  SGEIP  +        + L  N+FSG
Sbjct  563  TLYLAVNRLNSRLPASLGG-LRDLIEFNISSNLLSGEIPFEIGNLKAATLIDLSKNDFSG  621

Query  209  HVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
             +P   G L KL  L L  N+L G IP   G + +L  +DL  N L G   ++L+ 
Sbjct  622  KIPSTLGGLDKLINLSLAHNRLEGPIPDSFGKMLALEFLDLCYNYLSGQIPKSLEA  677


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 104/232 (45%), Gaps = 25/232 (11%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            V+ ++L    L G +   +  +  L  L L  N    + P  +  L+ L  L  S N FS
Sbjct  489  VTRIDLQYNELTGHIPNTVQGMLSLQELYLQSNKIEGTIPDVMCSLKNLGALDLSRNRFS  548

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G++P   G + +LR LYL  N ++  LP SL  L  L   ++  N L G IP EIGNL  
Sbjct  549  GSVPPCLGNVASLRTLYLAVNRLNSRLPASLGGLRDLIEFNISSNLLSGEIPFEIGNLKA  608

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
              L++LS N FS                        G++P  LG  L KL    +  N+ 
Sbjct  609  ATLIDLSKNDFS------------------------GKIPSTLGG-LDKLINLSLAHNRL  643

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAI  132
             G IP S  K   L+ L L +N  SG +P+    L  L+ +    N+L+G I
Sbjct  644  EGPIPDSFGKMLALEFLDLCYNYLSGQIPKSLEALVYLKYMNFSFNKLSGEI  695



>ref|XP_010322115.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Solanum lycopersicum]
Length=1080

 Score =   260 bits (665),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 214/327 (65%), Gaps = 4/327 (1%)
 Frame = -1

Query  1034  CLSIFFFHSLMLC---LTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCN  864
             C+ +F F  L+L     ++    NI+TD+ AL +LKS IS  P++IL  NWS +S   C+
Sbjct  6     CIVLFGFAVLILLPNQTSLATVPNISTDEAALFALKSHISSHPNNILESNWSSSSPV-CS  64

Query  863   WIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRR  684
             WIG+TC+SRH+RV+AL++ NM L G + P +GNLSFLVSL ++ N FH + P EL+ L+R
Sbjct  65    WIGITCSSRHHRVTALDISNMQLHGTIPPHIGNLSFLVSLRINYNTFHGNLPAELAHLKR  124

Query  683   LKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLE  504
             LK++    N+F+G IPS+  LL NL  + L +N  SG +P+SLFNL+KL+VL L  N L 
Sbjct  125   LKLINVRSNNFTGAIPSFLSLLPNLHTVSLWSNQFSGKIPSSLFNLTKLQVLTLQSNFLV  184

Query  503   GSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLP  324
             G IPREIG+L  L +L+L  N  +G  P  I N++ ++ ++L+ N+L G+LP  + +HLP
Sbjct  185   GEIPREIGDLRYLTVLDLQYNQLTGPIPPSIFNITTMQVIALTNNNLTGKLPTTICDHLP  244

Query  323   KLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQL  144
              L+   + SN   G IPS+L KC  L TLSL FN+F G VPRE  NLT L  LFL    L
Sbjct  245   NLERLYLSSNSLYGVIPSNLEKCRKLHTLSLSFNDFIGTVPRELANLTSLITLFLGQQHL  304

Query  143   TGAIPREIGALSSLLIVDLSNNKLYGT  63
              G IP E+G L  L  + L+ N+L G+
Sbjct  305   EGEIPVELGNLKKLQKLGLAENELTGS  331


 Score =   120 bits (302),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 96/275 (35%), Positives = 138/275 (50%), Gaps = 7/275 (3%)
 Frame = -1

Query  866  NWIGVTCNSRHNRVSALNLF--NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQ  693
            ++IG       N  S + LF     L GE+  +LGNL  L  L L++N    S P  +  
Sbjct  279  DFIGTVPRELANLTSLITLFLGQQHLEGEIPVELGNLKKLQKLGLAENELTGSVPTSIFN  338

Query  692  LRRLKILQCSFNDFSGNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGV  516
            +  L++L  S N  SG +PS  G  + NL   Y G N++SGF+  S+ N S+L +L L  
Sbjct  339  ISALQVLILSLNKLSGTLPSDLGRGMPNLEEFYCGGNSLSGFISDSITNYSRLRMLDLSF  398

Query  515  NSLEGSIPREIGNLFQLKLLNLSDNHFSG----SFPLDIlnlsklenlslsvnsLFGELP  348
            NS  G IP+ +G L  L+ LNL  N F+     SF   + N   L NL L  N L    P
Sbjct  399  NSFTGPIPKSLGKLEYLEALNLGYNSFTSDSTLSFLASLNNCRNLRNLWLYNNPLDAIFP  458

Query  347  LDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEK  168
              +GN    L  F     K  G IP+ + K + L  +SL  N F+G +P     +  L++
Sbjct  459  ASVGNFSDSLHGFEADGCKLKGMIPNEIGKLTGLTKMSLYNNEFTGFIPNTIQGMLSLQE  518

Query  167  LFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGT  63
            L+L  N++ G IP  + +L +L  +DLS NK  G+
Sbjct  519  LYLDGNKIQGTIPDYMCSLQNLGALDLSQNKFSGS  553


 Score =   110 bits (276),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 82/230 (36%), Positives = 111/230 (48%), Gaps = 25/230 (11%)
 Frame = -1

Query  827  VSALNLFNMGLVGEL-TPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            +  + L N  L G+L T    +L  L  L LS N+ +   P  L + R+L  L  SFNDF
Sbjct  221  MQVIALTNNNLTGKLPTTICDHLPNLERLYLSSNSLYGVIPSNLEKCRKLHTLSLSFNDF  280

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
             G +P     L +L  L+LG  ++ G +P  L NL KL+ L L  N L GS+P  I N+ 
Sbjct  281  IGTVPRELANLTSLITLFLGQQHLEGEIPVELGNLKKLQKLGLAENELTGSVPTSIFNIS  340

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
             L++L LS N  SG+                        LP DLG  +P L+ F    N 
Sbjct  341  ALQVLILSLNKLSGT------------------------LPSDLGRGMPNLEEFYCGGNS  376

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
             SG I  S++  S L+ L L FN+F+G +P+  G L  LE L L  N  T
Sbjct  377  LSGFISDSITNYSRLRMLDLSFNSFTGPIPKSLGKLEYLEALNLGYNSFT  426


 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 141/296 (48%), Gaps = 30/296 (10%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLK-  678
            + ++R+  L+L      G +   LG L +L +LNL  N+F +    SF   L+  R L+ 
Sbjct  386  TNYSRLRMLDLSFNSFTGPIPKSLGKLEYLEALNLGYNSFTSDSTLSFLASLNNCRNLRN  445

Query  677  ----------ILQCSFNDFS--------------GNIPSWFGLLQNLRFLYLGNNNISGF  570
                      I   S  +FS              G IP+  G L  L  + L NN  +GF
Sbjct  446  LWLYNNPLDAIFPASVGNFSDSLHGFEADGCKLKGMIPNEIGKLTGLTKMSLYNNEFTGF  505

Query  569  LPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlskle  390
            +P ++  +  L+ L+L  N ++G+IP  + +L  L  L+LS N FSGS P  +  L++L 
Sbjct  506  IPNTIQGMLSLQELYLDGNKIQGTIPDYMCSLQNLGALDLSQNKFSGSVPPCLGKLTRLR  565

Query  389  nlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSG  210
             L L  N L   LP  LG+ L  L  F + SN  SG+IP  +        + L  N+FSG
Sbjct  566  ILHLDYNRLDSRLPESLGS-LTDLLEFSVSSNLLSGQIPFEIGNLQAATIIDLSKNDFSG  624

Query  209  HVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
             +P   G L KL  L L  N+L G IP   G + +L  +DL  N L G   ++L+ 
Sbjct  625  TIPTTLGGLDKLIHLSLEHNRLDGPIPDSFGKMLALEFLDLCYNNLVGEIPKSLEA  680


 Score = 97.8 bits (242),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 80/262 (31%), Positives = 114/262 (44%), Gaps = 31/262 (12%)
 Frame = -1

Query  914  HSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLS  735
            H   AD   +  + P N IG     +   ++ ++L+N    G +   +  +  L  L L 
Sbjct  469  HGFEADGCKLKGMIP-NEIG-----KLTGLTKMSLYNNEFTGFIPNTIQGMLSLQELYLD  522

Query  734  QNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSL  555
             N    + P  +  L+ L  L  S N FSG++P   G L  LR L+L  N +   LP SL
Sbjct  523  GNKIQGTIPDYMCSLQNLGALDLSQNKFSGSVPPCLGKLTRLRILHLDYNRLDSRLPESL  582

Query  554  FNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlsls  375
             +L+ L    +  N L G IP EIGNL    +++LS N FSG+                 
Sbjct  583  GSLTDLLEFSVSSNLLSGQIPFEIGNLQAATIIDLSKNDFSGT-----------------  625

Query  374  vnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPRE  195
                   +P  LG  L KL    +  N+  G IP S  K   L+ L L +NN  G +P+ 
Sbjct  626  -------IPTTLGG-LDKLIHLSLEHNRLDGPIPDSFGKMLALEFLDLCYNNLVGEIPKS  677

Query  194  FGNLTKLEKLFLRSNQLTGAIP  129
               L  L+ L    N+L G IP
Sbjct  678  LEALVSLKYLNFSFNKLIGEIP  699


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 111/208 (53%), Gaps = 7/208 (3%)
 Frame = -1

Query  650  SGNIPSWFGLLQNLRF-----LYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            S  + SW G+  + R      L + N  + G +P  + NLS L  L +  N+  G++P E
Sbjct  59   SSPVCSWIGITCSSRHHRVTALDISNMQLHGTIPPHIGNLSFLVSLRINYNTFHGNLPAE  118

Query  485  IGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
            + +L +LKL+N+  N+F+G+ P  +  L  L  +SL  N   G++P  L N L KLQ+  
Sbjct  119  LAHLKRLKLINVRSNNFTGAIPSFLSLLPNLHTVSLWSNQFSGKIPSSLFN-LTKLQVLT  177

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
            ++SN   GEIP  +     L  L L +N  +G +P    N+T ++ + L +N LTG +P 
Sbjct  178  LQSNFLVGEIPREIGDLRYLTVLDLQYNQLTGPIPPSIFNITTMQVIALTNNNLTGKLPT  237

Query  125  EI-GALSSLLIVDLSNNKLYGTFIQNLD  45
             I   L +L  + LS+N LYG    NL+
Sbjct  238  TICDHLPNLERLYLSSNSLYGVIPSNLE  265



>ref|XP_009760442.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana sylvestris]
Length=1102

 Score =   260 bits (665),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 149/327 (46%), Positives = 213/327 (65%), Gaps = 5/327 (2%)
 Frame = -1

Query  1037  FCLSIFF-FHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNW  861
             F L +F  FH      T+    NI TD+ ALL+LKS IS  P+++L  NWS +S   C+W
Sbjct  28    FALVVFILFHHHTSLATV---PNINTDEAALLALKSHISSHPNNLLQSNWSSSSPV-CSW  83

Query  860   IGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRL  681
             IG+TC+SRH+RV+AL++ +M L G + P LGNLSFLVSL++S N FH   P EL+ L+RL
Sbjct  84    IGITCSSRHHRVTALDISSMQLHGTIPPHLGNLSFLVSLDISNNTFHGELPEELAHLQRL  143

Query  680   KILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEG  501
             K++  + N+F+G IP +  LL N+R++YL +N  SG +P+SL N++KLEVL L  N LEG
Sbjct  144   KLIDVTINNFTGAIPPFLSLLSNVRYMYLSSNQFSGKIPSSLSNVTKLEVLTLKENFLEG  203

Query  500   SIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPK  321
              IPRE+G+L  +  ++L  N  +GS P  I N++ ++ + L+ N+L G+ P  + +HLP 
Sbjct  204   VIPRELGDLRHMTFIDLQFNRLTGSIPPSIYNITSMQKIGLTYNNLTGKFPTTICDHLPN  263

Query  320   LQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
             L+ F +  N   G IP +L KC  LQ LSL  N+F+G VP+E GNLT L +L+L    L 
Sbjct  264   LEKFAISYNYLDGIIPPNLEKCRKLQMLSLSGNDFTGTVPKEIGNLTVLTELYLGDMHLE  323

Query  140   GAIPREIGALSSLLIVDLSNNKLYGTF  60
             G IP E+G L  L ++ L  N+  G+ 
Sbjct  324   GEIPVELGNLKKLQLLGLFGNEFIGSI  350


 Score =   110 bits (276),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 88/260 (34%), Positives = 133/260 (51%), Gaps = 5/260 (2%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            ++ L L +M L GE+  +LGNL  L  L L  N F  S P  +  +  ++ L    N   
Sbjct  312  LTELYLGDMHLEGEIPVELGNLKKLQLLGLFGNEFIGSIPTSIFNMSAMQYLSFDGNGLL  371

Query  647  GNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
            G +PS  G  + +L       NN+SGF+P S+ N S+L  L L  NS  G I + +GNL 
Sbjct  372  GTLPSDLGHRMPSLVEFNCATNNLSGFIPASISNSSRLRKLDLSANSFTGPILKSLGNLE  431

Query  470  QLKLLNLSDNHFSG----SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVM  303
             L+ LNL  N+F      SF   + N  KL  + LS N L G  P  +GN    L IF  
Sbjct  432  HLEFLNLQYNNFYSDSTLSFLTSLTNCRKLRVIGLSENPLHGFFPTSVGNFSDSLHIFES  491

Query  302  RSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPRE  123
             + K  G IP  +   + +  +++  N  +GH+P+    +  L++L+L+ N++ G IP  
Sbjct  492  YACKLKGSIPEEIGNLTGVTRMNMLNNELTGHIPKTIQRMLNLQQLYLQRNKIEGTIPDV  551

Query  122  IGALSSLLIVDLSNNKLYGT  63
            I  L +L  +DL+ N+L G+
Sbjct  552  ICTLKNLGALDLTENQLSGS  571


 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 113/217 (52%), Gaps = 1/217 (0%)
 Frame = -1

Query  716  SFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKL  537
            S P E+  L  +  +    N+ +G+IP     + NL+ LYL  N I G +P  +  L  L
Sbjct  499  SIPEEIGNLTGVTRMNMLNNELTGHIPKTIQRMLNLQQLYLQRNKIEGTIPDVICTLKNL  558

Query  536  EVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFG  357
              L L  N L GS+P  +GN+  L+ L L+ N  + + P  + +L  L   +++ N L G
Sbjct  559  GALDLTENQLSGSVPPCLGNITSLRNLYLAYNRLNSTLPASLGSLQDLVEFNVTSNLLSG  618

Query  356  ELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTK  177
            ++PL+ GN +    +  +  N FSGEIP++L     L  LSL  N   G +P  FG +  
Sbjct  619  KIPLEFGN-IKAATLIDLSKNNFSGEIPNTLVGLDRLIKLSLAHNRLDGPIPNSFGRMLA  677

Query  176  LEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            LE L L  N L+G IP+ + AL  L  ++ S NKL G
Sbjct  678  LEFLDLCYNNLSGEIPKSLEALVYLKYLNFSFNKLSG  714


 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 95/296 (32%), Positives = 140/296 (47%), Gaps = 30/296 (10%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLKI  675
            S  +R+  L+L      G +   LGNL  L  LNL  NNF++    SF   L+  R+L++
Sbjct  404  SNSSRLRKLDLSANSFTGPILKSLGNLEHLEFLNLQYNNFYSDSTLSFLTSLTNCRKLRV  463

Query  674  LQCSFN-------------------------DFSGNIPSWFGLLQNLRFLYLGNNNISGF  570
            +  S N                            G+IP   G L  +  + + NN ++G 
Sbjct  464  IGLSENPLHGFFPTSVGNFSDSLHIFESYACKLKGSIPEEIGNLTGVTRMNMLNNELTGH  523

Query  569  LPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlskle  390
            +P ++  +  L+ L+L  N +EG+IP  I  L  L  L+L++N  SGS P  + N++ L 
Sbjct  524  IPKTIQRMLNLQQLYLQRNKIEGTIPDVICTLKNLGALDLTENQLSGSVPPCLGNITSLR  583

Query  389  nlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSG  210
            NL L+ N L   LP  LG+ L  L  F + SN  SG+IP           + L  NNFSG
Sbjct  584  NLYLAYNRLNSTLPASLGS-LQDLVEFNVTSNLLSGKIPLEFGNIKAATLIDLSKNNFSG  642

Query  209  HVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
             +P     L +L KL L  N+L G IP   G + +L  +DL  N L G   ++L+ 
Sbjct  643  EIPNTLVGLDRLIKLSLAHNRLDGPIPNSFGRMLALEFLDLCYNNLSGEIPKSLEA  698


 Score =   102 bits (254),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 83/275 (30%), Positives = 122/275 (44%), Gaps = 53/275 (19%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRE-------------------------LSQ  693
            L G + P + N++ +  + L+ NN    FP                           L +
Sbjct  225  LTGSIPPSIYNITSMQKIGLTYNNLTGKFPTTICDHLPNLEKFAISYNYLDGIIPPNLEK  284

Query  692  LRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVN  513
             R+L++L  S NDF+G +P   G L  L  LYLG+ ++ G +P  L NL KL++L L  N
Sbjct  285  CRKLQMLSLSGNDFTGTVPKEIGNLTVLTELYLGDMHLEGEIPVELGNLKKLQLLGLFGN  344

Query  512  SLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGN  333
               GSIP  I N+  ++ L+   N                           G LP DLG+
Sbjct  345  EFIGSIPTSIFNMSAMQYLSFDGNGL------------------------LGTLPSDLGH  380

Query  332  HLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRS  153
             +P L  F   +N  SG IP+S+S  S L+ L L  N+F+G + +  GNL  LE L L+ 
Sbjct  381  RMPSLVEFNCATNNLSGFIPASISNSSRLRKLDLSANSFTGPILKSLGNLEHLEFLNLQY  440

Query  152  NQL----TGAIPREIGALSSLLIVDLSNNKLYGTF  60
            N      T +    +     L ++ LS N L+G F
Sbjct  441  NNFYSDSTLSFLTSLTNCRKLRVIGLSENPLHGFF  475


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 71/223 (32%), Positives = 112/223 (50%), Gaps = 1/223 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +  ++GNL+ +  +N+  N      P+ + ++  L+ L    N   G IP     L
Sbjct  496  LKGSIPEEIGNLTGVTRMNMLNNELTGHIPKTIQRMLNLQQLYLQRNKIEGTIPDVICTL  555

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            +NL  L L  N +SG +P  L N++ L  L+L  N L  ++P  +G+L  L   N++ N 
Sbjct  556  KNLGALDLTENQLSGSVPPCLGNITSLRNLYLAYNRLNSTLPASLGSLQDLVEFNVTSNL  615

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             SG  PL+  N+     + LS N+  GE+P  L   L +L    +  N+  G IP+S  +
Sbjct  616  LSGKIPLEFGNIKAATLIDLSKNNFSGEIPNTLVG-LDRLIKLSLAHNRLDGPIPNSFGR  674

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
               L+ L L +NN SG +P+    L  L+ L    N+L+G IP
Sbjct  675  MLALEFLDLCYNNLSGEIPKSLEALVYLKYLNFSFNKLSGEIP  717


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 117/232 (50%), Gaps = 5/232 (2%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            V+ +N+ N  L G +   +  +  L  L L +N    + P  +  L+ L  L  + N  S
Sbjct  510  VTRMNMLNNELTGHIPKTIQRMLNLQQLYLQRNKIEGTIPDVICTLKNLGALDLTENQLS  569

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G++P   G + +LR LYL  N ++  LP SL +L  L   ++  N L G IP E GN+  
Sbjct  570  GSVPPCLGNITSLRNLYLAYNRLNSTLPASLGSLQDLVEFNVTSNLLSGKIPLEFGNIKA  629

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
              L++LS N+FSG  P  ++ L +L  LSL+ N L G +P   G  L  L+   +  N  
Sbjct  630  ATLIDLSKNNFSGEIPNTLVGLDRLIKLSLAHNRLDGPIPNSFGRML-ALEFLDLCYNNL  688

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPR--EFGNLTKLEKLFLRSNQLTG  138
            SGEIP SL     L+ L+  FN  SG +P    F N T   + FL ++ L G
Sbjct  689  SGEIPKSLEALVYLKYLNFSFNKLSGEIPSGGPFANAT--SQSFLANDALCG  738


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P  LGN L  L    + +N F GE+P  L+    L+ + +  NNF+G +P     L+
Sbjct  107  GTIPPHLGN-LSFLVSLDISNNTFHGELPEELAHLQRLKLIDVTINNFTGAIPPFLSLLS  165

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             +  ++L SNQ +G IP  +  ++ L ++ L  N L G   + L
Sbjct  166  NVRYMYLSSNQFSGKIPSSLSNVTKLEVLTLKENFLEGVIPREL  209



>ref|XP_006344114.1| PREDICTED: putative receptor-like protein kinase At3g47110-like 
[Solanum tuberosum]
Length=319

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/282 (49%), Positives = 190/282 (67%), Gaps = 1/282 (0%)
 Frame = -1

Query  977  TNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMG  798
             NI+TD+ +LL+LKS IS   ++ILA NWS +S+  C+WIG+TC+SRH+RV+ALN+ +M 
Sbjct  20   ANISTDEASLLALKSHISSHSNNILASNWS-SSVPVCSWIGITCSSRHHRVTALNISSMQ  78

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G + P LGNLSFLVSLN++ N FH   P+EL+ L+RLK      N+F+G IPS+  LL
Sbjct  79   LHGTIPPHLGNLSFLVSLNINNNTFHGDLPQELAHLQRLKFFYAKNNNFTGAIPSFLSLL  138

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
             NLRFLYL NN  SG +P+SL NL+KL+VL +  N  EG IP+E+G+L  L +LNL  N 
Sbjct  139  PNLRFLYLSNNQFSGKIPSSLSNLTKLQVLSIQSNFFEGEIPQELGDLRYLIVLNLQYNQ  198

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             SGS P  I +++ ++ ++LS N+  G+LP+ + +HLP L+   +  N   G IP +L K
Sbjct  199  LSGSIPPSIFDITTMQVIALSGNNFTGKLPITICDHLPDLEGLYLGRNSLDGVIPPNLEK  258

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAI  132
            C  LQ L L  N  +G VPRE  NLT L  L+L    L G+I
Sbjct  259  CRKLQILELTENEIAGTVPRELANLTTLTGLYLMDLHLEGSI  300


 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 108/205 (53%), Gaps = 32/205 (16%)
 Frame = -1

Query  659  NDFSGNIP--SWFGLLQNLRFLYLGNNNIS-----GFLPTSLFNLSKLEVLHLGVNSLEG  501
            +++S ++P  SW G+  + R   +   NIS     G +P  L NLS L  L++  N+  G
Sbjct  46   SNWSSSVPVCSWIGITCSSRHHRVTALNISSMQLHGTIPPHLGNLSFLVSLNINNNTFHG  105

Query  500  SIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPK  321
             +P+E+ +L +LK     +N+F+G+ P                   F  L       LP 
Sbjct  106  DLPQELAHLQRLKFFYAKNNNFTGAIP------------------SFLSL-------LPN  140

Query  320  LQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
            L+   + +N+FSG+IPSSLS  + LQ LS+  N F G +P+E G+L  L  L L+ NQL+
Sbjct  141  LRFLYLSNNQFSGKIPSSLSNLTKLQVLSIQSNFFEGEIPQELGDLRYLIVLNLQYNQLS  200

Query  140  GAIPREIGALSSLLIVDLSNNKLYG  66
            G+IP  I  ++++ ++ LS N   G
Sbjct  201  GSIPPSIFDITTMQVIALSGNNFTG  225



>ref|XP_009376755.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Pyrus x bretschneideri]
Length=1116

 Score =   260 bits (664),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 163/357 (46%), Positives = 214/357 (60%), Gaps = 32/357 (9%)
 Frame = -1

Query  1025  IFFFHSLMLC--LTINA----HTNITTDKHALLSLKSKISFDPHSILADNWS--VNSITP  870
             +F+ + +++   LT  A    HTN +TD+  LL+LK+ I+ DP +IL  NWS   NS   
Sbjct  8     LFYIYMMIMANYLTAGALAIVHTNFSTDQSTLLALKAHITSDPQNILTANWSSAFNS-NI  66

Query  869   CNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQL  690
             CNW+GVTC +RH+RV+ALNL  MGL G + P LGNLSFLV L L  NNFH   P+ELS+L
Sbjct  67    CNWVGVTCGARHHRVTALNLSYMGLAGVIPPHLGNLSFLVELGLQNNNFHGPLPQELSRL  126

Query  689   RRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNS  510
             RRLK +    N+F G IPSWFG    L+ + L  N+ SGF+PT++FNLS LE ++L  N 
Sbjct  127   RRLKEINFGNNNFMGTIPSWFGSFAKLQTIILYGNSFSGFIPTAIFNLSALENIYLMRNQ  186

Query  509   LEGSIPREIGNLFQLKLLNLSDNHFS-----------------------GSFPLDIlnls  399
             L GSIPREIGNL  +K + L DN F                        GS  + +LN+S
Sbjct  187   LSGSIPREIGNLTMVKGIYLDDNKFEELPNEIGSLGQLEELFVQHNALKGSAFVPVLNIS  246

Query  398   klenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNN  219
              L  L+L  N++ G LP ++  HL  ++   +  NKF G IPS L +C  L+ LSL +NN
Sbjct  247   SLTTLTLFGNNMSGSLPDNICEHLSSIRQINLGQNKFDGHIPSKLWQCKDLRYLSLVYNN  306

Query  218   FSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             F G +P+  GNLT L ++FL  N L G IP EIG LS L ++ LS N L G     L
Sbjct  307   FRGSIPKSLGNLTYLSQIFLEDNNLEGTIPDEIGDLSQLEVLQLSVNNLNGVIPSKL  363


 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 90/237 (38%), Positives = 124/237 (52%), Gaps = 3/237 (1%)
 Frame = -1

Query  770  GNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            GNLS  L   +LS +N   + P +++ L  L  L    N  SG IP+    L+NL+ L+L
Sbjct  487  GNLSTPLTYFDLSISNIRGNIPIDIANLSSLIELHLEINQLSGAIPTSIQRLKNLQGLFL  546

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL-FQLKLLNLSDNHFSGSFPL  417
             +N + G +P  L  L+ L VL LG N L GSIP  +G L   L+ L+L  N  +   P 
Sbjct  547  YDNELQGHIPYELCQLNNLAVLGLGRNRLSGSIPSCLGTLSVALRNLSLESNLLTSKIPS  606

Query  416  DIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL  237
             +  L  + +L+LS NSL G L  D+G  L  +    + +N FSG IP S+     +  L
Sbjct  607  SLWELKSILHLNLSSNSLVGPLSEDIG-RLKDVVDIDLSNNHFSGNIPGSIGGLQKMINL  665

Query  236  SLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            SL  N   G +P  F  L  LE L L  N L+G IP+ + AL  L  ++LS NKL G
Sbjct  666  SLANNYLEGPIPSSFKTLLSLEFLDLSKNNLSGEIPKSLEALLYLKHLNLSFNKLQG  722


 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 90/308 (29%), Positives = 141/308 (46%), Gaps = 56/308 (18%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            ++ L LF   + G L  ++  +LS +  +NL QN F    P +L Q + L+ L   +N+F
Sbjct  248  LTTLTLFGNNMSGSLPDNICEHLSSIRQINLGQNKFDGHIPSKLWQCKDLRYLSLVYNNF  307

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
             G+IP   G L  L  ++L +NN+ G +P  + +LS+LEVL L VN+L G IP ++ N  
Sbjct  308  RGSIPKSLGNLTYLSQIFLEDNNLEGTIPDEIGDLSQLEVLQLSVNNLNGVIPSKLFNNS  367

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
             +++++L+ N  SG  P +I              +     PL   ++  KL+   + +N 
Sbjct  368  MIRIISLALNQLSGGLPANIGLNVPNLVFLSVSTNNLVAEPLPNFSNASKLRALDLDTNS  427

Query  290  FSGEIPSSLSKCSL----------------------------LQTLSL---PFN------  222
            F+G +P +L  CSL                            L TL L   P N      
Sbjct  428  FTGFLPVTL--CSLKNLERLILFWNHLTIHASTLSCLFNLRNLTTLDLGGNPLNITIPAF  485

Query  221  ----------------NFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVD  90
                            N  G++P +  NL+ L +L L  NQL+GAIP  I  L +L  + 
Sbjct  486  RGNLSTPLTYFDLSISNIRGNIPIDIANLSSLIELHLEINQLSGAIPTSIQRLKNLQGLF  545

Query  89   LSNNKLYG  66
            L +N+L G
Sbjct  546  LYDNELQG  553


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 91/279 (33%), Positives = 129/279 (46%), Gaps = 27/279 (10%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLK--------------ILQCSF  660
            LV E  P+  N S L +L+L  N+F    P  L  L+ L+               L C F
Sbjct  404  LVAEPLPNFSNASKLRALDLDTNSFTGFLPVTLCSLKNLERLILFWNHLTIHASTLSCLF  463

Query  659  N-------DFSGN-----IPSWFGLLQN-LRFLYLGNNNISGFLPTSLFNLSKLEVLHLG  519
            N       D  GN     IP++ G L   L +  L  +NI G +P  + NLS L  LHL 
Sbjct  464  NLRNLTTLDLGGNPLNITIPAFRGNLSTPLTYFDLSISNIRGNIPIDIANLSSLIELHLE  523

Query  518  VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL  339
            +N L G+IP  I  L  L+ L L DN   G  P ++  L+ L  L L  N L G +P  L
Sbjct  524  INQLSGAIPTSIQRLKNLQGLFLYDNELQGHIPYELCQLNNLAVLGLGRNRLSGSIPSCL  583

Query  338  GNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFL  159
            G     L+   + SN  + +IPSSL +   +  L+L  N+  G +  + G L  +  + L
Sbjct  584  GTLSVALRNLSLESNLLTSKIPSSLWELKSILHLNLSSNSLVGPLSEDIGRLKDVVDIDL  643

Query  158  RSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
             +N  +G IP  IG L  ++ + L+NN L G    +  T
Sbjct  644  SNNHFSGNIPGSIGGLQKMINLSLANNYLEGPIPSSFKT  682


 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L  ++   L  L  ++ LNLS N+       ++ +L+ +  +  S N FSGNIP   G L
Sbjct  600  LTSKIPSSLWELKSILHLNLSSNSLVGPLSEDIGRLKDVVDIDLSNNHFSGNIPGSIGGL  659

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            Q +  L L NN + G +P+S   L  LE L L  N+L G IP+ +  L  LK LNLS N 
Sbjct  660  QKMINLSLANNYLEGPIPSSFKTLLSLEFLDLSKNNLSGEIPKSLEALLYLKHLNLSFNK  719

Query  437  FSGSFP  420
              G  P
Sbjct  720  LQGEIP  725


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 69/139 (50%), Gaps = 1/139 (1%)
 Frame = -1

Query  833  NRVSALNLFNMGLVGELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFN  657
            N ++ L L    L G +   LG LS  L +L+L  N   +  P  L +L+ +  L  S N
Sbjct  563  NNLAVLGLGRNRLSGSIPSCLGTLSVALRNLSLESNLLTSKIPSSLWELKSILHLNLSSN  622

Query  656  DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN  477
               G +    G L+++  + L NN+ SG +P S+  L K+  L L  N LEG IP     
Sbjct  623  SLVGPLSEDIGRLKDVVDIDLSNNHFSGNIPGSIGGLQKMINLSLANNYLEGPIPSSFKT  682

Query  476  LFQLKLLNLSDNHFSGSFP  420
            L  L+ L+LS N+ SG  P
Sbjct  683  LLSLEFLDLSKNNLSGEIP  701



>ref|XP_010317427.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Solanum lycopersicum]
Length=1148

 Score =   259 bits (663),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 147/310 (47%), Positives = 203/310 (65%), Gaps = 1/310 (0%)
 Frame = -1

Query  989  INAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNL  810
            +   TNITTD+ ALLSLKS+IS DP   L ++WS  +I+ C W+GV C SRH RV +L L
Sbjct  19   VMTQTNITTDQLALLSLKSQISSDPFRFLNESWSP-AISVCRWVGVICGSRHQRVKSLKL  77

Query  809  FNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSW  630
             N+ L G +  D GNL+FLVSL+L  N+F+ + P+E++ LRRLK L  S N F G IPSW
Sbjct  78   SNLALTGRIPRDFGNLTFLVSLDLGSNHFYGNLPQEMAHLRRLKFLDLSLNSFRGEIPSW  137

Query  629  FGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
            FG L  L+ + L +N+ +G +P SL N S+LE L +  N L+G+IP EIGNL  L +L++
Sbjct  138  FGFLHQLQVVNLRSNSFTGSIPPSLSNASRLETLQISANLLQGNIPEEIGNLHNLNVLSM  197

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
              N  +GS P  I N+S++E +  S NSL G LP  L N LP L+   +  N+  G +P+
Sbjct  198  EHNQLTGSIPFTIFNISRIELIVFSNNSLSGNLPNGLCNGLPILKRLHLSMNELRGHLPT  257

Query  269  SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVD  90
            SLS CS LQ LSL FN+F G +  E G L+ L+ L+LR+N  TG IP+EIG L +L+ + 
Sbjct  258  SLSNCSQLQVLSLAFNDFDGRIHSEIGRLSNLQGLYLRNNHFTGIIPQEIGNLVNLVELY  317

Query  89   LSNNKLYGTF  60
            +  N++ G+ 
Sbjct  318  MEANQISGSI  327


 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 94/244 (39%), Positives = 140/244 (57%), Gaps = 3/244 (1%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G L   L N S L  L+L+ N+F      E+ +L  L+ L    N F+G IP   G L
Sbjct  251  LRGHLPTSLSNCSQLQVLSLAFNDFDGRIHSEIGRLSNLQGLYLRNNHFTGIIPQEIGNL  310

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
             NL  LY+  N ISG +P SL N+S LE + L  N+ +GS+PREIGNL +L++L LS+N 
Sbjct  311  VNLVELYMEANQISGSIPISLINISSLETVSLWRNNFKGSLPREIGNLTKLQVLYLSENR  370

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL-S  261
            F+G  P ++ NL +L+ L+L +NS  G LP+++ N + +L+I  +  N  S  +P ++ S
Sbjct  371  FTGEIPKEMSNLVELQVLALGLNSFSGLLPMEIFN-ISRLRIIQLSGNTLSATLPPNIGS  429

Query  260  KCSLLQTLSLP-FNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
                ++ LS+    N  G +P    N +KL  L L  N+L+G IP  +G L+ L  ++L 
Sbjct  430  TLPNIEVLSMGLLTNLVGTIPHSISNCSKLTILELSRNKLSGLIPSSLGYLTHLNFLNLW  489

Query  83   NNKL  72
             N L
Sbjct  490  GNNL  493


 Score =   110 bits (275),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 118/218 (54%), Gaps = 1/218 (0%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +  ++G LS L  L L  N+F    P+E+  L  L  L    N  SG+IP     + +
Sbjct  277  GRIHSEIGRLSNLQGLYLRNNHFTGIIPQEIGNLVNLVELYMEANQISGSIPISLINISS  336

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFS  432
            L  + L  NN  G LP  + NL+KL+VL+L  N   G IP+E+ NL +L++L L  N FS
Sbjct  337  LETVSLWRNNFKGSLPREIGNLTKLQVLYLSENRFTGEIPKEMSNLVELQVLALGLNSFS  396

Query  431  GSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMR-SNKFSGEIPSSLSKC  255
            G  P++I N+S+L  + LS N+L   LP ++G+ LP +++  M       G IP S+S C
Sbjct  397  GLLPMEIFNISRLRIIQLSGNTLSATLPPNIGSTLPNIEVLSMGLLTNLVGTIPHSISNC  456

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
            S L  L L  N  SG +P   G LT L  L L  N LT
Sbjct  457  SKLTILELSRNKLSGLIPSSLGYLTHLNFLNLWGNNLT  494


 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 81/255 (32%), Positives = 128/255 (50%), Gaps = 28/255 (11%)
 Frame = -1

Query  773  LGNLS-FLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLY  597
            +GN S  LV  + S+ N     P E+  L  L  L  S N+F G+IP+  G L+N+++  
Sbjct  529  VGNFSKSLVKFDASECNIKGKIPNEVGNLSSLLDLHLSDNNFIGSIPTSIGNLRNIQYFN  588

Query  596  LGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPL  417
            L +NN++GF+  ++  L  L  ++LG N L GS+P  +GN+  L+ + L+ N  S +   
Sbjct  589  LNHNNLTGFIGDNICKLQYLSEIYLGQNQLSGSLPNCLGNVTSLRWIYLASNKLSSN---  645

Query  416  DIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL  237
                                 LP  LGN L  L +  + SN   G +P  +        +
Sbjct  646  ---------------------LPTSLGN-LKDLLVLDLSSNNMVGSLPPEIGYLKAAIYM  683

Query  236  SLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFI  57
            +L  N F+  +P E G L  LE L+LR N+L G+IP  +  + SL  +D+S+N + GT  
Sbjct  684  NLSMNQFTNGIPTEIGGLQNLEHLYLRHNKLQGSIPDSMNNMVSLEYLDISHNNISGTIP  743

Query  56   QNLDTP*LK*LSYYN  12
             +L+   L+ L Y+N
Sbjct  744  MSLEK--LQYLEYFN  756


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 119/221 (54%), Gaps = 1/221 (0%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G++  ++GNLS L+ L+LS NNF  S P  +  LR ++    + N+ +G I      LQ 
Sbjct  548  GKIPNEVGNLSSLLDLHLSDNNFIGSIPTSIGNLRNIQYFNLNHNNLTGFIGDNICKLQY  607

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFS  432
            L  +YLG N +SG LP  L N++ L  ++L  N L  ++P  +GNL  L +L+LS N+  
Sbjct  608  LSEIYLGQNQLSGSLPNCLGNVTSLRWIYLASNKLSSNLPTSLGNLKDLLVLDLSSNNMV  667

Query  431  GSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCS  252
            GS P +I  L     ++LS+N     +P ++G  L  L+   +R NK  G IP S++   
Sbjct  668  GSLPPEIGYLKAAIYMNLSMNQFTNGIPTEIGG-LQNLEHLYLRHNKLQGSIPDSMNNMV  726

Query  251  LLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             L+ L +  NN SG +P     L  LE   +  N+L G IP
Sbjct  727  SLEYLDISHNNISGTIPMSLEKLQYLEYFNVSDNKLYGEIP  767


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 82/228 (36%), Positives = 120/228 (53%), Gaps = 6/228 (3%)
 Frame = -1

Query  728  NFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISG--FLP--T  561
            N   + P  +S   +L IL+ S N  SG IPS  G L +L FL L  NN++   FL   T
Sbjct  444  NLVGTIPHSISNCSKLTILELSRNKLSGLIPSSLGYLTHLNFLNLWGNNLTSDSFLSFLT  503

Query  560  SLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ-LKLLNLSDNHFSGSFPLDIlnlsklenl  384
            SL N   L  L L  N L   +P  +GN  + L   + S+ +  G  P ++ NLS L +L
Sbjct  504  SLTNCRNLNFLSLSFNPLNAMLPVSVGNFSKSLVKFDASECNIKGKIPNEVGNLSSLLDL  563

Query  383  slsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHV  204
             LS N+  G +P  +GN L  +Q F +  N  +G I  ++ K   L  + L  N  SG +
Sbjct  564  HLSDNNFIGSIPTSIGN-LRNIQYFNLNHNNLTGFIGDNICKLQYLSEIYLGQNQLSGSL  622

Query  203  PREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            P   GN+T L  ++L SN+L+  +P  +G L  LL++DLS+N + G+ 
Sbjct  623  PNCLGNVTSLRWIYLASNKLSSNLPTSLGNLKDLLVLDLSSNNMVGSL  670


 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L   L   LGNL  L+ L+LS NN   S P E+  L+    +  S N F+  IP+  G L
Sbjct  642  LSSNLPTSLGNLKDLLVLDLSSNNMVGSLPPEIGYLKAAIYMNLSMNQFTNGIPTEIGGL  701

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            QNL  LYL +N + G +P S+ N+  LE L +  N++ G+IP  +  L  L+  N+SDN 
Sbjct  702  QNLEHLYLRHNKLQGSIPDSMNNMVSLEYLDISHNNISGTIPMSLEKLQYLEYFNVSDNK  761

Query  437  FSGSFP  420
              G  P
Sbjct  762  LYGEIP  767


 Score = 73.9 bits (180),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 84/150 (56%), Gaps = 0/150 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G L   LGN++ L  + L+ N   ++ P  L  L+ L +L  S N+  G++P   G L
Sbjct  618  LSGSLPNCLGNVTSLRWIYLASNKLSSNLPTSLGNLKDLLVLDLSSNNMVGSLPPEIGYL  677

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            +   ++ L  N  +  +PT +  L  LE L+L  N L+GSIP  + N+  L+ L++S N+
Sbjct  678  KAAIYMNLSMNQFTNGIPTEIGGLQNLEHLYLRHNKLQGSIPDSMNNMVSLEYLDISHNN  737

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELP  348
             SG+ P+ +  L  LE  ++S N L+GE+P
Sbjct  738  ISGTIPMSLEKLQYLEYFNVSDNKLYGEIP  767



>ref|XP_008226831.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=984

 Score =   259 bits (661),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 152/331 (46%), Positives = 205/331 (62%), Gaps = 3/331 (1%)
 Frame = -1

Query  1058  MEITRHYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNS  879
             ME +R    +++       +  T  A TNITTD+  LL+L+S I+ DPH IL  NWS  +
Sbjct  1     MERSRFVLSMTLLLLQYSFVG-TGAAQTNITTDQSTLLALRSYITSDPHDILV-NWSSTT  58

Query  878   ITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL  699
                CNWIGVTC +RH RV++LNL  MG  G + P LGNLSFLV+L+ + N+FH + P EL
Sbjct  59    YV-CNWIGVTCGARHRRVASLNLSYMGFTGTIPPHLGNLSFLVALSFNNNSFHGTLPYEL  117

Query  698   SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG  519
             S LRRLK++   +N+F G+IPSWFG    L+  YL  N  SG +P ++FNLS L+V++L 
Sbjct  118   SYLRRLKLVSFGYNNFMGSIPSWFGAFPKLQSFYLHGNQFSGSIPATVFNLSTLQVINLN  177

Query  518   VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL  339
              N L G IP+EIGNL +L+ L +  N   G  PL + N+S L  L+L  ++L G L  ++
Sbjct  178   NNQLSGQIPKEIGNLDKLERLYVQSNALKGPVPLAVFNMSSLITLALYGSNLSGGLLDNI  237

Query  338   GNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFL  159
               HLP + +  +  N F G +PS L +C  L  LSL  NNFSG +P+  GNLT+L  + L
Sbjct  238   CQHLPSIHVLNLGRNHFDGPLPSKLWQCKELLILSLEENNFSGSIPKNIGNLTQLMVITL  297

Query  158   RSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
              SN L G IP EIG L +L I  +  N L G
Sbjct  298   SSNNLRGTIPDEIGDLQNLEIFTVGGNNLNG  328


 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 102/200 (51%), Gaps = 30/200 (15%)
 Frame = -1

Query  632  WFGLLQNLRFLYLGNNNIS-----GFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            W G+    R   + + N+S     G +P  L NLS L  L    NS  G++P E+  L +
Sbjct  63   WIGVTCGARHRRVASLNLSYMGFTGTIPPHLGNLSFLVALSFNNNSFHGTLPYELSYLRR  122

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
            LKL++   N+F GS P                 S FG  P        KLQ F +  N+F
Sbjct  123  LKLVSFGYNNFMGSIP-----------------SWFGAFP--------KLQSFYLHGNQF  157

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALS  108
            SG IP+++   S LQ ++L  N  SG +P+E GNL KLE+L+++SN L G +P  +  +S
Sbjct  158  SGSIPATVFNLSTLQVINLNNNQLSGQIPKEIGNLDKLERLYVQSNALKGPVPLAVFNMS  217

Query  107  SLLIVDLSNNKLYGTFIQNL  48
            SL+ + L  + L G  + N+
Sbjct  218  SLITLALYGSNLSGGLLDNI  237


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 114/210 (54%), Gaps = 2/210 (1%)
 Frame = -1

Query  767  NLSFLVSLNLSQNNFHNSFPRELSQ-LRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLG  591
            N+S L++L L  +N        + Q L  + +L    N F G +PS     + L  L L 
Sbjct  215  NMSSLITLALYGSNLSGGLLDNICQHLPSIHVLNLGRNHFDGPLPSKLWQCKELLILSLE  274

Query  590  NNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDI  411
             NN SG +P ++ NL++L V+ L  N+L G+IP EIG+L  L++  +  N+ +G  P  I
Sbjct  275  ENNFSGSIPKNIGNLTQLMVITLSSNNLRGTIPDEIGDLQNLEIFTVGGNNLNGLIPSSI  334

Query  410  lnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSL  231
             N+S +  ++L  N L G L  ++G  +P LQ F + +   SG IP +LS  S+L  + L
Sbjct  335  FNMSTIRVMALDTNPLSGSLLANIGLGVPNLQFFYVGATDLSGVIP-NLSNASMLINMDL  393

Query  230  PFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
              N+F+G +P     LT +E + L SN LT
Sbjct  394  GRNSFTGFIPSTLCALTNIESIRLGSNNLT  423


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 91/311 (29%), Positives = 134/311 (43%), Gaps = 56/311 (18%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +  LNL      G L   L     L+ L+L +NNF  S P+ +  L +L ++  S N+  
Sbjct  244  IHVLNLGRNHFDGPLPSKLWQCKELLILSLEENNFSGSIPKNIGNLTQLMVITLSSNNLR  303

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVL--------------------  528
            G IP   G LQNL    +G NN++G +P+S+FN+S + V+                    
Sbjct  304  GTIPDEIGDLQNLEIFTVGGNNLNGLIPSSIFNMSTIRVMALDTNPLSGSLLANIGLGVP  363

Query  527  -----HLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnls------------  399
                 ++G   L G IP  + N   L  ++L  N F+G  P  +  L+            
Sbjct  364  NLQFFYVGATDLSGVIP-NLSNASMLINMDLGRNSFTGFIPSTLCALTNIESIRLGSNNL  422

Query  398  klenlslsvnsLFGEL-PLDLGNH--------------LPKLQIFVMRSNKFSGEIPSSL  264
             +E  +LS  +  G L  L L N+                +LQ   ++++   G IP S+
Sbjct  423  TIETSTLSCLANLGNLRTLSLANNPLNARLDDSFWNFSTSRLQFINLQNSSMRGSIPFSI  482

Query  263  SKCSLLQTLSLPFNNFSGHVPR---EFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIV  93
               S L +LSL +N  SG +P      GNL  L  L L +N   G IP     L SL ++
Sbjct  483  GNLSSLISLSLEYNQLSGSIPTSVGRLGNLQDLVNLTLANNNFEGPIPSTFHDLLSLNLL  542

Query  92   DLSNNKLYGTF  60
            DLS N L G  
Sbjct  543  DLSRNNLSGVI  553


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 90/297 (30%), Positives = 140/297 (47%), Gaps = 56/297 (19%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF-----  627
            G +  ++GNL+ L+ + LS NN   + P E+  L+ L+I     N+ +G IPS       
Sbjct  280  GSIPKNIGNLTQLMVITLSSNNLRGTIPDEIGDLQNLEIFTVGGNNLNGLIPSSIFNMST  339

Query  626  -------------------GL-LQNLRFLY-----------------------LGNNNIS  576
                               GL + NL+F Y                       LG N+ +
Sbjct  340  IRVMALDTNPLSGSLLANIGLGVPNLQFFYVGATDLSGVIPNLSNASMLINMDLGRNSFT  399

Query  575  GFLPTSLFNLSKLEVLHLGVNSL--EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDI--l  408
            GF+P++L  L+ +E + LG N+L  E S    + NL  L+ L+L++N  +          
Sbjct  400  GFIPSTLCALTNIESIRLGSNNLTIETSTLSCLANLGNLRTLSLANNPLNARLDDSFWNF  459

Query  407  nlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL---  237
            + S+L+ ++L  +S+ G +P  +GN    L    +  N+ SG IP+S+ +   LQ L   
Sbjct  460  STSRLQFINLQNSSMRGSIPFSIGNLS-SLISLSLEYNQLSGSIPTSVGRLGNLQDLVNL  518

Query  236  SLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            +L  NNF G +P  F +L  L  L L  N L+G IPR + AL  L  +DLS N+L G
Sbjct  519  TLANNNFEGPIPSTFHDLLSLNLLDLSRNNLSGVIPRSLEALLLLKYLDLSFNRLQG  575



>ref|XP_010260175.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Nelumbo nucifera]
Length=1112

 Score =   259 bits (661),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 207/326 (63%), Gaps = 2/326 (1%)
 Frame = -1

Query  1025  IFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTC  846
             +   HS +  L  ++ +N TTD+ ALL+ K++I+ DP + LA NW++ S + CNWIGV C
Sbjct  13    LLLVHSCIAWLVSSSSSN-TTDQSALLAFKARITLDPDNTLATNWTIGS-SFCNWIGVRC  70

Query  845   NSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQC  666
             +SR  RV++L L NMGL G + P L NLSFL  L+LS N+FH   P  L  L RLK L  
Sbjct  71    SSRRQRVTSLVLSNMGLKGTIEPQLSNLSFLQVLDLSNNSFHGQLPYGLGHLHRLKYLHL  130

Query  665   SFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
              +N F+GN+P   G+L  L +L L NN++SG +P S+ N+S L  L L  ++L G IP+E
Sbjct  131   EYNQFTGNVPRELGMLSKLLWLSLHNNSLSGAIPPSIGNISMLAALELSSDNLAGPIPKE  190

Query  485   IGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
             +GNL  L+LL+L  N  +G  P  I N+S L  L L  NS+ G LP+D+G  LP+LQ  +
Sbjct  191   LGNLVNLQLLSLEHNQLTGVIPSTIFNISVLRYLLLQDNSISGSLPMDIGRQLPELQWLL  250

Query  305   MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
             +  N+FSG IPSSL +C  L  +SL  NNF G +PRE GNL+ L  L++  N LTG IP 
Sbjct  251   LFKNQFSGYIPSSLCQCGKLLKISLGRNNFIGGLPREIGNLSNLVGLYVHHNALTGTIPP  310

Query  125   EIGALSSLLIVDLSNNKLYGTFIQNL  48
              IG LS+LL +D+ NN   G   + +
Sbjct  311   SIGNLSNLLELDMGNNNFVGVIPKEI  336


 Score =   114 bits (284),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 110/223 (49%), Gaps = 24/223 (11%)
 Frame = -1

Query  812  LFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPS  633
            LF     G +   L     L+ ++L +NNF    PRE+  L  L  L    N  +G IP 
Sbjct  251  LFKNQFSGYIPSSLCQCGKLLKISLGRNNFIGGLPREIGNLSNLVGLYVHHNALTGTIPP  310

Query  632  WFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLN  453
              G L NL  L +GNNN  G +P  + +L  L  +    N+L+GS+P EI N+  L ++ 
Sbjct  311  SIGNLSNLLELDMGNNNFVGVIPKEIGHLENLRFMSFQDNNLKGSVPEEIFNISTLGVMA  370

Query  452  LSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIP  273
            L+DN FSG+                        LP  +GN LP++ I  + +N FSG+ P
Sbjct  371  LTDNSFSGN------------------------LPAGIGNWLPRITILYLGNNHFSGKFP  406

Query  272  SSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQL  144
            +S+S  S L +L L  N+FSG +P   GNL  L+ L L  N L
Sbjct  407  ASISNASQLTSLELANNSFSGPIPTSIGNLRNLQILNLAGNLL  449


 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 132/243 (54%), Gaps = 2/243 (1%)
 Frame = -1

Query  791  GELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            G L   +GNLS  L     +      + P+ L  L  +  L    N+ SG IPS  G L 
Sbjct  482  GFLPDSIGNLSTSLTIFTGASCQIRGNIPKGLGNLSNIITLNLGSNELSGTIPSTIGGLG  541

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             L+ LYLG+N I G +   L +L++L  L+L  N+L G +P  IGNL +L++L+LS N  
Sbjct  542  KLQRLYLGHNKIHGSIGNDLCSLNQLGELYLHGNNLSGQLPNCIGNLSRLEVLDLSSNIL  601

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            +   PL + +LS L  L+LS NSL+  LP ++G+ +  L++  M  N  SG I S++   
Sbjct  602  TSHIPLSLWSLSDLLTLNLSHNSLYDNLPQEVGD-MDFLELLDMSWNHLSGNISSTIGGL  660

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              L+ L L  N+  G +P+ FGNL  L  + L  N L+G IP+ +  L  L  ++LS NK
Sbjct  661  QRLKYLILSRNSLQGSLPQSFGNLLSLISMDLSFNNLSGNIPKSLEKLPFLSFLNLSYNK  720

Query  74   LYG  66
              G
Sbjct  721  FEG  723


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 100/314 (32%), Positives = 141/314 (45%), Gaps = 58/314 (18%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            L++ N   VG +  ++G+L  L  ++   NN   S P E+  +  L ++  + N FSGN+
Sbjct  321  LDMGNNNFVGVIPKEIGHLENLRFMSFQDNNLKGSVPEEIFNISTLGVMALTDNSFSGNL  380

Query  638  PSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG------  480
            P+  G  L  +  LYLGNN+ SG  P S+ N S+L  L L  NS  G IP  IG      
Sbjct  381  PAGIGNWLPRITILYLGNNHFSGKFPASISNASQLTSLELANNSFSGPIPTSIGNLRNLQ  440

Query  479  ------NLFQ-------------------LKLLNLSDNHFSGSFPLDIlnlsklenlsls  375
                  NL +                   L+ + +  N  +G  P  I NLS    +   
Sbjct  441  ILNLAGNLLEDQPNTQEIVFLTSLTNCRFLEQIEIDSNPLNGFLPDSIGNLSTSLTIFTG  500

Query  374  vnsLF-GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK--------------------  258
             +    G +P  LGN L  +    + SN+ SG IPS++                      
Sbjct  501  ASCQIRGNIPKGLGN-LSNIITLNLGSNELSGTIPSTIGGLGKLQRLYLGHNKIHGSIGN  559

Query  257  --CSL--LQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVD  90
              CSL  L  L L  NN SG +P   GNL++LE L L SN LT  IP  + +LS LL ++
Sbjct  560  DLCSLNQLGELYLHGNNLSGQLPNCIGNLSRLEVLDLSSNILTSHIPLSLWSLSDLLTLN  619

Query  89   LSNNKLYGTFIQNL  48
            LS+N LY    Q +
Sbjct  620  LSHNSLYDNLPQEV  633


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 90/298 (30%), Positives = 143/298 (48%), Gaps = 33/298 (11%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNS-------FPRELSQLRR  684
            S  +++++L L N    G +   +GNL  L  LNL+ N   +        F   L+  R 
Sbjct  410  SNASQLTSLELANNSFSGPIPTSIGNLRNLQILNLAGNLLEDQPNTQEIVFLTSLTNCRF  469

Query  683  LKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNN-NISGFLPTSLFNLSKLEVLHLGVNSL  507
            L+ ++   N  +G +P   G L     ++ G +  I G +P  L NLS +  L+LG N L
Sbjct  470  LEQIEIDSNPLNGFLPDSIGNLSTSLTIFTGASCQIRGNIPKGLGNLSNIITLNLGSNEL  529

Query  506  EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
             G+IP  IG L +L+ L L  N   GS   D+ +L++L  L L  N+L G+LP  +GN L
Sbjct  530  SGTIPSTIGGLGKLQRLYLGHNKIHGSIGNDLCSLNQLGELYLHGNNLSGQLPNCIGN-L  588

Query  326  PKLQIFVMRSNKFSGEI------------------------PSSLSKCSLLQTLSLPFNN  219
             +L++  + SN  +  I                        P  +     L+ L + +N+
Sbjct  589  SRLEVLDLSSNILTSHIPLSLWSLSDLLTLNLSHNSLYDNLPQEVGDMDFLELLDMSWNH  648

Query  218  FSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLD  45
             SG++    G L +L+ L L  N L G++P+  G L SL+ +DLS N L G   ++L+
Sbjct  649  LSGNISSTIGGLQRLKYLILSRNSLQGSLPQSFGNLLSLISMDLSFNNLSGNIPKSLE  706


 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 112/221 (51%), Gaps = 1/221 (0%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +   LGNLS +++LNL  N    + P  +  L +L+ L    N   G+I +    L  
Sbjct  507  GNIPKGLGNLSNIITLNLGSNELSGTIPSTIGGLGKLQRLYLGHNKIHGSIGNDLCSLNQ  566

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFS  432
            L  LYL  NN+SG LP  + NLS+LEVL L  N L   IP  + +L  L  LNLS N   
Sbjct  567  LGELYLHGNNLSGQLPNCIGNLSRLEVLDLSSNILTSHIPLSLWSLSDLLTLNLSHNSLY  626

Query  431  GSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCS  252
             + P ++ ++  LE L +S N L G +   +G  L +L+  ++  N   G +P S     
Sbjct  627  DNLPQEVGDMDFLELLDMSWNHLSGNISSTIGG-LQRLKYLILSRNSLQGSLPQSFGNLL  685

Query  251  LLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             L ++ L FNN SG++P+    L  L  L L  N+  G IP
Sbjct  686  SLISMDLSFNNLSGNIPKSLEKLPFLSFLNLSYNKFEGEIP  726



>ref|XP_009611662.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR isoform X2 [Nicotiana tomentosiformis]
Length=1031

 Score =   258 bits (659),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 148/309 (48%), Positives = 203/309 (66%), Gaps = 1/309 (0%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            NI+TD+ ALL+LKS ISF P++ILA NWS + +  C+WIG+TC+SRH+RV+ALN+ +M L
Sbjct  25   NISTDEAALLALKSHISFGPNNILARNWSSSGLV-CSWIGITCSSRHHRVTALNISSMQL  83

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             G + P LGNLSFLVSL++S N F+   P+EL+ L+RLK++  + N+F+G IPS+  LL 
Sbjct  84   HGTIPPHLGNLSFLVSLDISNNTFYGELPQELAHLQRLKLIDVTSNNFTGAIPSFLRLLP  143

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            NLRFL L  N  SG +P+ L NL+KLE L +  N L+G IPRE+G+L  +  L+L  N  
Sbjct  144  NLRFLNLSTNQFSGEIPSFLSNLTKLEELRIKENFLQGEIPRELGDLRYMVFLDLQSNQL  203

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            SG  P  I N+  ++ + L+ N L G+LP  + +HLP L+   +  N   G IP +L KC
Sbjct  204  SGFIPPSIFNIRTMQKIGLTDNKLTGKLPTTICDHLPNLEGLHLSKNHIGGAIPPNLGKC  263

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              LQ LSL  N F G VPRE  NLT+L  L+L +  L G IP E+G L  L  + LS N+
Sbjct  264  RKLQVLSLSVNKFIGVVPRELANLTELRILYLGNMLLEGEIPAELGNLKKLQALGLSQNE  323

Query  74   LYGTFIQNL  48
              G+   N+
Sbjct  324  FTGSVPANI  332


 Score =   120 bits (302),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 130/252 (52%), Gaps = 9/252 (4%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G + P+LG    L  L+LS N F    PREL+ L  L+IL        G IP+  G L+ 
Sbjct  254  GAIPPNLGKCRKLQVLSLSVNKFIGVVPRELANLTELRILYLGNMLLEGEIPAELGNLKK  313

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLE-----GSIPREIGNLFQLKLLNLS  447
            L+ L L  N  +G +P ++FN+S L+ L L  N L      G IP  +GNL  L++L   
Sbjct  314  LQALGLSQNEFTGSVPANIFNMSALQALQLSQNKLSDNSFTGPIPESLGNLEYLEMLTFE  373

Query  446  DNHFSG----SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGE  279
             N+F G    SF   +    KL++L  + N L G  P  +GN    LQIFV R  K  G 
Sbjct  374  KNNFFGDSALSFLTSLTKCRKLKSLWFADNPLDGVFPSSVGNFSNSLQIFVGRGCKLKGV  433

Query  278  IPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLL  99
            IP  +   + +  +SL  N  +GH+P    ++  L++L+LR+N+L G IP  I  L +L 
Sbjct  434  IPEEIGNLTRVIKMSLSNNELTGHIPNTIQSMLNLQELYLRNNKLEGTIPDVICNLKNLG  493

Query  98   IVDLSNNKLYGT  63
             + LS N   G+
Sbjct  494  ALHLSRNVFSGS  505


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 85/267 (32%), Positives = 126/267 (47%), Gaps = 28/267 (10%)
 Frame = -1

Query  857  GVTCNSRHNRVSALNLF---NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLR  687
            GV  +S  N  ++L +F      L G +  ++GNL+ ++ ++LS N      P  +  + 
Sbjct  407  GVFPSSVGNFSNSLQIFVGRGCKLKGVIPEEIGNLTRVIKMSLSNNELTGHIPNTIQSML  466

Query  686  RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSL  507
             L+ L    N   G IP     L+NL  L+L  N  SG +P  L  ++ L  L+L  NSL
Sbjct  467  NLQELYLRNNKLEGTIPDVICNLKNLGALHLSRNVFSGSVPPCLGKVTSLRYLYLAYNSL  526

Query  506  EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
              S+P+ +G L  L   ++S N  SG  P++I                        GN +
Sbjct  527  NSSLPQNLGALHDLIEFDISSNLLSGKIPVEI------------------------GN-I  561

Query  326  PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ  147
              L +  + +NKFSG+IPS+L     L  LSL  N   G +P  FG +  L  L L  N 
Sbjct  562  KALTLIDLSNNKFSGKIPSTLGGLDKLIKLSLAHNRLDGPIPESFGKMLALNFLDLCYNN  621

Query  146  LTGAIPREIGALSSLLIVDLSNNKLYG  66
            L G IP+ + AL  L  +++S NKL G
Sbjct  622  LNGEIPKSLEALVYLKYLNISFNKLSG  648


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 138/265 (52%), Gaps = 11/265 (4%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQ-----NNFHNSFPRELSQLRRLKILQC  666
            ++ AL L      G +  ++ N+S L +L LSQ     N+F    P  L  L  L++L  
Sbjct  313  KLQALGLSQNEFTGSVPANIFNMSALQALQLSQNKLSDNSFTGPIPESLGNLEYLEMLTF  372

Query  665  SFNDFSGNIPSWF----GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVN-SLEG  501
              N+F G+    F       + L+ L+  +N + G  P+S+ N S    + +G    L+G
Sbjct  373  EKNNFFGDSALSFLTSLTKCRKLKSLWFADNPLDGVFPSSVGNFSNSLQIFVGRGCKLKG  432

Query  500  SIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPK  321
             IP EIGNL ++  ++LS+N  +G  P  I ++  L+ L L  N L G +P D+  +L  
Sbjct  433  VIPEEIGNLTRVIKMSLSNNELTGHIPNTIQSMLNLQELYLRNNKLEGTIP-DVICNLKN  491

Query  320  LQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
            L    +  N FSG +P  L K + L+ L L +N+ +  +P+  G L  L +  + SN L+
Sbjct  492  LGALHLSRNVFSGSVPPCLGKVTSLRYLYLAYNSLNSSLPQNLGALHDLIEFDISSNLLS  551

Query  140  GAIPREIGALSSLLIVDLSNNKLYG  66
            G IP EIG + +L ++DLSNNK  G
Sbjct  552  GKIPVEIGNIKALTLIDLSNNKFSG  576


 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 97/280 (35%), Positives = 135/280 (48%), Gaps = 30/280 (11%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLK-----------ILQCSF  660
             G +   LGNL +L  L   +NNF      SF   L++ R+LK           +   S 
Sbjct  354  TGPIPESLGNLEYLEMLTFEKNNFFGDSALSFLTSLTKCRKLKSLWFADNPLDGVFPSSV  413

Query  659  NDFS--------------GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHL  522
             +FS              G IP   G L  +  + L NN ++G +P ++ ++  L+ L+L
Sbjct  414  GNFSNSLQIFVGRGCKLKGVIPEEIGNLTRVIKMSLSNNELTGHIPNTIQSMLNLQELYL  473

Query  521  GVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLD  342
              N LEG+IP  I NL  L  L+LS N FSGS P  +  ++ L  L L+ NSL   LP +
Sbjct  474  RNNKLEGTIPDVICNLKNLGALHLSRNVFSGSVPPCLGKVTSLRYLYLAYNSLNSSLPQN  533

Query  341  LGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLF  162
            LG  L  L  F + SN  SG+IP  +     L  + L  N FSG +P   G L KL KL 
Sbjct  534  LG-ALHDLIEFDISSNLLSGKIPVEIGNIKALTLIDLSNNKFSGKIPSTLGGLDKLIKLS  592

Query  161  LRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
            L  N+L G IP   G + +L  +DL  N L G   ++L+ 
Sbjct  593  LAHNRLDGPIPESFGKMLALNFLDLCYNNLNGEIPKSLEA  632


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 115/249 (46%), Gaps = 27/249 (11%)
 Frame = -1

Query  869  CNWIGVTCNSRHN--RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELS  696
            C   GV      N  RV  ++L N  L G +   + ++  L  L L  N    + P  + 
Sbjct  428  CKLKGVIPEEIGNLTRVIKMSLSNNELTGHIPNTIQSMLNLQELYLRNNKLEGTIPDVIC  487

Query  695  QLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGV  516
             L+ L  L  S N FSG++P   G + +LR+LYL  N+++  LP +L  L  L    +  
Sbjct  488  NLKNLGALHLSRNVFSGSVPPCLGKVTSLRYLYLAYNSLNSSLPQNLGALHDLIEFDISS  547

Query  515  NSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
            N L G IP EIGN+  L L++LS+N FS                        G++P  LG
Sbjct  548  NLLSGKIPVEIGNIKALTLIDLSNNKFS------------------------GKIPSTLG  583

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
              L KL    +  N+  G IP S  K   L  L L +NN +G +P+    L  L+ L + 
Sbjct  584  G-LDKLIKLSLAHNRLDGPIPESFGKMLALNFLDLCYNNLNGEIPKSLEALVYLKYLNIS  642

Query  155  SNQLTGAIP  129
             N+L+G IP
Sbjct  643  FNKLSGEIP  651


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 77/162 (48%), Gaps = 7/162 (4%)
 Frame = -1

Query  905  LADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNN  726
            L+ N    S+ PC  +G   + R+     L L    L   L  +LG L  L+  ++S N 
Sbjct  497  LSRNVFSGSVPPC--LGKVTSLRY-----LYLAYNSLNSSLPQNLGALHDLIEFDISSNL  549

Query  725  FHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNL  546
                 P E+  ++ L ++  S N FSG IPS  G L  L  L L +N + G +P S   +
Sbjct  550  LSGKIPVEIGNIKALTLIDLSNNKFSGKIPSTLGGLDKLIKLSLAHNRLDGPIPESFGKM  609

Query  545  SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
              L  L L  N+L G IP+ +  L  LK LN+S N  SG  P
Sbjct  610  LALNFLDLCYNNLNGEIPKSLEALVYLKYLNISFNKLSGEIP  651



>ref|XP_009611661.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Nicotiana tomentosiformis]
Length=1075

 Score =   258 bits (659),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 148/309 (48%), Positives = 203/309 (66%), Gaps = 1/309 (0%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            NI+TD+ ALL+LKS ISF P++ILA NWS + +  C+WIG+TC+SRH+RV+ALN+ +M L
Sbjct  25   NISTDEAALLALKSHISFGPNNILARNWSSSGLV-CSWIGITCSSRHHRVTALNISSMQL  83

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             G + P LGNLSFLVSL++S N F+   P+EL+ L+RLK++  + N+F+G IPS+  LL 
Sbjct  84   HGTIPPHLGNLSFLVSLDISNNTFYGELPQELAHLQRLKLIDVTSNNFTGAIPSFLRLLP  143

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            NLRFL L  N  SG +P+ L NL+KLE L +  N L+G IPRE+G+L  +  L+L  N  
Sbjct  144  NLRFLNLSTNQFSGEIPSFLSNLTKLEELRIKENFLQGEIPRELGDLRYMVFLDLQSNQL  203

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            SG  P  I N+  ++ + L+ N L G+LP  + +HLP L+   +  N   G IP +L KC
Sbjct  204  SGFIPPSIFNIRTMQKIGLTDNKLTGKLPTTICDHLPNLEGLHLSKNHIGGAIPPNLGKC  263

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              LQ LSL  N F G VPRE  NLT+L  L+L +  L G IP E+G L  L  + LS N+
Sbjct  264  RKLQVLSLSVNKFIGVVPRELANLTELRILYLGNMLLEGEIPAELGNLKKLQALGLSQNE  323

Query  74   LYGTFIQNL  48
              G+   N+
Sbjct  324  FTGSVPANI  332


 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 89/283 (31%), Positives = 120/283 (42%), Gaps = 77/283 (27%)
 Frame = -1

Query  755  LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNIS  576
            L  L+LS+N+   + P  L + R+L++L  S N F G +P     L  LR LYLGN  + 
Sbjct  242  LEGLHLSKNHIGGAIPPNLGKCRKLQVLSLSVNKFIGVVPRELANLTELRILYLGNMLLE  301

Query  575  GFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsk  396
            G +P  L NL KL+ L L  N   GS+P  I N+  L+ L LS N  SG+          
Sbjct  302  GEIPAELGNLKKLQALGLSQNEFTGSVPANIFNMSALQALQLSQNKLSGT----------  351

Query  395  lenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNF  216
                          LP DLG  +P ++ FV  SN  SG I +S+S  S L+ L L  N+F
Sbjct  352  --------------LPSDLGRGIPNIEEFVCGSNNLSGFISASISNSSRLRGLDLADNSF  397

Query  215  SGHVPREFGNLTKLEKLFLRSN--------------------------------------  150
            +G +P   GNL  LE L    N                                      
Sbjct  398  TGPIPESLGNLEYLEMLTFEKNNFFGDSALSFLTSLTKCRKLKSLWFADNPLDGVFPSSV  457

Query  149  ---------------QLTGAIPREIGALSSLLIVDLSNNKLYG  66
                           +L G IP EIG L+ ++ + LSNN+L G
Sbjct  458  GNFSNSLQIFVGRGCKLKGVIPEEIGNLTRVIKMSLSNNELTG  500


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 92/296 (31%), Positives = 136/296 (46%), Gaps = 53/296 (18%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G + P+LG    L  L+LS N F    PREL+ L  L+IL        G IP+  G L+ 
Sbjct  254  GAIPPNLGKCRKLQVLSLSVNKFIGVVPRELANLTELRILYLGNMLLEGEIPAELGNLKK  313

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG----------------  480
            L+ L L  N  +G +P ++FN+S L+ L L  N L G++P ++G                
Sbjct  314  LQALGLSQNEFTGSVPANIFNMSALQALQLSQNKLSGTLPSDLGRGIPNIEEFVCGSNNL  373

Query  479  ---------NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGE---------  354
                     N  +L+ L+L+DN F+G  P  + NL  LE L+   N+ FG+         
Sbjct  374  SGFISASISNSSRLRGLDLADNSFTGPIPESLGNLEYLEMLTFEKNNFFGDSALSFLTSL  433

Query  353  -------------------LPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSL  231
                                P  +GN    LQIFV R  K  G IP  +   + +  +SL
Sbjct  434  TKCRKLKSLWFADNPLDGVFPSSVGNFSNSLQIFVGRGCKLKGVIPEEIGNLTRVIKMSL  493

Query  230  PFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGT  63
              N  +GH+P    ++  L++L+LR+N+L G IP  I  L +L  + LS N   G+
Sbjct  494  SNNELTGHIPNTIQSMLNLQELYLRNNKLEGTIPDVICNLKNLGALHLSRNVFSGS  549


 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 143/296 (48%), Gaps = 30/296 (10%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLK-  678
            S  +R+  L+L +    G +   LGNL +L  L   +NNF      SF   L++ R+LK 
Sbjct  382  SNSSRLRGLDLADNSFTGPIPESLGNLEYLEMLTFEKNNFFGDSALSFLTSLTKCRKLKS  441

Query  677  ----------ILQCSFNDFS--------------GNIPSWFGLLQNLRFLYLGNNNISGF  570
                      +   S  +FS              G IP   G L  +  + L NN ++G 
Sbjct  442  LWFADNPLDGVFPSSVGNFSNSLQIFVGRGCKLKGVIPEEIGNLTRVIKMSLSNNELTGH  501

Query  569  LPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlskle  390
            +P ++ ++  L+ L+L  N LEG+IP  I NL  L  L+LS N FSGS P  +  ++ L 
Sbjct  502  IPNTIQSMLNLQELYLRNNKLEGTIPDVICNLKNLGALHLSRNVFSGSVPPCLGKVTSLR  561

Query  389  nlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSG  210
             L L+ NSL   LP +LG  L  L  F + SN  SG+IP  +     L  + L  N FSG
Sbjct  562  YLYLAYNSLNSSLPQNLG-ALHDLIEFDISSNLLSGKIPVEIGNIKALTLIDLSNNKFSG  620

Query  209  HVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
             +P   G L KL KL L  N+L G IP   G + +L  +DL  N L G   ++L+ 
Sbjct  621  KIPSTLGGLDKLIKLSLAHNRLDGPIPESFGKMLALNFLDLCYNNLNGEIPKSLEA  676


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 85/267 (32%), Positives = 126/267 (47%), Gaps = 28/267 (10%)
 Frame = -1

Query  857  GVTCNSRHNRVSALNLF---NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLR  687
            GV  +S  N  ++L +F      L G +  ++GNL+ ++ ++LS N      P  +  + 
Sbjct  451  GVFPSSVGNFSNSLQIFVGRGCKLKGVIPEEIGNLTRVIKMSLSNNELTGHIPNTIQSML  510

Query  686  RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSL  507
             L+ L    N   G IP     L+NL  L+L  N  SG +P  L  ++ L  L+L  NSL
Sbjct  511  NLQELYLRNNKLEGTIPDVICNLKNLGALHLSRNVFSGSVPPCLGKVTSLRYLYLAYNSL  570

Query  506  EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
              S+P+ +G L  L   ++S N  SG  P++I                        GN +
Sbjct  571  NSSLPQNLGALHDLIEFDISSNLLSGKIPVEI------------------------GN-I  605

Query  326  PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ  147
              L +  + +NKFSG+IPS+L     L  LSL  N   G +P  FG +  L  L L  N 
Sbjct  606  KALTLIDLSNNKFSGKIPSTLGGLDKLIKLSLAHNRLDGPIPESFGKMLALNFLDLCYNN  665

Query  146  LTGAIPREIGALSSLLIVDLSNNKLYG  66
            L G IP+ + AL  L  +++S NKL G
Sbjct  666  LNGEIPKSLEALVYLKYLNISFNKLSG  692


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 115/249 (46%), Gaps = 27/249 (11%)
 Frame = -1

Query  869  CNWIGVTCNSRHN--RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELS  696
            C   GV      N  RV  ++L N  L G +   + ++  L  L L  N    + P  + 
Sbjct  472  CKLKGVIPEEIGNLTRVIKMSLSNNELTGHIPNTIQSMLNLQELYLRNNKLEGTIPDVIC  531

Query  695  QLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGV  516
             L+ L  L  S N FSG++P   G + +LR+LYL  N+++  LP +L  L  L    +  
Sbjct  532  NLKNLGALHLSRNVFSGSVPPCLGKVTSLRYLYLAYNSLNSSLPQNLGALHDLIEFDISS  591

Query  515  NSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
            N L G IP EIGN+  L L++LS+N FS                        G++P  LG
Sbjct  592  NLLSGKIPVEIGNIKALTLIDLSNNKFS------------------------GKIPSTLG  627

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
              L KL    +  N+  G IP S  K   L  L L +NN +G +P+    L  L+ L + 
Sbjct  628  G-LDKLIKLSLAHNRLDGPIPESFGKMLALNFLDLCYNNLNGEIPKSLEALVYLKYLNIS  686

Query  155  SNQLTGAIP  129
             N+L+G IP
Sbjct  687  FNKLSGEIP  695


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 77/162 (48%), Gaps = 7/162 (4%)
 Frame = -1

Query  905  LADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNN  726
            L+ N    S+ PC  +G   + R+     L L    L   L  +LG L  L+  ++S N 
Sbjct  541  LSRNVFSGSVPPC--LGKVTSLRY-----LYLAYNSLNSSLPQNLGALHDLIEFDISSNL  593

Query  725  FHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNL  546
                 P E+  ++ L ++  S N FSG IPS  G L  L  L L +N + G +P S   +
Sbjct  594  LSGKIPVEIGNIKALTLIDLSNNKFSGKIPSTLGGLDKLIKLSLAHNRLDGPIPESFGKM  653

Query  545  SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
              L  L L  N+L G IP+ +  L  LK LN+S N  SG  P
Sbjct  654  LALNFLDLCYNNLNGEIPKSLEALVYLKYLNISFNKLSGEIP  695



>ref|XP_009780871.1| PREDICTED: receptor-like protein kinase [Nicotiana sylvestris]
Length=570

 Score =   251 bits (640),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 202/305 (66%), Gaps = 3/305 (1%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLFNMG  798
            NI TD  AL++LKS ISF+ ++IL  NWS  S TP C+WIG+TC+SRH RV+ALN+ NM 
Sbjct  29   NINTDAAALVALKSHISFETNNILTRNWS--SSTPVCSWIGITCSSRHQRVTALNISNMQ  86

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G + P LGNLSFLVSL++S N F+   P EL+ L+RLK +  + N+F+G IPS+  L+
Sbjct  87   LHGTIPPHLGNLSFLVSLDISNNTFYRELPEELAHLKRLKQIDVTSNNFTGVIPSFLSLV  146

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
             +LR + L +N  SG +P+ L NL+KLEVL +  N L+G IPRE+G+L  + +L+L  N 
Sbjct  147  PDLRIMRLSSNQFSGEIPSFLSNLTKLEVLSIQGNYLKGEIPRELGHLRYMTILDLQYNL  206

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             +GS P  I N++ ++ ++L+ N+L G+LP+ + +HLP L++  + +N   G +P ++ K
Sbjct  207  LTGSIPPSIFNITTMQVIALTSNNLTGKLPMTICDHLPNLEMLYLSTNNLEGVVPPNIGK  266

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
            C  LQ LSL  N F G +PRE  NLT+L  L LR   L G IP E+G L  L  + L  N
Sbjct  267  CRKLQVLSLSVNEFIGTIPRELANLTELTILELREQHLEGEIPVELGNLRKLQALLLYQN  326

Query  77   KLYGT  63
               GT
Sbjct  327  MFTGT  331


 Score =   103 bits (257),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 87/273 (32%), Positives = 127/273 (47%), Gaps = 29/273 (11%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            +G +  +L NL+ L  L L + +     P EL  LR+L+ L    N F+G +PS    + 
Sbjct  281  IGTIPRELANLTELTILELREQHLEGEIPVELGNLRKLQALLLYQNMFTGTVPSSIFNMS  340

Query  614  NLRFLYLGNNNISGFLPTSL-------------------------FNLSKLEVLHLGVNS  510
             L+ L LG N  +G LP+ L                          N SKL  L L  NS
Sbjct  341  ELQHLGLGGNEFTGTLPSDLGRGMHRLEKFSCAQNQFSGFISATISNSSKLTGLELSFNS  400

Query  509  LEGSIPREIGNLFQLKLLNLSDNHFSG----SFPLDIlnlsklenlslsvnsLFGELPLD  342
              G IP  +GNL  L+ LNL  N+FS     SF   + +   L+ L  + N L G  P  
Sbjct  401  FTGPIPTSLGNLKYLEFLNLWGNNFSSDSSMSFLTSLTDCRNLKVLWFADNPLDGVFPSS  460

Query  341  LGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLF  162
            +GN    L  FV +  K  G IP  +   + +  +SL  N  +GH+P     +  L++L+
Sbjct  461  VGNFSNSLHSFVGQDCKLKGVIPEEIGNLTGVTKMSLSNNELTGHIPNTIQGMLNLQELY  520

Query  161  LRSNQLTGAIPREIGALSSLLIVDLSNNKLYGT  63
            L++N+L G IP  I  L  L  ++LS N+  G+
Sbjct  521  LQNNKLEGTIPDVICNLKKLGALNLSGNQFAGS  553


 Score =   101 bits (252),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 83/280 (30%), Positives = 115/280 (41%), Gaps = 77/280 (28%)
 Frame = -1

Query  746  LNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFL  567
            L LS NN     P  + + R+L++L  S N+F G IP     L  L  L L   ++ G +
Sbjct  249  LYLSTNNLEGVVPPNIGKCRKLQVLSLSVNEFIGTIPRELANLTELTILELREQHLEGEI  308

Query  566  PTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklen  387
            P  L NL KL+ L L  N   G++P  I N+ +L+ L L  N F+G+             
Sbjct  309  PVELGNLRKLQALLLYQNMFTGTVPSSIFNMSELQHLGLGGNEFTGT-------------  355

Query  386  lslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGH  207
                       LP DLG  + +L+ F    N+FSG I +++S  S L  L L FN+F+G 
Sbjct  356  -----------LPSDLGRGMHRLEKFSCAQNQFSGFISATISNSSKLTGLELSFNSFTGP  404

Query  206  VPREFGNLTKLEKLFLRSN-----------------------------------------  150
            +P   GNL  LE L L  N                                         
Sbjct  405  IPTSLGNLKYLEFLNLWGNNFSSDSSMSFLTSLTDCRNLKVLWFADNPLDGVFPSSVGNF  464

Query  149  ------------QLTGAIPREIGALSSLLIVDLSNNKLYG  66
                        +L G IP EIG L+ +  + LSNN+L G
Sbjct  465  SNSLHSFVGQDCKLKGVIPEEIGNLTGVTKMSLSNNELTG  504


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 78/272 (29%), Positives = 112/272 (41%), Gaps = 53/272 (19%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
             ++ L L    L GE+  +LGNL  L +L L QN F  + P  +  +  L+ L    N+F
Sbjct  293  ELTILELREQHLEGEIPVELGNLRKLQALLLYQNMFTGTVPSSIFNMSELQHLGLGGNEF  352

Query  650  SGNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
            +G +PS  G  +  L       N  SGF+  ++ N SKL  L L  NS  G IP  +GNL
Sbjct  353  TGTLPSDLGRGMHRLEKFSCAQNQFSGFISATISNSSKLTGLELSFNSFTGPIPTSLGNL  412

Query  473  FQLKLLNL----------------------------SDNHFSGSFPLDIlnlsklenlsl  378
              L+ LNL                            +DN   G FP  + N S   +  +
Sbjct  413  KYLEFLNLWGNNFSSDSSMSFLTSLTDCRNLKVLWFADNPLDGVFPSSVGNFSNSLHSFV  472

Query  377  svnsLF-GELPLDLGN----------------HLPK-------LQIFVMRSNKFSGEIPS  270
              +    G +P ++GN                H+P        LQ   +++NK  G IP 
Sbjct  473  GQDCKLKGVIPEEIGNLTGVTKMSLSNNELTGHIPNTIQGMLNLQELYLQNNKLEGTIPD  532

Query  269  SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKL  174
             +     L  L+L  N F+G VP   G +T L
Sbjct  533  VICNLKKLGALNLSGNQFAGSVPPCLGKVTNL  564


 Score = 67.4 bits (163),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 80/170 (47%), Gaps = 29/170 (17%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLKI  675
            S  ++++ L L      G +   LGNL +L  LNL  NNF +    SF   L+  R LK+
Sbjct  386  SNSSKLTGLELSFNSFTGPIPTSLGNLKYLEFLNLWGNNFSSDSSMSFLTSLTDCRNLKV  445

Query  674  L-----------QCSFNDFS--------------GNIPSWFGLLQNLRFLYLGNNNISGF  570
            L             S  +FS              G IP   G L  +  + L NN ++G 
Sbjct  446  LWFADNPLDGVFPSSVGNFSNSLHSFVGQDCKLKGVIPEEIGNLTGVTKMSLSNNELTGH  505

Query  569  LPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
            +P ++  +  L+ L+L  N LEG+IP  I NL +L  LNLS N F+GS P
Sbjct  506  IPNTIQGMLNLQELYLQNNKLEGTIPDVICNLKKLGALNLSGNQFAGSVP  555


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = -1

Query  713  FPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLE  534
             P E+  L  +  +  S N+ +G+IP+    + NL+ LYL NN + G +P  + NL KL 
Sbjct  482  IPEEIGNLTGVTKMSLSNNELTGHIPNTIQGMLNLQELYLQNNKLEGTIPDVICNLKKLG  541

Query  533  VLHLGVNSLEGSIPREIGNLFQLKL  459
             L+L  N   GS+P  +G +  L L
Sbjct  542  ALNLSGNQFAGSVPPCLGKVTNLSL  566



>ref|XP_008346276.1| PREDICTED: receptor-like protein kinase [Malus domestica]
Length=805

 Score =   255 bits (652),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 158/336 (47%), Positives = 202/336 (60%), Gaps = 24/336 (7%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLF  807
            AHTN +TD+ ALL+LK+ I+ DP +IL  NWS  S +  CNW+GVTC +RH+ V+ALNL 
Sbjct  15   AHTNFSTDQSALLALKAHITSDPQNILTANWSSASNSNICNWVGVTCGARHHXVTALNLP  74

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
             MGL G + P LGNLSFLV L L  N+FH   P+ELS+LRRLK +    N F G IPSWF
Sbjct  75   YMGLAGVIPPHLGNLSFLVELGLQNNSFHGPLPQELSRLRRLKAINFGNNSFMGTIPSWF  134

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
            G    L+ + L +N+ SGFLP ++FNLS LE ++L  N L GSIPREIGNL  +K++ L 
Sbjct  135  GSFAKLQTIKLYDNDFSGFLPAAIFNLSALENIYLMRNQLWGSIPREIGNLTMVKIIYLD  194

Query  446  DNHFS-----------------------GSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
            DN F                        GS  + +LN+S L  L+LS N++ G LP ++ 
Sbjct  195  DNKFEELPKEIGSLGQLEELFVQNNALKGSAFVPVLNISSLTTLALSGNNMSGSLPDNMC  254

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
             HL  +Q F +  N+  G IPS L +C  L+  SL  NNF G +P+  GNLT L K+FL 
Sbjct  255  EHLSSIQRFYLNQNQLDGLIPSKLWQCKELREFSLQSNNFRGSIPKSLGNLTYLSKIFLY  314

Query  155  SNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             N L G IP EIG L  L  + LS N L G     L
Sbjct  315  ENNLEGTIPDEIGDLPQLETLQLSVNNLNGVIPSKL  350


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 126/237 (53%), Gaps = 3/237 (1%)
 Frame = -1

Query  770  GNL-SFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            GNL + L   +LS +N   + P +++ L  L  L    N  SG IP+    L+NL+ L+L
Sbjct  474  GNLXTPLTYFDLSISNIRGNIPVDIANLSSLIELHLEINQLSGPIPTSIQRLKNLQGLFL  533

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL-FQLKLLNLSDNHFSGSFPL  417
             +N + G +P  L  L+ L  L LG N L GSIP  +G L   L+ L+L  N  +   P 
Sbjct  534  YDNKLQGHIPYELCQLNNLAELGLGHNRLSGSIPSCLGALAIALRNLSLESNLLTSKIPS  593

Query  416  DIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL  237
             +  L  + +L+LS NSL G L  D+G  L ++    + +N FSG IP S+     + +L
Sbjct  594  SLWELKYILHLNLSSNSLVGPLSEDIG-KLKEVVDIDLSNNHFSGNIPGSIGGLQNMISL  652

Query  236  SLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            SL  N   G +P  F  L  LE L L +N L+G IP+ + AL  L  ++LS NKL G
Sbjct  653  SLANNYLQGPIPTAFKTLLSLEFLDLSNNNLSGVIPKSLEALLYLKHLNLSFNKLQG  709


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 88/264 (33%), Positives = 130/264 (49%), Gaps = 13/264 (5%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +S + L+   L G +  ++G+L  L +L LS NN +   P +L     ++I+  +FN  S
Sbjct  308  LSKIFLYENNLEGTIPDEIGDLPQLETLQLSVNNLNGVIPSKLFNNSMIRIISLAFNQLS  367

Query  647  GNIPSWFGL-LQNL-RFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
            G +P+  GL + NL RFL   N  ++G LP +  N SKL VL +  NS  G +P    +L
Sbjct  368  GGLPANIGLNVPNLERFLISTNKLVAGPLP-NFSNASKLRVLDMDTNSFTGFLPITFCSL  426

Query  473  FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL------GNHLPKLQI  312
              L++L L  NH +    +D   LS L NL        G  PL+       GN    L  
Sbjct  427  KNLEILFLFWNHLT----IDASTLSCLFNLRNLTKLDLGGNPLNTTIPAFRGNLXTPLTY  482

Query  311  FVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAI  132
            F +  +   G IP  ++  S L  L L  N  SG +P     L  L+ LFL  N+L G I
Sbjct  483  FDLSISNIRGNIPVDIANLSSLIELHLEINQLSGPIPTSIQRLKNLQGLFLYDNKLQGHI  542

Query  131  PREIGALSSLLIVDLSNNKLYGTF  60
            P E+  L++L  + L +N+L G+ 
Sbjct  543  PYELCQLNNLAELGLGHNRLSGSI  566


 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 127/257 (49%), Gaps = 35/257 (14%)
 Frame = -1

Query  764  LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNN  585
            LS +    L+QN      P +L Q + L+      N+F G+IP   G L  L  ++L  N
Sbjct  257  LSSIQRFYLNQNQLDGLIPSKLWQCKELREFSLQSNNFRGSIPKSLGNLTYLSKIFLYEN  316

Query  584  NISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIln  405
            N+ G +P  + +L +LE L L VN+L G IP ++ N   +++++L+ N  SG        
Sbjct  317  NLEGTIPDEIGDLPQLETLQLSVNNLNGVIPSKLFNNSMIRIISLAFNQLSGG-------  369

Query  404  lsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF-SGEIPSSLSKCSLLQTLSLP  228
                             LP ++G ++P L+ F++ +NK  +G +P + S  S L+ L + 
Sbjct  370  -----------------LPANIGLNVPNLERFLISTNKLVAGPLP-NFSNASKLRVLDMD  411

Query  227  FNNFSGHVPREFGNLTKLEKLFLRSNQLT--GAIPREIGALSSLLIVDLSNNKLYGT---  63
             N+F+G +P  F +L  LE LFL  N LT   +    +  L +L  +DL  N L  T   
Sbjct  412  TNSFTGFLPITFCSLKNLEILFLFWNHLTIDASTLSCLFNLRNLTKLDLGGNPLNTTIPA  471

Query  62   FIQNLDTP*LK*LSYYN  12
            F  NL TP    L+Y++
Sbjct  472  FRGNLXTP----LTYFD  484


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 100/303 (33%), Positives = 132/303 (44%), Gaps = 51/303 (17%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKIL--------------QCSF  660
            LV    P+  N S L  L++  N+F    P     L+ L+IL               C F
Sbjct  391  LVAGPLPNFSNASKLRVLDMDTNSFTGFLPITFCSLKNLEILFLFWNHLTIDASTLSCLF  450

Query  659  N-------DFSGN-----IPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG  519
            N       D  GN     IP++ G L   L +  L  +NI G +P  + NLS L  LHL 
Sbjct  451  NLRNLTKLDLGGNPLNTTIPAFRGNLXTPLTYFDLSISNIRGNIPVDIANLSSLIELHLE  510

Query  518  VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL  339
            +N L G IP  I  L  L+ L L DN   G  P ++  L+ L  L L  N L G +P  L
Sbjct  511  INQLSGPIPTSIQRLKNLQGLFLYDNKLQGHIPYELCQLNNLAELGLGHNRLSGSIPSCL  570

Query  338  GNHLPKLQIFVMRSNKFSGEIPSSL-----------SKCSLLQTLS-------------L  231
            G     L+   + SN  + +IPSSL           S  SL+  LS             L
Sbjct  571  GALAIALRNLSLESNLLTSKIPSSLWELKYILHLNLSSNSLVGPLSEDIGKLKEVVDIDL  630

Query  230  PFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQN  51
              N+FSG++P   G L  +  L L +N L G IP     L SL  +DLSNN L G   ++
Sbjct  631  SNNHFSGNIPGSIGGLQNMISLSLANNYLQGPIPTAFKTLLSLEFLDLSNNNLSGVIPKS  690

Query  50   LDT  42
            L+ 
Sbjct  691  LEA  693


 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 114/241 (47%), Gaps = 5/241 (2%)
 Frame = -1

Query  839  RHNRVSALNLFNMGLV---GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ  669
            R N  + L  F++ +    G +  D+ NLS L+ L+L  N      P  + +L+ L+ L 
Sbjct  473  RGNLXTPLTYFDLSISNIRGNIPVDIANLSSLIELHLEINQLSGPIPTSIQRLKNLQGLF  532

Query  668  CSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLS-KLEVLHLGVNSLEGSIP  492
               N   G+IP     L NL  L LG+N +SG +P+ L  L+  L  L L  N L   IP
Sbjct  533  LYDNKLQGHIPYELCQLNNLAELGLGHNRLSGSIPSCLGALAIALRNLSLESNLLTSKIP  592

Query  491  REIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQI  312
              +  L  +  LNLS N   G    DI  L ++ ++ LS N   G +P  +G  L  +  
Sbjct  593  SSLWELKYILHLNLSSNSLVGPLSEDIGKLKEVVDIDLSNNHFSGNIPGSIGG-LQNMIS  651

Query  311  FVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAI  132
              + +N   G IP++      L+ L L  NN SG +P+    L  L+ L L  N+L G I
Sbjct  652  LSLANNYLQGPIPTAFKTLLSLEFLDLSNNNLSGVIPKSLEALLYLKHLNLSFNKLQGEI  711

Query  131  P  129
            P
Sbjct  712  P  712



>ref|XP_009617958.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana tomentosiformis]
 ref|XP_009603196.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana tomentosiformis]
Length=1204

 Score =   258 bits (660),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 147/306 (48%), Positives = 205/306 (67%), Gaps = 3/306 (1%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLFNMG  798
            NI+TD+ ALL+LKS IS DP++ILA NWS  S +P C+WIG+TC+SRH+RV+AL++ +M 
Sbjct  28   NISTDEAALLALKSHISADPNNILATNWS--SFSPVCSWIGITCSSRHHRVAALDISSMQ  85

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G + P LGNLSFL SL +S N FH  FP EL+ L+RLK+ +CS N+F+G IPS+  LL
Sbjct  86   LHGTIPPHLGNLSFLTSLIISNNTFHGEFPEELAHLQRLKMFRCSKNNFTGAIPSFLSLL  145

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
             NLRF+YL  N   G +P+SL NL++L+ L +  N L+G IPRE+G+L  + +L+L DN 
Sbjct  146  PNLRFVYLFGNQFFGGIPSSLSNLTQLKELSMSGNYLKGEIPRELGDLRYMTILDLQDNQ  205

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
              G  P  I N++ ++ ++LS N+L G+ P  + +HLP L+   +  N   G IP++L K
Sbjct  206  LRGPIPPSIFNITTMQIIALSSNNLTGKFPTTICDHLPNLEGLYLSDNILDGIIPANLKK  265

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
            C  LQ LSL  N F+G VP+E GN++ L  L L    L G IP+E+G L  L  + L  N
Sbjct  266  CIKLQILSLSNNEFTGTVPKELGNISALTGLALGGQHLEGEIPQELGGLRYLTSLYLQEN  325

Query  77   KLYGTF  60
             L G+ 
Sbjct  326  LLTGSI  331


 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 136/257 (53%), Gaps = 1/257 (0%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL-SQLRRLKILQCSFNDF  651
            ++ L+L +  L G + P + N++ +  + LS NN    FP  +   L  L+ L  S N  
Sbjct  196  MTILDLQDNQLRGPIPPSIFNITTMQIIALSSNNLTGKFPTTICDHLPNLEGLYLSDNIL  255

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
             G IP+       L+ L L NN  +G +P  L N+S L  L LG   LEG IP+E+G L 
Sbjct  256  DGIIPANLKKCIKLQILSLSNNEFTGTVPKELGNISALTGLALGGQHLEGEIPQELGGLR  315

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
             L  L L +N  +GS P  I N++ ++ + L  N+L G+LP  + +HLP L++  + +N 
Sbjct  316  YLTSLYLQENLLTGSIPPSIFNITTMQKIILRSNNLTGKLPTTICDHLPDLEVLAISNNH  375

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
              G IP +L KC  L  L L  N F G VP E  NLT L +L+L   QL G IP E+G L
Sbjct  376  LDGVIPPNLEKCRKLDILMLSKNKFIGTVPIELANLTALTELYLGVQQLGGEIPVELGNL  435

Query  110  SSLLIVDLSNNKLYGTF  60
              L  + L  N+  G+ 
Sbjct  436  KKLRTLSLYQNEFTGSI  452


 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 143/263 (54%), Gaps = 3/263 (1%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            ++  L+L N    G +  +LGN+S L  L L   +     P+EL  LR L  L    N  
Sbjct  268  KLQILSLSNNEFTGTVPKELGNISALTGLALGGQHLEGEIPQELGGLRYLTSLYLQENLL  327

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN-LSKLEVLHLGVNSLEGSIPREIGNL  474
            +G+IP     +  ++ + L +NN++G LPT++ + L  LEVL +  N L+G IP  +   
Sbjct  328  TGSIPPSIFNITTMQKIILRSNNLTGKLPTTICDHLPDLEVLAISNNHLDGVIPPNLEKC  387

Query  473  FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSN  294
             +L +L LS N F G+ P+++ NL+ L  L L V  L GE+P++LGN L KL+   +  N
Sbjct  388  RKLDILMLSKNKFIGTVPIELANLTALTELYLGVQQLGGEIPVELGN-LKKLRTLSLYQN  446

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG-NLTKLEKLFLRSNQLTGAIPREIG  117
            +F+G IP+S+   S LQ L+L  N  SG +P + G  ++ +EK     N ++G IP  I 
Sbjct  447  EFTGSIPASIFNMSALQNLALEQNRLSGTLPSDLGRGMSSIEKFNCAYNHMSGFIPASIS  506

Query  116  ALSSLLIVDLSNNKLYGTFIQNL  48
              S L  +DL  N   G   ++L
Sbjct  507  NSSRLRGLDLGINSFTGPIPESL  529


 Score =   117 bits (292),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 105/295 (36%), Positives = 147/295 (50%), Gaps = 29/295 (10%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLKI  675
            S  +R+  L+L      G +   LGNL +L  LNL  N+F +    SF   L+  R+L++
Sbjct  506  SNSSRLRGLDLGINSFTGPIPESLGNLEYLEMLNLQWNDFSSDSAMSFLTSLTNCRKLRV  565

Query  674  LQ-----------CSFNDFS-------------GNIPSWFGLLQNLRFLYLGNNNISGFL  567
            L             S  +FS             G IP   G L  +  + L NN ++G +
Sbjct  566  LSFAENPLDGVFPASVGNFSAMQIFEGQGCKLKGIIPEEIGNLTGMTRMSLQNNELAGHI  625

Query  566  PTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklen  387
            P S+ ++ KL+ L+L  N ++G+IP  I NL  L  L+LS+NHFSGS P  +  ++ L N
Sbjct  626  PKSVQDMLKLQELYLYGNKIDGTIPNVICNLKSLGALDLSENHFSGSVPACLGTVTSLRN  685

Query  386  lslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGH  207
            L L+ NSL   LP  LGN L  L  F + SN  SG+IP  +        + L  NNFSG 
Sbjct  686  LYLAYNSLNSGLPTSLGN-LKDLIEFNVSSNLLSGKIPLEIGNLKAATLIDLSKNNFSGK  744

Query  206  VPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
            +    G L KL KL L  N L G IP   G + +L  +DLS N L G   ++L+ 
Sbjct  745  ISNTLGGLDKLIKLSLAHNILNGPIPDSFGKMLALEFLDLSFNNLSGEIPKSLEA  799


 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 90/259 (35%), Positives = 131/259 (51%), Gaps = 6/259 (2%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +  L + N  L G + P+L     L  L LS+N F  + P EL+ L  L  L        
Sbjct  366  LEVLAISNNHLDGVIPPNLEKCRKLDILMLSKNKFIGTVPIELANLTALTELYLGVQQLG  425

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG-NLF  471
            G IP   G L+ LR L L  N  +G +P S+FN+S L+ L L  N L G++P ++G  + 
Sbjct  426  GEIPVELGNLKKLRTLSLYQNEFTGSIPASIFNMSALQNLALEQNRLSGTLPSDLGRGMS  485

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
             ++  N + NH SG  P  I N S+L  L L +NS  G +P  LGN L  L++  ++ N 
Sbjct  486  SIEKFNCAYNHMSGFIPASISNSSRLRGLDLGINSFTGPIPESLGN-LEYLEMLNLQWND  544

Query  290  FSGEIP----SSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPRE  123
            FS +      +SL+ C  L+ LS   N   G  P   GN + ++    +  +L G IP E
Sbjct  545  FSSDSAMSFLTSLTNCRKLRVLSFAENPLDGVFPASVGNFSAMQIFEGQGCKLKGIIPEE  604

Query  122  IGALSSLLIVDLSNNKLYG  66
            IG L+ +  + L NN+L G
Sbjct  605  IGNLTGMTRMSLQNNELAG  623


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 113/233 (48%), Gaps = 25/233 (11%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            ++ ++L N  L G +   + ++  L  L L  N    + P  +  L+ L  L  S N FS
Sbjct  611  MTRMSLQNNELAGHIPKSVQDMLKLQELYLYGNKIDGTIPNVICNLKSLGALDLSENHFS  670

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G++P+  G + +LR LYL  N+++  LPTSL NL  L   ++  N L G IP EIGNL  
Sbjct  671  GSVPACLGTVTSLRNLYLAYNSLNSGLPTSLGNLKDLIEFNVSSNLLSGKIPLEIGNLKA  730

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
              L++LS N+FSG                        ++   LG  L KL    +  N  
Sbjct  731  ATLIDLSKNNFSG------------------------KISNTLGG-LDKLIKLSLAHNIL  765

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
            +G IP S  K   L+ L L FNN SG +P+    L  L+ L +  N+L+G IP
Sbjct  766  NGPIPDSFGKMLALEFLDLSFNNLSGEIPKSLEALINLKYLNISFNKLSGEIP  818


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 80/261 (31%), Positives = 106/261 (41%), Gaps = 52/261 (20%)
 Frame = -1

Query  746  LNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFL  567
            L +S N+     P  L + R+L IL  S N F G +P     L  L  LYLG   + G +
Sbjct  369  LAISNNHLDGVIPPNLEKCRKLDILMLSKNKFIGTVPIELANLTALTELYLGVQQLGGEI  428

Query  566  PTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklen  387
            P  L NL KL  L L  N   GSIP  I N+  L+ L L  N  SG+             
Sbjct  429  PVELGNLKKLRTLSLYQNEFTGSIPASIFNMSALQNLALEQNRLSGT-------------  475

Query  386  lslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGH  207
                       LP DLG  +  ++ F    N  SG IP+S+S  S L+ L L  N+F+G 
Sbjct  476  -----------LPSDLGRGMSSIEKFNCAYNHMSGFIPASISNSSRLRGLDLGINSFTGP  524

Query  206  VPREFGNLTKLEKLFLR----------------------------SNQLTGAIPREIGAL  111
            +P   GNL  LE L L+                             N L G  P  +G  
Sbjct  525  IPESLGNLEYLEMLNLQWNDFSSDSAMSFLTSLTNCRKLRVLSFAENPLDGVFPASVGNF  584

Query  110  SSLLIVDLSNNKLYGTFIQNL  48
            S++ I +    KL G   + +
Sbjct  585  SAMQIFEGQGCKLKGIIPEEI  605



>ref|XP_009589466.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Nicotiana tomentosiformis]
Length=1141

 Score =   258 bits (659),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 153/333 (46%), Positives = 211/333 (63%), Gaps = 6/333 (2%)
 Frame = -1

Query  1058  MEITRHYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNS  879
             ME +  +    +F  + L+ C+     TNITTD+ ALL+LK+  + +       NWS  +
Sbjct  1     MEKSYSFVLSVVFELYFLVACMA----TNITTDQSALLALKASFALNSSHPFTQNWSSQA  56

Query  878   ITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL  699
              + CNWIG++C SRH+RV+ALN+ NM + G ++P LGNLSFLVSL++S+NNFH  FP++L
Sbjct  57    -SVCNWIGISCGSRHHRVTALNVSNMNIHGTISPQLGNLSFLVSLDVSKNNFHGDFPQDL  115

Query  698   SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG  519
             S+LRRL+ +   +N+FSG IP WFGL   L+ L L NN  +  +P S+ NLSKLE L   
Sbjct  116   SRLRRLRAIDLGYNNFSGEIPMWFGLFSELKMLILDNNAFT-HIPPSISNLSKLETLSAR  174

Query  518   VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL  339
              N L+G+IP+EIG+L  LK L L  N  +GS P  ILN+S LE L+L+ N L G LP+D+
Sbjct  175   YNRLQGNIPKEIGHLQNLKELVLVSNQLTGSIPFSILNISSLETLALTYNQLSGSLPVDI  234

Query  338   GNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFL  159
              + L +++   + SN+ SG IP+ LS CS L  L+L +N  SG +P E G L  LE L L
Sbjct  235   CSRLQRIKSISIISNQLSGHIPAGLSNCSELYDLALSYNKLSGTIPPELGKLEMLEILSL  294

Query  158   RSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
               N L G IP  IG L  L  + L NN + G+ 
Sbjct  295   GGNNLEGIIPETIGNLRKLQKLQLENNHIVGSI  327


 Score =   136 bits (343),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 111/277 (40%), Positives = 151/277 (55%), Gaps = 6/277 (2%)
 Frame = -1

Query  854  VTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKI  675
            V   SR  R+ ++++ +  L G +   L N S L  L LS N    + P EL +L  L+I
Sbjct  232  VDICSRLQRIKSISIISNQLSGHIPAGLSNCSELYDLALSYNKLSGTIPPELGKLEMLEI  291

Query  674  LQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSI  495
            L    N+  G IP   G L+ L+ L L NN+I G +P ++FN+S L +L+   N+L G I
Sbjct  292  LSLGGNNLEGIIPETIGNLRKLQKLQLENNHIVGSIPRTIFNMSSLWLLNFNTNNLSGVI  351

Query  494  PREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQ  315
            PREIGNL +L+LL L  N  SGS P ++ N+S L  ++LS N+L G LP  LG     LQ
Sbjct  352  PREIGNLHKLELLYLQFNKLSGSLPEELFNISTLRGMALSYNNLSGSLPSALGYWPTTLQ  411

Query  314  IFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG-  138
               +  N   G IP+SL   S L+ L L  N FSG +P   G+L +LE+L L  N LT  
Sbjct  412  YLHLGENNIGGVIPNSLFNSSNLKELILDDNRFSGGIPNSLGDLRQLERLRLFRNNLTFP  471

Query  137  --AIPREIGALSSLLIVDLSNNKLYGTF---IQNLDT  42
              +I   +    SL  +DLS+N L G     I NL T
Sbjct  472  QLSIFASLANCRSLREIDLSDNPLNGVLSESIGNLST  508


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 89/252 (35%), Positives = 129/252 (51%), Gaps = 3/252 (1%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSL-NLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            ++L +  L G L+  +GNLS  + L +L  +      P  +  L  L  L    ND +G+
Sbjct  488  IDLSDNPLNGVLSESIGNLSTSLELFDLRHSEISGQLPLGIGNLSNLTDLYLFDNDLTGS  547

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            +PS F  L NL+ LYL  N + G LP  L NL  L ++ L  N + G IP  IGN+  L+
Sbjct  548  VPSTFCDLHNLQRLYLHQNRLIGPLPECLCNLPVLGMVSLSYNQISGPIPYCIGNVTSLR  607

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             + L+ N  +   P+ + +L  L  L LS NSL G LP D GN L  +    +  N  SG
Sbjct  608  NIYLNSNRLT-KIPMSLWSLKDLVELDLSNNSLVGSLPPDFGN-LNAITFLDLSRNHLSG  665

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
              PS++     L  LS+ +N   G +P   G +  LE + L SN L+G IP+ + AL  L
Sbjct  666  SFPSTVGDLQKLLYLSVAYNELQGFIPESLGKMLSLESVNLSSNYLSGMIPKSLEALQYL  725

Query  101  LIVDLSNNKLYG  66
               ++S N+L G
Sbjct  726  KHFNVSLNRLEG  737


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 86/254 (34%), Positives = 128/254 (50%), Gaps = 10/254 (4%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPR-----ELSQLRRLKILQCSFNDFSGNIPSWF  627
            G +   LG+L  L  L L +NN   +FP+      L+  R L+ +  S N  +G +    
Sbjct  446  GGIPNSLGDLRQLERLRLFRNNL--TFPQLSIFASLANCRSLREIDLSDNPLNGVLSESI  503

Query  626  G-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
            G L  +L    L ++ ISG LP  + NLS L  L+L  N L GS+P    +L  L+ L L
Sbjct  504  GNLSTSLELFDLRHSEISGQLPLGIGNLSNLTDLYLFDNDLTGSVPSTFCDLHNLQRLYL  563

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
              N   G  P  + NL  L  +SLS N + G +P  +GN +  L+   + SN+ + +IP 
Sbjct  564  HQNRLIGPLPECLCNLPVLGMVSLSYNQISGPIPYCIGN-VTSLRNIYLNSNRLT-KIPM  621

Query  269  SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVD  90
            SL     L  L L  N+  G +P +FGNL  +  L L  N L+G+ P  +G L  LL + 
Sbjct  622  SLWSLKDLVELDLSNNSLVGSLPPDFGNLNAITFLDLSRNHLSGSFPSTVGDLQKLLYLS  681

Query  89   LSNNKLYGTFIQNL  48
            ++ N+L G   ++L
Sbjct  682  VAYNELQGFIPESL  695


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            L+L N  LVG L PD GNL+ +  L+LS+N+   SFP  +  L++L  L  ++N+  G I
Sbjct  632  LDLSNNSLVGSLPPDFGNLNAITFLDLSRNHLSGSFPSTVGDLQKLLYLSVAYNELQGFI  691

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            P   G + +L  + L +N +SG +P SL  L  L+  ++ +N LEG IP +
Sbjct  692  PESLGKMLSLESVNLSSNYLSGMIPKSLEALQYLKHFNVSLNRLEGEIPSK  742


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 61/118 (52%), Gaps = 0/118 (0%)
 Frame = -1

Query  773  LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            L +L  LV L+LS N+   S P +   L  +  L  S N  SG+ PS  G LQ L +L +
Sbjct  623  LWSLKDLVELDLSNNSLVGSLPPDFGNLNAITFLDLSRNHLSGSFPSTVGDLQKLLYLSV  682

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
              N + GF+P SL  +  LE ++L  N L G IP+ +  L  LK  N+S N   G  P
Sbjct  683  AYNELQGFIPESLGKMLSLESVNLSSNYLSGMIPKSLEALQYLKHFNVSLNRLEGEIP  740



>ref|XP_009589465.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Nicotiana tomentosiformis]
Length=1142

 Score =   258 bits (659),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 153/333 (46%), Positives = 211/333 (63%), Gaps = 6/333 (2%)
 Frame = -1

Query  1058  MEITRHYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNS  879
             ME +  +    +F  + L+ C+     TNITTD+ ALL+LK+  + +       NWS  +
Sbjct  1     MEKSYSFVLSVVFELYFLVACMA----TNITTDQSALLALKASFALNSSHPFTQNWSSQA  56

Query  878   ITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL  699
              + CNWIG++C SRH+RV+ALN+ NM + G ++P LGNLSFLVSL++S+NNFH  FP++L
Sbjct  57    -SVCNWIGISCGSRHHRVTALNVSNMNIHGTISPQLGNLSFLVSLDVSKNNFHGDFPQDL  115

Query  698   SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG  519
             S+LRRL+ +   +N+FSG IP WFGL   L+ L L NN  +  +P S+ NLSKLE L   
Sbjct  116   SRLRRLRAIDLGYNNFSGEIPMWFGLFSELKMLILDNNAFT-HIPPSISNLSKLETLSAR  174

Query  518   VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL  339
              N L+G+IP+EIG+L  LK L L  N  +GS P  ILN+S LE L+L+ N L G LP+D+
Sbjct  175   YNRLQGNIPKEIGHLQNLKELVLVSNQLTGSIPFSILNISSLETLALTYNQLSGSLPVDI  234

Query  338   GNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFL  159
              + L +++   + SN+ SG IP+ LS CS L  L+L +N  SG +P E G L  LE L L
Sbjct  235   CSRLQRIKSISIISNQLSGHIPAGLSNCSELYDLALSYNKLSGTIPPELGKLEMLEILSL  294

Query  158   RSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
               N L G IP  IG L  L  + L NN + G+ 
Sbjct  295   GGNNLEGIIPETIGNLRKLQKLQLENNHIVGSI  327


 Score =   132 bits (331),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 111/278 (40%), Positives = 151/278 (54%), Gaps = 7/278 (3%)
 Frame = -1

Query  854  VTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKI  675
            V   SR  R+ ++++ +  L G +   L N S L  L LS N    + P EL +L  L+I
Sbjct  232  VDICSRLQRIKSISIISNQLSGHIPAGLSNCSELYDLALSYNKLSGTIPPELGKLEMLEI  291

Query  674  LQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLE-GS  498
            L    N+  G IP   G L+ L+ L L NN+I G +P ++FN+S L +L+   N+L  G 
Sbjct  292  LSLGGNNLEGIIPETIGNLRKLQKLQLENNHIVGSIPRTIFNMSSLWLLNFNTNNLSAGV  351

Query  497  IPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKL  318
            IPREIGNL +L+LL L  N  SGS P ++ N+S L  ++LS N+L G LP  LG     L
Sbjct  352  IPREIGNLHKLELLYLQFNKLSGSLPEELFNISTLRGMALSYNNLSGSLPSALGYWPTTL  411

Query  317  QIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
            Q   +  N   G IP+SL   S L+ L L  N FSG +P   G+L +LE+L L  N LT 
Sbjct  412  QYLHLGENNIGGVIPNSLFNSSNLKELILDDNRFSGGIPNSLGDLRQLERLRLFRNNLTF  471

Query  137  ---AIPREIGALSSLLIVDLSNNKLYGTF---IQNLDT  42
               +I   +    SL  +DLS+N L G     I NL T
Sbjct  472  PQLSIFASLANCRSLREIDLSDNPLNGVLSESIGNLST  509


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 89/252 (35%), Positives = 129/252 (51%), Gaps = 3/252 (1%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSL-NLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            ++L +  L G L+  +GNLS  + L +L  +      P  +  L  L  L    ND +G+
Sbjct  489  IDLSDNPLNGVLSESIGNLSTSLELFDLRHSEISGQLPLGIGNLSNLTDLYLFDNDLTGS  548

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            +PS F  L NL+ LYL  N + G LP  L NL  L ++ L  N + G IP  IGN+  L+
Sbjct  549  VPSTFCDLHNLQRLYLHQNRLIGPLPECLCNLPVLGMVSLSYNQISGPIPYCIGNVTSLR  608

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             + L+ N  +   P+ + +L  L  L LS NSL G LP D GN L  +    +  N  SG
Sbjct  609  NIYLNSNRLT-KIPMSLWSLKDLVELDLSNNSLVGSLPPDFGN-LNAITFLDLSRNHLSG  666

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
              PS++     L  LS+ +N   G +P   G +  LE + L SN L+G IP+ + AL  L
Sbjct  667  SFPSTVGDLQKLLYLSVAYNELQGFIPESLGKMLSLESVNLSSNYLSGMIPKSLEALQYL  726

Query  101  LIVDLSNNKLYG  66
               ++S N+L G
Sbjct  727  KHFNVSLNRLEG  738


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 86/254 (34%), Positives = 128/254 (50%), Gaps = 10/254 (4%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPR-----ELSQLRRLKILQCSFNDFSGNIPSWF  627
            G +   LG+L  L  L L +NN   +FP+      L+  R L+ +  S N  +G +    
Sbjct  447  GGIPNSLGDLRQLERLRLFRNNL--TFPQLSIFASLANCRSLREIDLSDNPLNGVLSESI  504

Query  626  G-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
            G L  +L    L ++ ISG LP  + NLS L  L+L  N L GS+P    +L  L+ L L
Sbjct  505  GNLSTSLELFDLRHSEISGQLPLGIGNLSNLTDLYLFDNDLTGSVPSTFCDLHNLQRLYL  564

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
              N   G  P  + NL  L  +SLS N + G +P  +GN +  L+   + SN+ + +IP 
Sbjct  565  HQNRLIGPLPECLCNLPVLGMVSLSYNQISGPIPYCIGN-VTSLRNIYLNSNRLT-KIPM  622

Query  269  SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVD  90
            SL     L  L L  N+  G +P +FGNL  +  L L  N L+G+ P  +G L  LL + 
Sbjct  623  SLWSLKDLVELDLSNNSLVGSLPPDFGNLNAITFLDLSRNHLSGSFPSTVGDLQKLLYLS  682

Query  89   LSNNKLYGTFIQNL  48
            ++ N+L G   ++L
Sbjct  683  VAYNELQGFIPESL  696


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            L+L N  LVG L PD GNL+ +  L+LS+N+   SFP  +  L++L  L  ++N+  G I
Sbjct  633  LDLSNNSLVGSLPPDFGNLNAITFLDLSRNHLSGSFPSTVGDLQKLLYLSVAYNELQGFI  692

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            P   G + +L  + L +N +SG +P SL  L  L+  ++ +N LEG IP +
Sbjct  693  PESLGKMLSLESVNLSSNYLSGMIPKSLEALQYLKHFNVSLNRLEGEIPSK  743


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 61/118 (52%), Gaps = 0/118 (0%)
 Frame = -1

Query  773  LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            L +L  LV L+LS N+   S P +   L  +  L  S N  SG+ PS  G LQ L +L +
Sbjct  624  LWSLKDLVELDLSNNSLVGSLPPDFGNLNAITFLDLSRNHLSGSFPSTVGDLQKLLYLSV  683

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
              N + GF+P SL  +  LE ++L  N L G IP+ +  L  LK  N+S N   G  P
Sbjct  684  AYNELQGFIPESLGKMLSLESVNLSSNYLSGMIPKSLEALQYLKHFNVSLNRLEGEIP  741



>ref|XP_009593033.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Nicotiana tomentosiformis]
Length=1085

 Score =   258 bits (658),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 205/305 (67%), Gaps = 2/305 (1%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISF-DPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMG  798
            NI+TD+ ALL+LKS IS  DP+ ILA NWS +S   CNWIG+TC+SRH+RV+AL++ +M 
Sbjct  28   NISTDEAALLALKSHISSSDPNKILATNWSSSSPV-CNWIGITCSSRHHRVAALDISSMQ  86

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G + P LGNLSFLVSL++S N FH   P EL+ L+RLK++  + N+F+G IPS+  LL
Sbjct  87   LHGTIPPHLGNLSFLVSLDISNNAFHGDLPEELAHLQRLKLINVTRNNFTGIIPSFLSLL  146

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
              LRF+YL +N  SG +P+S+ NL+KLEVL +  N L G IPRE+G+L  +  L+L  N 
Sbjct  147  PKLRFVYLSSNQFSGEIPSSISNLTKLEVLRIRENFLVGEIPRELGDLRCMTFLDLQRNR  206

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             +GS P  I N++ ++ ++L+ N+L G+LP  + +HLP L+   +  N  +G IP +L K
Sbjct  207  LTGSIPPTIFNITSIQRIALTGNNLAGKLPTTICDHLPNLEGLYISFNYLNGVIPPNLEK  266

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
            C  LQ LSL  N F G +PRE  NLT L  L L S  L G IP E+G L  L  +DLS N
Sbjct  267  CRKLQLLSLYENEFIGTIPRELANLTALRGLALGSMHLEGEIPVELGYLKKLQQLDLSEN  326

Query  77   KLYGT  63
            +  G+
Sbjct  327  EFIGS  331


 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 98/258 (38%), Positives = 141/258 (55%), Gaps = 5/258 (2%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
             L L +M L GE+  +LG L  L  L+LS+N F  S P  +  +  L IL    N FSG 
Sbjct  296  GLALGSMHLEGEIPVELGYLKKLQQLDLSENEFIGSVPASILNMSTLLILALGSNRFSGT  355

Query  641  IPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQL  465
            +PS  G  +QNL   Y+G NN+SGF+  S+ N S+L +L +  NS  G IP+ +GNL QL
Sbjct  356  LPSDLGRGMQNLEEFYIGGNNLSGFISPSISNSSRLRILDIAYNSFTGPIPQSLGNLEQL  415

Query  464  KLLNLSDNHF----SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRS  297
            +LLNL  N+F    S SF   + +   L  +  + N L G LP  +GN    LQIF   +
Sbjct  416  ELLNLQMNNFFSDSSLSFLTYLTSCRNLREVGFAENPLDGVLPASIGNFSDTLQIFYGEN  475

Query  296  NKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIG  117
             K  G IP  +   + +  ++L  N   GH+P+    +  L++L+L SN++ G IP  I 
Sbjct  476  CKLKGIIPEEIGNLTGVAKMTLSNNELIGHIPKTVLGMLNLQELYLDSNKIEGTIPDAIC  535

Query  116  ALSSLLIVDLSNNKLYGT  63
             L +L  +DLS N+  G+
Sbjct  536  NLKNLGALDLSGNQFSGS  553


 Score =   107 bits (268),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 125/245 (51%), Gaps = 2/245 (1%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQN-NFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L   +GN S  + +   +N       P E+  L  +  +  S N+  G+IP     
Sbjct  453  LDGVLPASIGNFSDTLQIFYGENCKLKGIIPEEIGNLTGVAKMTLSNNELIGHIPKTVLG  512

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            + NL+ LYL +N I G +P ++ NL  L  L L  N   GS+P  +GN+  L+ L L+ N
Sbjct  513  MLNLQELYLDSNKIEGTIPDAICNLKNLGALDLSGNQFSGSVPPCLGNVTSLRKLYLAYN  572

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              + S P  + +L  L  L  S N L  ++P ++GN L    +  +  N FSGE+PS++ 
Sbjct  573  SLNWSLPSSLGSLEDLIELDASSNLLSRQIPQEIGN-LRAAALIDLSKNDFSGEMPSTIG  631

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
                L  LSL  N   G +P  FG +  LE L L  N L+G IP+ + AL +L  +++S 
Sbjct  632  GLDKLTKLSLAHNRLEGPIPDSFGKMLALEVLELSFNNLSGEIPKPLEALKNLKYLNISF  691

Query  80   NKLYG  66
            NKL G
Sbjct  692  NKLSG  696


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 110/233 (47%), Gaps = 25/233 (11%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            V+ + L N  L+G +   +  +  L  L L  N    + P  +  L+ L  L  S N FS
Sbjct  492  VAKMTLSNNELIGHIPKTVLGMLNLQELYLDSNKIEGTIPDAICNLKNLGALDLSGNQFS  551

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G++P   G + +LR LYL  N+++  LP+SL +L  L  L    N L   IP+EIGNL  
Sbjct  552  GSVPPCLGNVTSLRKLYLAYNSLNWSLPSSLGSLEDLIELDASSNLLSRQIPQEIGNLRA  611

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
              L++LS N FS                        GE+P  +G  L KL    +  N+ 
Sbjct  612  AALIDLSKNDFS------------------------GEMPSTIGG-LDKLTKLSLAHNRL  646

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             G IP S  K   L+ L L FNN SG +P+    L  L+ L +  N+L+G IP
Sbjct  647  EGPIPDSFGKMLALEVLELSFNNLSGEIPKPLEALKNLKYLNISFNKLSGEIP  699


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 110/214 (51%), Gaps = 3/214 (1%)
 Frame = -1

Query  653  FSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
              G IP   G L  +  + L NN + G +P ++  +  L+ L+L  N +EG+IP  I NL
Sbjct  478  LKGIIPEEIGNLTGVAKMTLSNNELIGHIPKTVLGMLNLQELYLDSNKIEGTIPDAICNL  537

Query  473  FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSN  294
              L  L+LS N FSGS P  + N++ L  L L+ NSL   LP  LG+ L  L      SN
Sbjct  538  KNLGALDLSGNQFSGSVPPCLGNVTSLRKLYLAYNSLNWSLPSSLGS-LEDLIELDASSN  596

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGA  114
              S +IP  +        + L  N+FSG +P   G L KL KL L  N+L G IP   G 
Sbjct  597  LLSRQIPQEIGNLRAAALIDLSKNDFSGEMPSTIGGLDKLTKLSLAHNRLEGPIPDSFGK  656

Query  113  LSSLLIVDLSNNKLYGTFIQNLDTP*LK*LSYYN  12
            + +L +++LS N L G   + L+   LK L Y N
Sbjct  657  MLALEVLELSFNNLSGEIPKPLEA--LKNLKYLN  688


 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 75/259 (29%), Positives = 112/259 (43%), Gaps = 29/259 (11%)
 Frame = -1

Query  755  LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNIS  576
            L  L +S N  +   P  L + R+L++L    N+F G IP     L  LR L LG+ ++ 
Sbjct  246  LEGLYISFNYLNGVIPPNLEKCRKLQLLSLYENEFIGTIPRELANLTALRGLALGSMHLE  305

Query  575  GFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsk  396
            G +P  L  L KL+ L L  N   GS+P  I N+  L +L L  N FSG+ P D+    +
Sbjct  306  GEIPVELGYLKKLQQLDLSENEFIGSVPASILNMSTLLILALGSNRFSGTLPSDLGRGMQ  365

Query  395  lenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSS-----------------  267
                     +          ++  +L+I  +  N F+G IP S                 
Sbjct  366  NLEEFYIGGNNLSGFISPSISNSSRLRILDIAYNSFTGPIPQSLGNLEQLELLNLQMNNF  425

Query  266  -----------LSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN-QLTGAIPRE  123
                       L+ C  L+ +    N   G +P   GN +   ++F   N +L G IP E
Sbjct  426  FSDSSLSFLTYLTSCRNLREVGFAENPLDGVLPASIGNFSDTLQIFYGENCKLKGIIPEE  485

Query  122  IGALSSLLIVDLSNNKLYG  66
            IG L+ +  + LSNN+L G
Sbjct  486  IGNLTGVAKMTLSNNELIG  504


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 49/91 (54%), Gaps = 1/91 (1%)
 Frame = -1

Query  830  RVSAL-NLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND  654
            R +AL +L      GE+   +G L  L  L+L+ N      P    ++  L++L+ SFN+
Sbjct  610  RAAALIDLSKNDFSGEMPSTIGGLDKLTKLSLAHNRLEGPIPDSFGKMLALEVLELSFNN  669

Query  653  FSGNIPSWFGLLQNLRFLYLGNNNISGFLPT  561
             SG IP     L+NL++L +  N +SG +PT
Sbjct  670  LSGEIPKPLEALKNLKYLNISFNKLSGEIPT  700


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P  LGN L  L    + +N F G++P  L+    L+ +++  NNF+G +P     L 
Sbjct  89   GTIPPHLGN-LSFLVSLDISNNAFHGDLPEELAHLQRLKLINVTRNNFTGIIPSFLSLLP  147

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            KL  ++L SNQ +G IP  I  L+ L ++ +  N L G   + L
Sbjct  148  KLRFVYLSSNQFSGEIPSSISNLTKLEVLRIRENFLVGEIPREL  191



>ref|XP_008355308.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Malus domestica]
Length=467

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 155/355 (44%), Positives = 210/355 (59%), Gaps = 33/355 (9%)
 Frame = -1

Query  1037  FCLSIFFFHSLMLCLTINA----HTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP  870
             +CL   +   +   LT +A    HTN +TD+ ALL+LK+ I+ DP +IL  NWS  + + 
Sbjct  16    YCLCYIYLMIMANYLTADAIVIAHTNFSTDQSALLALKAHITSDPQNILTANWSSAANSD  75

Query  869   -CNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQ  693
              CNW+GVTC +RH+RV+ALNL +MGL G + P LGNLSFLV L+L  N F+ S P+ELS+
Sbjct  76    ICNWVGVTCGARHHRVTALNLSSMGLAGVIPPHLGNLSFLVELHLKNNFFNGSLPQELSR  135

Query  692   LRRLKILQCSFNDFSGNIPSWFGLLQNLR-FLYLGNNNISGFLPTSLFNLSKLEVLHLGV  516
             LRRLK++   +N+F+G IPSWFG    L+ F+  GN    GF+P ++FNLS L+ + L  
Sbjct  136   LRRLKVIDFQYNNFTGTIPSWFGSFPKLQTFILWGN----GFIPAAIFNLSALKKIDLSG  191

Query  515   NSLEGSIPREIGNLFQLKLLNLSDNHFS------GSFP-----------------LDIln  405
             N L GSIPREIGNL  +K++ L DN F       GS                   + ILN
Sbjct  192   NQLSGSIPREIGNLTMVKVIYLDDNKFEELPNEIGSLGQLEVLFVQDNALKGFAFVPILN  251

Query  404   lsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPF  225
             +S L  L+L  N++ G LP ++  HL  ++   +  N+  G IPS L +C  L+ +SL  
Sbjct  252   ISSLTALTLYGNNMSGSLPDNMCEHLSSIRQLYLGQNQLDGMIPSKLWQCKELREISLAS  311

Query  224   NNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             NNF G +P+  GNLT L  + L  N L G IP EIG L  L I+ L  N L G  
Sbjct  312   NNFRGSIPKSLGNLTYLSNIILSDNNLEGTIPDEIGDLPQLEILTLHANNLSGVI  366


 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 71/231 (31%), Positives = 116/231 (50%), Gaps = 27/231 (12%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            ++AL L+   + G L  ++  +LS +  L L QN      P +L Q + L+ +  + N+F
Sbjct  255  LTALTLYGNNMSGSLPDNMCEHLSSIRQLYLGQNQLDGMIPSKLWQCKELREISLASNNF  314

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
             G+IP   G L  L  + L +NN+ G +P  + +L +LE+L L  N+L G IP ++ N  
Sbjct  315  RGSIPKSLGNLTYLSNIILSDNNLEGTIPDEIGDLPQLEILTLHANNLSGVIPSKLFNNS  374

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIF-VMRSN  294
             ++ + LS N  SG                         LP ++G ++P L+   V ++N
Sbjct  375  MVREIGLSINQLSGG------------------------LPANIGLNVPNLEFLGVAQNN  410

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
              +G +P +LS  S L+ L +  N+F+G +P    +L  LE L L SN LT
Sbjct  411  LVAGLLP-NLSNASKLKELDMSTNSFTGFLPITLCSLKNLESLILHSNNLT  460



>ref|XP_009799273.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Nicotiana sylvestris]
Length=1142

 Score =   258 bits (658),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 210/333 (63%), Gaps = 6/333 (2%)
 Frame = -1

Query  1058  MEITRHYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNS  879
             ME +  +    +F  + L+ C+     TNITTD+ ALL+LKS  + +    L  NWS  +
Sbjct  1     MEKSYSFVLSVVFELYFLVACMA----TNITTDQSALLALKSSFALNSSHPLTQNWSSQA  56

Query  878   ITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL  699
              + CNWIG++C S H+RV+ALN+ NM + G + P LGNLSFLVSL++S+NNF   FP++L
Sbjct  57    -SVCNWIGISCGSHHHRVTALNISNMNIHGTIPPQLGNLSFLVSLDVSKNNFDGDFPQDL  115

Query  698   SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG  519
             S++RRL+ +   +N+FSG IP WFGL   L+ L L +N  + ++P S+ NLSKLE L  G
Sbjct  116   SRVRRLREIDLGYNNFSGEIPIWFGLFSKLKMLILDDNAFT-YIPPSISNLSKLETLSAG  174

Query  518   VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL  339
              N L+G+IP+EIGNL  LK L L  N  +GS P  ILN+S LE L+L+ N L G LP+D+
Sbjct  175   YNRLQGNIPKEIGNLQNLKELVLVSNQLTGSIPFSILNISSLETLALTYNQLSGSLPVDI  234

Query  338   GNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFL  159
              + L +++   + SN+ SG IP  LS CS L  L+L +N  SG +P E G L  LE L L
Sbjct  235   CSRLQRIKSISIISNQLSGHIPEGLSNCSELYDLALSYNKLSGTIPPELGKLEMLELLSL  294

Query  158   RSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
               N L G IP  IG L  L  + L NN L G+ 
Sbjct  295   GGNNLEGIIPDTIGNLRKLQKLQLENNHLVGSI  327


 Score =   128 bits (321),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 107/278 (38%), Positives = 150/278 (54%), Gaps = 7/278 (3%)
 Frame = -1

Query  854  VTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKI  675
            V   SR  R+ ++++ +  L G +   L N S L  L LS N    + P EL +L  L++
Sbjct  232  VDICSRLQRIKSISIISNQLSGHIPEGLSNCSELYDLALSYNKLSGTIPPELGKLEMLEL  291

Query  674  LQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLE-GS  498
            L    N+  G IP   G L+ L+ L L NN++ G +P ++FN+S L +L+   N+L  G 
Sbjct  292  LSLGGNNLEGIIPDTIGNLRKLQKLQLENNHLVGSIPRTIFNMSSLWLLNFNTNNLSAGV  351

Query  497  IPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKL  318
            IPREIGNL +L+LL L  N  SGS P ++ N+S L  ++LS N+  G LP  LG     L
Sbjct  352  IPREIGNLQKLELLYLQFNKLSGSLPEELFNISTLRGMALSYNNFSGSLPSALGYWPTTL  411

Query  317  QIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
            Q   +  N   G IP+S+   S L+ L L  N FSG +P   G+L +LE+L L  N LT 
Sbjct  412  QYLHLGENNIGGVIPNSVFNSSNLKELILDDNRFSGAIPNSLGDLRQLERLRLFRNNLTF  471

Query  137  ---AIPREIGALSSLLIVDLSNNKLYGTF---IQNLDT  42
               +I   +    SL  +DLS+N L G     I NL T
Sbjct  472  PQLSIFASLANCRSLREIDLSDNPLNGVLSDSIGNLST  509


 Score =   111 bits (278),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 86/252 (34%), Positives = 122/252 (48%), Gaps = 26/252 (10%)
 Frame = -1

Query  797  LVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L  D+   L  + S+++  N      P  LS    L  L  S+N  SG IP   G 
Sbjct  226  LSGSLPVDICSRLQRIKSISIISNQLSGHIPEGLSNCSELYDLALSYNKLSGTIPPELGK  285

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            L+ L  L LG NN+ G +P ++ NL KL+ L L  N L GSIPR I N+  L LLN + N
Sbjct  286  LEMLELLSLGGNNLEGIIPDTIGNLRKLQKLQLENNHLVGSIPRTIFNMSSLWLLNFNTN  345

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
            + S                        G +P ++GN L KL++  ++ NK SG +P  L 
Sbjct  346  NLSA-----------------------GVIPREIGN-LQKLELLYLQFNKLSGSLPEELF  381

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNL-TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
              S L+ ++L +NNFSG +P   G   T L+ L L  N + G IP  +   S+L  + L 
Sbjct  382  NISTLRGMALSYNNFSGSLPSALGYWPTTLQYLHLGENNIGGVIPNSVFNSSNLKELILD  441

Query  83   NNKLYGTFIQNL  48
            +N+  G    +L
Sbjct  442  DNRFSGAIPNSL  453


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 87/252 (35%), Positives = 130/252 (52%), Gaps = 3/252 (1%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSL-NLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            ++L +  L G L+  +GNLS  + L +L  +      P  +  L  L  L    ND +G+
Sbjct  489  IDLSDNPLNGVLSDSIGNLSTSLELFDLRHSEISGQIPLGIGNLSNLTDLYLLDNDLTGS  548

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            +PS F  L NL+ LYL  N + G LP  L NL  L ++ L  N + G IP  IGN+  L+
Sbjct  549  VPSTFCDLHNLQRLYLHQNRLIGPLPECLCNLPVLGMVSLSYNQISGPIPYCIGNVTSLR  608

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             + L+ N  +   P+ + +L  L  L LS NSL G LP D GN L  +    +  N  SG
Sbjct  609  NIYLNSNRLT-KIPMSLWSLKDLVELDLSNNSLVGSLPPDFGN-LNAITFLDLSRNHISG  666

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
             +PS++     L  LS+ +N   G +P   G +  LE + L +N L+G IP+ + AL  +
Sbjct  667  SVPSTVGDLQKLLYLSVAYNELQGSIPESLGKMLSLESVNLSNNYLSGMIPKSLEALQYV  726

Query  101  LIVDLSNNKLYG  66
               ++S N+L G
Sbjct  727  KHFNVSFNRLEG  738


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 133/277 (48%), Gaps = 29/277 (10%)
 Frame = -1

Query  794  VGELTPD-LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            +G + P+ + N S L  L L  N F  + P  L  LR+L+ L+   N+ +    S F  L
Sbjct  421  IGGVIPNSVFNSSNLKELILDDNRFSGAIPNSLGDLRQLERLRLFRNNLTFPQLSIFASL  480

Query  617  QN---LRFLYLGNNNISGFLPTSLFNLS-KLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
             N   LR + L +N ++G L  S+ NLS  LE+  L  + + G IP  IGNL  L  L L
Sbjct  481  ANCRSLREIDLSDNPLNGVLSDSIGNLSTSLELFDLRHSEISGQIPLGIGNLSNLTDLYL  540

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
             DN  +GS P    +L  L+ L L  N L G LP  L N LP L +  +  N+ SG IP 
Sbjct  541  LDNDLTGSVPSTFCDLHNLQRLYLHQNRLIGPLPECLCN-LPVLGMVSLSYNQISGPIPY  599

Query  269  SLSKCSLLQ-----------------------TLSLPFNNFSGHVPREFGNLTKLEKLFL  159
             +   + L+                        L L  N+  G +P +FGNL  +  L L
Sbjct  600  CIGNVTSLRNIYLNSNRLTKIPMSLWSLKDLVELDLSNNSLVGSLPPDFGNLNAITFLDL  659

Query  158  RSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
              N ++G++P  +G L  LL + ++ N+L G+  ++L
Sbjct  660  SRNHISGSVPSTVGDLQKLLYLSVAYNELQGSIPESL  696


 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 65/111 (59%), Gaps = 0/111 (0%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            L+L N  LVG L PD GNL+ +  L+LS+N+   S P  +  L++L  L  ++N+  G+I
Sbjct  633  LDLSNNSLVGSLPPDFGNLNAITFLDLSRNHISGSVPSTVGDLQKLLYLSVAYNELQGSI  692

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            P   G + +L  + L NN +SG +P SL  L  ++  ++  N LEG IP +
Sbjct  693  PESLGKMLSLESVNLSNNYLSGMIPKSLEALQYVKHFNVSFNRLEGEIPSK  743



>ref|XP_009799274.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR isoform X2 [Nicotiana sylvestris]
Length=1141

 Score =   258 bits (658),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 210/333 (63%), Gaps = 6/333 (2%)
 Frame = -1

Query  1058  MEITRHYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNS  879
             ME +  +    +F  + L+ C+     TNITTD+ ALL+LKS  + +    L  NWS  +
Sbjct  1     MEKSYSFVLSVVFELYFLVACMA----TNITTDQSALLALKSSFALNSSHPLTQNWSSQA  56

Query  878   ITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL  699
              + CNWIG++C S H+RV+ALN+ NM + G + P LGNLSFLVSL++S+NNF   FP++L
Sbjct  57    -SVCNWIGISCGSHHHRVTALNISNMNIHGTIPPQLGNLSFLVSLDVSKNNFDGDFPQDL  115

Query  698   SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG  519
             S++RRL+ +   +N+FSG IP WFGL   L+ L L +N  + ++P S+ NLSKLE L  G
Sbjct  116   SRVRRLREIDLGYNNFSGEIPIWFGLFSKLKMLILDDNAFT-YIPPSISNLSKLETLSAG  174

Query  518   VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL  339
              N L+G+IP+EIGNL  LK L L  N  +GS P  ILN+S LE L+L+ N L G LP+D+
Sbjct  175   YNRLQGNIPKEIGNLQNLKELVLVSNQLTGSIPFSILNISSLETLALTYNQLSGSLPVDI  234

Query  338   GNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFL  159
              + L +++   + SN+ SG IP  LS CS L  L+L +N  SG +P E G L  LE L L
Sbjct  235   CSRLQRIKSISIISNQLSGHIPEGLSNCSELYDLALSYNKLSGTIPPELGKLEMLELLSL  294

Query  158   RSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
               N L G IP  IG L  L  + L NN L G+ 
Sbjct  295   GGNNLEGIIPDTIGNLRKLQKLQLENNHLVGSI  327


 Score =   132 bits (333),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 107/277 (39%), Positives = 150/277 (54%), Gaps = 6/277 (2%)
 Frame = -1

Query  854  VTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKI  675
            V   SR  R+ ++++ +  L G +   L N S L  L LS N    + P EL +L  L++
Sbjct  232  VDICSRLQRIKSISIISNQLSGHIPEGLSNCSELYDLALSYNKLSGTIPPELGKLEMLEL  291

Query  674  LQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSI  495
            L    N+  G IP   G L+ L+ L L NN++ G +P ++FN+S L +L+   N+L G I
Sbjct  292  LSLGGNNLEGIIPDTIGNLRKLQKLQLENNHLVGSIPRTIFNMSSLWLLNFNTNNLSGVI  351

Query  494  PREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQ  315
            PREIGNL +L+LL L  N  SGS P ++ N+S L  ++LS N+  G LP  LG     LQ
Sbjct  352  PREIGNLQKLELLYLQFNKLSGSLPEELFNISTLRGMALSYNNFSGSLPSALGYWPTTLQ  411

Query  314  IFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG-  138
               +  N   G IP+S+   S L+ L L  N FSG +P   G+L +LE+L L  N LT  
Sbjct  412  YLHLGENNIGGVIPNSVFNSSNLKELILDDNRFSGAIPNSLGDLRQLERLRLFRNNLTFP  471

Query  137  --AIPREIGALSSLLIVDLSNNKLYGTF---IQNLDT  42
              +I   +    SL  +DLS+N L G     I NL T
Sbjct  472  QLSIFASLANCRSLREIDLSDNPLNGVLSDSIGNLST  508


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 87/252 (35%), Positives = 130/252 (52%), Gaps = 3/252 (1%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSL-NLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            ++L +  L G L+  +GNLS  + L +L  +      P  +  L  L  L    ND +G+
Sbjct  488  IDLSDNPLNGVLSDSIGNLSTSLELFDLRHSEISGQIPLGIGNLSNLTDLYLLDNDLTGS  547

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            +PS F  L NL+ LYL  N + G LP  L NL  L ++ L  N + G IP  IGN+  L+
Sbjct  548  VPSTFCDLHNLQRLYLHQNRLIGPLPECLCNLPVLGMVSLSYNQISGPIPYCIGNVTSLR  607

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             + L+ N  +   P+ + +L  L  L LS NSL G LP D GN L  +    +  N  SG
Sbjct  608  NIYLNSNRLT-KIPMSLWSLKDLVELDLSNNSLVGSLPPDFGN-LNAITFLDLSRNHISG  665

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
             +PS++     L  LS+ +N   G +P   G +  LE + L +N L+G IP+ + AL  +
Sbjct  666  SVPSTVGDLQKLLYLSVAYNELQGSIPESLGKMLSLESVNLSNNYLSGMIPKSLEALQYV  725

Query  101  LIVDLSNNKLYG  66
               ++S N+L G
Sbjct  726  KHFNVSFNRLEG  737


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 133/277 (48%), Gaps = 29/277 (10%)
 Frame = -1

Query  794  VGELTPD-LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            +G + P+ + N S L  L L  N F  + P  L  LR+L+ L+   N+ +    S F  L
Sbjct  420  IGGVIPNSVFNSSNLKELILDDNRFSGAIPNSLGDLRQLERLRLFRNNLTFPQLSIFASL  479

Query  617  QN---LRFLYLGNNNISGFLPTSLFNLS-KLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
             N   LR + L +N ++G L  S+ NLS  LE+  L  + + G IP  IGNL  L  L L
Sbjct  480  ANCRSLREIDLSDNPLNGVLSDSIGNLSTSLELFDLRHSEISGQIPLGIGNLSNLTDLYL  539

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
             DN  +GS P    +L  L+ L L  N L G LP  L N LP L +  +  N+ SG IP 
Sbjct  540  LDNDLTGSVPSTFCDLHNLQRLYLHQNRLIGPLPECLCN-LPVLGMVSLSYNQISGPIPY  598

Query  269  SLSKCSLLQ-----------------------TLSLPFNNFSGHVPREFGNLTKLEKLFL  159
             +   + L+                        L L  N+  G +P +FGNL  +  L L
Sbjct  599  CIGNVTSLRNIYLNSNRLTKIPMSLWSLKDLVELDLSNNSLVGSLPPDFGNLNAITFLDL  658

Query  158  RSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
              N ++G++P  +G L  LL + ++ N+L G+  ++L
Sbjct  659  SRNHISGSVPSTVGDLQKLLYLSVAYNELQGSIPESL  695


 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 65/111 (59%), Gaps = 0/111 (0%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            L+L N  LVG L PD GNL+ +  L+LS+N+   S P  +  L++L  L  ++N+  G+I
Sbjct  632  LDLSNNSLVGSLPPDFGNLNAITFLDLSRNHISGSVPSTVGDLQKLLYLSVAYNELQGSI  691

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            P   G + +L  + L NN +SG +P SL  L  ++  ++  N LEG IP +
Sbjct  692  PESLGKMLSLESVNLSNNYLSGMIPKSLEALQYVKHFNVSFNRLEGEIPSK  742



>ref|XP_010321913.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Solanum lycopersicum]
Length=807

 Score =   254 bits (650),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 148/304 (49%), Positives = 204/304 (67%), Gaps = 4/304 (1%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            NI+TD+ ALL+LKS IS D   ILA NWS +S+  C+WIG+TC+SRH+RV+AL++ +M L
Sbjct  25   NISTDEAALLALKSHISND---ILATNWS-SSVPVCSWIGITCSSRHHRVTALDISSMQL  80

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             G + P LGNLSFL SL++S N FH   P+EL++L+RLK +  + N+F+G IPS+  LL 
Sbjct  81   HGTIPPHLGNLSFLSSLDISNNTFHGDLPQELARLQRLKSINVTSNNFTGAIPSFLSLLP  140

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            NLRF++L +N  SG +P+SL N++KL+ L+L  N LEG IPREIG+L  L +L+L  N  
Sbjct  141  NLRFVHLSSNQFSGKIPSSLSNITKLQRLYLDRNFLEGEIPREIGDLRYLTILDLQINQL  200

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            SGS P  I N++ +  ++L+ N+L G LP  + +HLP L+   +  N   G IP +L KC
Sbjct  201  SGSIPPSIFNITTMHVIALTGNNLTGNLPKTICDHLPDLEGLYLSKNSLDGVIPPNLEKC  260

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              LQ L L  N F G +PRE  NLT L  L+L    L G IP E+G L  L  +DL+ N+
Sbjct  261  RKLQKLQLGENKFIGTLPRELANLTALTYLYLSELHLEGEIPMELGNLQKLQELDLALNE  320

Query  74   LYGT  63
            L G+
Sbjct  321  LTGS  324


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 92/190 (48%), Gaps = 24/190 (13%)
 Frame = -1

Query  755  LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNIS  576
            L  L LS+N+     P  L + R+L+ LQ   N F G +P     L  L +LYL   ++ 
Sbjct  239  LEGLYLSKNSLDGVIPPNLEKCRKLQKLQLGENKFIGTLPRELANLTALTYLYLSELHLE  298

Query  575  GFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsk  396
            G +P  L NL KL+ L L +N L GS+P  I N+  L+ ++  +N+ SG+          
Sbjct  299  GEIPMELGNLQKLQELDLALNELTGSVPHSIFNMSALQYIDFGENNLSGT----------  348

Query  395  lenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNF  216
                          LP DLG  +P L+IF    N  SG I  S+S  S L+   L  N+F
Sbjct  349  --------------LPSDLGRGMPNLEIFYCGGNDLSGFISDSISNSSKLREFDLSQNSF  394

Query  215  SGHVPREFGN  186
            +G +P+  GN
Sbjct  395  TGSIPKSLGN  404


 Score = 80.9 bits (198),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 105/240 (44%), Gaps = 30/240 (13%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G + P+L     L  L L +N F  + PREL+ L  L  L  S     G IP   G L
Sbjct  249  LDGVIPPNLEKCRKLQKLQLGENKFIGTLPRELANLTALTYLYLSELHLEGEIPMELGNL  308

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG-NLFQLKLLNLSDN  441
            Q L+ L L  N ++G +P S+FN+S L+ +  G N+L G++P ++G  +  L++     N
Sbjct  309  QKLQELDLALNELTGSVPHSIFNMSALQYIDFGENNLSGTLPSDLGRGMPNLEIFYCGGN  368

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              SG     I N S                         KL+ F +  N F+G IP SL 
Sbjct  369  DLSGFISDSISNSS-------------------------KLREFDLSQNSFTGSIPKSLG  403

Query  260  KCSLLQTLSLPFNNFSGHVPREF----GNLTKLEKLFLRSNQLTGAIPREIGALSSLLIV  93
                L+ L L +NNF       F     N   L  L L  N L G +P  +G  S+ L +
Sbjct  404  NLEYLELLDLLWNNFVSDSTLSFLASLTNCRNLRALTLAGNPLDGVLPASVGNFSNSLQI  463



>emb|CDP18219.1| unnamed protein product [Coffea canephora]
Length=1107

 Score =   256 bits (655),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 190/304 (63%), Gaps = 25/304 (8%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFN  804
            A  NITTD+ +LL+L++ IS DP  ILA NWSV+S + C+WIGVTC   H RV+AL++ N
Sbjct  49   ASNNITTDQSSLLALRAHISVDPLLILAKNWSVSS-SVCDWIGVTCGFHHRRVTALDISN  107

Query  803  MGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
            MGL G L   LGNLSFL+SLN+S NNFH   P EL+ L RLK+L  S ND +G IP W  
Sbjct  108  MGLTGILPSQLGNLSFLISLNMSMNNFHGELPNELAWLHRLKVLDLSLNDLTGEIPEWSS  167

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
                L++L L NN+ +G +P S+ N+S L  L+L  NSLEG+IP EI N+  L++++L  
Sbjct  168  SFPKLQYLSLRNNSFTGLIPPSISNMSDLRSLYLSNNSLEGNIPGEIFNISSLEMISLGG  227

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N  SGS                        LP  +  +LP+L++  +  N+ SG IPSSL
Sbjct  228  NRLSGS------------------------LPNYMCGNLPRLRVIRLSKNELSGPIPSSL  263

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
             +CS LQ +S  FN FSG +P+E G L KLE ++   N+L G IP+E+G  + L  +DL+
Sbjct  264  VQCSELQAVSFSFNKFSGTIPKEIGKLKKLEVIYFSMNKLVGEIPKELGTSTMLKFLDLA  323

Query  83   NNKL  72
            +N L
Sbjct  324  DNHL  327


 Score =   119 bits (299),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 88/233 (38%), Positives = 129/233 (55%), Gaps = 4/233 (2%)
 Frame = -1

Query  827  VSALNLFNMG---LVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSF  660
            +S+L + ++G   L G L   + GNL  L  + LS+N      P  L Q   L+ +  SF
Sbjct  217  ISSLEMISLGGNRLSGSLPNYMCGNLPRLRVIRLSKNELSGPIPSSLVQCSELQAVSFSF  276

Query  659  NDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG  480
            N FSG IP   G L+ L  +Y   N + G +P  L   + L+ L L  N L   IPREIG
Sbjct  277  NKFSGTIPKEIGKLKKLEVIYFSMNKLVGEIPKELGTSTMLKFLDLADNHLTAVIPREIG  336

Query  479  NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMR  300
            NL+ L+ L+L  N+ +GS P++I NLS++  +SL+ N L G LP  +   LP L+   + 
Sbjct  337  NLYNLETLSLGWNNLTGSIPVEIFNLSRVTLMSLAGNQLSGNLPSTVFYGLPNLEQLYLN  396

Query  299  SNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
            SN   G++P S++  S L  +++  N F+GH+P   GNL  L+ L L SN+L 
Sbjct  397  SNYIVGDLPESITNSSKLLVVTVSDNFFTGHIPISLGNLRLLQVLDLGSNKLV  449


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 99/318 (31%), Positives = 147/318 (46%), Gaps = 59/318 (19%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFN----DFSGNIPSW  630
            +VG+L   + N S L+ + +S N F    P  L  LR L++L    N    DFS    S+
Sbjct  400  IVGDLPESITNSSKLLVVTVSDNFFTGHIPISLGNLRLLQVLDLGSNKLVTDFSHPETSF  459

Query  629  FGLL---QNLRFLYLGNNNISGFLPTSLFNLSK-LEVLHLGVNSLEGSIPREIGNLFQLK  462
               L   +NLR L + +N ++G LP S+ NLS  LE L+    +L+G +P  IGNL  L 
Sbjct  460  ISSLANSKNLRTLAVNDNPLNGILPESVGNLSSSLERLYAYRCNLQGKVPDGIGNLSSLF  519

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
            +L+L  N  +G  P+ I  L  L+ + L +N    +L LD      KL   ++  N+ SG
Sbjct  520  ILSLYGNQLTGPLPITIQRLQNLQAIVLYMNK-LNQLSLDYFCTFTKLGAIILGQNQISG  578

Query  281  EIPSSLSKCSLLQTL---------------------------------SLPF--------  225
             +P  L   + L+ L                                 SLP         
Sbjct  579  AVPDCLENVTSLRYLYLNSNRLNSSLPRTLWNLTDLLLLDLSSNSLTGSLPLEMQNLKAA  638

Query  224  -------NNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
                   NN SG +P   G++  L+ L L  NQL G+IP+ IG++ SL  VDLS+N   G
Sbjct  639  TSLILSLNNLSGGIPSTIGDMQSLDHLSLAHNQLEGSIPKSIGSILSLETVDLSHNFFSG  698

Query  65   TFIQNLDTP*LK*LSYYN  12
            +  ++L+   LK L+ +N
Sbjct  699  SIPKSLEN--LKYLTSFN  714


 Score = 79.7 bits (195),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 116/227 (51%), Gaps = 1/227 (0%)
 Frame = -1

Query  809  FNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSW  630
            +   L G++   +GNLS L  L+L  N      P  + +L+ L+ +    N  +     +
Sbjct  500  YRCNLQGKVPDGIGNLSSLFILSLYGNQLTGPLPITIQRLQNLQAIVLYMNKLNQLSLDY  559

Query  629  FGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
            F     L  + LG N ISG +P  L N++ L  L+L  N L  S+PR + NL  L LL+L
Sbjct  560  FCTFTKLGAIILGQNQISGAVPDCLENVTSLRYLYLNSNRLNSSLPRTLWNLTDLLLLDL  619

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
            S N  +GS PL++ NL    +L LS+N+L G +P  +G+ +  L    +  N+  G IP 
Sbjct  620  SSNSLTGSLPLEMQNLKAATSLILSLNNLSGGIPSTIGD-MQSLDHLSLAHNQLEGSIPK  678

Query  269  SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
            S+     L+T+ L  N FSG +P+   NL  L    +  N L+G IP
Sbjct  679  SIGSILSLETVDLSHNFFSGSIPKSLENLKYLTSFNVSFNNLSGEIP  725


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 83/163 (51%), Gaps = 28/163 (17%)
 Frame = -1

Query  548  LSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvn  369
            ++ L++ ++G   L G +P ++GNL  L  LN+S N+F                      
Sbjct  100  VTALDISNMG---LTGILPSQLGNLSFLISLNMSMNNF----------------------  134

Query  368  sLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG  189
               GELP +L   L +L++  +  N  +GEIP   S    LQ LSL  N+F+G +P    
Sbjct  135  --HGELPNELA-WLHRLKVLDLSLNDLTGEIPEWSSSFPKLQYLSLRNNSFTGLIPPSIS  191

Query  188  NLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            N++ L  L+L +N L G IP EI  +SSL ++ L  N+L G+ 
Sbjct  192  NMSDLRSLYLSNNSLEGNIPGEIFNISSLEMISLGGNRLSGSL  234



>ref|XP_007021924.1| Serine-threonine protein kinase [Theobroma cacao]
 gb|EOY13449.1| Serine-threonine protein kinase [Theobroma cacao]
Length=396

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 147/303 (49%), Positives = 184/303 (61%), Gaps = 2/303 (1%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            NITTD+ ALL+LK+ ++ DP +ILA NWS  + + CNWIGVTC S H RV  LNL +MGL
Sbjct  30   NITTDQLALLALKAHVTHDPQNILATNWSTTT-SVCNWIGVTCRSDHQRVVTLNLSDMGL  88

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            +G + P LGNLSFL  LN+  NNF  S P EL+ L  L+ +    N FSG IPSWF    
Sbjct  89   IGTIPPHLGNLSFLTKLNIPNNNFQGSLPMELANLSSLQYINFDNNSFSGEIPSWFDSFT  148

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             L+ L L  NN  G +P+SL +LS L+ L L  N L+G IP  IGNL  LK L L  N  
Sbjct  149  QLQSLSLYGNNFFGVIPSSLGSLSNLKELFLYDNDLKGHIPVAIGNLSNLKYLRLGQNQL  208

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            SG  P  +    +LE L L   +L G +P ++ N L +L    +  N  +G IP+SL KC
Sbjct  209  SGRIPTSLFKCKELEVLFLYDTALEGSVPEEIEN-LTRLSDLALNGNDLTGRIPTSLFKC  267

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              LQ L L  N   G VP E GNLT+L  L L  N LTG IP  IG+L+S++ +DLSNN 
Sbjct  268  KELQVLILSSNALEGSVPEEIGNLTRLSYLSLYRNNLTGEIPSAIGSLTSIIRLDLSNNS  327

Query  74   LYG  66
            L G
Sbjct  328  LTG  330


 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 92/201 (46%), Gaps = 30/201 (15%)
 Frame = -1

Query  632  WFGLL-----QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            W G+      Q +  L L +  + G +P  L NLS L  L++  N+ +GS+P E+ NL  
Sbjct  66   WIGVTCRSDHQRVVTLNLSDMGLIGTIPPHLGNLSFLTKLNIPNNNFQGSLPMELANLSS  125

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
            L+ +N  +N FSG  P                            +   +LQ   +  N F
Sbjct  126  LQYINFDNNSFSGEIP-------------------------SWFDSFTQLQSLSLYGNNF  160

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALS  108
             G IPSSL   S L+ L L  N+  GH+P   GNL+ L+ L L  NQL+G IP  +    
Sbjct  161  FGVIPSSLGSLSNLKELFLYDNDLKGHIPVAIGNLSNLKYLRLGQNQLSGRIPTSLFKCK  220

Query  107  SLLIVDLSNNKLYGTFIQNLD  45
             L ++ L +  L G+  + ++
Sbjct  221  ELEVLFLYDTALEGSVPEEIE  241


 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 73/134 (54%), Gaps = 0/134 (0%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
             +  L L++  L G +  ++ NL+ L  L L+ N+     P  L + + L++L  S N  
Sbjct  221  ELEVLFLYDTALEGSVPEEIENLTRLSDLALNGNDLTGRIPTSLFKCKELQVLILSSNAL  280

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
             G++P   G L  L +L L  NN++G +P+++ +L+ +  L L  NSL G IP  +GNL 
Sbjct  281  EGSVPEEIGNLTRLSYLSLYRNNLTGEIPSAIGSLTSIIRLDLSNNSLTGEIPSAVGNLS  340

Query  470  QLKLLNLSDNHFSG  429
             ++ ++   N+ +G
Sbjct  341  SIQHIDFRINNLAG  354


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 91/225 (40%), Gaps = 73/225 (32%)
 Frame = -1

Query  812  LFNMGLVGELTPDLGNLSFLVSLNLSQNNF------------------------HNSFPR  705
            L++  L G +   +GNLS L  L L QN                            S P 
Sbjct  179  LYDNDLKGHIPVAIGNLSNLKYLRLGQNQLSGRIPTSLFKCKELEVLFLYDTALEGSVPE  238

Query  704  ELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLH  525
            E+  L RL  L  + ND +G I                        PTSLF   +L+VL 
Sbjct  239  EIENLTRLSDLALNGNDLTGRI------------------------PTSLFKCKELQVLI  274

Query  524  LGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPL  345
            L  N+LEGS+P EIGNL +L  L+L  N+ +G  P  I +L+ +             + L
Sbjct  275  LSSNALEGSVPEEIGNLTRLSYLSLYRNNLTGEIPSAIGSLTSI-------------IRL  321

Query  344  DLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSG  210
            DL N            N  +GEIPS++   S +Q +    NN +G
Sbjct  322  DLSN------------NSLTGEIPSAVGNLSSIQHIDFRINNLAG  354



>ref|XP_007214168.1| hypothetical protein PRUPE_ppa018998mg, partial [Prunus persica]
 gb|EMJ15367.1| hypothetical protein PRUPE_ppa018998mg, partial [Prunus persica]
Length=1018

 Score =   255 bits (652),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 160/355 (45%), Positives = 214/355 (60%), Gaps = 30/355 (8%)
 Frame = -1

Query  1046  RHYFCLSIFFFHSLML-----CLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVN  882
             R  F LSI F   + L      +   A +NITTD+ ALL+LKS I+ DPH+I + NWS  
Sbjct  1     RSCFLLSITFLLVVHLQYSSIGIVGAAQSNITTDQSALLALKSHITSDPHNI-SVNWSTT  59

Query  881   SITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRE  702
             + + CNW+GVTC +RH RVS LNL  MGL G + P LGNLSFLV L+L  N+FH + P+E
Sbjct  60    T-SVCNWVGVTCGARHLRVSVLNLSYMGLSGTIPPPLGNLSFLVELDLRNNSFHGTLPKE  118

Query  701   LSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHL  522
             LS LRRLK++    N+F G+IPSWFG    L+   L  N  SG +P ++FNLS L+V+ L
Sbjct  119   LSYLRRLKLISFISNNFMGSIPSWFGSFPKLQTFNLLGNQFSGSIPMTIFNLSTLQVIDL  178

Query  521   GVNSLEGSIPREIGNLFQLKLLNLSDNHF-----------------------SGSFPLDI  411
               N L G IPREIGNL  LK + L  N+F                        G  P+ I
Sbjct  179   SFNRLSGEIPREIGNLTMLKEIKLDSNNFNEFPNEIGSLDKLEMLSVKLNALQGHVPVAI  238

Query  410   lnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSL  231
              N++ L  L+L  N+L G LP ++ +HLP +Q+  +  NKF G +PS L +C+ L  L++
Sbjct  239   FNMTSLITLNLFGNNLSGGLPDNICHHLPSIQVVNLNRNKFDGPLPSKLWQCTKLLRLAM  298

Query  230   PFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
               NNFSG +P++ GNLT+L ++ L  N LTG IP EIG L +L I  + +N L G
Sbjct  299   VENNFSGSIPKKIGNLTQLMQIGLDKNNLTGTIPDEIGDLQNLEIFTVGDNNLNG  353


 Score =   117 bits (293),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 91/266 (34%), Positives = 138/266 (52%), Gaps = 8/266 (3%)
 Frame = -1

Query  833  NRVSALNLFNM------GLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQ-LRRLKI  675
            N + +L+   M       L G +   + N++ L++LNL  NN     P  +   L  +++
Sbjct  212  NEIGSLDKLEMLSVKLNALQGHVPVAIFNMTSLITLNLFGNNLSGGLPDNICHHLPSIQV  271

Query  674  LQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSI  495
            +  + N F G +PS       L  L +  NN SG +P  + NL++L  + L  N+L G+I
Sbjct  272  VNLNRNKFDGPLPSKLWQCTKLLRLAMVENNFSGSIPKKIGNLTQLMQIGLDKNNLTGTI  331

Query  494  PREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQ  315
            P EIG+L  L++  + DN+ +G  P  I N+S L  + LS N L G LP ++G  LP LQ
Sbjct  332  PDEIGDLQNLEIFTVGDNNLNGLIPSSIFNISTLRVMQLSFNQLSGSLPANIGFGLPNLQ  391

Query  314  IFVMRSNK-FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
            I  +  N    G IP  +   S L TLSL  N  SG +P   G L  L+ L+LR N L  
Sbjct  392  ILYIADNSGIRGNIPICIGNISSLVTLSLGVNQLSGSIPTSLGRLRNLQGLYLRDNMLQA  451

Query  137  AIPREIGALSSLLIVDLSNNKLYGTF  60
             IP ++  L +L  ++L++N L G+ 
Sbjct  452  YIPYQLCQLDNLANLNLASNHLSGSI  477


 Score =   113 bits (283),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 98/281 (35%), Positives = 138/281 (49%), Gaps = 28/281 (10%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +  +NL      G L   L   + L+ L + +NNF  S P+++  L +L  +    N+ +
Sbjct  269  IQVVNLNRNKFDGPLPSKLWQCTKLLRLAMVENNFSGSIPKKIGNLTQLMQIGLDKNNLT  328

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG-NLF  471
            G IP   G LQNL    +G+NN++G +P+S+FN+S L V+ L  N L GS+P  IG  L 
Sbjct  329  GTIPDEIGDLQNLEIFTVGDNNLNGLIPSSIFNISTLRVMQLSFNQLSGSLPANIGFGLP  388

Query  470  QLKLLNLSDNH-FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSN  294
             L++L ++DN    G+ P+ I N+S L  LSL VN L G +P  LG  L  LQ   +R N
Sbjct  389  NLQILYIADNSGIRGNIPICIGNISSLVTLSLGVNQLSGSIPTSLG-RLRNLQGLYLRDN  447

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT----------------------  180
                 IP  L +   L  L+L  N+ SG +P   GNL                       
Sbjct  448  MLQAYIPYQLCQLDNLANLNLASNHLSGSIPSCLGNLATSLRSLSLQSNSLSSTVPSTLW  507

Query  179  KLEKLF---LRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            +L  +    L SN L G +   IG L   + VDLSNN L G
Sbjct  508  RLAHILYVNLSSNSLIGPLSEGIGNLKVAIEVDLSNNHLSG  548


 Score = 83.2 bits (204),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 97/294 (33%), Positives = 136/294 (46%), Gaps = 50/294 (17%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL-  621
            L G +  ++G+L  L    +  NN +   P  +  +  L+++Q SFN  SG++P+  G  
Sbjct  327  LTGTIPDEIGDLQNLEIFTVGDNNLNGLIPSSIFNISTLRVMQLSFNQLSGSLPANIGFG  386

Query  620  LQNLRFLYLGNNN-ISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
            L NL+ LY+ +N+ I G +P  + N+S L  L LGVN L GSIP  +G L  L+ L L D
Sbjct  387  LPNLQILYIADNSGIRGNIPICIGNISSLVTLSLGVNQLSGSIPTSLGRLRNLQGLYLRD  446

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGN-----------------HLP---  324
            N      P  +  L  L NL+L+ N L G +P  LGN                  +P   
Sbjct  447  NMLQAYIPYQLCQLDNLANLNLASNHLSGSIPSCLGNLATSLRSLSLQSNSLSSTVPSTL  506

Query  323  ---------------------------KLQIFV-MRSNKFSGEIPSSLSKCSLLQTLSLP  228
                                       K+ I V + +N  SG IPS++     L  LSL 
Sbjct  507  WRLAHILYVNLSSNSLIGPLSEGIGNLKVAIEVDLSNNHLSGIIPSTIGGLQDLVQLSLA  566

Query  227  FNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             NN  G +P  F +L  L  L L  N L+G IPR + AL  L  +DLS N+L G
Sbjct  567  NNNLDGPIPSTFHDLLSLNLLNLSRNNLSGVIPRSLEALLLLKYLDLSFNRLQG  620



>ref|XP_004231674.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Solanum lycopersicum]
Length=1088

 Score =   255 bits (652),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 204/309 (66%), Gaps = 6/309 (2%)
 Frame = -1

Query  971  ITTDKHALLSLKSKISFDPH----SILADNWSVN-SITPCNWIGVTCNSRHNRVSALNLF  807
            I TD+ ALL+LKS +S DP+    ++L  NWS +   + C WIG+TCN RH RV+AL++ 
Sbjct  26   IGTDEIALLALKSHLSSDPNNNNNAVLQTNWSCSIPSSVCTWIGITCNGRH-RVTALDIS  84

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
            +M L G + P LGNLSFLVSL++S N FH    +EL+ LRRLK++  + N+FSG IPS+ 
Sbjct  85   SMQLHGTIPPHLGNLSFLVSLDISNNTFHGHLSQELTHLRRLKLIDVTRNNFSGAIPSFL  144

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
              L NL+FLYL NN  SG +P+SL NL+ L+ L +  N L+G IP EIGNL  L  L+L 
Sbjct  145  SSLPNLQFLYLSNNQYSGEIPSSLSNLTNLQELRIQRNFLQGKIPPEIGNLRYLTFLDLQ  204

Query  446  DNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSS  267
             N  +GS P  I N++ L  L++  N L G+LP+D+ ++LP LQ+ ++ SN   G IP +
Sbjct  205  GNRLTGSIPPSIFNMTSLTRLAIIHNRLVGKLPVDICDNLPNLQVLLLSSNNLDGRIPPN  264

Query  266  LSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDL  87
            L KCS LQ L+L  N F+G +PRE GNLT L  L L  N L G +P EIG L +L ++ L
Sbjct  265  LQKCSNLQLLTLSGNEFTGPIPRELGNLTMLTILHLGENHLEGELPAEIGNLHNLQVLGL  324

Query  86   SNNKLYGTF  60
             NNKL G+ 
Sbjct  325  RNNKLNGSI  333


 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 96/284 (34%), Positives = 131/284 (46%), Gaps = 35/284 (12%)
 Frame = -1

Query  797  LVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            LVG+L  D+  NL  L  L LS NN     P  L +   L++L  S N+F+G IP   G 
Sbjct  232  LVGKLPVDICDNLPNLQVLLLSSNNLDGRIPPNLQKCSNLQLLTLSGNEFTGPIPRELGN  291

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            L  L  L+LG N++ G LP  + NL  L+VL L  N L GSIP EI N+  L++L +  N
Sbjct  292  LTMLTILHLGENHLEGELPAEIGNLHNLQVLGLRNNKLNGSIPAEIFNISALQILTMYGN  351

Query  440  HFSGSFPLDIlnlsklenlslsvnsLF-GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
               GS PLD+   +          +   G +   + N   KL +  +  NKF+G IP SL
Sbjct  352  QLCGSLPLDLGVGTPNLEEVYLGLNELSGRIAPTISNS-SKLTLLGLTDNKFTGPIPDSL  410

Query  263  SKCSLLQTLSLPFNNF-------------------------------SGHVPREFGNLTK  177
                 LQ L L  NNF                               +G +P   GN + 
Sbjct  411  GSLEFLQVLFLGGNNFMNEPSSSELTFVSSLTNCRYLREVVIEDNSLNGFLPSSIGNFSD  470

Query  176  LEKLFL-RSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
              ++F+ R  +L G IP EIG LS L ++ LS+N   G+    L
Sbjct  471  SFRMFVARRTKLKGTIPEEIGNLSGLGVLALSHNDFTGSIPDKL  514


 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/302 (30%), Positives = 137/302 (45%), Gaps = 56/302 (19%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G + P+L   S L  L LS N F    PREL  L  L IL    N   G +P+  G L
Sbjct  257  LDGRIPPNLQKCSNLQLLTLSGNEFTGPIPRELGNLTMLTILHLGENHLEGELPAEIGNL  316

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVL-------------------------HLGVN  513
             NL+ L L NN ++G +P  +FN+S L++L                         +LG+N
Sbjct  317  HNLQVLGLRNNKLNGSIPAEIFNISALQILTMYGNQLCGSLPLDLGVGTPNLEEVYLGLN  376

Query  512  SLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGE-------  354
             L G I   I N  +L LL L+DN F+G  P  + +L  L+ L L  N+   E       
Sbjct  377  ELSGRIAPTISNSSKLTLLGLTDNKFTGPIPDSLGSLEFLQVLFLGGNNFMNEPSSSELT  436

Query  353  ------------------------LPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLL  246
                                    LP  +GN     ++FV R  K  G IP  +   S L
Sbjct  437  FVSSLTNCRYLREVVIEDNSLNGFLPSSIGNFSDSFRMFVARRTKLKGTIPEEIGNLSGL  496

Query  245  QTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
              L+L  N+F+G +P +  ++  L++ +L +N L+G IP +I +L +L  + L+ N++ G
Sbjct  497  GVLALSHNDFTGSIPDKLRSMKNLQEFYLENNSLSGTIPDDICSLRNLGALKLTGNRISG  556

Query  65   TF  60
            + 
Sbjct  557  SI  558


 Score =   114 bits (285),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 115/244 (47%), Gaps = 25/244 (10%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +  ++GNLS L  L LS N+F  S P +L  ++ L+      N  SG IP     L
Sbjct  482  LKGTIPEEIGNLSGLGVLALSHNDFTGSIPDKLRSMKNLQEFYLENNSLSGTIPDDICSL  541

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            +NL  L L  N ISG +P  L N+S L  LHL  N L  ++P  + +L  L  LN S N 
Sbjct  542  RNLGALKLTGNRISGSIPACLGNVSTLRYLHLAYNRLTSTLPETLWSLQDLLELNASANL  601

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             SGS P ++                        GN L    +  +  N FSG IPS++  
Sbjct  602  LSGSIPPEV------------------------GN-LKAASVIDLSRNDFSGNIPSTIGG  636

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
               L +LS+  N   G +P  FG +  LE L    N LT  IP+ + ALS L   ++S N
Sbjct  637  LQKLISLSMAHNKLEGPIPSSFGKMVGLEFLDFSYNNLTSEIPKSLEALSHLNYFNISFN  696

Query  77   KLYG  66
            KL G
Sbjct  697  KLRG  700


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L   L   L +L  L+ LN S N    S P E+  L+   ++  S NDFSGNIPS  G L
Sbjct  578  LTSTLPETLWSLQDLLELNASANLLSGSIPPEVGNLKAASVIDLSRNDFSGNIPSTIGGL  637

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            Q L  L + +N + G +P+S   +  LE L    N+L   IP+ +  L  L   N+S N 
Sbjct  638  QKLISLSMAHNKLEGPIPSSFGKMVGLEFLDFSYNNLTSEIPKSLEALSHLNYFNISFNK  697

Query  437  FSGSFP  420
              G  P
Sbjct  698  LRGEIP  703



>ref|XP_009375059.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Pyrus x bretschneideri]
Length=1132

 Score =   255 bits (652),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 151/336 (45%), Positives = 200/336 (60%), Gaps = 24/336 (7%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLF  807
            AHTN +TD+ ALL+LK+ I+ DP +IL  NWS  S +  CNW+GVTC +RH+RV+ALNL 
Sbjct  38   AHTNFSTDQSALLALKAHITSDPQNILTANWSSASNSDICNWVGVTCGARHHRVTALNLS  97

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
            +MGL G + P LGNLSFL+ L+L  N F+   P+ELS+LRRLK +   +N+F+G IPSWF
Sbjct  98   SMGLAGVIPPHLGNLSFLIKLHLKNNFFNGPLPQELSRLRRLKAINLQYNNFTGTIPSWF  157

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
            G    L+   L  N  SGF+P ++FNLS LE + L  N L GSIPREIGNL  +K++ L 
Sbjct  158  GSFPKLQTFILWGNGFSGFIPAAIFNLSALEKIDLSNNQLSGSIPREIGNLTMVKVIYLD  217

Query  446  DNHFS-----------------------GSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
            DN F                        GS  + +LN+S L   +L  N++ G LP ++ 
Sbjct  218  DNKFEELPNEIGSLGQLEVLFVQDNALKGSAFVPVLNISSLTTFTLYGNNMSGSLPDNMC  277

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
             HL  ++   +  N+  G IPS L +C  L+ +SL  NNF G +P+  GNLT L K+ L 
Sbjct  278  EHLSSIRRLYLDQNQLDGMIPSKLWQCKELREISLASNNFRGSIPKSLGNLTYLSKIILS  337

Query  155  SNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             N L G IP EIG L  L I+ L  N L G     L
Sbjct  338  DNNLEGTIPDEIGDLPQLEILTLHTNNLSGVIPSKL  373


 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 85/237 (36%), Positives = 124/237 (52%), Gaps = 3/237 (1%)
 Frame = -1

Query  770  GNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            GNLS  L  ++L  +N   + P ++  L  +  L    N  SG IPS    L+NL+ LYL
Sbjct  503  GNLSTSLQYVDLRFSNIKGNIPVDIGNLSSMIELNLGDNQLSGAIPSSIQRLKNLQGLYL  562

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG-NLFQLKLLNLSDNHFSGSFPL  417
             +N + G +P  L  L+ L  L  G N L GSIP  +G +   L+ L+L  N  +   P 
Sbjct  563  NDNQLQGHIPYELCQLNNLADLRFGANRLSGSIPSCLGTSTVALRRLSLVSNLLTSKIPP  622

Query  416  DIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL  237
             +  L+++ +L+L+ NSL G L  D+G  L  +    + +N FSG IP S+     + + 
Sbjct  623  SLWELNRILHLNLASNSLDGPLSEDIG-KLRDVVDMDLSNNHFSGNIPGSIGGLQNMISF  681

Query  236  SLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            SL  N+  G +P  F  L  LE L L  N L+G IP+ + AL  L  ++LS NKL G
Sbjct  682  SLANNSLEGPIPSSFKTLLSLEFLDLSKNNLSGVIPKSLEALLYLKHLNLSFNKLQG  738


 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 73/246 (30%), Positives = 108/246 (44%), Gaps = 50/246 (20%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +  D+GNLS ++ LNL  N    + P  + +L+ L+ L  + N   G+IP     L N
Sbjct  521  GNIPVDIGNLSSMIELNLGDNQLSGAIPSSIQRLKNLQGLYLNDNQLQGHIPYELCQLNN  580

Query  611  LRFLYLGNNNISGFLPT-------------------------SLFNLSKLEVLHLGVNSL  507
            L  L  G N +SG +P+                         SL+ L+++  L+L  NSL
Sbjct  581  LADLRFGANRLSGSIPSCLGTSTVALRRLSLVSNLLTSKIPPSLWELNRILHLNLASNSL  640

Query  506  EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
            +G +  +IG L  +  ++LS+NHFSG+ P  I                           L
Sbjct  641  DGPLSEDIGKLRDVVDMDLSNNHFSGNIPGSI-------------------------GGL  675

Query  326  PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ  147
              +  F + +N   G IPSS      L+ L L  NN SG +P+    L  L+ L L  N+
Sbjct  676  QNMISFSLANNSLEGPIPSSFKTLLSLEFLDLSKNNLSGVIPKSLEALLYLKHLNLSFNK  735

Query  146  LTGAIP  129
            L G IP
Sbjct  736  LQGEIP  741


 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 78/270 (29%), Positives = 122/270 (45%), Gaps = 37/270 (14%)
 Frame = -1

Query  764  LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNN  585
            LS +  L L QN      P +L Q + L+ +  + N+F G+IP   G L  L  + L +N
Sbjct  280  LSSIRRLYLDQNQLDGMIPSKLWQCKELREISLASNNFRGSIPKSLGNLTYLSKIILSDN  339

Query  584  NISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIln  405
            N+ G +P  + +L +LE+L L  N+L G IP ++ N   ++ + LS N  SG  P +I  
Sbjct  340  NLEGTIPDEIGDLPQLEILTLHTNNLSGVIPSKLFNNSMVREIGLSINQLSGGLPANIGL  399

Query  404  lsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSL--------  249
                        +     PL   ++  KL+   M  N F+G +P +L  CSL        
Sbjct  400  NVPNLEFLGVAQNNLVAGPLPNLSNASKLKELDMSINSFTGFLPITL--CSLKNLEFLIL  457

Query  248  --------------------------LQTLSLPFNNFSGHVPREFGNL-TKLEKLFLRSN  150
                                      L  L L +N  +  +P   GNL T L+ + LR +
Sbjct  458  HSNNLTIDASAPQVGSTLSCLFNLRNLTRLYLSYNPLNTKIPAPRGNLSTSLQYVDLRFS  517

Query  149  QLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             + G IP +IG LSS++ ++L +N+L G  
Sbjct  518  NIKGNIPVDIGNLSSMIELNLGDNQLSGAI  547


 Score = 89.0 bits (219),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 86/309 (28%), Positives = 122/309 (39%), Gaps = 57/309 (18%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +   L     L  ++L+ NNF  S P+ L  L  L  +  S N+  G IP   G L
Sbjct  293  LDGMIPSKLWQCKELREISLASNNFRGSIPKSLGNLTYLSKIILSDNNLEGTIPDEIGDL  352

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG--------------  480
              L  L L  NN+SG +P+ LFN S +  + L +N L G +P  IG              
Sbjct  353  PQLEILTLHTNNLSGVIPSKLFNNSMVREIGLSINQLSGGLPANIGLNVPNLEFLGVAQN  412

Query  479  -----------NLFQLKLLNLSDNHFSGSFP--------LDIlnlsklenlslsvnsLFG  357
                       N  +LK L++S N F+G  P        L+ L L        +     G
Sbjct  413  NLVAGPLPNLSNASKLKELDMSINSFTGFLPITLCSLKNLEFLILHSNNLTIDASAPQVG  472

Query  356  ------------------------ELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSL  249
                                    ++P   GN    LQ   +R +   G IP  +   S 
Sbjct  473  STLSCLFNLRNLTRLYLSYNPLNTKIPAPRGNLSTSLQYVDLRFSNIKGNIPVDIGNLSS  532

Query  248  LQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLY  69
            +  L+L  N  SG +P     L  L+ L+L  NQL G IP E+  L++L  +    N+L 
Sbjct  533  MIELNLGDNQLSGAIPSSIQRLKNLQGLYLNDNQLQGHIPYELCQLNNLADLRFGANRLS  592

Query  68   GTFIQNLDT  42
            G+    L T
Sbjct  593  GSIPSCLGT  601


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 117/253 (46%), Gaps = 3/253 (1%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLR-RLKILQCSFNDFSGNIPSWFGLL  618
            VG     L NL  L  L LS N  +   P     L   L+ +   F++  GNIP   G L
Sbjct  471  VGSTLSCLFNLRNLTRLYLSYNPLNTKIPAPRGNLSTSLQYVDLRFSNIKGNIPVDIGNL  530

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
             ++  L LG+N +SG +P+S+  L  L+ L+L  N L+G IP E+  L  L  L    N 
Sbjct  531  SSMIELNLGDNQLSGAIPSSIQRLKNLQGLYLNDNQLQGHIPYELCQLNNLADLRFGANR  590

Query  437  FSGSFPLDIlnlsklenlslsvnsLF-GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
             SGS P  +   +        V++L   ++P  L   L ++    + SN   G +   + 
Sbjct  591  LSGSIPSCLGTSTVALRRLSLVSNLLTSKIPPSLW-ELNRILHLNLASNSLDGPLSEDIG  649

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
            K   +  + L  N+FSG++P   G L  +    L +N L G IP     L SL  +DLS 
Sbjct  650  KLRDVVDMDLSNNHFSGNIPGSIGGLQNMISFSLANNSLEGPIPSSFKTLLSLEFLDLSK  709

Query  80   NKLYGTFIQNLDT  42
            N L G   ++L+ 
Sbjct  710  NNLSGVIPKSLEA  722


 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L  ++ P L  L+ ++ LNL+ N+       ++ +LR +  +  S N FSGNIP   G L
Sbjct  616  LTSKIPPSLWELNRILHLNLASNSLDGPLSEDIGKLRDVVDMDLSNNHFSGNIPGSIGGL  675

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            QN+    L NN++ G +P+S   L  LE L L  N+L G IP+ +  L  LK LNLS N 
Sbjct  676  QNMISFSLANNSLEGPIPSSFKTLLSLEFLDLSKNNLSGVIPKSLEALLYLKHLNLSFNK  735

Query  437  FSGSFP  420
              G  P
Sbjct  736  LQGEIP  741


 Score = 70.9 bits (172),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 70/138 (51%), Gaps = 7/138 (5%)
 Frame = -1

Query  905  LADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNN  726
            L  N   + I P  W         NR+  LNL +  L G L+ D+G L  +V ++LS N+
Sbjct  611  LVSNLLTSKIPPSLW-------ELNRILHLNLASNSLDGPLSEDIGKLRDVVDMDLSNNH  663

Query  725  FHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNL  546
            F  + P  +  L+ +     + N   G IPS F  L +L FL L  NN+SG +P SL  L
Sbjct  664  FSGNIPGSIGGLQNMISFSLANNSLEGPIPSSFKTLLSLEFLDLSKNNLSGVIPKSLEAL  723

Query  545  SKLEVLHLGVNSLEGSIP  492
              L+ L+L  N L+G IP
Sbjct  724  LYLKHLNLSFNKLQGEIP  741



>emb|CDP15116.1| unnamed protein product [Coffea canephora]
Length=1134

 Score =   255 bits (651),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 158/306 (52%), Positives = 197/306 (64%), Gaps = 6/306 (2%)
 Frame = -1

Query  977  TNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMG  798
            TNITTD++ALLSLK  I+ +    LA NWS  +   C W G+TC +R  RV+ LN+ NMG
Sbjct  27   TNITTDQYALLSLKPLITSE---TLAKNWSA-AFPVCQWTGITCGARRYRVTGLNISNMG  82

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL-  621
            L G + P LGNLSFLVSL+LS NNFH   P EL+ LRRL+ L    ND SG IPSWFG  
Sbjct  83   LTGIMPPTLGNLSFLVSLDLSGNNFHGQLPHELAYLRRLRFLNLGINDLSGEIPSWFGYS  142

Query  620  LQNLRFLYLGNNNISGFLPTSLF-NLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
               L++L L NN+  G +P  +F N+S LE L L  N+LEG+IP EIG L  LK L    
Sbjct  143  FPKLQYLNLANNSFLGSIPPLIFYNISTLEQLRLSFNNLEGTIPNEIGKLQNLKKLICER  202

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N  SGS P +I N+S LE ++L  N L G LP D+   L +L    +  NKFSG IPS+L
Sbjct  203  NQLSGSLPSEIFNISSLEMIALRDNHLSGSLPGDMCRRLQRLFWLNLSENKFSGNIPSTL  262

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
            S+CS LQ LSL  NNF+G +P E GNLT+L+ L+L SN L G IP EIG L+ L  + ++
Sbjct  263  SQCSALQMLSLSINNFTGIIPNEIGNLTELQLLYLGSNNLEGDIPGEIGKLTMLKGLSIT  322

Query  83   NNKLYG  66
             N L G
Sbjct  323  TNHLTG  328


 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 138/245 (56%), Gaps = 3/245 (1%)
 Frame = -1

Query  797  LVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L  D+   L  L  LNLS+N F  + P  LSQ   L++L  S N+F+G IP+  G 
Sbjct  229  LSGSLPGDMCRRLQRLFWLNLSENKFSGNIPSTLSQCSALQMLSLSINNFTGIIPNEIGN  288

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            L  L+ LYLG+NN+ G +P  +  L+ L+ L +  N L G IPREIGNL  L+ L+ S+N
Sbjct  289  LTELQLLYLGSNNLEGDIPGEIGKLTMLKGLSITTNHLTGKIPREIGNLTMLESLSASEN  348

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
            + +G  P ++ NL  LE L +  NSL G +P+ + N L +L      +N  SG +P ++ 
Sbjct  349  NLTGLIPQELGNLHNLEILQIQNNSLSGSIPVRIFN-LSRLIALSFSANGLSGNLPENI-  406

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
            +   L+ L L  N F G +P    N ++L +L L  NQ +G+IP  +G L  L  + L  
Sbjct  407  ELPFLRDLILSMNYFGGVIPNSISNSSQLTRLELSGNQFSGSIPCSLGDLRLLQYLGLHL  466

Query  80   NKLYG  66
            NKL G
Sbjct  467  NKLNG  471


 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/234 (39%), Positives = 128/234 (55%), Gaps = 2/234 (1%)
 Frame = -1

Query  839  RHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSF  660
            R  R+  LNL      G +   L   S L  L+LS NNF    P E+  L  L++L    
Sbjct  240  RLQRLFWLNLSENKFSGNIPSTLSQCSALQMLSLSINNFTGIIPNEIGNLTELQLLYLGS  299

Query  659  NDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG  480
            N+  G+IP   G L  L+ L +  N+++G +P  + NL+ LE L    N+L G IP+E+G
Sbjct  300  NNLEGDIPGEIGKLTMLKGLSITTNHLTGKIPREIGNLTMLESLSASENNLTGLIPQELG  359

Query  479  NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMR  300
            NL  L++L + +N  SGS P+ I NLS+L  LS S N L G LP ++   LP L+  ++ 
Sbjct  360  NLHNLEILQIQNNSLSGSIPVRIFNLSRLIALSFSANGLSGNLPENI--ELPFLRDLILS  417

Query  299  SNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
             N F G IP+S+S  S L  L L  N FSG +P   G+L  L+ L L  N+L G
Sbjct  418  MNYFGGVIPNSISNSSQLTRLELSGNQFSGSIPCSLGDLRLLQYLGLHLNKLNG  471


 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 129/252 (51%), Gaps = 7/252 (3%)
 Frame = -1

Query  878  ITPCNWIGVTCNSRHNRVSALNLF--NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPR  705
            I+ CN  G+  +   N    +NL   +  L+G +   + +L  L +L  + N      P 
Sbjct  521  ISGCNIKGMIPSGIGNLSGLINLAIDSNQLIGPIPDTISHLQKLQALYANNNKLSKVMPD  580

Query  704  ELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLH  525
            +L  L+ L  L  S N FSG IP   G + +LR +YL +N     +P +L NL  +  L+
Sbjct  581  KLCSLQSLAYLILSQNQFSGLIPECLGNITSLRAVYLDSNRFHSSIPATLLNLKYILELN  640

Query  524  LGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPL  345
            L  NSL G +  E GNL   + ++LS N  +G+ P  + +L  L+NL L+ N+  G +P 
Sbjct  641  LSTNSLSGIMGLEFGNLKAARYIDLSINSLTGALPTTLGDLQSLQNLVLAHNTFQGSIPE  700

Query  344  DLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPRE--FGNLTKLE  171
             +GN L  L++  +  N  SG IP  L K   L   ++ FNN SG +P E  F N T++ 
Sbjct  701  SIGNIL-SLELLDLSHNYLSGLIPPILVKLQYLTRFNVSFNNLSGEIPSEGPFKNFTEMS  759

Query  170  KLFLRSNQLTGA  135
              F+ ++ L GA
Sbjct  760  --FISNDGLCGA  769


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/242 (31%), Positives = 109/242 (45%), Gaps = 25/242 (10%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +   +GNLS L++L +  N      P  +S L++L+ L  + N  S  +P     LQ+
Sbjct  528  GMIPSGIGNLSGLINLAIDSNQLIGPIPDTISHLQKLQALYANNNKLSKVMPDKLCSLQS  587

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFS  432
            L +L L  N  SG +P  L N++ L  ++L  N    SIP  + NL  +  LNLS N  S
Sbjct  588  LAYLILSQNQFSGLIPECLGNITSLRAVYLDSNRFHSSIPATLLNLKYILELNLSTNSLS  647

Query  431  GSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCS  252
            G   L+                 FG        +L   +   +  N  +G +P++L    
Sbjct  648  GIMGLE-----------------FG--------NLKAARYIDLSINSLTGALPTTLGDLQ  682

Query  251  LLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKL  72
             LQ L L  N F G +P   GN+  LE L L  N L+G IP  +  L  L   ++S N L
Sbjct  683  SLQNLVLAHNTFQGSIPESIGNILSLELLDLSHNYLSGLIPPILVKLQYLTRFNVSFNNL  742

Query  71   YG  66
             G
Sbjct  743  SG  744


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 95/266 (36%), Positives = 134/266 (50%), Gaps = 13/266 (5%)
 Frame = -1

Query  833  NRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND  654
            +R+ AL+    GL G L P+   L FL  L LS N F    P  +S   +L  L+ S N 
Sbjct  386  SRLIALSFSANGLSGNL-PENIELPFLRDLILSMNYFGGVIPNSISNSSQLTRLELSGNQ  444

Query  653  FSGNIPSWFGLLQNLRFLYLGNNNISG--------FLPTSLFNLSKLEVLHLGVNSL-EG  501
            FSG+IP   G L+ L++L L  N ++G        F+ T L N    +++ + +N L  G
Sbjct  445  FSGSIPCSLGDLRLLQYLGLHLNKLNGDPSSPELSFI-TCLTNCKSFKIIEVSLNPLLNG  503

Query  500  SIPREIGNLFQ-LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLP  324
             +P  IGN    L+   +S  +  G  P  I NLS L NL++  N L G +P D  +HL 
Sbjct  504  YLPESIGNFSSSLESFLISGCNIKGMIPSGIGNLSGLINLAIDSNQLIGPIP-DTISHLQ  562

Query  323  KLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQL  144
            KLQ     +NK S  +P  L     L  L L  N FSG +P   GN+T L  ++L SN+ 
Sbjct  563  KLQALYANNNKLSKVMPDKLCSLQSLAYLILSQNQFSGLIPECLGNITSLRAVYLDSNRF  622

Query  143  TGAIPREIGALSSLLIVDLSNNKLYG  66
              +IP  +  L  +L ++LS N L G
Sbjct  623  HSSIPATLLNLKYILELNLSTNSLSG  648


 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 89/281 (32%), Positives = 135/281 (48%), Gaps = 12/281 (4%)
 Frame = -1

Query  857  GVTCNSRHN--RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN-------SFPR  705
            GV  NS  N  +++ L L      G +   LG+L  L  L L  N  +        SF  
Sbjct  423  GVIPNSISNSSQLTRLELSGNQFSGSIPCSLGDLRLLQYLGLHLNKLNGDPSSPELSFIT  482

Query  704  ELSQLRRLKILQCSFNDF-SGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEV  531
             L+  +  KI++ S N   +G +P   G    +L    +   NI G +P+ + NLS L  
Sbjct  483  CLTNCKSFKIIEVSLNPLLNGYLPESIGNFSSSLESFLISGCNIKGMIPSGIGNLSGLIN  542

Query  530  LHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGEL  351
            L +  N L G IP  I +L +L+ L  ++N  S   P  + +L  L  L LS N   G +
Sbjct  543  LAIDSNQLIGPIPDTISHLQKLQALYANNNKLSKVMPDKLCSLQSLAYLILSQNQFSGLI  602

Query  350  PLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLE  171
            P  LGN +  L+   + SN+F   IP++L     +  L+L  N+ SG +  EFGNL    
Sbjct  603  PECLGN-ITSLRAVYLDSNRFHSSIPATLLNLKYILELNLSTNSLSGIMGLEFGNLKAAR  661

Query  170  KLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             + L  N LTGA+P  +G L SL  + L++N   G+  +++
Sbjct  662  YIDLSINSLTGALPTTLGDLQSLQNLVLAHNTFQGSIPESI  702



>ref|XP_011101453.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1189

 Score =   254 bits (648),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 220/338 (65%), Gaps = 11/338 (3%)
 Frame = -1

Query  1040  YFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CN  864
             +   S++ F   M CL +N   NI TD+ ALL  KS+   +P ++LA NWS  S TP C+
Sbjct  10    FISWSMYLF---MSCLALN-RLNIMTDQSALLVFKSQFEQEPGNVLARNWS--SDTPVCS  63

Query  863   WIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRR  684
             WIG+TC+SRH RV+A+N+ +M L G + P LGNLSFLVSL+LS N FH   P EL++LRR
Sbjct  64    WIGITCSSRHLRVAAINVSDMNLSGIIPPQLGNLSFLVSLDLSGNKFHGDLPEELAKLRR  123

Query  683   LKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLE  504
             L+    SFN FSG IPSWFG L NL+ L L   + +G +P SL N+SKLE L+L  N LE
Sbjct  124   LRFFNFSFNRFSGKIPSWFGALPNLQELLLEYCSFTGSIPPSLSNISKLETLNLKSNLLE  183

Query  503   GSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLP  324
               IP EIG+L  LK L L +N  SG  P  I N+S LE  + + NSL G LP ++  H+P
Sbjct  184   SMIPAEIGDLHNLKRLVLGENKLSGPIPASIFNISTLEAAAFTSNSLSGNLPANMCRHMP  243

Query  323   KLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFL-RSNQ  147
              L+ F +  N+  G IPS++ +CS LQTL+  +N F+G VP++ GNL+ LE L+L  +N 
Sbjct  244   NLKSFNVAFNQLHGHIPSNIDECSKLQTLAFEYNQFTGPVPKQIGNLSMLEILYLGNNNN  303

Query  146   LTGAIPREIGALSSLLIVDLSNNKLYG---TFIQNLDT  42
             L G IP E+G LS+L ++ LS + + G   +FI N+ T
Sbjct  304   LKGEIPAEVGYLSNLQVLSLSADGIRGPISSFIYNIST  341


 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/233 (33%), Positives = 110/233 (47%), Gaps = 25/233 (11%)
 Frame = -1

Query  755  LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNN-I  579
            L S N++ N  H   P  + +  +L+ L   +N F+G +P   G L  L  LYLGNNN +
Sbjct  245  LKSFNVAFNQLHGHIPSNIDECSKLQTLAFEYNQFTGPVPKQIGNLSMLEILYLGNNNNL  304

Query  578  SGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnls  399
             G +P  +  LS L+VL L  + + G I   I N+  L+ L L  N+ +G+ P +I    
Sbjct  305  KGEIPAEVGYLSNLQVLSLSADGIRGPISSFIYNISTLQELYLDANNLTGNLPTEICL--  362

Query  398  klenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNN  219
                                   LP LQ   + +NK +G IP  L  CS L  + +  N 
Sbjct  363  ----------------------RLPSLQGLYLSANKLAGSIPRQLGNCSSLVEIYMDENM  400

Query  218  FSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             +G +P E GNL  LE L   +NQLTG IP  I  +S+L  +    N + G+ 
Sbjct  401  LTGEIPSEIGNLLNLEILVSDNNQLTGIIPATIFNISTLRTLSFFANHIMGSL  453


 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 92/266 (35%), Positives = 136/266 (51%), Gaps = 7/266 (3%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN-----SFPRELSQLRRLKILQCSFN  657
            +L+L    L G +   LG L FL  LN+++N+F +     SF   L+   RLK+L  S N
Sbjct  490  SLDLGGNRLTGLVPNSLGELKFLEFLNIARNDFTSESSDMSFVTSLTNCMRLKVLWVSDN  549

Query  656  DFSGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG  480
              SG +P   G    +L  + + N  I G +P  + N+S L  L++  N   G IP  I 
Sbjct  550  SLSGYLPDSIGNFSSSLEQIEMSNCGIKGSIPKEIGNVSNLAFLYMDDNEFTGFIPTTIK  609

Query  479  NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMR  300
             L  L+LL+L  N  SG  P DI +L  L  L+LS N L+G +P  LGN +  L+   + 
Sbjct  610  GLKNLQLLSLQGNRLSGPIPDDICHLFSLGELTLSKNKLYGPVPACLGN-VTSLRYLRLD  668

Query  299  SNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREI  120
             N+ +  IP ++     L    L  N FSG +P E GNL  +  + L  N+L+  IP  I
Sbjct  669  RNELNSSIPLTIGGLRNLLRFELFSNFFSGVIPPEIGNLVAVTSIDLSLNELSSGIPTTI  728

Query  119  GALSSLLIVDLSNNKLYGTFIQNLDT  42
            G L S++ + L+ N+L G    ++ T
Sbjct  729  GGLISVIDLSLAQNRLQGPIPDSIST  754


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 84/256 (33%), Positives = 124/256 (48%), Gaps = 2/256 (1%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND  654
            R+  L + +  L G L   +GN S  L  + +S      S P+E+  +  L  L    N+
Sbjct  540  RLKVLWVSDNSLSGYLPDSIGNFSSSLEQIEMSNCGIKGSIPKEIGNVSNLAFLYMDDNE  599

Query  653  FSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
            F+G IP+    L+NL+ L L  N +SG +P  + +L  L  L L  N L G +P  +GN+
Sbjct  600  FTGFIPTTIKGLKNLQLLSLQGNRLSGPIPDDICHLFSLGELTLSKNKLYGPVPACLGNV  659

Query  473  FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSN  294
              L+ L L  N  + S PL I  L  L    L  N   G +P ++GN L  +    +  N
Sbjct  660  TSLRYLRLDRNELNSSIPLTIGGLRNLLRFELFSNFFSGVIPPEIGN-LVAVTSIDLSLN  718

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGA  114
            + S  IP+++     +  LSL  N   G +P     +  LE+L L  N LTG IP+ +  
Sbjct  719  ELSSGIPTTIGGLISVIDLSLAQNRLQGPIPDSISTIVSLERLDLSHNNLTGVIPKTMDG  778

Query  113  LSSLLIVDLSNNKLYG  66
            L  L  ++LS NKL G
Sbjct  779  LQYLKYLNLSFNKLTG  794


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 115/230 (50%), Gaps = 1/230 (0%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            + + N G+ G +  ++GN+S L  L +  N F    P  +  L+ L++L    N  SG I
Sbjct  569  IEMSNCGIKGSIPKEIGNVSNLAFLYMDDNEFTGFIPTTIKGLKNLQLLSLQGNRLSGPI  628

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKL  459
            P     L +L  L L  N + G +P  L N++ L  L L  N L  SIP  IG L  L  
Sbjct  629  PDDICHLFSLGELTLSKNKLYGPVPACLGNVTSLRYLRLDRNELNSSIPLTIGGLRNLLR  688

Query  458  LNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGE  279
              L  N FSG  P +I NL  + ++ LS+N L   +P  +G  +  + + + + N+  G 
Sbjct  689  FELFSNFFSGVIPPEIGNLVAVTSIDLSLNELSSGIPTTIGGLISVIDLSLAQ-NRLQGP  747

Query  278  IPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
            IP S+S    L+ L L  NN +G +P+    L  L+ L L  N+LTG IP
Sbjct  748  IPDSISTIVSLERLDLSHNNLTGVIPKTMDGLQYLKYLNLSFNKLTGEIP  797


 Score = 92.0 bits (227),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 86/268 (32%), Positives = 131/268 (49%), Gaps = 20/268 (7%)
 Frame = -1

Query  812  LFNMGLVGELTPDLGNLS------------FLVSLNLSQNNFHNSFPRELSQLRRLKILQ  669
            ++N+  + EL  D  NL+             L  L LS N    S PR+L     L  + 
Sbjct  336  IYNISTLQELYLDANNLTGNLPTEICLRLPSLQGLYLSANKLAGSIPRQLGNCSSLVEIY  395

Query  668  CSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR  489
               N  +G IPS  G L NL  L   NN ++G +P ++FN+S L  L    N + GS+P 
Sbjct  396  MDENMLTGEIPSEIGNLLNLEILVSDNNQLTGIIPATIFNISTLRTLSFFANHIMGSLPS  455

Query  488  EIG-NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQI  312
             +   L  L  L L  N+ +G  P  I N S L +L L  N L G +P  LG  L  L+ 
Sbjct  456  TVSVGLPNLVELYLGQNNLTGPIPGFISNASGLISLDLGGNRLTGLVPNSLG-ELKFLEF  514

Query  311  FVMRSNKFSGE-----IPSSLSKCSLLQTLSLPFNNFSGHVPREFGNL-TKLEKLFLRSN  150
              +  N F+ E       +SL+ C  L+ L +  N+ SG++P   GN  + LE++ + + 
Sbjct  515  LNIARNDFTSESSDMSFVTSLTNCMRLKVLWVSDNSLSGYLPDSIGNFSSSLEQIEMSNC  574

Query  149  QLTGAIPREIGALSSLLIVDLSNNKLYG  66
             + G+IP+EIG +S+L  + + +N+  G
Sbjct  575  GIKGSIPKEIGNVSNLAFLYMDDNEFTG  602



>ref|XP_009775020.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana sylvestris]
Length=1114

 Score =   253 bits (647),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 153/315 (49%), Positives = 205/315 (65%), Gaps = 7/315 (2%)
 Frame = -1

Query  998  CLTINAHTNITTDKHALLSLKSKIS-FDPHSILADNWSVNSITP-CNWIGVTCNSRHNRV  825
            CL+I    NITTD+  LL+L+S+ S +D H +L  NWS  + TP C+WIGVTC  RH RV
Sbjct  36   CLSI---VNITTDQTTLLALRSQFSLYDSHHLLTRNWS--TFTPTCSWIGVTCGPRHQRV  90

Query  824  SALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSG  645
            +ALNL +M L G + P LGNLSFL+SL++  N+F+ + P EL++LRRLK++    N+F+G
Sbjct  91   TALNLSSMNLKGMVPPQLGNLSFLISLDIRNNSFYGNLPEELARLRRLKMINVMNNNFTG  150

Query  644  NIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQL  465
             IPS+FGLL NL  LYL  N  SG +PTSLFN++KL+ L L  N L G IP+EI  L  L
Sbjct  151  AIPSFFGLLPNLHSLYLSFNQFSGNIPTSLFNITKLKYLRLRGNFLGGEIPQEISRLCCL  210

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
              ++L DN   GS P  + N S L+ + L+ N+L+G+LP ++ ++LP L+   +  N+F 
Sbjct  211  TSIDLQDNKLIGSIPPTMFNQSSLKQIGLTKNNLYGKLPGNICDNLPNLEALALSGNRFD  270

Query  284  GEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSS  105
            G IP +L  CS LQ LSL  N+F+G +P E GNLT L  L L    L G IP EIG L  
Sbjct  271  GLIPPNLQNCSKLQILSLSQNDFTGTIPAEIGNLTMLTALQLGVTYLKGEIPMEIGYLQK  330

Query  104  LLIVDLSNNKLYGTF  60
            L I  L  N+L G+ 
Sbjct  331  LQIFGLYQNRLSGSI  345


 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 94/270 (35%), Positives = 126/270 (47%), Gaps = 33/270 (12%)
 Frame = -1

Query  905  LADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDL-GNLSFLVSLNLSQN  729
            L DN  + SI P  +         + +  + L    L G+L  ++  NL  L +L LS N
Sbjct  215  LQDNKLIGSIPPTMF-------NQSSLKQIGLTKNNLYGKLPGNICDNLPNLEALALSGN  267

Query  728  NFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN  549
             F    P  L    +L+IL  S NDF+G IP+  G                        N
Sbjct  268  RFDGLIPPNLQNCSKLQILSLSQNDFTGTIPAEIG------------------------N  303

Query  548  LSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvn  369
            L+ L  L LGV  L+G IP EIG L +L++  L  N  SGS P  I N+S L+ L++   
Sbjct  304  LTMLTALQLGVTYLKGEIPMEIGYLQKLQIFGLYQNRLSGSIPASIFNISSLQILTIVDC  363

Query  368  sLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG  189
             L G LPL++G   P LQ   +  N  SG  PSS+S  S L  L L  N+FSG +P    
Sbjct  364  QLSGSLPLNVGQGTPNLQEIYLGMNNLSGLFPSSISNASKLIALDLSNNSFSGSIPDSLS  423

Query  188  NLTKLEKLFLRSNQLTGAIP-REIGALSSL  102
             L  L+ L L  N+L    P  E+  L+SL
Sbjct  424  KLEFLQLLQLGQNKLINQNPSSELTFLTSL  453


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 118/244 (48%), Gaps = 25/244 (10%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +  ++GNL+ ++S+ L  N+     P+ +  L++L+      N  SG IP     L
Sbjct  494  LSGIIPEEIGNLTNVISILLFVNDLTGFIPKTVGGLQKLQRFLIHSNMISGTIPDEICSL  553

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            QN+  L +G N ISG LP+ L NL+ L  L+L  N L  S+P  + +L  L +L+ + N 
Sbjct  554  QNIGDLGVGQNKISGPLPSCLGNLTSLRNLYLASNRLNSSLPESMWSLQDLLILDAASNS  613

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
            FSG                          P+ +GN L  +    +  N FSG IPS++  
Sbjct  614  FSGVLS-----------------------PI-IGN-LKAITKIELSYNDFSGMIPSTMGG  648

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
               +   SL  N   G +P  FG L  LE L L  N LTG IP+ + AL  L  +++S N
Sbjct  649  LQKMIYFSLSHNRIDGPIPVSFGKLLSLEFLDLSYNNLTGEIPKSLEALVYLRYLNVSFN  708

Query  77   KLYG  66
            KL G
Sbjct  709  KLSG  712


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 123/253 (49%), Gaps = 15/253 (6%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            VG+ TP+L  +       L  NN    FP  +S   +L  L  S N FSG+IP     L+
Sbjct  373  VGQGTPNLQEIY------LGMNNLSGLFPSSISNASKLIALDLSNNSFSGSIPDSLSKLE  426

Query  614  NLRFLYLGNNNISGFLP-------TSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ-LKL  459
             L+ L LG N +    P       TSL     L  L +G N L G +P  IGN    LK 
Sbjct  427  FLQLLQLGQNKLINQNPSSELTFLTSLTRCRNLRELVIGPNPLNGILPASIGNFSSSLKR  486

Query  458  LNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGE  279
             +      SG  P +I NL+ + ++ L VN L G +P  +G  L KLQ F++ SN  SG 
Sbjct  487  FSAPGCKLSGIIPEEIGNLTNVISILLFVNDLTGFIPKTVGG-LQKLQRFLIHSNMISGT  545

Query  278  IPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLL  99
            IP  +     +  L +  N  SG +P   GNLT L  L+L SN+L  ++P  + +L  LL
Sbjct  546  IPDEICSLQNIGDLGVGQNKISGPLPSCLGNLTSLRNLYLASNRLNSSLPESMWSLQDLL  605

Query  98   IVDLSNNKLYGTF  60
            I+D ++N   G  
Sbjct  606  ILDAASNSFSGVL  618


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 132/298 (44%), Gaps = 31/298 (10%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRE-------LSQLRR  684
            S  +++ AL+L N    G +   L  L FL  L L QN   N  P         L++ R 
Sbjct  399  SNASKLIALDLSNNSFSGSIPDSLSKLEFLQLLQLGQNKLINQNPSSELTFLTSLTRCRN  458

Query  683  LKILQCSFNDFSGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSL  507
            L+ L    N  +G +P+  G    +L+        +SG +P  + NL+ +  + L VN L
Sbjct  459  LRELVIGPNPLNGILPASIGNFSSSLKRFSAPGCKLSGIIPEEIGNLTNVISILLFVNDL  518

Query  506  EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGN--  333
             G IP+ +G L +L+   +  N  SG+ P +I +L  + +L +  N + G LP  LGN  
Sbjct  519  TGFIPKTVGGLQKLQRFLIHSNMISGTIPDEICSLQNIGDLGVGQNKISGPLPSCLGNLT  578

Query  332  ---------------------HLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNF  216
                                  L  L I    SN FSG +   +     +  + L +N+F
Sbjct  579  SLRNLYLASNRLNSSLPESMWSLQDLLILDAASNSFSGVLSPIIGNLKAITKIELSYNDF  638

Query  215  SGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
            SG +P   G L K+    L  N++ G IP   G L SL  +DLS N L G   ++L+ 
Sbjct  639  SGMIPSTMGGLQKMIYFSLSHNRIDGPIPVSFGKLLSLEFLDLSYNNLTGEIPKSLEA  696


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 103/233 (44%), Gaps = 25/233 (11%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            V ++ LF   L G +   +G L  L    +  N    + P E+  L+ +  L    N  S
Sbjct  508  VISILLFVNDLTGFIPKTVGGLQKLQRFLIHSNMISGTIPDEICSLQNIGDLGVGQNKIS  567

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G +PS  G L +LR LYL +N ++  LP S+++L  L +L    NS  G +   IGNL  
Sbjct  568  GPLPSCLGNLTSLRNLYLASNRLNSSLPESMWSLQDLLILDAASNSFSGVLSPIIGNLKA  627

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
            +  + LS N FSG  P  +                           L K+  F +  N+ 
Sbjct  628  ITKIELSYNDFSGMIPSTM-------------------------GGLQKMIYFSLSHNRI  662

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             G IP S  K   L+ L L +NN +G +P+    L  L  L +  N+L+G IP
Sbjct  663  DGPIPVSFGKLLSLEFLDLSYNNLTGEIPKSLEALVYLRYLNVSFNKLSGEIP  715


 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 98/201 (49%), Gaps = 30/201 (15%)
 Frame = -1

Query  635  SWFGLL-----QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
            SW G+      Q +  L L + N+ G +P  L NLS L  L +  NS  G++P E+  L 
Sbjct  77   SWIGVTCGPRHQRVTALNLSSMNLKGMVPPQLGNLSFLISLDIRNNSFYGNLPEELARLR  136

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
            +LK++N+ +N+F+G+ P                 S FG         LP L    +  N+
Sbjct  137  RLKMINVMNNNFTGAIP-----------------SFFG--------LLPNLHSLYLSFNQ  171

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
            FSG IP+SL   + L+ L L  N   G +P+E   L  L  + L+ N+L G+IP  +   
Sbjct  172  FSGNIPTSLFNITKLKYLRLRGNFLGGEIPQEISRLCCLTSIDLQDNKLIGSIPPTMFNQ  231

Query  110  SSLLIVDLSNNKLYGTFIQNL  48
            SSL  + L+ N LYG    N+
Sbjct  232  SSLKQIGLTKNNLYGKLPGNI  252



>ref|XP_006358728.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Solanum tuberosum]
Length=1052

 Score =   253 bits (646),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 207/330 (63%), Gaps = 26/330 (8%)
 Frame = -1

Query  977  TNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLFNM  801
             NI+TD+ ALL+LKS IS D ++I+A NWS  S TP C+WIG+TC+SRH+RV+AL++ +M
Sbjct  24   ANISTDEVALLALKSHISSDINNIIASNWS--SSTPVCSWIGITCSSRHHRVTALDISSM  81

Query  800  GLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
             L G + P LGNLSF+ SL++S N FH   P EL+ L+RLK +    N+F+G IPS+  L
Sbjct  82   QLYGTIPPHLGNLSFISSLDISNNTFHGDLPVELAHLQRLKFINAKNNNFTGAIPSFLSL  141

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            L NL  LYL NN  SG +PTSL NL+KLEVL L  N LEG IPREIG+L  L +L+L  +
Sbjct  142  LPNLGSLYLSNNQFSGKIPTSLSNLTKLEVLQLQSNFLEGEIPREIGDLRYLTVLDLQLS  201

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              +GS P  I N++ ++ ++LS N+L G+LP  + +HLP L+   +  N   G IP +L 
Sbjct  202  QLTGSIPPSIFNITTMQVIALSGNNLTGKLPKTICDHLPDLEGLYLGRNSLEGVIPPNLE  261

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR-----------------------SN  150
            +C  LQ L L FN F+G VPRE  NLT L KL +                        S 
Sbjct  262  ECRKLQQLVLSFNEFAGTVPRELANLTDLTKLAMTALHLEGSIKFSSFSFPPSLYSYISR  321

Query  149  QLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            +LTG IP E+G L  L  + LS N+L G+ 
Sbjct  322  KLTGEIPMELGNLKKLQALGLSQNELTGSI  351


 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 134/250 (54%), Gaps = 5/250 (2%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL-  621
            L GE+  +LGNL  L +L LSQN    S P  +  +  L+I+    N  SG +PS  G  
Sbjct  323  LTGEIPMELGNLKKLQALGLSQNELTGSIPDIIFNMSALQIIDFGLNKLSGTLPSDLGRG  382

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            + N+  L+ G NN+SGF+  S+ N S+L +L L  NS  G IP+ +GNL  L++LNL  N
Sbjct  383  IPNIEELFCGGNNLSGFISASISNSSRLTMLDLSNNSFTGLIPKSLGNLEYLEVLNLWGN  442

Query  440  HFSG----SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIP  273
            +F      SF   + N   L+ L+LS N L G LP  +GN    LQ F ++  K  G IP
Sbjct  443  NFVSDSTLSFLASLTNCRNLKLLTLSGNPLDGVLPASVGNFSNALQTFEVQGCKLKGVIP  502

Query  272  SSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIV  93
              +   + +  + L  N  +GH+P     ++ L++L+L  N++ G IP  I  L +L  +
Sbjct  503  QEIGNLTEVTRMILVNNELTGHIPNTVHGMSILQELYLYDNKIEGTIPDVICNLKNLGAL  562

Query  92   DLSNNKLYGT  63
             LS N   G+
Sbjct  563  VLSENHFSGS  572


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 141/296 (48%), Gaps = 30/296 (10%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLKI  675
            S  +R++ L+L N    G +   LGNL +L  LNL  NNF +    SF   L+  R LK+
Sbjct  405  SNSSRLTMLDLSNNSFTGLIPKSLGNLEYLEVLNLWGNNFVSDSTLSFLASLTNCRNLKL  464

Query  674  LQCSFN-------------------------DFSGNIPSWFGLLQNLRFLYLGNNNISGF  570
            L  S N                            G IP   G L  +  + L NN ++G 
Sbjct  465  LTLSGNPLDGVLPASVGNFSNALQTFEVQGCKLKGVIPQEIGNLTEVTRMILVNNELTGH  524

Query  569  LPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlskle  390
            +P ++  +S L+ L+L  N +EG+IP  I NL  L  L LS+NHFSGS P  + N++ L 
Sbjct  525  IPNTVHGMSILQELYLYDNKIEGTIPDVICNLKNLGALVLSENHFSGSVPSCLGNMTSLR  584

Query  389  nlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSG  210
             L L  N L   LP  LGN L  L  F +  N  SGEIP           + L  N+FSG
Sbjct  585  KLYLDNNKLDSRLPSSLGN-LQDLIEFDVSYNLLSGEIPLESGNLKAATRIDLSNNSFSG  643

Query  209  HVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
             +P   G+L KL  L L  N+L G IP   G + SL  +DLS N L     ++L+ 
Sbjct  644  KIPSTLGSLDKLINLSLAHNRLEGPIPESFGKMLSLEYLDLSYNNLSDEIPKSLEA  699


 Score =   107 bits (267),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 102/310 (33%), Positives = 136/310 (44%), Gaps = 40/310 (13%)
 Frame = -1

Query  878  ITPCNWIGVTCNSRHN--RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPR  705
            +  C   GV      N   V+ + L N  L G +   +  +S L  L L  N    + P 
Sbjct  492  VQGCKLKGVIPQEIGNLTEVTRMILVNNELTGHIPNTVHGMSILQELYLYDNKIEGTIPD  551

Query  704  ELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLH  525
             +  L+ L  L  S N FSG++PS  G + +LR LYL NN +   LP+SL NL  L    
Sbjct  552  VICNLKNLGALVLSENHFSGSVPSCLGNMTSLRKLYLDNNKLDSRLPSSLGNLQDLIEFD  611

Query  524  LGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPL  345
            +  N L G IP E GNL     ++LS+N FSG  P  + +L KL NLSL+ N L G +P 
Sbjct  612  VSYNLLSGEIPLESGNLKAATRIDLSNNSFSGKIPSTLGSLDKLINLSLAHNRLEGPIPE  671

Query  344  DLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVP------------  201
              G  L  L+   +  N  S EIP SL     L+ ++  FN FSG +P            
Sbjct  672  SFGKML-SLEYLDLSYNNLSDEIPKSLEALVYLKHMNFSFNKFSGEIPTGSTFANVTSQS  730

Query  200  -------------------------REFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLI  96
                                        G L  L +L + SN L+G IP E G L +   
Sbjct  731  FLSNDALCGDSRFNVKPCLTKSTKKSTLGTLQDLIQLDVSSNLLSGEIPLESGNLKAATF  790

Query  95   VDLSNNKLYG  66
            + LSNN   G
Sbjct  791  IGLSNNYFSG  800


 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 132/299 (44%), Gaps = 38/299 (13%)
 Frame = -1

Query  851  TCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKIL  672
            +C      +  L L N  L   L   LGNL  L+  ++S N      P E   L+    +
Sbjct  575  SCLGNMTSLRKLYLDNNKLDSRLPSSLGNLQDLIEFDVSYNLLSGEIPLESGNLKAATRI  634

Query  671  QCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIP  492
              S N FSG IPS  G L  L  L L +N + G +P S   +  LE L L  N+L   IP
Sbjct  635  DLSNNSFSGKIPSTLGSLDKLINLSLAHNRLEGPIPESFGKMLSLEYLDLSYNNLSDEIP  694

Query  491  REIGNLFQLKLLNLSDNHFS-----GSFPLDIlnlsklenlslsvnsLF-----------  360
            + +  L  LK +N S N FS     GS   ++ + S L N +L  +S F           
Sbjct  695  KSLEALVYLKHMNFSFNKFSGEIPTGSTFANVTSQSFLSNDALCGDSRFNVKPCLTKSTK  754

Query  359  ---------------------GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQ  243
                                 GE+PL+ GN L       + +N FSG+IPS+L     L 
Sbjct  755  KSTLGTLQDLIQLDVSSNLLSGEIPLESGN-LKAATFIGLSNNYFSGKIPSTLGSLDRLI  813

Query  242  TLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             LSL  N   G +P  FG +  LE L L  N L+G IP+ + AL  L  +++S N+L G
Sbjct  814  NLSLAHNRLEGPIPESFGKMLSLENLDLSYNNLSGEIPKSLEALVYLKYLNISFNELSG  872


 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 121/267 (45%), Gaps = 28/267 (10%)
 Frame = -1

Query  857  GVTCNSRHNRVSALNLFNM---GLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLR  687
            GV   S  N  +AL  F +    L G +  ++GNL+ +  + L  N      P  +  + 
Sbjct  474  GVLPASVGNFSNALQTFEVQGCKLKGVIPQEIGNLTEVTRMILVNNELTGHIPNTVHGMS  533

Query  686  RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSL  507
             L+ L    N   G IP     L+NL  L L  N+ SG +P+ L N++ L  L+L  N L
Sbjct  534  ILQELYLYDNKIEGTIPDVICNLKNLGALVLSENHFSGSVPSCLGNMTSLRKLYLDNNKL  593

Query  506  EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
            +  +P  +GNL  L   ++S N  S                        GE+PL+ GN  
Sbjct  594  DSRLPSSLGNLQDLIEFDVSYNLLS------------------------GEIPLESGNLK  629

Query  326  PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ  147
               +I  + +N FSG+IPS+L     L  LSL  N   G +P  FG +  LE L L  N 
Sbjct  630  AATRI-DLSNNSFSGKIPSTLGSLDKLINLSLAHNRLEGPIPESFGKMLSLEYLDLSYNN  688

Query  146  LTGAIPREIGALSSLLIVDLSNNKLYG  66
            L+  IP+ + AL  L  ++ S NK  G
Sbjct  689  LSDEIPKSLEALVYLKHMNFSFNKFSG  715


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 59/118 (50%), Gaps = 0/118 (0%)
 Frame = -1

Query  773  LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            LG L  L+ L++S N      P E   L+    +  S N FSG IPS  G L  L  L L
Sbjct  758  LGTLQDLIQLDVSSNLLSGEIPLESGNLKAATFIGLSNNYFSGKIPSTLGSLDRLINLSL  817

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
             +N + G +P S   +  LE L L  N+L G IP+ +  L  LK LN+S N  SG  P
Sbjct  818  AHNRLEGPIPESFGKMLSLENLDLSYNNLSGEIPKSLEALVYLKYLNISFNELSGEIP  875


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L GE+  + GNL     + LS N F    P  L  L RL  L  + N   G IP  FG +
Sbjct  774  LSGEIPLESGNLKAATFIGLSNNYFSGKIPSTLGSLDRLINLSLAHNRLEGPIPESFGKM  833

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIP  492
             +L  L L  NN+SG +P SL  L  L+ L++  N L G IP
Sbjct  834  LSLENLDLSYNNLSGEIPKSLEALVYLKYLNISFNELSGEIP  875



>emb|CDP08216.1| unnamed protein product [Coffea canephora]
Length=976

 Score =   253 bits (645),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 148/310 (48%), Positives = 199/310 (64%), Gaps = 3/310 (1%)
 Frame = -1

Query  971  ITTDKHALLSLKSKISFDPHSILADNWSVNSITP--CNWIGVTCNSRHNRVSALNLFNMG  798
            + TD+ ALL+LK+ I+ + H  L+ NWS  +     C+WIGV C SRH RV+ LN+ NMG
Sbjct  6    LGTDQSALLALKAHITSEQHEFLSKNWSSAASASSVCDWIGVQCGSRHQRVTGLNVSNMG  65

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G + PDLGNLSFLVSL+L  N+FH S P ELS LRRL+++  S N F+G IP WFG  
Sbjct  66   LTGTIPPDLGNLSFLVSLDLRSNSFHGSLPEELSHLRRLRLILFSNNRFTGAIPMWFGHF  125

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
              L+FL L  N  SGF+P+S+ NLS++E L L  N L+G IP +IGNL  LKLLN   N+
Sbjct  126  PELQFLLLDINGFSGFIPSSISNLSRVEKLDLSENFLQGKIPEKIGNLSALKLLNFYRNY  185

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             +G  PL +  +S+L+ L LS N   G +P ++GN L KL    + +N F+G IP  L K
Sbjct  186  LAGQIPLSLCKISQLKALDLSSNRFGGYIPKEIGN-LEKLTYLSLMNNNFTGVIPRELGK  244

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
               L  L L  NN +G +PRE GNL  L++L L  N++ G+IP+EIG L+ L  +  +NN
Sbjct  245  LHGLNVLVLGRNNLTGTIPREIGNLQNLQRLNLEWNKIAGSIPKEIGNLTMLTELYFANN  304

Query  77   KLYGTFIQNL  48
             L GT  + +
Sbjct  305  SLTGTIPREM  314


 Score =   141 bits (356),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 133/230 (58%), Gaps = 0/230 (0%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            ++ AL+L +    G +  ++GNL  L  L+L  NNF    PREL +L  L +L    N+ 
Sbjct  199  QLKALDLSSNRFGGYIPKEIGNLEKLTYLSLMNNNFTGVIPRELGKLHGLNVLVLGRNNL  258

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
            +G IP   G LQNL+ L L  N I+G +P  + NL+ L  L+   NSL G+IPRE+GNL+
Sbjct  259  TGTIPREIGNLQNLQRLNLEWNKIAGSIPKEIGNLTMLTELYFANNSLTGTIPREMGNLY  318

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
             L+ L L  N  +GS P  I NLS L N++LS N L G LP DLG  LPKL    +  N 
Sbjct  319  LLENLQLPYNGLNGSIPRGIFNLSALWNIALSSNLLSGNLPRDLGYRLPKLLFIELAGND  378

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
              G IP S++ CS L+ L L  N F+G +P   G+L  L+ L L SN LT
Sbjct  379  LGGVIPVSITNCSQLRMLELSINRFTGSIPDALGDLRLLQVLALYSNNLT  428


 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/258 (37%), Positives = 129/258 (50%), Gaps = 26/258 (10%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            RV  L+L    L G++   +GNLS L  LN  +N      P  L ++ +LK L  S N F
Sbjct  151  RVEKLDLSENFLQGKIPEKIGNLSALKLLNFYRNYLAGQIPLSLCKISQLKALDLSSNRF  210

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
             G IP   G L+ L +L L NNN +G +P  L  L  L VL LG N+L G+IPREIGNL 
Sbjct  211  GGYIPKEIGNLEKLTYLSLMNNNFTGVIPRELGKLHGLNVLVLGRNNLTGTIPREIGNLQ  270

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
             L+ LNL  N  +GS P +I                          +L  L      +N 
Sbjct  271  NLQRLNLEWNKIAGSIPKEI-------------------------GNLTMLTELYFANNS  305

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIG-A  114
             +G IP  +    LL+ L LP+N  +G +PR   NL+ L  + L SN L+G +PR++G  
Sbjct  306  LTGTIPREMGNLYLLENLQLPYNGLNGSIPRGIFNLSALWNIALSSNLLSGNLPRDLGYR  365

Query  113  LSSLLIVDLSNNKLYGTF  60
            L  LL ++L+ N L G  
Sbjct  366  LPKLLFIELAGNDLGGVI  383


 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 105/319 (33%), Positives = 158/319 (50%), Gaps = 19/319 (6%)
 Frame = -1

Query  1004  MLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWS-----VNSITPCNWIGVTCNS  840
             ML L+IN  T    D    L L   ++   +++ +D  S     + S+T C         
Sbjct  395   MLELSINRFTGSIPDALGDLRLLQVLALYSNNLTSDPTSMELSFITSLTKCK--------  446

Query  839   RHNRVSALNLFNMGLVGELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCS  663
                 +  L L    L G L   +GNLS  L  L +  +    + P +   L  L +L   
Sbjct  447   ---NLDYLALGPNPLNGLLPASIGNLSATLQKLYIGTSEIKGTIPSQAGNLTNLILLALQ  503

Query  662   FNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREI  483
              N  +G IP+ F  LQN++ L + +NN++G L  +L NL +L  ++L  N   GSI    
Sbjct  504   SNQLTGGIPAAFKDLQNMQTLDMEDNNLNGTL-ENLCNLQRLAYVYLTANRFSGSILECF  562

Query  482   GNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVM  303
             GN+  L+ L+L +N    + P    NL  L  L+LS NSL G LPL++GN L  +    +
Sbjct  563   GNMTSLRELDLGNNFLVSAIPNSFWNLKDLLQLNLSSNSLNGSLPLEVGN-LKAITSIDV  621

Query  302   RSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPRE  123
              +N+FSG+IP +      L  L+L  N F G +P  F N+  L+ L+L  N L+G+IP+ 
Sbjct  622   SANQFSGDIPRTTGDLQNLVILNLSQNQFHGSIPESFSNMLSLQGLYLSHNNLSGSIPKS  681

Query  122   IGALSSLLIVDLSNNKLYG  66
             + AL  L  +D+S N L G
Sbjct  682   LEALRDLKELDVSYNHLSG  700


 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 106/223 (48%), Gaps = 26/223 (12%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +     +L  + +L++  NN + +    L  L+RL  +  + N FSG+I   FG +
Sbjct  507  LTGGIPAAFKDLQNMQTLDMEDNNLNGTL-ENLCNLQRLAYVYLTANRFSGSILECFGNM  565

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
             +LR L LGNN +   +P S +NL  L  L+L  NSL GS+P E+GNL  +  +++S N 
Sbjct  566  TSLRELDLGNNFLVSAIPNSFWNLKDLLQLNLSSNSLNGSLPLEVGNLKAITSIDVSANQ  625

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
            FSG  P                              L  L I  +  N+F G IP S S 
Sbjct  626  FSGDIPRTT-------------------------GDLQNLVILNLSQNQFHGSIPESFSN  660

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
               LQ L L  NN SG +P+    L  L++L +  N L+G IP
Sbjct  661  MLSLQGLYLSHNNLSGSIPKSLEALRDLKELDVSYNHLSGEIP  703


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 91/303 (30%), Positives = 144/303 (48%), Gaps = 59/303 (19%)
 Frame = -1

Query  797  LVGELTPDLG-NLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L  DLG  L  L+ + L+ N+     P  ++   +L++L+ S N F+G+IP   G 
Sbjct  354  LSGNLPRDLGYRLPKLLFIELAGNDLGGVIPVSITNCSQLRMLELSINRFTGSIPDALGD  413

Query  620  L-------------------------------QNLRFLYLGNNNISGFLPTSLFNLSK-L  537
            L                               +NL +L LG N ++G LP S+ NLS  L
Sbjct  414  LRLLQVLALYSNNLTSDPTSMELSFITSLTKCKNLDYLALGPNPLNGLLPASIGNLSATL  473

Query  536  EVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFG  357
            + L++G + ++G+IP + GNL  L LL L  N  +G  P    +L  ++ L +  N+L G
Sbjct  474  QKLYIGTSEIKGTIPSQAGNLTNLILLALQSNQLTGGIPAAFKDLQNMQTLDMEDNNLNG  533

Query  356  ELPLDLGNHLPKLQIFVMRSNKFSGEI------------------------PSSLSKCSL  249
             L  +L N L +L    + +N+FSG I                        P+S      
Sbjct  534  TLE-NLCN-LQRLAYVYLTANRFSGSILECFGNMTSLRELDLGNNFLVSAIPNSFWNLKD  591

Query  248  LQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLY  69
            L  L+L  N+ +G +P E GNL  +  + + +NQ +G IPR  G L +L+I++LS N+ +
Sbjct  592  LLQLNLSSNSLNGSLPLEVGNLKAITSIDVSANQFSGDIPRTTGDLQNLVILNLSQNQFH  651

Query  68   GTF  60
            G+ 
Sbjct  652  GSI  654


 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 77/145 (53%), Gaps = 0/145 (0%)
 Frame = -1

Query  854  VTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKI  675
            + C      +  L+L N  LV  +     NL  L+ LNLS N+ + S P E+  L+ +  
Sbjct  559  LECFGNMTSLRELDLGNNFLVSAIPNSFWNLKDLLQLNLSSNSLNGSLPLEVGNLKAITS  618

Query  674  LQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSI  495
            +  S N FSG+IP   G LQNL  L L  N   G +P S  N+  L+ L+L  N+L GSI
Sbjct  619  IDVSANQFSGDIPRTTGDLQNLVILNLSQNQFHGSIPESFSNMLSLQGLYLSHNNLSGSI  678

Query  494  PREIGNLFQLKLLNLSDNHFSGSFP  420
            P+ +  L  LK L++S NH SG  P
Sbjct  679  PKSLEALRDLKELDVSYNHLSGEIP  703


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G++    G+L  LV LNLSQN FH S P   S +  L+ L  S N+ SG+IP     L++
Sbjct  628  GDIPRTTGDLQNLVILNLSQNQFHGSIPESFSNMLSLQGLYLSHNNLSGSIPKSLEALRD  687

Query  611  LRFLYLGNNNISGFLPT  561
            L+ L +  N++SG +P+
Sbjct  688  LKELDVSYNHLSGEIPS  704



>emb|CDP20776.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 193/305 (63%), Gaps = 25/305 (8%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            NIT+D+ ALLSLK+KI+ DPH ILA NWS  S + C+W GVTC SRH RV+ALN+ N+GL
Sbjct  5    NITSDQSALLSLKAKITGDPHEILASNWSATS-SVCDWRGVTCGSRHRRVTALNISNLGL  63

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             G + P LGNLSFL+SL++S+NNF+   P EL +L RL++L                   
Sbjct  64   TGTIPPQLGNLSFLMSLDMSRNNFYGELPHELIRLSRLQVLS------------------  105

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
                  LGNN+ +GF+P S+ N+SKLE L L  NSL+G++P EIGNL +LK + L  N  
Sbjct  106  ------LGNNSFTGFIPPSISNMSKLETLSLQFNSLQGALPIEIGNLNKLKQIVLVYNQL  159

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            SG  PL + N+S L+ ++L  NSL G LP  + + L  L    +  NK SG IP SLS+C
Sbjct  160  SGFLPLGMFNISSLQVIALQNNSLSGSLPSSICSRLQGLTWLDLGRNKLSGVIPPSLSEC  219

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
            S LQ LSL  NNFSG +P  FGNLT L+ L LR N L G IP   G L++L  + L  N 
Sbjct  220  SKLQVLSLSDNNFSGVIPEGFGNLTALKGLSLRWNNLIGVIPEGFGNLTALERLYLDGNN  279

Query  74   LYGTF  60
            L+GT 
Sbjct  280  LHGTI  284


 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 67/118 (57%), Gaps = 0/118 (0%)
 Frame = -1

Query  764  LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNN  585
            L  L  L+L +N      P  LS+  +L++L  S N+FSG IP  FG L  L+ L L  N
Sbjct  195  LQGLTWLDLGRNKLSGVIPPSLSECSKLQVLSLSDNNFSGVIPEGFGNLTALKGLSLRWN  254

Query  584  NISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDI  411
            N+ G +P    NL+ LE L+L  N+L G+IP EIG L +LK + L  N  SG  PL +
Sbjct  255  NLIGVIPEGFGNLTALERLYLDGNNLHGTIPMEIGKLKKLKRIVLDYNQLSGFLPLGL  312


 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 66/136 (49%), Gaps = 0/136 (0%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCS  663
            SR   ++ L+L    L G + P L   S L  L+LS NNF    P     L  LK L   
Sbjct  193  SRLQGLTWLDLGRNKLSGVIPPSLSECSKLQVLSLSDNNFSGVIPEGFGNLTALKGLSLR  252

Query  662  FNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREI  483
            +N+  G IP  FG L  L  LYL  NN+ G +P  +  L KL+ + L  N L G +P  +
Sbjct  253  WNNLIGVIPEGFGNLTALERLYLDGNNLHGTIPMEIGKLKKLKRIVLDYNQLSGFLPLGL  312

Query  482  GNLFQLKLLNLSDNHF  435
             N+  L+++ L    +
Sbjct  313  FNISSLQVIALQSPRW  328



>emb|CDP06824.1| unnamed protein product [Coffea canephora]
Length=1115

 Score =   253 bits (646),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 151/334 (45%), Positives = 200/334 (60%), Gaps = 25/334 (7%)
 Frame = -1

Query  1058  MEITRHYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSK-ISFDPHSILADNWSVN  882
             M    + FCL    F    L +   +++NIT D+ ALL+ K + I+ +   ILA NWSV 
Sbjct  1     MNKIYYSFCL---IFSLACLAVMAASNSNITADQSALLAFKDRMITSESQKILAKNWSVT  57

Query  881   SITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRE  702
             S   C+W+G+TC SRH RV+ALN+ +M L G + P LGNLSFLVSL++ +NNFH   PRE
Sbjct  58    SFV-CDWMGITCGSRHLRVTALNISDMNLTGTVPPQLGNLSFLVSLDIKRNNFHGELPRE  116

Query  701   LSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHL  522
             L+ LRRL+ L    N+  G +PSWFG L  L++L L NN+ +G +P S+ N+S LE L L
Sbjct  117   LAHLRRLRHLDFGINNLGGELPSWFGYLHKLQYLSLRNNSFTGSIPPSISNMSNLETLWL  176

Query  521   GVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLD  342
               NSLEGS+P E  NL  L+ L +  N  SG  PL                   G LP +
Sbjct  177   SHNSLEGSVPIEFQNLNNLENLIIEHNQLSG--PLS------------------GILPDN  216

Query  341   LGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLF  162
             + + L KL    +  N  +G+IPS+LS+CSLLQ  SL  N+ SG +P+   NLT LE L+
Sbjct  217   ICHGLQKLTWLGLGGNNLTGQIPSTLSQCSLLQHFSLASNHLSGSIPKAIWNLTMLEGLY  276

Query  161   LRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             L SN LTGA P EIG L+ L I+D + NKL G  
Sbjct  277   LGSNNLTGATPNEIGNLTMLTILDFAVNKLSGAI  310


 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 99/331 (30%), Positives = 150/331 (45%), Gaps = 45/331 (14%)
 Frame = -1

Query  908  ILADNWSVNSITPCNWIGVTCN-------SRHNRVSALNLFNMG---LVGELTPDLGNLS  759
            IL DN   + +    W+G+  N       S  ++ S L  F++    L G +   + NL+
Sbjct  212  ILPDNI-CHGLQKLTWLGLGGNNLTGQIPSTLSQCSLLQHFSLASNHLSGSIPKAIWNLT  270

Query  758  FLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNI  579
             L  L L  NN   + P E+  L  L IL  + N  SG IP   G L  L  LY  +N +
Sbjct  271  MLEGLYLGSNNLTGATPNEIGNLTMLTILDFAVNKLSGAIPMEIGNLALLTSLYFQSNKL  330

Query  578  SGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnls  399
            +G +P  + NL +LE L LG N+L GSIP EI N+  L+++ L  N+FSG+ PL + +  
Sbjct  331  TGGIPEKIGNLHRLETLVLGDNTLSGSIPTEISNISSLQVIELYQNNFSGTIPLTMNHKL  390

Query  398  klenlslsvnsLF-GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFN  222
                      +   G +P  + N    L   ++  N+  G IP+SL     LQ ++L FN
Sbjct  391  NNLETLSLYQNYLTGVIPNSISNA-SNLVDLMLDDNELIGSIPNSLGSLRNLQLINLAFN  449

Query  221  N-------------------------------FSGHVPREFGNL-TKLEKLFLRSNQLTG  138
                                             +G +P  F N  + LE     + ++ G
Sbjct  450  RLSSESSSPELSFFTSLTTCRSLRYLEVHQNPLNGFLPASFSNYSSSLEDFGAFNCKIKG  509

Query  137  AIPREIGALSSLLIVDLSNNKLYGTFIQNLD  45
            +IP  I  LSSLL +D SNN+L G+  + ++
Sbjct  510  SIPLGISNLSSLLYLDFSNNELIGSIPRTIN  540


 Score =   102 bits (254),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 120/248 (48%), Gaps = 26/248 (10%)
 Frame = -1

Query  809  FNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSW  630
            FN  + G +   + NLS L+ L+ S N    S PR +++L  L+      N     + S+
Sbjct  503  FNCKIKGSIPLGISNLSSLLYLDFSNNELIGSIPRTINRLMNLQEFYLESNQIRDVLDSF  562

Query  629  FGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
             G  Q+L +L LG N   G +P    N++ L  + L  N L  +IP  + ++  L++LNL
Sbjct  563  CGF-QSLGYLALGQNQFFGSIPECFRNMTSLRQIFLDSNMLASTIPATLLSMKDLQVLNL  621

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
            S N FSGS                        LP ++GN L  +    +  NK S  IP+
Sbjct  622  SSNFFSGS------------------------LPREIGN-LKAIYSLDLSINKLSDVIPT  656

Query  269  SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVD  90
            ++ +   LQTLSL  NN  G +P+   N+  LE L +  N L+G IP+ + AL  L   +
Sbjct  657  TIGELQALQTLSLAKNNLQGSIPKSISNMLNLEFLDISHNNLSGTIPKSLEALKHLKEFN  716

Query  89   LSNNKLYG  66
            +S N+L G
Sbjct  717  VSFNRLSG  724


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 98/338 (29%), Positives = 143/338 (42%), Gaps = 58/338 (17%)
 Frame = -1

Query  860  IGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRL  681
            I +T N + N +  L+L+   L G +   + N S LV L L  N    S P  L  LR L
Sbjct  382  IPLTMNHKLNNLETLSLYQNYLTGVIPNSISNASNLVDLMLDDNELIGSIPNSLGSLRNL  441

Query  680  KILQCSFNDFSGNIP-------SWFGLLQNLRFLYLGNNNISGFLPTS------------  558
            +++  +FN  S           +     ++LR+L +  N ++GFLP S            
Sbjct  442  QLINLAFNRLSSESSSPELSFFTSLTTCRSLRYLEVHQNPLNGFLPASFSNYSSSLEDFG  501

Query  557  -------------LFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK---------------  462
                         + NLS L  L    N L GSIPR I  L  L+               
Sbjct  502  AFNCKIKGSIPLGISNLSSLLYLDFSNNELIGSIPRTINRLMNLQEFYLESNQIRDVLDS  561

Query  461  --------LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
                     L L  N F GS P    N++ L  + L  N L   +P  L + +  LQ+  
Sbjct  562  FCGFQSLGYLALGQNQFFGSIPECFRNMTSLRQIFLDSNMLASTIPATLLS-MKDLQVLN  620

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
            + SN FSG +P  +     + +L L  N  S  +P   G L  L+ L L  N L G+IP+
Sbjct  621  LSSNFFSGSLPREIGNLKAIYSLDLSINKLSDVIPTTIGELQALQTLSLAKNNLQGSIPK  680

Query  125  EIGALSSLLIVDLSNNKLYGTFIQNLDTP*LK*LSYYN  12
             I  + +L  +D+S+N L GT  ++L+   LK L  +N
Sbjct  681  SISNMLNLEFLDISHNNLSGTIPKSLEA--LKHLKEFN  716


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 61/109 (56%), Gaps = 0/109 (0%)
 Frame = -1

Query  746  LNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFL  567
            LNLS N F  S PRE+  L+ +  L  S N  S  IP+  G LQ L+ L L  NN+ G +
Sbjct  619  LNLSSNFFSGSLPREIGNLKAIYSLDLSINKLSDVIPTTIGELQALQTLSLAKNNLQGSI  678

Query  566  PTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
            P S+ N+  LE L +  N+L G+IP+ +  L  LK  N+S N  SG  P
Sbjct  679  PKSISNMLNLEFLDISHNNLSGTIPKSLEALKHLKEFNVSFNRLSGEIP  727


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 88/188 (47%), Gaps = 36/188 (19%)
 Frame = -1

Query  767  NLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGN  588
            N++ L  + L  N   ++ P  L  ++ L++L  S N FSG++P   G L+ +  L L  
Sbjct  588  NMTSLRQIFLDSNMLASTIPATLLSMKDLQVLNLSSNFFSGSLPREIGNLKAIYSLDLSI  647

Query  587  NNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIl  408
            N +S  +PT++  L  L+ L L  N+L+GSIP+ I N+  L+ L++S N+ SG+ P  + 
Sbjct  648  NKLSDVIPTTIGELQALQTLSLAKNNLQGSIPKSISNMLNLEFLDISHNNLSGTIPKSL-  706

Query  407  nlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLP  228
                                      L  L+ F +  N+ SGEIP              P
Sbjct  707  ------------------------EALKHLKEFNVSFNRLSGEIPR-----------GGP  731

Query  227  FNNFSGHV  204
            F +F+G +
Sbjct  732  FRSFTGQL  739


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 62/113 (55%), Gaps = 0/113 (0%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +  LNL +    G L  ++GNL  + SL+LS N   +  P  + +L+ L+ L  + N+  
Sbjct  616  LQVLNLSSNFFSGSLPREIGNLKAIYSLDLSINKLSDVIPTTIGELQALQTLSLAKNNLQ  675

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR  489
            G+IP     + NL FL + +NN+SG +P SL  L  L+  ++  N L G IPR
Sbjct  676  GSIPKSISNMLNLEFLDISHNNLSGTIPKSLEALKHLKEFNVSFNRLSGEIPR  728


 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P  LGN L  L    ++ N F GE+P  L+    L+ L    NN  G +P  FG L 
Sbjct  87   GTVPPQLGN-LSFLVSLDIKRNNFHGELPRELAHLRRLRHLDFGINNLGGELPSWFGYLH  145

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF---IQNLD  45
            KL+ L LR+N  TG+IP  I  +S+L  + LS+N L G+     QNL+
Sbjct  146  KLQYLSLRNNSFTGSIPPSISNMSNLETLWLSHNSLEGSVPIEFQNLN  193



>ref|XP_008347286.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Malus domestica]
Length=831

 Score =   251 bits (640),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 200/332 (60%), Gaps = 24/332 (7%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLF  807
            AHTN +TD+ ALL+LK+ ++ DP +IL  NWS  S +  CNW+GVTC +RH+RV+ALNL 
Sbjct  16   AHTNFSTDQSALLALKAHVTTDPQNILTANWSSASNSNICNWVGVTCGARHHRVTALNLP  75

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
             MGL G + P LGNLSFLV L L  N+FH   P+ELS+LRRLK +    N F G IPSW 
Sbjct  76   YMGLAGVIPPHLGNLSFLVELGLQNNSFHGPLPQELSRLRRLKAINFGNNSFMGTIPSWX  135

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
            G    L+ + L +N+ SGF+P ++FNLS LE ++L  N L GSIPREIGNL  +K + L 
Sbjct  136  GSFAKLQTIKLYDNDFSGFIPAAIFNLSALENIYLMXNQLSGSIPREIGNLTVVKGIYLD  195

Query  446  DNHFS-----------------------GSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
            DN F                        GS  +  LN+S L  L+LS N++ G LP ++ 
Sbjct  196  DNKFKELPNEIGNLGQLEEFYVQDNALKGSAFVPALNISSLTTLALSGNNMSGSLPDNIC  255

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
             HL  +Q F +  N+F G IPS L +C  L+ +S  +NNF G +P+  GNLT L  +   
Sbjct  256  EHLSSIQRFYLGQNQFDGLIPSKLWQCKELRVVSFEYNNFRGSIPKSLGNLTYLTTINFI  315

Query  155  SNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             N L G IP EIG LS L ++ LS N L G  
Sbjct  316  VNNLEGTIPDEIGDLSQLEVLQLSANNLNGVI  347


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 125/249 (50%), Gaps = 35/249 (14%)
 Frame = -1

Query  740  LSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPT  561
            L QN F    P +L Q + L+++   +N+F G+IP   G L  L  +    NN+ G +P 
Sbjct  266  LGQNQFDGLIPSKLWQCKELRVVSFEYNNFRGSIPKSLGNLTYLTTINFIVNNLEGTIPD  325

Query  560  SLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenls  381
             + +LS+LEVL L  N+L G IP ++ N   +++++L+ N  SG                
Sbjct  326  EIGDLSQLEVLQLSANNLNGVIPSKLFNNSMIRIISLTLNQLSGG---------------  370

Query  380  lsvnsLFGELPLDLGNHLPKLQIFVMRSNKF-SGEIPSSLSKCSLLQTLSLPFNNFSGHV  204
                     LP ++G ++P L+ F++ +NK  +G +P + S  S L+ L +  N+F+G +
Sbjct  371  ---------LPANIGLNVPNLEFFLVSTNKLVAGPLP-NFSNASKLRVLDMDTNSFTGFL  420

Query  203  PREFGNLTKLEKLFLRSNQLT--GAIPREIGALSSLLIVDLSNNKLYGT---FIQNLDTP  39
            P    +L  LE LFL  N LT   +    +  L +L  +DL  N L  T   F  NL TP
Sbjct  421  PSTLCSLENLEILFLFWNHLTIDASTLSCLFNLRNLTKLDLGGNPLNTTIPAFRGNLSTP  480

Query  38   *LK*LSYYN  12
                L+Y++
Sbjct  481  ----LTYFD  485


 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 90/240 (38%), Positives = 123/240 (51%), Gaps = 9/240 (4%)
 Frame = -1

Query  770  GNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            GNLS  L   +LS +N   + P +++ L  L  L    N  SG IP+    L+NL+ L+L
Sbjct  475  GNLSTPLTYFDLSISNIRGNIPVDIANLSSLIELHLEINQLSGXIPTSIQRLKNLQGLFL  534

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL-FQLKLLNLSDNHFSGSFPL  417
             +N + G +P  L  L  L  L L  N L GSIP  +G L   L+ L+L  N  +   P 
Sbjct  535  YDNKLQGHIPYELCQLXNLAELGLXHNRLSGSIPSCLGXLAXALRNLSLESNLLTSXIPS  594

Query  416  DIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV---MRSNKFSGEIPSSLSKCSLL  246
             +  L    +L+LS NSL G L  D+G    KL+  V   + +N FSG IP S+     +
Sbjct  595  SLWELKYXLHLNLSXNSLVGPLSEDIG----KLKXVVDIDLSNNHFSGNIPGSIGGLQNM  650

Query  245  QTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
              LSL  N   G +P  F  L  LE L L +N L+G IP+ + AL  L  ++LS NKL G
Sbjct  651  IXLSLANNYLQGPIPTSFKTLLSLEFLDLSNNNLSGVIPKSLEALLYLKHLNLSFNKLQG  710


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 110/249 (44%), Gaps = 34/249 (14%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L   +   L  L + + LNLS N+       ++ +L+ +  +  S N FSGNIP   G L
Sbjct  588  LTSXIPSSLWELKYXLHLNLSXNSLVGPLSEDIGKLKXVVDIDLSNNHFSGNIPGSIGGL  647

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            QN+  L L NN + G +PTS   L  LE L L  N+L G IP+ +  L  LK LNLS N 
Sbjct  648  QNMIXLSLANNYLQGPIPTSFKTLLSLEFLDLSNNNLSGVIPKSLEALLYLKHLNLSFNK  707

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
              G  P                   FG    D  + +  ++   +  N  SG IPS L  
Sbjct  708  LQGEIP---------------TGGPFGNFFAD--SFVSNVRDLGLVINNLSGVIPSKLFN  750

Query  257  CSLLQTLSLPFNNFSGHVPREFG-----------------NLTKLEKLFLRSNQLTGAIP  129
              +++ + L FN  SG +P   G                 N +KL KL + +N  TG +P
Sbjct  751  LCIIREIGLSFNQLSGSLPANIGLNAPNLEILYVARSNLSNASKLWKLDMNTNSFTGILP  810

Query  128  REIGALSSL  102
              + +L +L
Sbjct  811  TTLCSLKNL  819


 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 85/275 (31%), Positives = 124/275 (45%), Gaps = 35/275 (13%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +   LGNL++L ++N   NN   + P E+  L +L++LQ S N+ +G IPS       
Sbjct  297  GSIPKSLGNLTYLTTINFIVNNLEGTIPDEIGDLSQLEVLQLSANNLNGVIPSKLFNNSM  356

Query  611  LRFLYLGNNNISGFLPTSL-------------------------FNLSKLEVLHLGVNSL  507
            +R + L  N +SG LP ++                          N SKL VL +  NS 
Sbjct  357  IRIISLTLNQLSGGLPANIGLNVPNLEFFLVSTNKLVAGPLPNFSNASKLRVLDMDTNSF  416

Query  506  EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL----  339
             G +P  + +L  L++L L  NH +    +D   LS L NL        G  PL+     
Sbjct  417  TGFLPSTLCSLENLEILFLFWNHLT----IDASTLSCLFNLRNLTKLDLGGNPLNTTIPA  472

Query  338  --GNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKL  165
              GN    L  F +  +   G IP  ++  S L  L L  N  SG +P     L  L+ L
Sbjct  473  FRGNLSTPLTYFDLSISNIRGNIPVDIANLSSLIELHLEINQLSGXIPTSIQRLKNLQGL  532

Query  164  FLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            FL  N+L G IP E+  L +L  + L +N+L G+ 
Sbjct  533  FLYDNKLQGHIPYELCQLXNLAELGLXHNRLSGSI  567


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 97/303 (32%), Positives = 127/303 (42%), Gaps = 51/303 (17%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKIL--------------QCSF  660
            LV    P+  N S L  L++  N+F    P  L  L  L+IL               C F
Sbjct  392  LVAGPLPNFSNASKLRVLDMDTNSFTGFLPSTLCSLENLEILFLFWNHLTIDASTLSCLF  451

Query  659  N-------DFSGN-----IPSWFGLLQN-LRFLYLGNNNISGFLPTSLFNLSKLEVLHLG  519
            N       D  GN     IP++ G L   L +  L  +NI G +P  + NLS L  LHL 
Sbjct  452  NLRNLTKLDLGGNPLNTTIPAFRGNLSTPLTYFDLSISNIRGNIPVDIANLSSLIELHLE  511

Query  518  VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL  339
            +N L G IP  I  L  L+ L L DN   G  P ++  L  L  L L  N L G +P  L
Sbjct  512  INQLSGXIPTSIQRLKNLQGLFLYDNKLQGHIPYELCQLXNLAELGLXHNRLSGSIPSCL  571

Query  338  GNHLPKLQIFVMRSNKFSGEIPSSL------------------------SKCSLLQTLSL  231
            G     L+   + SN  +  IPSSL                         K   +  + L
Sbjct  572  GXLAXALRNLSLESNLLTSXIPSSLWELKYXLHLNLSXNSLVGPLSEDIGKLKXVVDIDL  631

Query  230  PFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQN  51
              N+FSG++P   G L  +  L L +N L G IP     L SL  +DLSNN L G   ++
Sbjct  632  SNNHFSGNIPGSIGGLQNMIXLSLANNYLQGPIPTSFKTLLSLEFLDLSNNNLSGVIPKS  691

Query  50   LDT  42
            L+ 
Sbjct  692  LEA  694



>ref|XP_009760562.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana sylvestris]
Length=1153

 Score =   253 bits (645),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 209/319 (66%), Gaps = 6/319 (2%)
 Frame = -1

Query  1016  FHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSR  837
              H++  CL +N    I+TD+ +L +LK+ I+ DP+ IL+ NWS +S + CNWIG+TC SR
Sbjct  19    LHNIAACLALN----ISTDQSSLQALKAHITSDPNHILSKNWS-SSTSVCNWIGITCGSR  73

Query  836   HNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFN  657
             H RV+ LN+  MG +G + P LGNLSFLVSL+LS NNF+   P E S LR+L+ +  SFN
Sbjct  74    HQRVTVLNVSGMGFIGTIPPQLGNLSFLVSLDLSVNNFYGELPLEFSHLRKLRAINLSFN  133

Query  656   DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN  477
              F G IP + G  ++LR L +  N+  GF+P+S+ N+  LE+L++  N LEG+IP  I  
Sbjct  134   RFFGQIPPFLGDFKDLRMLSVETNDFKGFIPSSISNMKNLEILNMRFNYLEGNIPAGIAT  193

Query  476   LFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRS  297
             L  LKLL+L  N  +GS  L ILN+S LENL L  ++L G+LP DL   LP+LQI  + S
Sbjct  194   LQSLKLLSLGFNKLNGSNVLSILNISSLENLDLGGSALTGDLPSDLCRRLPRLQILDLES  253

Query  296   NKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIG  117
             N  SG+IP ++S+CS LQ L L  N+F G +P E GNL  L+ L L  N L G IP EIG
Sbjct  254   NMLSGQIPRTISECSELQFLWLSENDFVGTIPGEVGNLQLLKGLDLGHNTLEGRIPDEIG  313

Query  116   ALSSLLIVDLSNNKLYGTF  60
              L+   +V + NNKL G+ 
Sbjct  314   HLNLDYLV-VQNNKLTGSI  331


 Score =   114 bits (285),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 117/218 (54%), Gaps = 1/218 (0%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            VG +  ++GNL  L  L+L  N      P E+  L  L  L    N  +G+IP     + 
Sbjct  281  VGTIPGEVGNLQLLKGLDLGHNTLEGRIPDEIGHLN-LDYLVVQNNKLTGSIPLTIFDIS  339

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            +L  LY+ NN + G LP  + NL+ L VL LG N L G+IP EIG+L Q+  L L  N+F
Sbjct  340  SLGLLYMRNNKLEGPLPREVGNLTLLSVLDLGNNKLTGAIPDEIGSLQQMTQLQLDLNNF  399

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            SGS P+ I N+S L  +SL+ N + G +P  +G+  P ++   +  N  +G +PSS+S  
Sbjct  400  SGSIPVGIFNMSSLVRISLAQNHISGNIPSTIGHWPPNIEQIHLLDNNINGVLPSSISNL  459

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
            S+L  L L  N   G +P   GNLT L  + L  N  T
Sbjct  460  SMLTVLKLGGNKLEGSIPNSLGNLTILGVVDLYGNSFT  497


 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 133/293 (45%), Gaps = 34/293 (12%)
 Frame = -1

Query  836  HNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFN  657
            H  +  L + N  L G +   + ++S L  L +  N      PRE+  L  L +L    N
Sbjct  314  HLNLDYLVVQNNKLTGSIPLTIFDISSLGLLYMRNNKLEGPLPREVGNLTLLSVLDLGNN  373

Query  656  DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG-  480
              +G IP   G LQ +  L L  NN SG +P  +FN+S L  + L  N + G+IP  IG 
Sbjct  374  KLTGAIPDEIGSLQQMTQLQLDLNNFSGSIPVGIFNMSSLVRISLAQNHISGNIPSTIGH  433

Query  479  ---NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIF  309
               N+ Q+ LL   DN+ +G  P  I NLS L  L L  N L G +P  LGN L  L + 
Sbjct  434  WPPNIEQIHLL---DNNINGVLPSSISNLSMLTVLKLGGNKLEGSIPNSLGN-LTILGVV  489

Query  308  VMRSNKFSGE--------------------------IPSSLSKCSLLQTLSLPFNNFSGH  207
             +  N F+ +                          +P S+   S LQT S    N  GH
Sbjct  490  DLYGNSFTSDLSFITPLANSKFLRELILSFNPLNAMLPKSIGNISSLQTFSADGCNLRGH  549

Query  206  VPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            +P E GNL  L  L L  N+ TG +PR I +L SL    L  N++ G F + L
Sbjct  550  IPVEIGNLRDLSSLKLEDNEFTGIVPRTISSLKSLQQFSLGANRITGPFPKEL  602


 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 84/240 (35%), Positives = 124/240 (52%), Gaps = 1/240 (0%)
 Frame = -1

Query  785  LTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLR  606
            L   +GN+S L + +    N     P E+  LR L  L+   N+F+G +P     L++L+
Sbjct  526  LPKSIGNISSLQTFSADGCNLRGHIPVEIGNLRDLSSLKLEDNEFTGIVPRTISSLKSLQ  585

Query  605  FLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGS  426
               LG N I+G  P  L  LS L +L+L  N ++GSIP  +G++  L+ + L  N+FS  
Sbjct  586  QFSLGANRITGPFPKELCELSNLGLLNLSQNQMQGSIPSCLGDVTSLREVYLDSNNFSAI  645

Query  425  FPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLL  246
             P  +  L  +  L+LS N   G LPL+ GN    + +  +  N+ SG IPS+L     L
Sbjct  646  IPSSLGKLKDILKLNLSSNFFNGSLPLEFGNLKSAIHV-DLSWNQISGNIPSTLGGLQKL  704

Query  245  QTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
              LSL  N   G +P  FG L  LE L L  N ++G IP  +  L  L   ++S N+L+G
Sbjct  705  TQLSLAHNRIKGSIPETFGKLINLEALDLSYNNISGVIPMSLEELKQLGSFNVSFNRLHG  764


 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 88/258 (34%), Positives = 135/258 (52%), Gaps = 3/258 (1%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN--SFPRELSQLRRLKILQCSFND  654
            ++ L L    L G +   LGNL+ L  ++L  N+F +  SF   L+  + L+ L  SFN 
Sbjct  462  LTVLKLGGNKLEGSIPNSLGNLTILGVVDLYGNSFTSDLSFITPLANSKFLRELILSFNP  521

Query  653  FSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
             +  +P   G + +L+       N+ G +P  + NL  L  L L  N   G +PR I +L
Sbjct  522  LNAMLPKSIGNISSLQTFSADGCNLRGHIPVEIGNLRDLSSLKLEDNEFTGIVPRTISSL  581

Query  473  FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSN  294
              L+  +L  N  +G FP ++  LS L  L+LS N + G +P  LG+ +  L+   + SN
Sbjct  582  KSLQQFSLGANRITGPFPKELCELSNLGLLNLSQNQMQGSIPSCLGD-VTSLREVYLDSN  640

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGA  114
             FS  IPSSL K   +  L+L  N F+G +P EFGNL     + L  NQ++G IP  +G 
Sbjct  641  NFSAIIPSSLGKLKDILKLNLSSNFFNGSLPLEFGNLKSAIHVDLSWNQISGNIPSTLGG  700

Query  113  LSSLLIVDLSNNKLYGTF  60
            L  L  + L++N++ G+ 
Sbjct  701  LQKLTQLSLAHNRIKGSI  718


 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 72/233 (31%), Positives = 105/233 (45%), Gaps = 25/233 (11%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +S+L L +    G +   + +L  L   +L  N     FP+EL +L  L +L  S N   
Sbjct  560  LSSLKLEDNEFTGIVPRTISSLKSLQQFSLGANRITGPFPKELCELSNLGLLNLSQNQMQ  619

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G+IPS  G + +LR +YL +NN S  +P+SL  L  +  L+L  N   GS+P E GNL  
Sbjct  620  GSIPSCLGDVTSLREVYLDSNNFSAIIPSSLGKLKDILKLNLSSNFFNGSLPLEFGNLKS  679

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
               ++LS N  SG+ P  +                           L KL    +  N+ 
Sbjct  680  AIHVDLSWNQISGNIPSTL-------------------------GGLQKLTQLSLAHNRI  714

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             G IP +  K   L+ L L +NN SG +P     L +L    +  N+L G IP
Sbjct  715  KGSIPETFGKLINLEALDLSYNNISGVIPMSLEELKQLGSFNVSFNRLHGEIP  767



>emb|CDP21532.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 138/314 (44%), Positives = 188/314 (60%), Gaps = 6/314 (2%)
 Frame = -1

Query  1058  MEITRHYFCLSIFFFHSLML----CLTINAHTNITTDKHALLSLKSKISFDPHSILADNW  891
             M+ T   F  ++   H +       +  N H N  +D +ALL+ K+ I FDP  I+  NW
Sbjct  1     MQTTYFLFVAALVLLHFVTTGSASIIVANNHNNSASDHNALLAFKAAI-FDPQRIIPTNW  59

Query  890   SVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSF  711
             S  S + CNWIG+TCN+RH+RV+A++L  M + G + P LGNLSFLV LN+  N+FH   
Sbjct  60    ST-STSVCNWIGITCNARHHRVAAIDLSYMRIAGTMPPQLGNLSFLVRLNVMNNSFHGHL  118

Query  710   PRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEV  531
             P ELS+LRRLK +    N F G +PSW G L  LR+L   +N  SG L   L N +KLE 
Sbjct  119   PTELSRLRRLKYISLEGNAFEGELPSWLGGLTALRYLSFRDNGFSGSLSGRLSNFTKLET  178

Query  530   LHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGEL  351
             + LG N   G++  E   L +LKLL +  N  +G  PL + NLS L+    + NSL G L
Sbjct  179   IRLGFNFFTGNLSEEFSALPKLKLLEIQYNQLAGPLPLALFNLSSLQVFGFTSNSLSGYL  238

Query  350   PLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLE  171
             P  + ++LP+LQ F +  N   GEIPS + +CS LQ LSL +N F G++P+EF NLT L 
Sbjct  239   PAHICDYLPQLQGFYLSLNNIEGEIPSGIGECSGLQVLSLSYNKFRGYIPKEFWNLTTLT  298

Query  170   KLFLRSNQLTGAIP  129
             ++ L  N LTG +P
Sbjct  299   QIALGGNDLTGKLP  312


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 96/200 (48%), Gaps = 30/200 (15%)
 Frame = -1

Query  650  SGNIPSWFGLLQNLRF-----LYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            S ++ +W G+  N R      + L    I+G +P  L NLS L  L++  NS  G +P E
Sbjct  62   STSVCNWIGITCNARHHRVAAIDLSYMRIAGTMPPQLGNLSFLVRLNVMNNSFHGHLPTE  121

Query  485  IGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
            +  L +LK ++L  N F G                        ELP  LG  L  L+   
Sbjct  122  LSRLRRLKYISLEGNAFEG------------------------ELPSWLGG-LTALRYLS  156

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
             R N FSG +   LS  + L+T+ L FN F+G++  EF  L KL+ L ++ NQL G +P 
Sbjct  157  FRDNGFSGSLSGRLSNFTKLETIRLGFNFFTGNLSEEFSALPKLKLLEIQYNQLAGPLPL  216

Query  125  EIGALSSLLIVDLSNNKLYG  66
             +  LSSL +   ++N L G
Sbjct  217  ALFNLSSLQVFGFTSNSLSG  236



>ref|XP_009763990.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X3 [Nicotiana sylvestris]
Length=959

 Score =   251 bits (641),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 148/330 (45%), Positives = 210/330 (64%), Gaps = 3/330 (1%)
 Frame = -1

Query  1037  FCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWI  858
             F L++F    L    ++ +  NI+TD+ ALL+LKS IS  P++ILA NWS + +  C+WI
Sbjct  9     FALAVFIL--LHDHTSLASVANISTDEAALLALKSHISSGPNNILARNWSSSGLV-CSWI  65

Query  857   GVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLK  678
             G+TC+SRH+RV+ALN+ +M L G + P LGNLSFL S+++S N F+   P EL+ L+RLK
Sbjct  66    GITCSSRHHRVTALNISSMQLHGTIPPHLGNLSFLTSIDISNNTFYGELPEELAHLQRLK  125

Query  677   ILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGS  498
             ++  + N+F+G IPS+  LL NLRFL L  N  SG +P+ L NL+KL+VL +  N L+G 
Sbjct  126   LIDITSNNFTGAIPSFLRLLPNLRFLNLSTNQFSGEIPSFLSNLTKLQVLRIQGNFLQGE  185

Query  497   IPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKL  318
             IPRE+G+L  +  L+L  N  +G  P  I N+  ++ + L+ N L G+LP  + ++LP L
Sbjct  186   IPRELGDLRYMVFLDLQFNQLNGFIPPSIFNIRTMQKIGLTGNKLTGKLPTTICDNLPNL  245

Query  317   QIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
             +   +  N   G IP +L KC  LQ LSL  N F G VPRE  NLT L +L+L    L G
Sbjct  246   EGLYLSKNYIGGAIPPNLGKCRKLQILSLSINEFIGAVPRELANLTALTRLYLGFLHLEG  305

Query  137   AIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
              IP E+G L  L  + LSNN+  G+   N+
Sbjct  306   EIPAELGNLKKLQALKLSNNEFTGSVPANI  335


 Score =   120 bits (302),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 96/259 (37%), Positives = 132/259 (51%), Gaps = 8/259 (3%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN-------I  639
            L GE+  +LGNL  L +L LS N F  S P  +  +  L+ LQ S N  SG        I
Sbjct  303  LEGEIPAELGNLKKLQALKLSNNEFTGSVPANIFNMSALQTLQLSQNKLSGQDCQLKGVI  362

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKL  459
            P   G L  +  + L NN ++G +P ++  +  L+ L+L  N LEG+IP  I NL  L  
Sbjct  363  PKEIGNLTGVTKMSLSNNELTGHIPNTIQGMLNLQELYLQNNKLEGTIPDVICNLKNLGA  422

Query  458  LNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGE  279
            L LS N FSGS P  +  ++ L  L L+ N L   LP +LG  L  L  F + SN  SG+
Sbjct  423  LYLSGNEFSGSVPPCLGKVTSLRYLYLAYNRLNSSLPENLG-ALHDLIKFDISSNLLSGK  481

Query  278  IPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLL  99
            IP  +     +  + L  NNFSG +P   G L  + KL L  N+L G IP   G + +L 
Sbjct  482  IPVEIGNIKAVTLIDLSKNNFSGKIPSTLGRLDNVIKLSLAHNRLDGPIPESFGKMLALN  541

Query  98   IVDLSNNKLYGTFIQNLDT  42
             +DL  N L G   ++L+ 
Sbjct  542  FLDLCYNNLNGEIPKSLEA  560


 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 137/276 (50%), Gaps = 33/276 (12%)
 Frame = -1

Query  797  LVGEL-TPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF----------  651
            L G+L T    NL  L  L LS+N    + P  L + R+L+IL  S N+F          
Sbjct  230  LTGKLPTTICDNLPNLEGLYLSKNYIGGAIPPNLGKCRKLQILSLSINEFIGAVPRELAN  289

Query  650  --------------SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVN  513
                           G IP+  G L+ L+ L L NN  +G +P ++FN+S L+ L L  N
Sbjct  290  LTALTRLYLGFLHLEGEIPAELGNLKKLQALKLSNNEFTGSVPANIFNMSALQTLQLSQN  349

Query  512  -------SLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGE  354
                    L+G IP+EIGNL  +  ++LS+N  +G  P  I  +  L+ L L  N L G 
Sbjct  350  KLSGQDCQLKGVIPKEIGNLTGVTKMSLSNNELTGHIPNTIQGMLNLQELYLQNNKLEGT  409

Query  353  LPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKL  174
            +P D+  +L  L    +  N+FSG +P  L K + L+ L L +N  +  +P   G L  L
Sbjct  410  IP-DVICNLKNLGALYLSGNEFSGSVPPCLGKVTSLRYLYLAYNRLNSSLPENLGALHDL  468

Query  173  EKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             K  + SN L+G IP EIG + ++ ++DLS N   G
Sbjct  469  IKFDISSNLLSGKIPVEIGNIKAVTLIDLSKNNFSG  504


 Score =   118 bits (296),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 137/262 (52%), Gaps = 8/262 (3%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNS-------FPRELSQLRRLKIL  672
            ++ AL L N    G +  ++ N+S L +L LSQN             P+E+  L  +  +
Sbjct  316  KLQALKLSNNEFTGSVPANIFNMSALQTLQLSQNKLSGQDCQLKGVIPKEIGNLTGVTKM  375

Query  671  QCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIP  492
              S N+ +G+IP+    + NL+ LYL NN + G +P  + NL  L  L+L  N   GS+P
Sbjct  376  SLSNNELTGHIPNTIQGMLNLQELYLQNNKLEGTIPDVICNLKNLGALYLSGNEFSGSVP  435

Query  491  REIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQI  312
              +G +  L+ L L+ N  + S P ++  L  L    +S N L G++P+++GN +  + +
Sbjct  436  PCLGKVTSLRYLYLAYNRLNSSLPENLGALHDLIKFDISSNLLSGKIPVEIGN-IKAVTL  494

Query  311  FVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAI  132
              +  N FSG+IPS+L +   +  LSL  N   G +P  FG +  L  L L  N L G I
Sbjct  495  IDLSKNNFSGKIPSTLGRLDNVIKLSLAHNRLDGPIPESFGKMLALNFLDLCYNNLNGEI  554

Query  131  PREIGALSSLLIVDLSNNKLYG  66
            P+ + AL  L  +++S NKL G
Sbjct  555  PKSLEALVYLRYLNVSFNKLSG  576


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 117/232 (50%), Gaps = 5/232 (2%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            V+ ++L N  L G +   +  +  L  L L  N    + P  +  L+ L  L  S N+FS
Sbjct  372  VTKMSLSNNELTGHIPNTIQGMLNLQELYLQNNKLEGTIPDVICNLKNLGALYLSGNEFS  431

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G++P   G + +LR+LYL  N ++  LP +L  L  L    +  N L G IP EIGN+  
Sbjct  432  GSVPPCLGKVTSLRYLYLAYNRLNSSLPENLGALHDLIKFDISSNLLSGKIPVEIGNIKA  491

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
            + L++LS N+FSG  P  +  L  +  LSL+ N L G +P   G  L  L    +  N  
Sbjct  492  VTLIDLSKNNFSGKIPSTLGRLDNVIKLSLAHNRLDGPIPESFGKML-ALNFLDLCYNNL  550

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPR--EFGNLTKLEKLFLRSNQLTG  138
            +GEIP SL     L+ L++ FN  SG +P    F N T   + FL ++ L G
Sbjct  551  NGEIPKSLEALVYLRYLNVSFNKLSGEIPTGGPFANATY--QSFLSNDALCG  600



>ref|XP_006367573.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1-like [Solanum tuberosum]
Length=610

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 154/317 (49%), Positives = 204/317 (64%), Gaps = 12/317 (4%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFN  804
            + TNITTD+ ALLSLKS+IS +P   L ++WS  +I  C W+GVTC+ RH RV +LNL +
Sbjct  21   SQTNITTDQLALLSLKSQISSEPFHYLDESWSP-AINVCRWVGVTCDYRHQRVKSLNLSD  79

Query  803  MGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
            M L G +  D GNL+FLVSL+L +NNFH + P+E+  LRRLK L+ SFN F G IPSWFG
Sbjct  80   MALTGRIPRDFGNLTFLVSLDLGRNNFHGNLPQEMVLLRRLKFLKLSFNKFRGEIPSWFG  139

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
             L+ L+ L L NN+ +GF+P SL N S+LE L +  N LEG+IP EIGNL  LK L++  
Sbjct  140  FLKQLQVLNLKNNSFTGFIPPSLSNASRLETLEISANLLEGNIPEEIGNLHNLKWLSIQQ  199

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N  +GS P  I N+S ++ ++ + NSL G LP  L N LP L+   +  NK  G +P SL
Sbjct  200  NQVTGSIPFTIFNISSIQVIAFTYNSLSGNLPNGLCNGLPILKGLYLSMNKLDGHMPKSL  259

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ-----LTGAIPREIGA----L  111
            S CS LQTLSL  N+F G +  E G L+ L+ L L+SN      L+G +P  IG+    +
Sbjct  260  SNCSQLQTLSLSGNDFDGRIHSEIGRLSNLQTLLLKSNHFTGNNLSGTLPPNIGSTLPNI  319

Query  110  SSLLIVDLSNNKLYGTF  60
              L +  L+N  L GT 
Sbjct  320  DGLYLASLTN--LVGTI  334


 Score = 85.5 bits (210),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 86/250 (34%), Positives = 129/250 (52%), Gaps = 13/250 (5%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            +G   P++  L +L SL     N   + P  +S   +L  L+ S N  +G IP+  G L 
Sbjct  312  IGSTLPNIDGL-YLASLT----NLVGTIPHSISNCSKLTDLELSDNKLTGLIPNSLGYLT  366

Query  614  NLRFLYLGNNNISG--FLP--TSLFNLSKLEVLHLGVNSLEGSIPREIGNL-FQLKLLNL  450
            +L FL L  NN++   FL   TSL N  +L  L L  N L G +P  +GN    L + ++
Sbjct  367  HLNFLNLWGNNLTSDSFLSFLTSLTNCRRLTNLDLSSNPLNGMLPVSVGNFSISLIMFDV  426

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
            +  +  G  P ++ NLS L +L LS N+  G +P  + N L  LQ   + +NK +G I  
Sbjct  427  NACNIKGKIPNEVGNLSNLLDLDLSDNNFIGSMPTSIHN-LRSLQHLDLNNNKLTGFIGD  485

Query  269  SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVD  90
            +L K   L  + L  N  SG +P   GN+T L  ++L SN+L+  IP  +G L  L+ + 
Sbjct  486  NLCKLQHLGDIYLGQNQLSGSLPNCLGNVTSLRLIYLDSNKLSSNIPTSLGNLKDLIELH  545

Query  89   LSNNKL--YG  66
            LS+N +  YG
Sbjct  546  LSSNNMVEYG  555


 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 127/257 (49%), Gaps = 11/257 (4%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN------IP  636
            L G +   L N S L +L+LS N+F      E+ +L  L+ L    N F+GN       P
Sbjct  251  LDGHMPKSLSNCSQLQTLSLSGNDFDGRIHSEIGRLSNLQTLLLKSNHFTGNNLSGTLPP  310

Query  635  SWFGLLQNLRFLYLGN-NNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKL  459
            +    L N+  LYL +  N+ G +P S+ N SKL  L L  N L G IP  +G L  L  
Sbjct  311  NIGSTLPNIDGLYLASLTNLVGTIPHSISNCSKLTDLELSDNKLTGLIPNSLGYLTHLNF  370

Query  458  LNLSDNHFSG----SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
            LNL  N+ +     SF   + N  +L NL LS N L G LP+ +GN    L +F + +  
Sbjct  371  LNLWGNNLTSDSFLSFLTSLTNCRRLTNLDLSSNPLNGMLPVSVGNFSISLIMFDVNACN  430

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
              G+IP+ +   S L  L L  NNF G +P    NL  L+ L L +N+LTG I   +  L
Sbjct  431  IKGKIPNEVGNLSNLLDLDLSDNNFIGSMPTSIHNLRSLQHLDLNNNKLTGFIGDNLCKL  490

Query  110  SSLLIVDLSNNKLYGTF  60
              L  + L  N+L G+ 
Sbjct  491  QHLGDIYLGQNQLSGSL  507


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 1/138 (1%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND  654
            R++ L+L +  L G L   +GN S  L+  +++  N     P E+  L  L  L  S N+
Sbjct  395  RLTNLDLSSNPLNGMLPVSVGNFSISLIMFDVNACNIKGKIPNEVGNLSNLLDLDLSDNN  454

Query  653  FSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
            F G++P+    L++L+ L L NN ++GF+  +L  L  L  ++LG N L GS+P  +GN+
Sbjct  455  FIGSMPTSIHNLRSLQHLDLNNNKLTGFIGDNLCKLQHLGDIYLGQNQLSGSLPNCLGNV  514

Query  473  FQLKLLNLSDNHFSGSFP  420
              L+L+ L  N  S + P
Sbjct  515  TSLRLIYLDSNKLSSNIP  532



>ref|XP_009783787.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Nicotiana 
sylvestris]
Length=1182

 Score =   252 bits (643),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 149/332 (45%), Positives = 210/332 (63%), Gaps = 5/332 (2%)
 Frame = -1

Query  1037  FCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISF-DPHS-ILADNWSVNSITPCN  864
             F L++F        L I    +I+TDK +LL+LKS IS  DP+  I+A NWS +S   C+
Sbjct  9     FGLAVFILLHYHTSLAIVP--SISTDKDSLLALKSHISSSDPNDNIIASNWSSSSPV-CS  65

Query  863   WIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRR  684
             WIG+TC+SRHNRV+AL++ +M L G + P +GNLSFLVSLN+S NNFH   P ELS L+R
Sbjct  66    WIGITCSSRHNRVTALDISSMQLYGTVPPHVGNLSFLVSLNISNNNFHGELPEELSHLQR  125

Query  683   LKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLE  504
             LK++    N+F+G +PS+  LL NLR L L +N   G +P S  NL+KLE L +  N LE
Sbjct  126   LKMIIVESNNFTGVVPSFLSLLPNLRILRLASNQFYGKIPPSFSNLTKLEGLSVARNFLE  185

Query  503   GSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLP  324
             G IPRE+GNL  + +L+L +NH +GS P  I N++ +  ++L  N++ G LP  +  +LP
Sbjct  186   GEIPRELGNLRYITILDLQENHLTGSIPPSIFNITTMRIITLFKNNVAGNLPTTICENLP  245

Query  323   KLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQL  144
              L++  +  N   G IP+++ KC  L+ LSL  N F+G VPRE  NL  L +L+L    L
Sbjct  246   NLEVLHIPVNNLDGVIPTNIGKCRKLRILSLSGNKFTGTVPRELANLKDLTELYLGYQHL  305

Query  143   TGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
              G IP E+G L  L ++ L+ N   G+   N+
Sbjct  306   QGEIPAELGNLKKLRLLGLNKNDFTGSIPSNI  337


 Score =   138 bits (348),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 102/261 (39%), Positives = 150/261 (57%), Gaps = 1/261 (0%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQ-LRRLKILQCSFNDF  651
            ++ L+L    L G + P + N++ +  + L +NN   + P  + + L  L++L    N+ 
Sbjct  198  ITILDLQENHLTGSIPPSIFNITTMRIITLFKNNVAGNLPTTICENLPNLEVLHIPVNNL  257

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
             G IP+  G  + LR L L  N  +G +P  L NL  L  L+LG   L+G IP E+GNL 
Sbjct  258  DGVIPTNIGKCRKLRILSLSGNKFTGTVPRELANLKDLTELYLGYQHLQGEIPAELGNLK  317

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
            +L+LL L+ N F+GS P +I N+  L+ L LSVN L G LP D G  +P L+ F   SN 
Sbjct  318  KLRLLGLNKNDFTGSIPSNIFNMPALQILELSVNRLSGRLPSDFGRGIPSLEFFFCGSNN  377

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
             SG I +S+S  S L+TL L +N+F+G +P E GNL  L+ L L  N+ T ++P  I  +
Sbjct  378  LSGSISASISNSSRLRTLDLSYNSFTGEIPAELGNLNNLQYLDLTENKFTSSVPASILNI  437

Query  110  SSLLIVDLSNNKLYGTFIQNL  48
            S+L I+ L  N+L GT   +L
Sbjct  438  SALRILGLGVNRLSGTLPSDL  458


 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 143/268 (53%), Gaps = 5/268 (2%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            R+  L+L      GE+  +LGNL+ L  L+L++N F +S P  +  +  L+IL    N  
Sbjct  391  RLRTLDLSYNSFTGEIPAELGNLNNLQYLDLTENKFTSSVPASILNISALRILGLGVNRL  450

Query  650  SGNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
            SG +PS  G  + +L  L  G+NN+SGF+  ++ N S+L  L L +N   G IP  +GNL
Sbjct  451  SGTLPSDLGRKMPSLEDLLCGDNNLSGFISATISNSSRLRKLDLTLNRFTGPIPESLGNL  510

Query  473  FQLKLLNLSDNHFSG----SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
              L++L L  N+FS     SF   + N  KL +L  S N   G LP  +GN    LQI  
Sbjct  511  EYLEVLALGANNFSSDSTLSFLTPLTNCRKLRSLRFSDNPFDGVLPPSVGNFSNSLQILD  570

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
             +  K  G IP  +   + +  +SL  N  SG++P+    + KL++++L  N++ G IP 
Sbjct  571  GQGCKLKGFIPEEIGNVTGMTRMSLFNNELSGYIPKTIERMLKLQEIYLHKNKIGGTIPD  630

Query  125  EIGALSSLLIVDLSNNKLYGTFIQNLDT  42
             I  L +L  +DLS N++ G+    L T
Sbjct  631  VICNLQNLGELDLSGNQITGSVPPCLGT  658


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 126/255 (49%), Gaps = 25/255 (10%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            ++  L+L      G +  +L NL  L  L L   +     P EL  L++L++L  + NDF
Sbjct  270  KLRILSLSGNKFTGTVPRELANLKDLTELYLGYQHLQGEIPAELGNLKKLRLLGLNKNDF  329

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSL-------------------------FNL  546
            +G+IPS    +  L+ L L  N +SG LP+                            N 
Sbjct  330  TGSIPSNIFNMPALQILELSVNRLSGRLPSDFGRGIPSLEFFFCGSNNLSGSISASISNS  389

Query  545  SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvns  366
            S+L  L L  NS  G IP E+GNL  L+ L+L++N F+ S P  ILN+S L  L L VN 
Sbjct  390  SRLRTLDLSYNSFTGEIPAELGNLNNLQYLDLTENKFTSSVPASILNISALRILGLGVNR  449

Query  365  LFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGN  186
            L G LP DLG  +P L+  +   N  SG I +++S  S L+ L L  N F+G +P   GN
Sbjct  450  LSGTLPSDLGRKMPSLEDLLCGDNNLSGFISATISNSSRLRKLDLTLNRFTGPIPESLGN  509

Query  185  LTKLEKLFLRSNQLT  141
            L  LE L L +N  +
Sbjct  510  LEYLEVLALGANNFS  524


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 116/223 (52%), Gaps = 1/223 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +  ++GN++ +  ++L  N      P+ + ++ +L+ +    N   G IP     L
Sbjct  576  LKGFIPEEIGNVTGMTRMSLFNNELSGYIPKTIERMLKLQEIYLHKNKIGGTIPDVICNL  635

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            QNL  L L  N I+G +P  L  ++ L  L+L  N L   +P  +G+L  +   N+S N 
Sbjct  636  QNLGELDLSGNQITGSVPPCLGTITSLRKLNLAYNRLNSRLPASLGSLRDIIEFNVSSNL  695

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             SG  PL+I NL     + LS N+  G +P  +G  L +L  F +  NK  G IP SL K
Sbjct  696  LSGQIPLEIGNLKAATLIELSKNNFSGNIPSSIGG-LDRLTNFSLAHNKLDGPIPDSLGK  754

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
               L+ L L FNN SG +P+   +L  +++L +  N+L+G IP
Sbjct  755  ILALEFLDLSFNNLSGEIPKSLEDLVYIKQLNISFNKLSGEIP  797


 Score =   104 bits (260),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 142/295 (48%), Gaps = 30/295 (10%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLKI  675
            S  +R+  L+L      G +   LGNL +L  L L  NNF +    SF   L+  R+L+ 
Sbjct  484  SNSSRLRKLDLTLNRFTGPIPESLGNLEYLEVLALGANNFSSDSTLSFLTPLTNCRKLRS  543

Query  674  LQCSFNDFSGN-------------------------IPSWFGLLQNLRFLYLGNNNISGF  570
            L+ S N F G                          IP   G +  +  + L NN +SG+
Sbjct  544  LRFSDNPFDGVLPPSVGNFSNSLQILDGQGCKLKGFIPEEIGNVTGMTRMSLFNNELSGY  603

Query  569  LPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlskle  390
            +P ++  + KL+ ++L  N + G+IP  I NL  L  L+LS N  +GS P  +  ++ L 
Sbjct  604  IPKTIERMLKLQEIYLHKNKIGGTIPDVICNLQNLGELDLSGNQITGSVPPCLGTITSLR  663

Query  389  nlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSG  210
             L+L+ N L   LP  LG+ L  +  F + SN  SG+IP  +        + L  NNFSG
Sbjct  664  KLNLAYNRLNSRLPASLGS-LRDIIEFNVSSNLLSGQIPLEIGNLKAATLIELSKNNFSG  722

Query  209  HVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLD  45
            ++P   G L +L    L  N+L G IP  +G + +L  +DLS N L G   ++L+
Sbjct  723  NIPSSIGGLDRLTNFSLAHNKLDGPIPDSLGKILALEFLDLSFNNLSGEIPKSLE  777


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 119/243 (49%), Gaps = 2/243 (1%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSF-PRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            G L P +GN S  + +   Q      F P E+  +  +  +    N+ SG IP     + 
Sbjct  553  GVLPPSVGNFSNSLQILDGQGCKLKGFIPEEIGNVTGMTRMSLFNNELSGYIPKTIERML  612

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             L+ +YL  N I G +P  + NL  L  L L  N + GS+P  +G +  L+ LNL+ N  
Sbjct  613  KLQEIYLHKNKIGGTIPDVICNLQNLGELDLSGNQITGSVPPCLGTITSLRKLNLAYNRL  672

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            +   P  + +L  +   ++S N L G++PL++GN L    +  +  N FSG IPSS+   
Sbjct  673  NSRLPASLGSLRDIIEFNVSSNLLSGQIPLEIGN-LKAATLIELSKNNFSGNIPSSIGGL  731

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              L   SL  N   G +P   G +  LE L L  N L+G IP+ +  L  +  +++S NK
Sbjct  732  DRLTNFSLAHNKLDGPIPDSLGKILALEFLDLSFNNLSGEIPKSLEDLVYIKQLNISFNK  791

Query  74   LYG  66
            L G
Sbjct  792  LSG  794


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 81/162 (50%), Gaps = 7/162 (4%)
 Frame = -1

Query  905  LADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNN  726
            L+ N    S+ PC  +G   + R      LNL    L   L   LG+L  ++  N+S N 
Sbjct  643  LSGNQITGSVPPC--LGTITSLRK-----LNLAYNRLNSRLPASLGSLRDIIEFNVSSNL  695

Query  725  FHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNL  546
                 P E+  L+   +++ S N+FSGNIPS  G L  L    L +N + G +P SL  +
Sbjct  696  LSGQIPLEIGNLKAATLIELSKNNFSGNIPSSIGGLDRLTNFSLAHNKLDGPIPDSLGKI  755

Query  545  SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
              LE L L  N+L G IP+ + +L  +K LN+S N  SG  P
Sbjct  756  LALEFLDLSFNNLSGEIPKSLEDLVYIKQLNISFNKLSGEIP  797


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 2/145 (1%)
 Frame = -1

Query  854  VTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKI  675
            V CN ++  +  L+L    + G + P LG ++ L  LNL+ N  ++  P  L  LR +  
Sbjct  631  VICNLQN--LGELDLSGNQITGSVPPCLGTITSLRKLNLAYNRLNSRLPASLGSLRDIIE  688

Query  674  LQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSI  495
               S N  SG IP   G L+    + L  NN SG +P+S+  L +L    L  N L+G I
Sbjct  689  FNVSSNLLSGQIPLEIGNLKAATLIELSKNNFSGNIPSSIGGLDRLTNFSLAHNKLDGPI  748

Query  494  PREIGNLFQLKLLNLSDNHFSGSFP  420
            P  +G +  L+ L+LS N+ SG  P
Sbjct  749  PDSLGKILALEFLDLSFNNLSGEIP  773



>ref|XP_006367143.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Solanum tuberosum]
Length=837

 Score =   249 bits (637),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 158/371 (43%), Positives = 209/371 (56%), Gaps = 49/371 (13%)
 Frame = -1

Query  1028  SIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVT  849
             +I   H  ++  +    TN TTD+  LLSLKS+IS DP   L D+WS  + + C+W+G+T
Sbjct  196   AILRDHLYVMASSAMTQTNTTTDQSTLLSLKSQISSDPFHFLDDSWSP-TTSVCHWVGIT  254

Query  848   CNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ  669
             C+SRH+RV +LNL NM L G +  DLGNL+FLVSL L  NNFH + P+E+SQL RLK + 
Sbjct  255   CDSRHHRVKSLNLSNMALTGRIPRDLGNLTFLVSLVLRSNNFHGNLPQEISQLHRLKFVD  314

Query  668   CSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR  489
              S N+F G +PSWFG L  L  L L NN+ +G +P S  N+S LE L +  NS+EG IP+
Sbjct  315   LSLNNFRGEVPSWFGFLHKLEVLDLRNNSFTGSIPCSFSNISTLENLDVDFNSIEGEIPK  374

Query  488   EIGNLFQLKLLNL-----------------------------------------------  450
              IG+L  L++LNL                                               
Sbjct  375   VIGSLINLRILNLRGNNLIGSIPPSLSNASRLEVLDLSSNLLRGNIPEGIGNLQNLNWLS  434

Query  449   -SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIP  273
               DN  +GS P  I N+S++E ++ +VNSL G LP  L N LP L+   + +NK    IP
Sbjct  435   IQDNQLTGSIPFTIFNISRIEFIAFAVNSLSGNLPNGLCNRLPILKGLYLSTNKLDSHIP  494

Query  272   SSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIV  93
             +SL  CS LQ LSL  N FSG +PRE GNL  L  L + +NQ+TG+IP  I  +SSL  V
Sbjct  495   TSLPNCSELQILSLAENYFSGIIPREIGNLVNLVTLTVETNQITGSIPISIFNISSLQFV  554

Query  92    DLSNNKLYGTF  60
              L  N L G+ 
Sbjct  555   SLGTNNLKGSL  565


 Score =   116 bits (291),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 118/235 (50%), Gaps = 27/235 (11%)
 Frame = -1

Query  764  LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNN  585
            L  L  L LS N   +  P  L     L+IL  + N FSG IP   G L NL  L +  N
Sbjct  476  LPILKGLYLSTNKLDSHIPTSLPNCSELQILSLAENYFSGIIPREIGNLVNLVTLTVETN  535

Query  584  NISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIln  405
             I+G +P S+FN+S L+ + LG N+L+GS+PREIGNL +L+ L   +N F+G  P +I  
Sbjct  536  QITGSIPISIFNISSLQFVSLGTNNLKGSLPREIGNLTKLQFLYFHENRFTGEIPKEI--  593

Query  404  lsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPF  225
                                    +L +L++  +  N FSG +P  +     L  + L F
Sbjct  594  -----------------------RNLVELEVLHLAFNSFSGSLPMLIFNILALTIIDLSF  630

Query  224  NNFSGHVPREFGN-LTKLEKLFL-RSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            NN SG +P   G+ L  +E+L++ R   L G IP  I   S L  ++L+ NKL G
Sbjct  631  NNLSGTLPPNIGSTLPNIEELYMARLTNLVGTIPHSISNCSKLTHLELAENKLSG  685


 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 100/314 (32%), Positives = 139/314 (44%), Gaps = 78/314 (25%)
 Frame = -1

Query  773  LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            L N S L  L+L++N F    PRE+  L  L  L    N  +G+IP     + +L+F+ L
Sbjct  497  LPNCSELQILSLAENYFSGIIPREIGNLVNLVTLTVETNQITGSIPISIFNISSLQFVSL  556

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLD  414
            G NN+ G LP  + NL+KL+ L+   N   G IP+EI NL +L++L+L+ N FSGS P+ 
Sbjct  557  GTNNLKGSLPREIGNLTKLQFLYFHENRFTGEIPKEIRNLVELEVLHLAFNSFSGSLPML  616

Query  413  IlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMR----------------------  300
            I N+  L  + LS N+L G LP ++G+ LP ++   M                       
Sbjct  617  IFNILALTIIDLSFNNLSGTLPPNIGSTLPNIEELYMARLTNLVGTIPHSISNCSKLTHL  676

Query  299  ---SNKFSGEIP----------------------------SSLSKCSLLQTLSLPFN---  222
                NK SG IP                            +SL+ C  L +LSL FN   
Sbjct  677  ELAENKLSGLIPNSLGYLTHLHFLNLQRNNLSSDPFLSFLTSLTNCRNLTSLSLSFNPLN  736

Query  221  ----------------------NFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALS  108
                                  N +  +P E GNLT L  L L  N L+G IP     L 
Sbjct  737  GMLPVSIGNFSKSLVNFYASACNINSQIPNEVGNLTNLIDLDLTRNNLSGWIPTSTQNLR  796

Query  107  SLLIVDLSNNKLYG  66
            +L  + L+ NKL G
Sbjct  797  NLQRLYLNINKLTG  810


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 115/236 (49%), Gaps = 6/236 (3%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG-LL  618
             GE+  ++ NL  L  L+L+ N+F  S P  +  +  L I+  SFN+ SG +P   G  L
Sbjct  586  TGEIPKEIRNLVELEVLHLAFNSFSGSLPMLIFNILALTIIDLSFNNLSGTLPPNIGSTL  645

Query  617  QNLRFLYLGN-NNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
             N+  LY+    N+ G +P S+ N SKL  L L  N L G IP  +G L  L  LNL  N
Sbjct  646  PNIEELYMARLTNLVGTIPHSISNCSKLTHLELAENKLSGLIPNSLGYLTHLHFLNLQRN  705

Query  440  HFSGSFPLDIlnlsklenlslsvnsLF----GELPLDLGNHLPKLQIFVMRSNKFSGEIP  273
            + S    L  L          S++  F    G LP+ +GN    L  F   +   + +IP
Sbjct  706  NLSSDPFLSFLTSLTNCRNLTSLSLSFNPLNGMLPVSIGNFSKSLVNFYASACNINSQIP  765

Query  272  SSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSS  105
            + +   + L  L L  NN SG +P    NL  L++L+L  N+LTG I   I  +++
Sbjct  766  NEVGNLTNLIDLDLTRNNLSGWIPTSTQNLRNLQRLYLNINKLTGFIGDHICKIAA  821



>ref|XP_009763989.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Nicotiana sylvestris]
Length=1034

 Score =   251 bits (641),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 148/330 (45%), Positives = 210/330 (64%), Gaps = 3/330 (1%)
 Frame = -1

Query  1037  FCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWI  858
             F L++F    L    ++ +  NI+TD+ ALL+LKS IS  P++ILA NWS + +  C+WI
Sbjct  9     FALAVFIL--LHDHTSLASVANISTDEAALLALKSHISSGPNNILARNWSSSGLV-CSWI  65

Query  857   GVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLK  678
             G+TC+SRH+RV+ALN+ +M L G + P LGNLSFL S+++S N F+   P EL+ L+RLK
Sbjct  66    GITCSSRHHRVTALNISSMQLHGTIPPHLGNLSFLTSIDISNNTFYGELPEELAHLQRLK  125

Query  677   ILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGS  498
             ++  + N+F+G IPS+  LL NLRFL L  N  SG +P+ L NL+KL+VL +  N L+G 
Sbjct  126   LIDITSNNFTGAIPSFLRLLPNLRFLNLSTNQFSGEIPSFLSNLTKLQVLRIQGNFLQGE  185

Query  497   IPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKL  318
             IPRE+G+L  +  L+L  N  +G  P  I N+  ++ + L+ N L G+LP  + ++LP L
Sbjct  186   IPRELGDLRYMVFLDLQFNQLNGFIPPSIFNIRTMQKIGLTGNKLTGKLPTTICDNLPNL  245

Query  317   QIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
             +   +  N   G IP +L KC  LQ LSL  N F G VPRE  NLT L +L+L    L G
Sbjct  246   EGLYLSKNYIGGAIPPNLGKCRKLQILSLSINEFIGAVPRELANLTALTRLYLGFLHLEG  305

Query  137   AIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
              IP E+G L  L  + LSNN+  G+   N+
Sbjct  306   EIPAELGNLKKLQALKLSNNEFTGSVPANI  335


 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 96/256 (38%), Positives = 128/256 (50%), Gaps = 10/256 (4%)
 Frame = -1

Query  797  LVGEL-TPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G+L T    NL  L  L LS+N    + P  L + R+L+IL  S N+F G +P     
Sbjct  230  LTGKLPTTICDNLPNLEGLYLSKNYIGGAIPPNLGKCRKLQILSLSINEFIGAVPRELAN  289

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLN----  453
            L  L  LYLG  ++ G +P  L NL KL+ L L  N   GS+P  I N+  L+ L     
Sbjct  290  LTALTRLYLGFLHLEGEIPAELGNLKKLQALKLSNNEFTGSVPANIFNMSALQTLQLSQN  349

Query  452  -LSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLP---KLQIFVMRSNKFS  285
             LSDN F+G  P  + NL  LE L+   N+ FG+  L     L    KL+      N   
Sbjct  350  KLSDNSFTGPIPESLGNLEYLERLNFEENNFFGDSALSFLTSLTKCRKLRFLRFADNPLD  409

Query  284  GEIPSSLSKCS-LLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALS  108
            G  PSS+   S  LQ+         G +P+E GNLT + K+ L +N+LTG IP  I  + 
Sbjct  410  GVFPSSVGHFSNSLQSFVGQDCQLKGVIPKEIGNLTGVTKMSLSNNELTGHIPNTIQGML  469

Query  107  SLLIVDLSNNKLYGTF  60
            +L  + L NNKL GT 
Sbjct  470  NLQELYLQNNKLEGTI  485


 Score =   108 bits (270),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 91/278 (33%), Positives = 133/278 (48%), Gaps = 35/278 (13%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND-----FSGNIPS  633
            L GE+  +LGNL  L +L LS N F  S P  +  +  L+ LQ S N      F+G IP 
Sbjct  303  LEGEIPAELGNLKKLQALKLSNNEFTGSVPANIFNMSALQTLQLSQNKLSDNSFTGPIPE  362

Query  632  WFGLLQ----------------------------NLRFLYLGNNNISGFLPTSLFNLSKL  537
              G L+                             LRFL   +N + G  P+S+ + S  
Sbjct  363  SLGNLEYLERLNFEENNFFGDSALSFLTSLTKCRKLRFLRFADNPLDGVFPSSVGHFSNS  422

Query  536  EVLHLGVN-SLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLF  360
                +G +  L+G IP+EIGNL  +  ++LS+N  +G  P  I  +  L+ L L  N L 
Sbjct  423  LQSFVGQDCQLKGVIPKEIGNLTGVTKMSLSNNELTGHIPNTIQGMLNLQELYLQNNKLE  482

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P D+  +L  L    +  N+FSG +P  L K + L+ L L +N  +  +P   G L 
Sbjct  483  GTIP-DVICNLKNLGALYLSGNEFSGSVPPCLGKVTSLRYLYLAYNRLNSSLPENLGALH  541

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             L K  + SN L+G IP EIG + ++ ++DLS N   G
Sbjct  542  DLIKFDISSNLLSGKIPVEIGNIKAVTLIDLSKNNFSG  579


 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 132/280 (47%), Gaps = 30/280 (11%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLKILQCSFN----------  657
             G +   LGNL +L  LN  +NNF      SF   L++ R+L+ L+ + N          
Sbjct  357  TGPIPESLGNLEYLERLNFEENNFFGDSALSFLTSLTKCRKLRFLRFADNPLDGVFPSSV  416

Query  656  ---------------DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHL  522
                              G IP   G L  +  + L NN ++G +P ++  +  L+ L+L
Sbjct  417  GHFSNSLQSFVGQDCQLKGVIPKEIGNLTGVTKMSLSNNELTGHIPNTIQGMLNLQELYL  476

Query  521  GVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLD  342
              N LEG+IP  I NL  L  L LS N FSGS P  +  ++ L  L L+ N L   LP +
Sbjct  477  QNNKLEGTIPDVICNLKNLGALYLSGNEFSGSVPPCLGKVTSLRYLYLAYNRLNSSLPEN  536

Query  341  LGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLF  162
            LG  L  L  F + SN  SG+IP  +     +  + L  NNFSG +P   G L  + KL 
Sbjct  537  LG-ALHDLIKFDISSNLLSGKIPVEIGNIKAVTLIDLSKNNFSGKIPSTLGRLDNVIKLS  595

Query  161  LRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
            L  N+L G IP   G + +L  +DL  N L G   ++L+ 
Sbjct  596  LAHNRLDGPIPESFGKMLALNFLDLCYNNLNGEIPKSLEA  635


 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 112/244 (46%), Gaps = 25/244 (10%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +  ++GNL+ +  ++LS N      P  +  +  L+ L    N   G IP     L
Sbjct  433  LKGVIPKEIGNLTGVTKMSLSNNELTGHIPNTIQGMLNLQELYLQNNKLEGTIPDVICNL  492

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            +NL  LYL  N  SG +P  L  ++ L  L+L  N L  S+P  +G L  L   ++S N 
Sbjct  493  KNLGALYLSGNEFSGSVPPCLGKVTSLRYLYLAYNRLNSSLPENLGALHDLIKFDISSNL  552

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             SG  P++I                        GN +  + +  +  N FSG+IPS+L +
Sbjct  553  LSGKIPVEI------------------------GN-IKAVTLIDLSKNNFSGKIPSTLGR  587

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
               +  LSL  N   G +P  FG +  L  L L  N L G IP+ + AL  L  +++S N
Sbjct  588  LDNVIKLSLAHNRLDGPIPESFGKMLALNFLDLCYNNLNGEIPKSLEALVYLRYLNVSFN  647

Query  77   KLYG  66
            KL G
Sbjct  648  KLSG  651


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 117/232 (50%), Gaps = 5/232 (2%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            V+ ++L N  L G +   +  +  L  L L  N    + P  +  L+ L  L  S N+FS
Sbjct  447  VTKMSLSNNELTGHIPNTIQGMLNLQELYLQNNKLEGTIPDVICNLKNLGALYLSGNEFS  506

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G++P   G + +LR+LYL  N ++  LP +L  L  L    +  N L G IP EIGN+  
Sbjct  507  GSVPPCLGKVTSLRYLYLAYNRLNSSLPENLGALHDLIKFDISSNLLSGKIPVEIGNIKA  566

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
            + L++LS N+FSG  P  +  L  +  LSL+ N L G +P   G  L  L    +  N  
Sbjct  567  VTLIDLSKNNFSGKIPSTLGRLDNVIKLSLAHNRLDGPIPESFGKML-ALNFLDLCYNNL  625

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPR--EFGNLTKLEKLFLRSNQLTG  138
            +GEIP SL     L+ L++ FN  SG +P    F N T   + FL ++ L G
Sbjct  626  NGEIPKSLEALVYLRYLNVSFNKLSGEIPTGGPFANATY--QSFLSNDALCG  675



>ref|XP_008362210.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=1172

 Score =   251 bits (642),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 154/351 (44%), Positives = 208/351 (59%), Gaps = 25/351 (7%)
 Frame = -1

Query  1028  SIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGV  852
             S++   +    LTI +HTNI+TD+ ALLSLK+ I+ DP +IL  NWS  S +  CNW+GV
Sbjct  110   SVYRAQAAPSVLTI-SHTNISTDQSALLSLKAHITRDPQNILTANWSSASNSNICNWVGV  168

Query  851   TCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKIL  672
             +C + H+RV+ALNL +MGL G + P LGNLSFLV L L  N+FH   P+ELS+LRRLK +
Sbjct  169   SCGAGHHRVTALNLSHMGLAGVIPPHLGNLSFLVELGLENNSFHGPLPQELSRLRRLKEI  228

Query  671   QCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIP  492
                 N+F G IPSWFG    L+ + L  N  SGF+PT++FNLS LE + LG N L GSIP
Sbjct  229   NFGNNNFMGTIPSWFGSFAKLQTIRLYGNGFSGFIPTAIFNLSALETIDLGWNQLSGSIP  288

Query  491   REIGNLFQLKLLNLSDNHFS-----------------------GSFPLDIlnlsklenls  381
             REIGNL  +K + L DN F                         S  + + N+S L  L+
Sbjct  289   REIGNLTMVKGIYLDDNKFEELPNEMGSLVQLEELYVQFNALKASALMPVFNISSLTILN  348

Query  380   lsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVP  201
             L  N++ G  P ++  HL  +++F +  ++  G IP+ L +C  L+ +SL  NNF G +P
Sbjct  349   LYGNNMSGSFPDNICEHLSSIRVFDLSRSQLGGLIPAKLWQCKELREISLHSNNFRGSIP  408

Query  200   REFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             +  GNLT L  + L  N LTG IP EIG L  L  + L+ N L G  +  L
Sbjct  409   KSLGNLTYLTGIDLSENHLTGTIPDEIGDLPQLEFLGLAINNLSGVILSKL  459


 Score = 83.2 bits (204),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 92/291 (32%), Positives = 131/291 (45%), Gaps = 38/291 (13%)
 Frame = -1

Query  827  VSALNLFNMG---LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFN  657
            +S++ +F++    L G +   L     L  ++L  NNF  S P+ L  L  L  +  S N
Sbjct  366  LSSIRVFDLSRSQLGGLIPAKLWQCKELREISLHSNNFRGSIPKSLGNLTYLTGIDLSEN  425

Query  656  DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG-  480
              +G IP   G L  L FL L  NN+SG + + LFNLS +  + L  N L GS+P  IG 
Sbjct  426  HLTGTIPDEIGDLPQLEFLGLAINNLSGVILSKLFNLSMIRTIGLSFNQLSGSLPANIGL  485

Query  479  -------------NLF-----------QLKLLNLSDNHFSGSFP--------LDIlnlsk  396
                         NL            +L++L++S N F+G  P        L+I++L  
Sbjct  486  NAPNLEILFVSSTNLVAGLLPNLSSASKLRVLDMSKNAFTGFLPSTLCSLKNLEIISLFL  545

Query  395  lenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSL-LQTLSLPFNN  219
                  +           L N L  L    M  N  +  IP+S    S  L  + L   N
Sbjct  546  NNLTIDASTPQAASTLSCLFN-LRNLTKLDMGDNSLNTTIPASRGNLSTSLLYVGLFRCN  604

Query  218  FSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
              G++P E GNL+ L  L L SNQL+GAIP  I  L +L  + L +N+L G
Sbjct  605  IRGNIPVEIGNLSSLIALQLGSNQLSGAIPTSIQRLQNLQXLXLYDNELQG  655


 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 94/286 (33%), Positives = 137/286 (48%), Gaps = 3/286 (1%)
 Frame = -1

Query  911  SILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSF-LVSLNLS  735
            S+  +N ++++ TP     ++C      ++ L++ +  L   +    GNLS  L+ + L 
Sbjct  542  SLFLNNLTIDASTPQAASTLSCLFNLRNLTKLDMGDNSLNTTIPASRGNLSTSLLYVGLF  601

Query  734  QNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSL  555
            + N   + P E+  L  L  LQ   N  SG IP+    LQNL+ L L +N + G +P  L
Sbjct  602  RCNIRGNIPVEIGNLSSLIALQLGSNQLSGAIPTSIQRLQNLQXLXLYDNELQGHIPYEL  661

Query  554  FNLSKLEVLHLGVNSLEGSIPREIGNL-FQLKLLNLSDNHFSGSFPLDIlnlsklenlsl  378
              L+ L  L L  N L GSIP  +G L   L+ L L  N  +   P  +  L  +  L+L
Sbjct  662  CQLNNLAGLXLHGNRLSGSIPSCLGTLAVALRYLXLGSNLLTSKIPSSLWELKYILXLNL  721

Query  377  svnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPR  198
            S NSL G L   +G  L  +    + +N FSG IP  +     +   SL  N   G +P 
Sbjct  722  SSNSLVGPLSEXIG-KLKXVXXMDLSNNHFSGNIPXXIGGLQKMIXXSLANNYLEGPIPX  780

Query  197  EFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             F  L  LE L L  N L+G IP+ + AL  L  ++LS NKL G  
Sbjct  781  SFKTLLSLEFLDLSKNNLSGVIPKSLEALLYLKHLNLSFNKLQGEI  826


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 95/318 (30%), Positives = 136/318 (43%), Gaps = 67/318 (21%)
 Frame = -1

Query  995  LTINAHT-NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSA  819
            LTI+A T    +    L +L++    D    + DN S+N+  P         SR N  ++
Sbjct  548  LTIDASTPQAASTLSCLFNLRNLTKLD----MGDN-SLNTTIPA--------SRGNLSTS  594

Query  818  L---NLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPR-------------------  705
            L    LF   + G +  ++GNLS L++L L  N    + P                    
Sbjct  595  LLYVGLFRCNIRGNIPVEIGNLSSLIALQLGSNQLSGAIPTSIQRLQNLQXLXLYDNELQ  654

Query  704  -----ELSQLRRLKILQCSFNDFSGNIPSWFGLLQ-NLRFLYLGNNNISGFLPTSLFNLS  543
                 EL QL  L  L    N  SG+IPS  G L   LR+L LG+N ++  +P+SL+ L 
Sbjct  655  GHIPYELCQLNNLAGLXLHGNRLSGSIPSCLGTLAVALRYLXLGSNLLTSKIPSSLWELK  714

Query  542  KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsL  363
             +  L+L  NSL G +   IG L  +  ++LS+NHFSG+ P  I                
Sbjct  715  YILXLNLSSNSLVGPLSEXIGKLKXVXXMDLSNNHFSGNIPXXI----------------  758

Query  362  FGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNL  183
                       L K+    + +N   G IP S      L+ L L  NN SG +P+    L
Sbjct  759  ---------GGLQKMIXXSLANNYLEGPIPXSFKTLLSLEFLDLSKNNLSGVIPKSLEAL  809

Query  182  TKLEKLFLRSNQLTGAIP  129
              L+ L L  N+L G IP
Sbjct  810  LYLKHLNLSFNKLQGEIP  827


 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 101/350 (29%), Positives = 141/350 (40%), Gaps = 110/350 (31%)
 Frame = -1

Query  767  NLSFLVSLNLSQNNFHNSFPRELSQ-LRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLG  591
            N+S L  LNL  NN   SFP  + + L  +++   S +   G IP+     + LR + L 
Sbjct  340  NISSLTILNLYGNNMSGSFPDNICEHLSSIRVFDLSRSQLGGLIPAKLWQCKELREISLH  399

Query  590  NNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDI  411
            +NN  G +P SL NL+ L  + L  N L G+IP EIG+L QL+ L L+ N+ SG     +
Sbjct  400  SNNFRGSIPKSLGNLTYLTGIDLSENHLTGTIPDEIGDLPQLEFLGLAINNLSGVILSKL  459

Query  410  lnlsklenlslsvnsLFGELPLDLGNHLP------------------------KLQIFVM  303
             NLS +  + LS N L G LP ++G + P                        KL++  M
Sbjct  460  FNLSMIRTIGLSFNQLSGSLPANIGLNAPNLEILFVSSTNLVAGLLPNLSSASKLRVLDM  519

Query  302  RSNKFSGEIPSSLSKCSL----------------------LQTLSLPFN-----------  222
              N F+G +PS+L  CSL                        TLS  FN           
Sbjct  520  SKNAFTGFLPSTL--CSLKNLEIISLFLNNLTIDASTPQAASTLSCLFNLRNLTKLDMGD  577

Query  221  --------------------------NFSGHVPREFGNLTKLEKLFLRSNQLTGA-----  135
                                      N  G++P E GNL+ L  L L SNQL+GA     
Sbjct  578  NSLNTTIPASRGNLSTSLLYVGLFRCNIRGNIPVEIGNLSSLIALQLGSNQLSGAIPTSI  637

Query  134  -------------------IPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
                               IP E+  L++L  + L  N+L G+    L T
Sbjct  638  QRLQNLQXLXLYDNELQGHIPYELCQLNNLAGLXLHGNRLSGSIPSCLGT  687


 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 112/270 (41%), Gaps = 55/270 (20%)
 Frame = -1

Query  767  NLSFLVSLNLSQNNFHNSFPRELSQLRR----LKILQCSFNDFSGNIPSWFGLLQNLRFL  600
            NL  L  L++  N+ + + P     L      + + +C   +  GNIP   G L +L  L
Sbjct  566  NLRNLTKLDMGDNSLNTTIPASRGNLSTSLLYVGLFRC---NIRGNIPVEIGNLSSLIAL  622

Query  599  YLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
             LG+N +SG +PTS+  L  L+ L L  N L+G IP E+  L  L  L L  N  SGS  
Sbjct  623  QLGSNQLSGAIPTSIQRLQNLQXLXLYDNELQGHIPYELCQLNNLAGLXLHGNRLSGS--  680

Query  419  LDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL--------  264
                                  +P  LG     L+   + SN  + +IPSSL        
Sbjct  681  ----------------------IPSCLGTLAVALRYLXLGSNLLTSKIPSSLWELKYILX  718

Query  263  ----------------SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAI  132
                             K   +  + L  N+FSG++P   G L K+    L +N L G I
Sbjct  719  LNLSSNSLVGPLSEXIGKLKXVXXMDLSNNHFSGNIPXXIGGLQKMIXXSLANNYLEGPI  778

Query  131  PREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
            P     L SL  +DLS N L G   ++L+ 
Sbjct  779  PXSFKTLLSLEFLDLSKNNLSGVIPKSLEA  808



>ref|XP_009763988.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Nicotiana sylvestris]
Length=1078

 Score =   251 bits (641),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 148/330 (45%), Positives = 210/330 (64%), Gaps = 3/330 (1%)
 Frame = -1

Query  1037  FCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWI  858
             F L++F    L    ++ +  NI+TD+ ALL+LKS IS  P++ILA NWS + +  C+WI
Sbjct  9     FALAVFIL--LHDHTSLASVANISTDEAALLALKSHISSGPNNILARNWSSSGLV-CSWI  65

Query  857   GVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLK  678
             G+TC+SRH+RV+ALN+ +M L G + P LGNLSFL S+++S N F+   P EL+ L+RLK
Sbjct  66    GITCSSRHHRVTALNISSMQLHGTIPPHLGNLSFLTSIDISNNTFYGELPEELAHLQRLK  125

Query  677   ILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGS  498
             ++  + N+F+G IPS+  LL NLRFL L  N  SG +P+ L NL+KL+VL +  N L+G 
Sbjct  126   LIDITSNNFTGAIPSFLRLLPNLRFLNLSTNQFSGEIPSFLSNLTKLQVLRIQGNFLQGE  185

Query  497   IPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKL  318
             IPRE+G+L  +  L+L  N  +G  P  I N+  ++ + L+ N L G+LP  + ++LP L
Sbjct  186   IPRELGDLRYMVFLDLQFNQLNGFIPPSIFNIRTMQKIGLTGNKLTGKLPTTICDNLPNL  245

Query  317   QIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
             +   +  N   G IP +L KC  LQ LSL  N F G VPRE  NLT L +L+L    L G
Sbjct  246   EGLYLSKNYIGGAIPPNLGKCRKLQILSLSINEFIGAVPRELANLTALTRLYLGFLHLEG  305

Query  137   AIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
              IP E+G L  L  + LSNN+  G+   N+
Sbjct  306   EIPAELGNLKKLQALKLSNNEFTGSVPANI  335


 Score =   120 bits (301),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 132/250 (53%), Gaps = 5/250 (2%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL-  621
            L GE+  +LGNL  L +L LS N F  S P  +  +  L+ LQ S N  SG +PS  G  
Sbjct  303  LEGEIPAELGNLKKLQALKLSNNEFTGSVPANIFNMSALQTLQLSQNKLSGTLPSDLGRG  362

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            + N+     G+NN+SGF+  S+ N S+L  L+L  NS  G IP  +GNL  L+ LN  +N
Sbjct  363  IPNIEEFVCGSNNLSGFISASISNSSRLRGLNLADNSFTGPIPESLGNLEYLERLNFEEN  422

Query  440  HFSG----SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIP  273
            +F G    SF   +    KL  L  + N L G  P  +G+    LQ FV +  +  G IP
Sbjct  423  NFFGDSALSFLTSLTKCRKLRFLRFADNPLDGVFPSSVGHFSNSLQSFVGQDCQLKGVIP  482

Query  272  SSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIV  93
              +   + +  +SL  N  +GH+P     +  L++L+L++N+L G IP  I  L +L  +
Sbjct  483  KEIGNLTGVTKMSLSNNELTGHIPNTIQGMLNLQELYLQNNKLEGTIPDVICNLKNLGAL  542

Query  92   DLSNNKLYGT  63
             LS N+  G+
Sbjct  543  YLSGNEFSGS  552


 Score =   114 bits (284),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 131/298 (44%), Gaps = 78/298 (26%)
 Frame = -1

Query  797  LVGEL-TPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G+L T    NL  L  L LS+N    + P  L + R+L+IL  S N+F G +P     
Sbjct  230  LTGKLPTTICDNLPNLEGLYLSKNYIGGAIPPNLGKCRKLQILSLSINEFIGAVPRELAN  289

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            L  L  LYLG  ++ G +P  L NL KL+ L L  N   GS+P  I N+  L+ L LS N
Sbjct  290  LTALTRLYLGFLHLEGEIPAELGNLKKLQALKLSNNEFTGSVPANIFNMSALQTLQLSQN  349

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              SG+                        LP DLG  +P ++ FV  SN  SG I +S+S
Sbjct  350  KLSGT------------------------LPSDLGRGIPNIEEFVCGSNNLSGFISASIS  385

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKL--------------------------FL  159
              S L+ L+L  N+F+G +P   GNL  LE+L                          FL
Sbjct  386  NSSRLRGLNLADNSFTGPIPESLGNLEYLERLNFEENNFFGDSALSFLTSLTKCRKLRFL  445

Query  158  R-----------------SN----------QLTGAIPREIGALSSLLIVDLSNNKLYG  66
            R                 SN          QL G IP+EIG L+ +  + LSNN+L G
Sbjct  446  RFADNPLDGVFPSSVGHFSNSLQSFVGQDCQLKGVIPKEIGNLTGVTKMSLSNNELTG  503


 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 140/296 (47%), Gaps = 30/296 (10%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLKI  675
            S  +R+  LNL +    G +   LGNL +L  LN  +NNF      SF   L++ R+L+ 
Sbjct  385  SNSSRLRGLNLADNSFTGPIPESLGNLEYLERLNFEENNFFGDSALSFLTSLTKCRKLRF  444

Query  674  LQCSFN-------------------------DFSGNIPSWFGLLQNLRFLYLGNNNISGF  570
            L+ + N                            G IP   G L  +  + L NN ++G 
Sbjct  445  LRFADNPLDGVFPSSVGHFSNSLQSFVGQDCQLKGVIPKEIGNLTGVTKMSLSNNELTGH  504

Query  569  LPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlskle  390
            +P ++  +  L+ L+L  N LEG+IP  I NL  L  L LS N FSGS P  +  ++ L 
Sbjct  505  IPNTIQGMLNLQELYLQNNKLEGTIPDVICNLKNLGALYLSGNEFSGSVPPCLGKVTSLR  564

Query  389  nlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSG  210
             L L+ N L   LP +LG  L  L  F + SN  SG+IP  +     +  + L  NNFSG
Sbjct  565  YLYLAYNRLNSSLPENLG-ALHDLIKFDISSNLLSGKIPVEIGNIKAVTLIDLSKNNFSG  623

Query  209  HVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
             +P   G L  + KL L  N+L G IP   G + +L  +DL  N L G   ++L+ 
Sbjct  624  KIPSTLGRLDNVIKLSLAHNRLDGPIPESFGKMLALNFLDLCYNNLNGEIPKSLEA  679


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 139/277 (50%), Gaps = 8/277 (3%)
 Frame = -1

Query  866  NWIGVTCNSRHNRVSALNLFNMGL---VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELS  696
            N+IG        +   L + ++ +   +G +  +L NL+ L  L L   +     P EL 
Sbjct  253  NYIGGAIPPNLGKCRKLQILSLSINEFIGAVPRELANLTALTRLYLGFLHLEGEIPAELG  312

Query  695  QLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSL-FNLSKLEVLHLG  519
             L++L+ L+ S N+F+G++P+    +  L+ L L  N +SG LP+ L   +  +E    G
Sbjct  313  NLKKLQALKLSNNEFTGSVPANIFNMSALQTLQLSQNKLSGTLPSDLGRGIPNIEEFVCG  372

Query  518  VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL  339
             N+L G I   I N  +L+ LNL+DN F+G  P  + NL  LE L+   N+ FG+  L  
Sbjct  373  SNNLSGFISASISNSSRLRGLNLADNSFTGPIPESLGNLEYLERLNFEENNFFGDSALSF  432

Query  338  GNHLP---KLQIFVMRSNKFSGEIPSSLSKCS-LLQTLSLPFNNFSGHVPREFGNLTKLE  171
               L    KL+      N   G  PSS+   S  LQ+         G +P+E GNLT + 
Sbjct  433  LTSLTKCRKLRFLRFADNPLDGVFPSSVGHFSNSLQSFVGQDCQLKGVIPKEIGNLTGVT  492

Query  170  KLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            K+ L +N+LTG IP  I  + +L  + L NNKL GT 
Sbjct  493  KMSLSNNELTGHIPNTIQGMLNLQELYLQNNKLEGTI  529


 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 112/244 (46%), Gaps = 25/244 (10%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +  ++GNL+ +  ++LS N      P  +  +  L+ L    N   G IP     L
Sbjct  477  LKGVIPKEIGNLTGVTKMSLSNNELTGHIPNTIQGMLNLQELYLQNNKLEGTIPDVICNL  536

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            +NL  LYL  N  SG +P  L  ++ L  L+L  N L  S+P  +G L  L   ++S N 
Sbjct  537  KNLGALYLSGNEFSGSVPPCLGKVTSLRYLYLAYNRLNSSLPENLGALHDLIKFDISSNL  596

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             SG  P++I                        GN +  + +  +  N FSG+IPS+L +
Sbjct  597  LSGKIPVEI------------------------GN-IKAVTLIDLSKNNFSGKIPSTLGR  631

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
               +  LSL  N   G +P  FG +  L  L L  N L G IP+ + AL  L  +++S N
Sbjct  632  LDNVIKLSLAHNRLDGPIPESFGKMLALNFLDLCYNNLNGEIPKSLEALVYLRYLNVSFN  691

Query  77   KLYG  66
            KL G
Sbjct  692  KLSG  695


 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 117/232 (50%), Gaps = 5/232 (2%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            V+ ++L N  L G +   +  +  L  L L  N    + P  +  L+ L  L  S N+FS
Sbjct  491  VTKMSLSNNELTGHIPNTIQGMLNLQELYLQNNKLEGTIPDVICNLKNLGALYLSGNEFS  550

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G++P   G + +LR+LYL  N ++  LP +L  L  L    +  N L G IP EIGN+  
Sbjct  551  GSVPPCLGKVTSLRYLYLAYNRLNSSLPENLGALHDLIKFDISSNLLSGKIPVEIGNIKA  610

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
            + L++LS N+FSG  P  +  L  +  LSL+ N L G +P   G  L  L    +  N  
Sbjct  611  VTLIDLSKNNFSGKIPSTLGRLDNVIKLSLAHNRLDGPIPESFGKML-ALNFLDLCYNNL  669

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPR--EFGNLTKLEKLFLRSNQLTG  138
            +GEIP SL     L+ L++ FN  SG +P    F N T   + FL ++ L G
Sbjct  670  NGEIPKSLEALVYLRYLNVSFNKLSGEIPTGGPFANATY--QSFLSNDALCG  719



>emb|CDP11283.1| unnamed protein product [Coffea canephora]
Length=1027

 Score =   251 bits (640),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 188/307 (61%), Gaps = 26/307 (8%)
 Frame = -1

Query  977  TNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMG  798
            TNITTD+ +LL+L++ IS DP  ILA NWSV S + C+WIGV+C SRH RV+ LN+  M 
Sbjct  27   TNITTDQSSLLALRAHISVDPLQILAKNWSVGS-SICDWIGVSCGSRHRRVTGLNISYMN  85

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G L P LGNLSFLVSL++S NNFH   P E   LRRLK+L  SFN+  G  P W G  
Sbjct  86   LSGTLPPQLGNLSFLVSLDVSANNFHGELPHEFVGLRRLKLLNLSFNNLEGEFPPWIGSF  145

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
              L  L+L NN+ +G +P+S+ NLSKLE + L  N L+G+IP  I N+  L++++L+ N 
Sbjct  146  PQLHRLFLRNNSFTGLIPSSISNLSKLESISLSFNRLQGNIPIGIFNISSLQMISLTGNG  205

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSS-LS  261
             SG                         LP D+  HLP L    +  NK +G++PSS L+
Sbjct  206  LSGV------------------------LPSDMCYHLPGLIRLSLSLNKLNGQLPSSNLA  241

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
            KCS L+ LSL  N F G +P+E G L KLE+L+L  N L G IPREIG   SL  ++L +
Sbjct  242  KCSELRVLSLSLNEFGGSIPKEIGALKKLEELYLGGNYLEGVIPREIGNWVSLQQLNLQS  301

Query  80   NKLYGTF  60
            N L G+ 
Sbjct  302  NSLTGSI  308


 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 97/294 (33%), Positives = 142/294 (48%), Gaps = 39/294 (13%)
 Frame = -1

Query  827  VSALNLFNM---GLVGELTPDLG-NLSFLVSLNLSQNNFHNSFPRE-LSQLRRLKILQCS  663
            +S+L + ++   GL G L  D+  +L  L+ L+LS N  +   P   L++   L++L  S
Sbjct  193  ISSLQMISLTGNGLSGVLPSDMCYHLPGLIRLSLSLNKLNGQLPSSNLAKCSELRVLSLS  252

Query  662  FNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREI  483
             N+F G+IP   G L+ L  LYLG N + G +P  + N   L+ L+L  NSL GSIP EI
Sbjct  253  LNEFGGSIPKEIGALKKLEELYLGGNYLEGVIPREIGNWVSLQQLNLQSNSLTGSIPVEI  312

Query  482  GNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLF-GELPLDLGNHLPKLQIFV  306
             NL +L L++++ N  SG+ P                 +   G LP  + N    L+   
Sbjct  313  FNLSKLSLMSVTQNQLSGNLPSTFGYRLPNLEYLYLDINYLSGALPSSISNS-SNLRHIE  371

Query  305  MRSNKFSGEIP-------------------------------SSLSKCSLLQTLSLPFNN  219
               NKF+G IP                               +SL+KC  L  LSL  N 
Sbjct  372  FGGNKFTGPIPTSMGDLRFLELLDLGGNLLVSDSSSPELTFITSLTKCKYLAALSLDVNP  431

Query  218  FSGHVPREFGNL-TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             +G +P    NL T LE+L   + ++ G+IP  IG L SL+++DLSNN L G+ 
Sbjct  432  LNGIIPDSLSNLSTSLEQLNAANCKIKGSIPDGIGNLRSLILLDLSNNDLTGSL  485


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 85/283 (30%), Positives = 133/283 (47%), Gaps = 38/283 (13%)
 Frame = -1

Query  887  VNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSF-LVSLNLSQNNFHNSF  711
            + S+T C ++           +AL+L    L G +   L NLS  L  LN +      S 
Sbjct  413  ITSLTKCKYL-----------AALSLDVNPLNGIIPDSLSNLSTSLEQLNAANCKIKGSI  461

Query  710  PRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLF-NLSKLE  534
            P  +  LR L +L  S ND +G++P+    LQ L+++ L  N +   +P  L   L  L+
Sbjct  462  PDGIGNLRSLILLDLSNNDLTGSLPATIKDLQKLQYMDLSMNKLISRVPLHLLCALHNLD  521

Query  533  VLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGE  354
             ++LG N    SIP+  GNL  L+ LNLS N    + P +I                   
Sbjct  522  TMNLGQNQFMASIPKCFGNLTSLRHLNLSHNRLYSAPPEEIW------------------  563

Query  353  LPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKL  174
                   +L  L +  + SN  SG +P +++   +   + L  N FSG +P   G++  L
Sbjct  564  -------NLKDLLMLDLSSNLLSGSLPYAITNMKMANWVDLSTNQFSGGIPDSIGDMQNL  616

Query  173  EKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLD  45
            + LFL  N+L G+IP  IG + SL  +DLS+N L G+   +++
Sbjct  617  QNLFLAHNRLQGSIPESIGKMLSLESLDLSHNFLSGSIPMSME  659


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 76/163 (47%), Gaps = 25/163 (15%)
 Frame = -1

Query  836  HNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL--------------  699
            HN +  +NL     +  +    GNL+ L  LNLS N  +++ P E+              
Sbjct  518  HN-LDTMNLGQNQFMASIPKCFGNLTSLRHLNLSHNRLYSAPPEEIWNLKDLLMLDLSSN  576

Query  698  ----------SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN  549
                      + ++    +  S N FSG IP   G +QNL+ L+L +N + G +P S+  
Sbjct  577  LLSGSLPYAITNMKMANWVDLSTNQFSGGIPDSIGDMQNLQNLFLAHNRLQGSIPESIGK  636

Query  548  LSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
            +  LE L L  N L GSIP  + NL  L+  N+S N+ SG  P
Sbjct  637  MLSLESLDLSHNFLSGSIPMSMENLRYLRHFNVSFNNLSGEVP  679



>ref|XP_009623836.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana tomentosiformis]
Length=1083

 Score =   251 bits (641),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 210/326 (64%), Gaps = 7/326 (2%)
 Frame = -1

Query  1019  FFHSLMLCLTINAHT------NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWI  858
             F  +L + +  + HT      NI TD+ ALL+LKS IS D +++L  NWS +S   C+WI
Sbjct  7     FLFALAVLILFHHHTSVATVPNINTDEAALLALKSHISSDLNNLLQSNWSSSSPV-CSWI  65

Query  857   GVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLK  678
             G+TC+SRH+RV+AL++ +M L G + P LGNLSFLV L++S N FH   P EL+ L+RLK
Sbjct  66    GITCSSRHHRVTALDISSMQLHGTIPPHLGNLSFLVFLDISNNTFHGELPEELAHLQRLK  125

Query  677   ILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGS  498
             ++  + N+F+G +P +  LL N+R++YL +N  SG +P+SL N++KLEVL L  N LEG 
Sbjct  126   LIDVTINNFTGGVPPFLSLLSNIRYMYLSSNQFSGKIPSSLSNVTKLEVLTLKENFLEGV  185

Query  497   IPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKL  318
             IPRE+ +L  +  ++L  N  +GS P  I N++ ++ + L+ N+L G+LP  + +HLP L
Sbjct  186   IPRELRDLRHMTFIDLQFNRLTGSIPPSIYNITPMQKIGLTYNNLTGKLPTTICDHLPNL  245

Query  317   QIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
             + F +  N   G IP +L KC  LQ LSL  N+F G VP+E  NLT L +L+L    L G
Sbjct  246   EKFGISYNYLDGTIPPNLEKCRKLQMLSLSGNDFIGTVPKEIANLTALMELYLGDMHLEG  305

Query  137   AIPREIGALSSLLIVDLSNNKLYGTF  60
              IP E+G L  L ++ L  N+  G+ 
Sbjct  306   EIPVELGNLKKLQLLGLFGNEFIGSI  331


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 92/280 (33%), Positives = 141/280 (50%), Gaps = 7/280 (3%)
 Frame = -1

Query  881  SITPCNWIGVTCNSRHNRVSALNLF--NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFP  708
            S++  ++IG       N  + + L+  +M L GE+  +LGNL  L  L L  N F  S P
Sbjct  273  SLSGNDFIGTVPKEIANLTALMELYLGDMHLEGEIPVELGNLKKLQLLGLFGNEFIGSIP  332

Query  707  RELSQLRRLKILQCSFNDFSGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEV  531
              +  +  ++ L    N   G +PS  G  + +L       NN+SGF+P S+ N S+L  
Sbjct  333  TSIFNMSAIQYLSFDGNRLLGTLPSDLGHRMPSLVEFNCALNNLSGFIPASISNSSRLRK  392

Query  530  LHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSG----SFPLDIlnlsklenlslsvnsL  363
            L L  NS  G I + +GNL  L+ LNL  N+F      SF   + N  KL  + LS N L
Sbjct  393  LDLSANSFTGPILKSLGNLEHLEFLNLQYNNFYSDSTLSFLTSLTNCRKLRVIGLSENPL  452

Query  362  FGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNL  183
             G  P  +GN    L IF   + K  G IP  +   + +  +++  N  +GH+P+    +
Sbjct  453  HGFFPTSVGNFSDSLHIFESYACKLKGIIPEEIGNLTGVTRMNMLNNELTGHIPKTIQRM  512

Query  182  TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGT  63
              L++L+L+ N++ G IP  I  L +L  +DLS N+L G+
Sbjct  513  LNLQQLYLQRNKIEGTIPDVICTLKNLGALDLSENQLSGS  552


 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 94/312 (30%), Positives = 139/312 (45%), Gaps = 54/312 (17%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLKI  675
            S  +R+  L+L      G +   LGNL  L  LNL  NNF++    SF   L+  R+L++
Sbjct  385  SNSSRLRKLDLSANSFTGPILKSLGNLEHLEFLNLQYNNFYSDSTLSFLTSLTNCRKLRV  444

Query  674  L----------------------------QCSF---------------------NDFSGN  642
            +                             C                       N+ +G+
Sbjct  445  IGLSENPLHGFFPTSVGNFSDSLHIFESYACKLKGIIPEEIGNLTGVTRMNMLNNELTGH  504

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IP     + NL+ LYL  N I G +P  +  L  L  L L  N L GS+P  +GN+  L+
Sbjct  505  IPKTIQRMLNLQQLYLQRNKIEGTIPDVICTLKNLGALDLSENQLSGSVPPCLGNITSLR  564

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             L L+ N  + + P  + +L  L   +++ N L G++PL++GN +    +  +  N FSG
Sbjct  565  NLYLAYNRLNSTLPASLGSLQDLVEFNVTSNLLSGKIPLEVGN-IKAATLIDLSKNNFSG  623

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
            EIP++L     L  LSL  N   G +P  FG +  LE L    N LTG IP+ + AL  L
Sbjct  624  EIPNTLVGLDRLIKLSLAHNRLYGPIPNSFGRMLALEFLDFCYNNLTGEIPKSLEALVYL  683

Query  101  LIVDLSNNKLYG  66
              ++ S NKL G
Sbjct  684  KYLNFSFNKLSG  695


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 90/282 (32%), Positives = 128/282 (45%), Gaps = 43/282 (15%)
 Frame = -1

Query  890  SVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGEL-TPDLGNLSFLVSLNLSQNNFHNS  714
            S+ +ITP   IG+T N+              L G+L T    +L  L    +S N    +
Sbjct  213  SIYNITPMQKIGLTYNN--------------LTGKLPTTICDHLPNLEKFGISYNYLDGT  258

Query  713  FPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLE  534
             P  L + R+L++L  S NDF G +P     L  L  LYLG+ ++ G +P  L NL KL+
Sbjct  259  IPPNLEKCRKLQMLSLSGNDFIGTVPKEIANLTALMELYLGDMHLEGEIPVELGNLKKLQ  318

Query  533  VLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGE  354
            +L L  N   GSIP  I N+  ++ L+   N                           G 
Sbjct  319  LLGLFGNEFIGSIPTSIFNMSAIQYLSFDGNRL------------------------LGT  354

Query  353  LPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKL  174
            LP DLG+ +P L  F    N  SG IP+S+S  S L+ L L  N+F+G + +  GNL  L
Sbjct  355  LPSDLGHRMPSLVEFNCALNNLSGFIPASISNSSRLRKLDLSANSFTGPILKSLGNLEHL  414

Query  173  EKLFLRSNQL----TGAIPREIGALSSLLIVDLSNNKLYGTF  60
            E L L+ N      T +    +     L ++ LS N L+G F
Sbjct  415  EFLNLQYNNFYSDSTLSFLTSLTNCRKLRVIGLSENPLHGFF  456


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 118/232 (51%), Gaps = 5/232 (2%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            V+ +N+ N  L G +   +  +  L  L L +N    + P  +  L+ L  L  S N  S
Sbjct  491  VTRMNMLNNELTGHIPKTIQRMLNLQQLYLQRNKIEGTIPDVICTLKNLGALDLSENQLS  550

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G++P   G + +LR LYL  N ++  LP SL +L  L   ++  N L G IP E+GN+  
Sbjct  551  GSVPPCLGNITSLRNLYLAYNRLNSTLPASLGSLQDLVEFNVTSNLLSGKIPLEVGNIKA  610

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
              L++LS N+FSG  P  ++ L +L  LSL+ N L+G +P   G  L  L+      N  
Sbjct  611  ATLIDLSKNNFSGEIPNTLVGLDRLIKLSLAHNRLYGPIPNSFGRML-ALEFLDFCYNNL  669

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPR--EFGNLTKLEKLFLRSNQLTG  138
            +GEIP SL     L+ L+  FN  SG +P    F N T   + FL ++ L G
Sbjct  670  TGEIPKSLEALVYLKYLNFSFNKLSGEIPTGGPFANAT--SQSFLPNDALCG  719


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 69/223 (31%), Positives = 112/223 (50%), Gaps = 1/223 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +  ++GNL+ +  +N+  N      P+ + ++  L+ L    N   G IP     L
Sbjct  477  LKGIIPEEIGNLTGVTRMNMLNNELTGHIPKTIQRMLNLQQLYLQRNKIEGTIPDVICTL  536

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            +NL  L L  N +SG +P  L N++ L  L+L  N L  ++P  +G+L  L   N++ N 
Sbjct  537  KNLGALDLSENQLSGSVPPCLGNITSLRNLYLAYNRLNSTLPASLGSLQDLVEFNVTSNL  596

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             SG  PL++ N+     + LS N+  GE+P  L   L +L    +  N+  G IP+S  +
Sbjct  597  LSGKIPLEVGNIKAATLIDLSKNNFSGEIPNTLVG-LDRLIKLSLAHNRLYGPIPNSFGR  655

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
               L+ L   +NN +G +P+    L  L+ L    N+L+G IP
Sbjct  656  MLALEFLDFCYNNLTGEIPKSLEALVYLKYLNFSFNKLSGEIP  698


 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P  LGN L  L    + +N F GE+P  L+    L+ + +  NNF+G VP     L+
Sbjct  88   GTIPPHLGN-LSFLVFLDISNNTFHGELPEELAHLQRLKLIDVTINNFTGGVPPFLSLLS  146

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             +  ++L SNQ +G IP  +  ++ L ++ L  N L G   + L
Sbjct  147  NIRYMYLSSNQFSGKIPSSLSNVTKLEVLTLKENFLEGVIPREL  190



>ref|XP_008364201.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Malus domestica]
Length=603

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 151/336 (45%), Positives = 196/336 (58%), Gaps = 24/336 (7%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLF  807
            AHTN  TD+ ALL+ K+ I+ DP +IL  NWS  S +  C W+GVTC +RH+RV+ALNL 
Sbjct  73   AHTNFNTDQSALLAFKAHITSDPQNILTANWSSASNSDVCTWVGVTCRARHHRVTALNLS  132

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
             MGL G + P LGNLSFLV+L L+ N+FH   P+ELS LRRLK +    N+F G IPSWF
Sbjct  133  YMGLAGVIPPHLGNLSFLVALGLTNNSFHGPLPQELSHLRRLKAIHFENNNFMGTIPSWF  192

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF--------  471
            G    L+   L  N  SGF+P ++FNLS LE++ L  N L GSIPREIGNL         
Sbjct  193  GSFPILQIFTLYGNRFSGFIPAAIFNLSXLEIIDLSNNQLSGSIPREIGNLTMVKGIYLD  252

Query  470  ---------------QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
                           QL+ L + DN    S  + +LN+S L   +L  N++ G LP ++ 
Sbjct  253  ENKFEELPNEIGSLGQLEELFVQDNALKSSALVPVLNISSLTTFTLFGNNMSGSLPDNMC  312

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
             HL  ++ F +  N+  G IPS L +C  L+  SL  NNF G +P+  GNLT L ++FL 
Sbjct  313  EHLSSVRXFSLAQNQLDGLIPSKLWQCKELRQFSLGSNNFRGSIPKSLGNLTYLIEIFLN  372

Query  155  SNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             N LTG IP EIG L  L  + L+ N L G     L
Sbjct  373  GNNLTGTIPDEIGDLPQLENLQLTINNLNGVIPSKL  408


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 90/299 (30%), Positives = 140/299 (47%), Gaps = 39/299 (13%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            ++   LF   + G L  ++  +LS +   +L+QN      P +L Q + L+      N+F
Sbjct  293  LTTFTLFGNNMSGSLPDNMCEHLSSVRXFSLAQNQLDGLIPSKLWQCKELRQFSLGSNNF  352

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
             G+IP   G L  L  ++L  NN++G +P  + +L +LE L L +N+L G IP ++ N  
Sbjct  353  RGSIPKSLGNLTYLIEIFLNGNNLTGTIPDEIGDLPQLENLQLTINNLNGVIPSKLFNNS  412

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLF-GELPLDLGNHLPKLQIFVMRSN  294
             ++ + LS N  SGS P +I   +          +    EL  +L N   KL+   M +N
Sbjct  413  MIRHIWLSLNQLSGSLPANIGLYAPNLEFLGVAENNLAAELLPNLSNA-SKLRELDMSTN  471

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGH-------------------------------  207
             F+G +PS+L     L+ LSL  NN +                                 
Sbjct  472  SFTGVLPSTLCSLKNLEYLSLYSNNLTTDASTPQAASTLSCLFNLRNLTKLYLSDNPLNT  531

Query  206  -VPREFGNL-TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG---TFIQNLD  45
             +P   GNL T L+++ L  + + G IP +IG LSSL+ +DL NN+L G   T IQ L 
Sbjct  532  TIPTSRGNLSTSLQRVNLGMSNIRGNIPVDIGNLSSLIALDLDNNQLSGAIPTSIQGLQ  590


 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 130/249 (52%), Gaps = 9/249 (4%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +   LGNL++L+ + L+ NN   + P E+  L +L+ LQ + N+ +G IPS       
Sbjct  354  GSIPKSLGNLTYLIEIFLNGNNLTGTIPDEIGDLPQLENLQLTINNLNGVIPSKLFNNSM  413

Query  611  LRFLYLGNNNISGFLPTSL-FNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            +R ++L  N +SG LP ++      LE L +  N+L   +   + N  +L+ L++S N F
Sbjct  414  IRHIWLSLNQLSGSLPANIGLYAPNLEFLGVAENNLAAELLPNLSNASKLRELDMSTNSF  473

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGN-------HLPKLQIFVMRSNKFSGEI  276
            +G  P  + +L  LE LSL  N+L  +              +L  L    +  N  +  I
Sbjct  474  TGVLPSTLCSLKNLEYLSLYSNNLTTDASTPQAASTLSCLFNLRNLTKLYLSDNPLNTTI  533

Query  275  PSSLSKCSL-LQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLL  99
            P+S    S  LQ ++L  +N  G++P + GNL+ L  L L +NQL+GAIP  I  L +L 
Sbjct  534  PTSRGNLSTSLQRVNLGMSNIRGNIPVDIGNLSSLIALDLDNNQLSGAIPTSIQGLQNLQ  593

Query  98   IVDLSNNKL  72
             + L++N+L
Sbjct  594  ALYLNDNEL  602



>ref|XP_006357294.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Solanum tuberosum]
Length=1080

 Score =   250 bits (639),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 151/329 (46%), Positives = 211/329 (64%), Gaps = 6/329 (2%)
 Frame = -1

Query  1034  CLSIFFFHSLMLCL----TINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPC  867
             C+ +F   ++ + L    ++    NI TD+ AL +LKS IS  P++IL  NWS +S   C
Sbjct  5     CIVLFGLAAVFILLHNQTSLATVPNIGTDEAALFALKSHISSRPNNILESNWSSSSPV-C  63

Query  866   NWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLR  687
             +WIG+TC+SRH+RV+AL++ +M L G + P +GNLSFLVSL +S N FH + P EL+ L+
Sbjct  64    SWIGITCSSRHHRVTALDISSMQLHGTIPPHIGNLSFLVSLRISYNAFHGNLPAELAHLK  123

Query  686   RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSL  507
             RLK++    N+F+G IPS+  LL NLR + L +N  SG +P+SLFNL+KL+VL L  N L
Sbjct  124   RLKLINVRSNNFTGAIPSFLSLLPNLRTVSLWSNQFSGKIPSSLFNLTKLQVLSLQSNFL  183

Query  506   EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
              G IPREIG+L  L +L+L  N  +G  P  I N++ +  + L+ N+L G+LP  + +HL
Sbjct  184   VGEIPREIGDLRYLTVLDLQYNQLTGPIPPSIFNITTMRVIGLTNNNLTGKLPTTICDHL  243

Query  326   PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFL-RSN  150
             P L+   + SN   G IPS+L KC  LQ LSL  N F G VPRE  NLT L  LFL +  
Sbjct  244   PNLEGLYLSSNSLDGVIPSNLEKCRKLQRLSLSSNEFIGTVPRELANLTALITLFLGQQV  303

Query  149   QLTGAIPREIGALSSLLIVDLSNNKLYGT  63
              L G IP E+G L  L ++ L+ N+  G+
Sbjct  304   HLEGEIPVELGNLKKLQMLGLAENEFTGS  332


 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 139/282 (49%), Gaps = 13/282 (5%)
 Frame = -1

Query  881  SITPCNWIGVTCNSRHNRVSALNLF---NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSF  711
            S++   +IG       N  + + LF    + L GE+  +LGNL  L  L L++N F  S 
Sbjct  274  SLSSNEFIGTVPRELANLTALITLFLGQQVHLEGEIPVELGNLKKLQMLGLAENEFTGSV  333

Query  710  PRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEV  531
            P  +  +  L+ L  S N  SG +PS  G   NL   Y G NN+SGF+  S+ N S+L +
Sbjct  334  PTSIFNISALQFLTLSLNKLSGTLPSDLG--PNLEEFYCGGNNLSGFISDSISNSSRLRM  391

Query  530  LHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGEL  351
            L L  NS  G IP+ +G L  L+ LNL +N F     L    L+ L N     N  F   
Sbjct  392  LDLSFNSFTGPIPKSLGKLEYLEALNLGNNSFISDSTLSF--LASLNNCRNLRNLWFYNN  449

Query  350  PLD------LGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG  189
            PLD      +GN    L  F     K  G IP  + K + L  +SL  N F+G +P    
Sbjct  450  PLDAIFPAFVGNFSDSLHGFEADGCKLKGMIPQEIGKLTGLTKMSLSNNEFTGFIPNTIQ  509

Query  188  NLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGT  63
             +  L++L+L  N++ G IP ++ +L +L  +DLS NK  G+
Sbjct  510  GMLSLQELYLDKNKIEGPIPDDMCSLQNLGALDLSQNKFSGS  551


 Score =   107 bits (268),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 137/296 (46%), Gaps = 30/296 (10%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLK-  678
            S  +R+  L+L      G +   LG L +L +LNL  N+F +    SF   L+  R L+ 
Sbjct  384  SNSSRLRMLDLSFNSFTGPIPKSLGKLEYLEALNLGNNSFISDSTLSFLASLNNCRNLRN  443

Query  677  ------ILQCSFNDFSGN------------------IPSWFGLLQNLRFLYLGNNNISGF  570
                   L   F  F GN                  IP   G L  L  + L NN  +GF
Sbjct  444  LWFYNNPLDAIFPAFVGNFSDSLHGFEADGCKLKGMIPQEIGKLTGLTKMSLSNNEFTGF  503

Query  569  LPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlskle  390
            +P ++  +  L+ L+L  N +EG IP ++ +L  L  L+LS N FSGS P  +   + L 
Sbjct  504  IPNTIQGMLSLQELYLDKNKIEGPIPDDMCSLQNLGALDLSQNKFSGSVPPCLGKFTSLR  563

Query  389  nlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSG  210
             L L  N L   LP  LG+ L  L  F + SN  SG+IP  +        + L  N+FSG
Sbjct  564  TLHLDYNMLDSRLPESLGS-LKDLLEFSVSSNLLSGQIPFEIGNLQAATIIDLSKNDFSG  622

Query  209  HVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
             +P   G L KL  L L  N+L G IP   G + +L  +DLS N L G   ++L+ 
Sbjct  623  KIPSTLGGLDKLINLSLEHNRLDGPIPDSFGKMLALEFLDLSYNNLVGEIPKSLEA  678


 Score =   107 bits (267),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 112/216 (52%), Gaps = 1/216 (0%)
 Frame = -1

Query  713  FPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLE  534
             P+E+ +L  L  +  S N+F+G IP+    + +L+ LYL  N I G +P  + +L  L 
Sbjct  480  IPQEIGKLTGLTKMSLSNNEFTGFIPNTIQGMLSLQELYLDKNKIEGPIPDDMCSLQNLG  539

Query  533  VLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGE  354
             L L  N   GS+P  +G    L+ L+L  N      P  + +L  L   S+S N L G+
Sbjct  540  ALDLSQNKFSGSVPPCLGKFTSLRTLHLDYNMLDSRLPESLGSLKDLLEFSVSSNLLSGQ  599

Query  353  LPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKL  174
            +P ++GN L    I  +  N FSG+IPS+L     L  LSL  N   G +P  FG +  L
Sbjct  600  IPFEIGN-LQAATIIDLSKNDFSGKIPSTLGGLDKLINLSLEHNRLDGPIPDSFGKMLAL  658

Query  173  EKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            E L L  N L G IP+ + AL SL  ++ S NKL G
Sbjct  659  EFLDLSYNNLVGEIPKSLEALVSLKYLNFSFNKLIG  694


 Score = 91.7 bits (226),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 93/209 (44%), Gaps = 25/209 (12%)
 Frame = -1

Query  755  LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNIS  576
            L  L L +N      P ++  L+ L  L  S N FSG++P   G   +LR L+L  N + 
Sbjct  514  LQELYLDKNKIEGPIPDDMCSLQNLGALDLSQNKFSGSVPPCLGKFTSLRTLHLDYNMLD  573

Query  575  GFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsk  396
              LP SL +L  L    +  N L G IP EIGNL    +++LS N FS            
Sbjct  574  SRLPESLGSLKDLLEFSVSSNLLSGQIPFEIGNLQAATIIDLSKNDFS------------  621

Query  395  lenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNF  216
                        G++P  LG  L KL    +  N+  G IP S  K   L+ L L +NN 
Sbjct  622  ------------GKIPSTLGG-LDKLINLSLEHNRLDGPIPDSFGKMLALEFLDLSYNNL  668

Query  215  SGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             G +P+    L  L+ L    N+L G IP
Sbjct  669  VGEIPKSLEALVSLKYLNFSFNKLIGEIP  697


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 65/130 (50%), Gaps = 1/130 (1%)
 Frame = -1

Query  809  FNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSW  630
            +NM L   L   LG+L  L+  ++S N      P E+  L+   I+  S NDFSG IPS 
Sbjct  569  YNM-LDSRLPESLGSLKDLLEFSVSSNLLSGQIPFEIGNLQAATIIDLSKNDFSGKIPST  627

Query  629  FGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
             G L  L  L L +N + G +P S   +  LE L L  N+L G IP+ +  L  LK LN 
Sbjct  628  LGGLDKLINLSLEHNRLDGPIPDSFGKMLALEFLDLSYNNLVGEIPKSLEALVSLKYLNF  687

Query  449  SDNHFSGSFP  420
            S N   G  P
Sbjct  688  SFNKLIGEIP  697



>ref|XP_009611716.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 isoform X1 [Nicotiana tomentosiformis]
Length=581

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 149/370 (40%), Positives = 213/370 (58%), Gaps = 50/370 (14%)
 Frame = -1

Query  1025  IFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTC  846
             +  FH ++  L +  HTNITTD+ ALLSLKS+I  D   +L  +WS  +I+ C+W+GVTC
Sbjct  9     LLLFHLVVASLAM-THTNITTDQAALLSLKSQIISDSFHLLDKSWSP-TISVCHWVGVTC  66

Query  845   NSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQC  666
              S + RV +LN+ NM L G + PD GNL+FLVSL+LS NNF+ + P+E+++L RL+ ++ 
Sbjct  67    GSHYQRVKSLNISNMALTGRIPPDFGNLTFLVSLDLSSNNFYGNLPQEMARLHRLRFVRL  126

Query  665   SFNDFSGNIPSWFGL---------------------------------------------  621
              FN+FSG +PSWFG+                                             
Sbjct  127   GFNNFSGEVPSWFGVLHQLQVLTLRNNSFKGFIPSLFSNISKLQTLELKFNSLEGQIPNE  186

Query  620   ---LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
                L+NLRFL LG N + GF+P SL N S L  ++L  N L+G+IP+EIGNL  L  L++
Sbjct  187   IGNLENLRFLSLGGNKLKGFIPPSLSNASMLVTVYLSYNFLQGNIPKEIGNLQNLNHLSI  246

Query  449   SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
               N  +GS P+ I N+S LE+++ + N+L G LP D+ + LP L+   +  NK  G +P 
Sbjct  247   EHNQLTGSIPISIFNISGLESIAFTNNTLSGNLPTDMCDRLPMLEKLYLSMNKLRGHMPL  306

Query  269   SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVD  90
             SL  CS LQ LS+  N F G +  E G+L+ L+ L+L  N   G IP  I  +SSL ++ 
Sbjct  307   SLPNCSKLQMLSVSMNEFDGPIYNEIGHLSNLQHLYLGRNHFEGTIPISIFNISSLQVLS  366

Query  89    LSNNKLYGTF  60
             L  N L+G+ 
Sbjct  367   LGRNNLFGSL  376


 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 154/311 (50%), Gaps = 57/311 (18%)
 Frame = -1

Query  806  NMGLVGELTPDLGN-LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSW  630
            N  L G L  D+ + L  L  L LS N      P  L    +L++L  S N+F G I + 
Sbjct  272  NNTLSGNLPTDMCDRLPMLEKLYLSMNKLRGHMPLSLPNCSKLQMLSVSMNEFDGPIYNE  331

Query  629  FGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
             G L NL+ LYLG N+  G +P S+FN+S L+VL LG N+L GS+P E+GNL +L++L+L
Sbjct  332  IGHLSNLQHLYLGRNHFEGTIPISIFNISSLQVLSLGRNNLFGSLPWEVGNLTKLQILDL  391

Query  449  SD------------------------NHFSGSFPLDIlnlsklenlslsvnsLFGELPLD  342
            +                         N F+GS P +I N+S +  + L  N+L G LPL+
Sbjct  392  NQNMLTGEIPKEVSNLIELDGIDLGLNKFTGSLPTEIFNISGITVIDLLNNNLTGTLPLN  451

Query  341  LGNHLPKLQ-IFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKL  165
            +G+ LP ++ +++ R N F G IP S+S CS L TL +  N  +G +P   G LT LE L
Sbjct  452  IGSMLPNIEGLYLGRLNLF-GTIPDSISNCSKLNTLDVAGNRLTGLIPTSLGYLTHLEYL  510

Query  164  FLRSNQLT----------------------------GAIPREIGALS--SLLIVDLSNNK  75
             L  N L                             G +P  +G LS  SLL ++ +  +
Sbjct  511  LLDGNNLVSDSTLSFLTSLSNCRDLEFLSLSLNPLNGVLPVSLGNLSSTSLLRINAAGCR  570

Query  74   LYGTFIQNLDT  42
            + G F + L T
Sbjct  571  IKGKFQKELGT  581


 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 118/248 (48%), Gaps = 35/248 (14%)
 Frame = -1

Query  827  VSALNLFNMG---LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFN  657
            +S+L + ++G   L G L  ++GNL+ L  L+L+QN      P+E+S L  L  +    N
Sbjct  359  ISSLQVLSLGRNNLFGSLPWEVGNLTKLQILDLNQNMLTGEIPKEVSNLIELDGIDLGLN  418

Query  656  DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN-LSKLEVLHLGVNSLEGSIPREIG  480
             F+G++P+    +  +  + L NNN++G LP ++ + L  +E L+LG  +L G+IP  I 
Sbjct  419  KFTGSLPTEIFNISGITVIDLLNNNLTGTLPLNIGSMLPNIEGLYLGRLNLFGTIPDSIS  478

Query  479  NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMR  300
            N  +L  L+++ N  +G  P  +                          +L  L+  ++ 
Sbjct  479  NCSKLNTLDVAGNRLTGLIPTSL-------------------------GYLTHLEYLLLD  513

Query  299  SNKFSGEIP----SSLSKCSLLQTLSLPFNNFSGHVPREFGNL--TKLEKLFLRSNQLTG  138
             N    +      +SLS C  L+ LSL  N  +G +P   GNL  T L ++     ++ G
Sbjct  514  GNNLVSDSTLSFLTSLSNCRDLEFLSLSLNPLNGVLPVSLGNLSSTSLLRINAAGCRIKG  573

Query  137  AIPREIGA  114
               +E+G 
Sbjct  574  KFQKELGT  581



>emb|CDO96776.1| unnamed protein product [Coffea canephora]
Length=1107

 Score =   250 bits (639),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 201/317 (63%), Gaps = 4/317 (1%)
 Frame = -1

Query  1025  IFFFHSLMLCL---TINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIG  855
             + F   L+LCL   +I    NIT D+ AL +LKS ++FDP  +L+ +W +  I  CNW G
Sbjct  6     LVFHLVLVLCLLRTSIVRTKNITIDQSALRALKSHVTFDPSDVLSRSW-IYQIPVCNWTG  64

Query  854   VTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKI  675
             V C+S H RV ALN+ ++GL G + P + NLSFL S+++S N+F  + P EL  L+RL  
Sbjct  65    VKCSSLHQRVVALNISHLGLQGNIPPQVANLSFLNSIDISGNDFQGNLPEELVHLQRLSY  124

Query  674   LQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSI  495
             +  SFN FSG +PSW G L NL++LYL NN+ +G LP+SLFN SKLE + +  + LEG I
Sbjct  125   INFSFNKFSGGVPSWLGFLPNLQYLYLANNSFTGILPSSLFNASKLEDMRIPYSQLEGII  184

Query  494   PREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQ  315
               EIGNL  LK+L+L DN   GS P  + N+S L+ ++L+ NSL G LP+++   LPKLQ
Sbjct  185   AEEIGNLGNLKILDLQDNELMGSIPRTLFNISSLQVITLTNNSLSGTLPMNICTKLPKLQ  244

Query  314   IFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGA  135
                +  N  SG+I S    C+ LQ+L L  NNFSG +PRE GNLT L +L    N   G 
Sbjct  245   GIYLSRNLLSGQILSRFKNCTELQSLLLSMNNFSGQIPREVGNLTMLSRLRCGYNMFEGT  304

Query  134   IPREIGALSSLLIVDLS  84
              P  IG L +L ++ ++
Sbjct  305   FPPGIGNLLNLEVLHMA  321


 Score =   109 bits (272),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 117/237 (49%), Gaps = 6/237 (3%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G++     N + L SL LS NNF    PRE+  L  L  L+C +N F G  P   G L
Sbjct  253  LSGQILSRFKNCTELQSLLLSMNNFSGQIPREVGNLTMLSRLRCGYNMFEGTFPPGIGNL  312

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
             NL  L++    ++G +P    NL KL  L L +N L G IP+ I N+  L  ++ + N+
Sbjct  313  LNLEVLHMAFCLLNGPVPAEFGNLQKLRTLDLTMNFLSGPIPKSIFNISTLTNISFTLNN  372

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             SGS P +I          L   +    + LD  ++L KL    +  N+F+G IP+SL  
Sbjct  373  LSGSIPPNIDQQLPNLEGLLLGGNKLSGVVLDSISNLTKLSHLELGQNQFTGSIPTSLGS  432

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEK------LFLRSNQLTGAIPREIGALSS  105
               L+ L++  N+F+   P EF  LT L K      L +  N L+G +P  IG  SS
Sbjct  433  LRFLEYLNIQRNHFTSDSPSEFSFLTSLTKCRNLRFLSISENPLSGELPPTIGNFSS  489


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 87/251 (35%), Positives = 121/251 (48%), Gaps = 32/251 (13%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +   + NL+ L  L L QN F  S P  L  LR L+ L    N F+ + PS F  L
Sbjct  398  LSGVVLDSISNLTKLSHLELGQNQFTGSIPTSLGSLRFLEYLNIQRNHFTSDSPSEFSFL  457

Query  617  ------QNLRFLYLGNNNISGFLPTSLFNLSK-LEVLHLGVNSLEGSIPREIGNLFQLKL  459
                  +NLRFL +  N +SG LP ++ N S   +  +  +  ++G+IP EIGNL  L L
Sbjct  458  TSLTKCRNLRFLSISENPLSGELPPTIGNFSSSFQNFYAILCGIKGNIPHEIGNLSSLLL  517

Query  458  LNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGE  279
            L+L +N F+G  P                         D    L  LQ   ++ N+ SG 
Sbjct  518  LSLGNNSFTGPLP-------------------------DTLKGLSNLQGLDLQDNRISGS  552

Query  278  IPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLL  99
            IP+ L     L  + L  N FSG VP  FGN+T L +L+L SN+L    P  +G L  LL
Sbjct  553  IPNHLCTLRHLAIVQLSRNQFSGQVPDCFGNITSLRELYLYSNRLNSTFPASLGRLKDLL  612

Query  98   IVDLSNNKLYG  66
             +++S+N   G
Sbjct  613  YLEISSNSFIG  623


 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 121/243 (50%), Gaps = 1/243 (0%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            +  + L N  L G L  ++   L  L  + LS+N               L+ L  S N+F
Sbjct  218  LQVITLTNNSLSGTLPMNICTKLPKLQGIYLSRNLLSGQILSRFKNCTELQSLLLSMNNF  277

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
            SG IP   G L  L  L  G N   G  P  + NL  LEVLH+    L G +P E GNL 
Sbjct  278  SGQIPREVGNLTMLSRLRCGYNMFEGTFPPGIGNLLNLEVLHMAFCLLNGPVPAEFGNLQ  337

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
            +L+ L+L+ N  SG  P  I N+S L N+S ++N+L G +P ++   LP L+  ++  NK
Sbjct  338  KLRTLDLTMNFLSGPIPKSIFNISTLTNISFTLNNLSGSIPPNIDQQLPNLEGLLLGGNK  397

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
             SG +  S+S  + L  L L  N F+G +P   G+L  LE L ++ N  T   P E   L
Sbjct  398  LSGVVLDSISNLTKLSHLELGQNQFTGSIPTSLGSLRFLEYLNIQRNHFTSDSPSEFSFL  457

Query  110  SSL  102
            +SL
Sbjct  458  TSL  460


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 117/224 (52%), Gaps = 5/224 (2%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             G L   L  LS L  L+L  N    S P  L  LR L I+Q S N FSG +P  FG + 
Sbjct  526  TGPLPDTLKGLSNLQGLDLQDNRISGSIPNHLCTLRHLAIVQLSRNQFSGQVPDCFGNIT  585

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            +LR LYL +N ++   P SL  L  L  L +  NS  G IP E+GNL     ++L++N F
Sbjct  586  SLRELYLYSNRLNSTFPASLGRLKDLLYLEISSNSFIGDIPPEVGNLKAALDIDLAENEF  645

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            SG+ P  +  L  L +L+L+ N L G +P +  ++L  LQ+  + +N F+GEI +SL   
Sbjct  646  SGNIPTTLGGLQNLISLTLAHNELQGPIP-ETFSNLLSLQLLDLSNNNFTGEISTSLESL  704

Query  254  SLLQTLSLPFNNFSGHVP--REFGNLTKLEKLFLRSNQLTGAIP  129
              L+  ++ FN   G +P    F N T   + F+ +  L G  P
Sbjct  705  LQLKYFNVSFNELQGRIPLNGSFANFTY--ESFMSNKALCGGPP  746


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = -1

Query  539  LEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLF  360
            L + HLG   L+G+IP ++ NL  L  +++S N F G+ P ++++L +L  ++ S N   
Sbjct  77   LNISHLG---LQGNIPPQVANLSFLNSIDISGNDFQGNLPEELVHLQRLSYINFSFNKFS  133

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P  LG  LP LQ   + +N F+G +PSSL   S L+ + +P++   G +  E GNL 
Sbjct  134  GGVPSWLG-FLPNLQYLYLANNSFTGILPSSLFNASKLEDMRIPYSQLEGIIAEEIGNLG  192

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
             L+ L L+ N+L G+IPR +  +SSL ++ L+NN L GT   N+ T
Sbjct  193  NLKILDLQDNELMGSIPRTLFNISSLQVITLTNNSLSGTLPMNICT  238


 Score = 85.9 bits (211),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 104/315 (33%), Positives = 140/315 (44%), Gaps = 36/315 (11%)
 Frame = -1

Query  857  GVTCNSRHN--RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRE------  702
            GV  +S  N  ++S L L      G +   LG+L FL  LN+ +N+F +  P E      
Sbjct  400  GVVLDSISNLTKLSHLELGQNQFTGSIPTSLGSLRFLEYLNIQRNHFTSDSPSEFSFLTS  459

Query  701  LSQLRRLKILQCSFNDFSGNIPSWFG----LLQNLRFLYLG-NNNI--------------  579
            L++ R L+ L  S N  SG +P   G      QN   +  G   NI              
Sbjct  460  LTKCRNLRFLSISENPLSGELPPTIGNFSSSFQNFYAILCGIKGNIPHEIGNLSSLLLLS  519

Query  578  ------SGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPL  417
                  +G LP +L  LS L+ L L  N + GSIP  +  L  L ++ LS N FSG  P 
Sbjct  520  LGNNSFTGPLPDTLKGLSNLQGLDLQDNRISGSIPNHLCTLRHLAIVQLSRNQFSGQVPD  579

Query  416  DIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL  237
               N++ L  L L  N L    P  LG  L  L    + SN F G+IP  +        +
Sbjct  580  CFGNITSLRELYLYSNRLNSTFPASLG-RLKDLLYLEISSNSFIGDIPPEVGNLKAALDI  638

Query  236  SLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFI  57
             L  N FSG++P   G L  L  L L  N+L G IP     L SL ++DLSNN   G   
Sbjct  639  DLAENEFSGNIPTTLGGLQNLISLTLAHNELQGPIPETFSNLLSLQLLDLSNNNFTGEIS  698

Query  56   QNLDTP*LK*LSYYN  12
             +L++  L  L Y+N
Sbjct  699  TSLES--LLQLKYFN  711


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 123/251 (49%), Gaps = 14/251 (6%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFH-------NSFPRELSQLRRLKILQCSFNDFSGNI  639
            L GEL P +GN S       S  NF+        + P E+  L  L +L    N F+G +
Sbjct  476  LSGELPPTIGNFSS------SFQNFYAILCGIKGNIPHEIGNLSSLLLLSLGNNSFTGPL  529

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKL  459
            P     L NL+ L L +N ISG +P  L  L  L ++ L  N   G +P   GN+  L+ 
Sbjct  530  PDTLKGLSNLQGLDLQDNRISGSIPNHLCTLRHLAIVQLSRNQFSGQVPDCFGNITSLRE  589

Query  458  LNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGE  279
            L L  N  + +FP  +  L  L  L +S NS  G++P ++GN    L I  +  N+FSG 
Sbjct  590  LYLYSNRLNSTFPASLGRLKDLLYLEISSNSFIGDIPPEVGNLKAALDI-DLAENEFSGN  648

Query  278  IPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLL  99
            IP++L     L +L+L  N   G +P  F NL  L+ L L +N  TG I   + +L  L 
Sbjct  649  IPTTLGGLQNLISLTLAHNELQGPIPETFSNLLSLQLLDLSNNNFTGEISTSLESLLQLK  708

Query  98   IVDLSNNKLYG  66
              ++S N+L G
Sbjct  709  YFNVSFNELQG  719



>ref|XP_010317513.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Solanum lycopersicum]
Length=304

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 136/281 (48%), Positives = 185/281 (66%), Gaps = 1/281 (0%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFN  804
            + T I TD+  LLSLKS+I  DP   L ++WS+N I+ C+WIGVTC+ R+ RV +LNL +
Sbjct  24   SSTTILTDQSTLLSLKSQIISDPFHYLDESWSLN-ISVCDWIGVTCDYRYQRVKSLNLSS  82

Query  803  MGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
            M L G +  + GNL+FLVSL+L +N+FH   P+E++ LRRLK +  S N FSG  P WFG
Sbjct  83   MTLTGMIPREFGNLTFLVSLDLRRNHFHGYLPQEMANLRRLKFVHLSVNSFSGEFPCWFG  142

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
             L  L+ L L NN  +G +P+SL N S+LE L++  N LEG+IP EIGNL  L +L++  
Sbjct  143  FLDQLQVLNLANNRFTGSVPSSLSNASRLETLNISSNLLEGNIPEEIGNLHNLNVLSMEH  202

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N  +GS P  I N+S++E +  S NSL G LP  L N LP L+   +  N+  G +P+SL
Sbjct  203  NQLTGSIPFTIFNISRIELIVFSNNSLSGNLPNGLCNGLPILKRLHLSMNELRGHLPTSL  262

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
            S CS LQ LSL FN+F G +  E G L+ L+ L+LR+N  T
Sbjct  263  SNCSQLQVLSLAFNDFDGRIHSEIGRLSNLQGLYLRNNHFT  303


 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 101/197 (51%), Gaps = 30/197 (15%)
 Frame = -1

Query  641  IPSWFGLLQNLRF-----LYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN  477
            +  W G+  + R+     L L +  ++G +P    NL+ L  L L  N   G +P+E+ N
Sbjct  60   VCDWIGVTCDYRYQRVKSLNLSSMTLTGMIPREFGNLTFLVSLDLRRNHFHGYLPQEMAN  119

Query  476  LFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRS  297
            L +LK ++LS N FSG FP                   FG         L +LQ+  + +
Sbjct  120  LRRLKFVHLSVNSFSGEFPC-----------------WFG--------FLDQLQVLNLAN  154

Query  296  NKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIG  117
            N+F+G +PSSLS  S L+TL++  N   G++P E GNL  L  L +  NQLTG+IP  I 
Sbjct  155  NRFTGSVPSSLSNASRLETLNISSNLLEGNIPEEIGNLHNLNVLSMEHNQLTGSIPFTIF  214

Query  116  ALSSLLIVDLSNNKLYG  66
             +S + ++  SNN L G
Sbjct  215  NISRIELIVFSNNSLSG  231



>ref|XP_009376753.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X3 [Pyrus x bretschneideri]
Length=1099

 Score =   249 bits (637),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 197/332 (59%), Gaps = 24/332 (7%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLF  807
            AHTN +TD+ ALLSLK+ I  DP +IL  NWS  S +  C W+GVTC +RH+RV+ALNL 
Sbjct  8    AHTNFSTDQSALLSLKAHIISDPQNILTANWSSASNSDICTWVGVTCGARHHRVTALNLS  67

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
             MGL G + P LGNLSFLV L L  N+FH   P+ELS+LRRLK +    N+F G IPSWF
Sbjct  68   YMGLAGVIPPHLGNLSFLVELGLENNSFHGPLPQELSRLRRLKTINFVNNNFMGTIPSWF  127

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
            G    L+   L  N  SGF+P ++FNLS LE++ L  N L GSIPREIGNL  +K ++L 
Sbjct  128  GSFPKLQTFKLLGNGFSGFIPAAIFNLSALEIIDLSSNQLSGSIPREIGNLTMVKSIHLD  187

Query  446  DNHFS-----------------------GSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
            DN F                        GS  +  LN+S L  L+L  N++ G LP ++ 
Sbjct  188  DNKFEELPKEIGSLGQLEELLVQDNALKGSAFVPALNISSLITLALFGNNMSGSLPDNMC  247

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
             HLP ++   +  N+F G IPS L +C  L+ +S  +NNF G +P+  GNLT L +++L 
Sbjct  248  EHLPSVRGINLGQNQFDGLIPSKLWQCKELRVVSFEYNNFRGSIPKSLGNLTYLSRIYLY  307

Query  155  SNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             N L G IP EI  L  L I+ L  N L G  
Sbjct  308  HNNLEGTIPDEISNLPQLEILGLMINNLNGVI  339


 Score =   110 bits (276),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 99/303 (33%), Positives = 148/303 (49%), Gaps = 41/303 (14%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSG  645
             L LF   + G L  ++  +L  +  +NL QN F    P +L Q + L+++   +N+F G
Sbjct  230  TLALFGNNMSGSLPDNMCEHLPSVRGINLGQNQFDGLIPSKLWQCKELRVVSFEYNNFRG  289

Query  644  NIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQL  465
            +IP   G L  L  +YL +NN+ G +P  + NL +LE+L L +N+L G IP ++ NL  +
Sbjct  290  SIPKSLGNLTYLSRIYLYHNNLEGTIPDEISNLPQLEILGLMINNLNGVIPPKLFNLSMI  349

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
            +++ LS N  SGS P +I   +      L   +     PL   ++  KL++  M SN F+
Sbjct  350  RVIGLSLNPLSGSLPANIGLNAPNLESLLVDGTNLVAGPLPNLSNASKLRVLDMGSNSFT  409

Query  284  GEIPSSLSKCSL----------------------------------LQTLSLPFNNFSGH  207
            G +PS+L  CSL                                  L  LSL  N  +  
Sbjct  410  GFLPSTL--CSLKNLERLYLYLNSLTIDASAPQVESPLSCLFNLRKLTGLSLGGNPLNTT  467

Query  206  VPREFGNL-TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF---IQNLDTP  39
            +P   GNL T LE + L  + + G IP +IG LSSL+ ++L NN+L G     IQNL   
Sbjct  468  IPVFRGNLSTSLEDVDLSFSNIRGNIPVDIGNLSSLIALNLENNQLSGPIPSSIQNLQAL  527

Query  38   *LK  30
             LK
Sbjct  528  YLK  530


 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 124/239 (52%), Gaps = 6/239 (3%)
 Frame = -1

Query  770  GNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            GNLS  L  ++LS +N   + P ++  L  L  L    N  SG IPS    +QNL+ LYL
Sbjct  473  GNLSTSLEDVDLSFSNIRGNIPVDIGNLSSLIALNLENNQLSGPIPSS---IQNLQALYL  529

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL-FQLKLLNLSDNHFSGSFPL  417
             +N + G +P  L  L+ L  LHLG N L GSIP  +GNL   L+ L L  N  +   P 
Sbjct  530  KDNVLQGHIPYELCQLNNLAELHLGGNRLSGSIPSCLGNLSVALRHLWLGSNLLTSKIPS  589

Query  416  DIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL  237
                L  + +L+LS NSL G L  D+G  L  +    + +N FSG IP S+     + + 
Sbjct  590  SFWQLKNMLHLNLSSNSLVGPLSEDIG-KLKDVVDMDLSNNHFSGNIPGSIGGLQNMISF  648

Query  236  SLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            SL  N+  G +P  F  L  LE L L  N L+G IP+ + AL  L  ++LS NKL G  
Sbjct  649  SLANNSLEGPIPSSFKTLLSLEFLDLSKNNLSGVIPKSLEALLYLKHLNLSFNKLQGEI  707


 Score = 91.7 bits (226),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 108/222 (49%), Gaps = 5/222 (2%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +  D+GNLS L++LNL  N      P   S ++ L+ L    N   G+IP     L N
Sbjct  491  GNIPVDIGNLSSLIALNLENNQLSGPIP---SSIQNLQALYLKDNVLQGHIPYELCQLNN  547

Query  611  LRFLYLGNNNISGFLPTSLFNLS-KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            L  L+LG N +SG +P+ L NLS  L  L LG N L   IP     L  +  LNLS N  
Sbjct  548  LAELHLGGNRLSGSIPSCLGNLSVALRHLWLGSNLLTSKIPSSFWQLKNMLHLNLSSNSL  607

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
             G    DI  L  + ++ LS N   G +P  +G  L  +  F + +N   G IPSS    
Sbjct  608  VGPLSEDIGKLKDVVDMDLSNNHFSGNIPGSIGG-LQNMISFSLANNSLEGPIPSSFKTL  666

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
              L+ L L  NN SG +P+    L  L+ L L  N+L G IP
Sbjct  667  LSLEFLDLSKNNLSGVIPKSLEALLYLKHLNLSFNKLQGEIP  708


 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 112/243 (46%), Gaps = 28/243 (12%)
 Frame = -1

Query  767  NLSFLVSLNLSQNNFHNSFPRELSQLR-RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLG  591
            NL  L  L+L  N  + + P     L   L+ +  SF++  GNIP   G L +L  L L 
Sbjct  450  NLRKLTGLSLGGNPLNTTIPVFRGNLSTSLEDVDLSFSNIRGNIPVDIGNLSSLIALNLE  509

Query  590  NNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDI  411
            NN +SG +P+S+ NL   + L+L  N L+G IP E+  L  L  L+L  N  SGS     
Sbjct  510  NNQLSGPIPSSIQNL---QALYLKDNVLQGHIPYELCQLNNLAELHLGGNRLSGS-----  561

Query  410  lnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSL  231
                               +P  LGN    L+   + SN  + +IPSS  +   +  L+L
Sbjct  562  -------------------IPSCLGNLSVALRHLWLGSNLLTSKIPSSFWQLKNMLHLNL  602

Query  230  PFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQN  51
              N+  G +  + G L  +  + L +N  +G IP  IG L +++   L+NN L G    +
Sbjct  603  SSNSLVGPLSEDIGKLKDVVDMDLSNNHFSGNIPGSIGGLQNMISFSLANNSLEGPIPSS  662

Query  50   LDT  42
              T
Sbjct  663  FKT  665


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 62/109 (57%), Gaps = 0/109 (0%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            LNL +  LVG L+ D+G L  +V ++LS N+F  + P  +  L+ +     + N   G I
Sbjct  600  LNLSSNSLVGPLSEDIGKLKDVVDMDLSNNHFSGNIPGSIGGLQNMISFSLANNSLEGPI  659

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIP  492
            PS F  L +L FL L  NN+SG +P SL  L  L+ L+L  N L+G IP
Sbjct  660  PSSFKTLLSLEFLDLSKNNLSGVIPKSLEALLYLKHLNLSFNKLQGEIP  708


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 67/139 (48%), Gaps = 1/139 (1%)
 Frame = -1

Query  833  NRVSALNLFNMGLVGELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFN  657
            N ++ L+L    L G +   LGNLS  L  L L  N   +  P    QL+ +  L  S N
Sbjct  546  NNLAELHLGGNRLSGSIPSCLGNLSVALRHLWLGSNLLTSKIPSSFWQLKNMLHLNLSSN  605

Query  656  DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN  477
               G +    G L+++  + L NN+ SG +P S+  L  +    L  NSLEG IP     
Sbjct  606  SLVGPLSEDIGKLKDVVDMDLSNNHFSGNIPGSIGGLQNMISFSLANNSLEGPIPSSFKT  665

Query  476  LFQLKLLNLSDNHFSGSFP  420
            L  L+ L+LS N+ SG  P
Sbjct  666  LLSLEFLDLSKNNLSGVIP  684



>ref|XP_009376752.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Pyrus x bretschneideri]
Length=1114

 Score =   249 bits (637),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 197/332 (59%), Gaps = 24/332 (7%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLF  807
            AHTN +TD+ ALLSLK+ I  DP +IL  NWS  S +  C W+GVTC +RH+RV+ALNL 
Sbjct  23   AHTNFSTDQSALLSLKAHIISDPQNILTANWSSASNSDICTWVGVTCGARHHRVTALNLS  82

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
             MGL G + P LGNLSFLV L L  N+FH   P+ELS+LRRLK +    N+F G IPSWF
Sbjct  83   YMGLAGVIPPHLGNLSFLVELGLENNSFHGPLPQELSRLRRLKTINFVNNNFMGTIPSWF  142

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
            G    L+   L  N  SGF+P ++FNLS LE++ L  N L GSIPREIGNL  +K ++L 
Sbjct  143  GSFPKLQTFKLLGNGFSGFIPAAIFNLSALEIIDLSSNQLSGSIPREIGNLTMVKSIHLD  202

Query  446  DNHFS-----------------------GSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
            DN F                        GS  +  LN+S L  L+L  N++ G LP ++ 
Sbjct  203  DNKFEELPKEIGSLGQLEELLVQDNALKGSAFVPALNISSLITLALFGNNMSGSLPDNMC  262

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
             HLP ++   +  N+F G IPS L +C  L+ +S  +NNF G +P+  GNLT L +++L 
Sbjct  263  EHLPSVRGINLGQNQFDGLIPSKLWQCKELRVVSFEYNNFRGSIPKSLGNLTYLSRIYLY  322

Query  155  SNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             N L G IP EI  L  L I+ L  N L G  
Sbjct  323  HNNLEGTIPDEISNLPQLEILGLMINNLNGVI  354


 Score =   110 bits (276),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 99/303 (33%), Positives = 148/303 (49%), Gaps = 41/303 (14%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSG  645
             L LF   + G L  ++  +L  +  +NL QN F    P +L Q + L+++   +N+F G
Sbjct  245  TLALFGNNMSGSLPDNMCEHLPSVRGINLGQNQFDGLIPSKLWQCKELRVVSFEYNNFRG  304

Query  644  NIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQL  465
            +IP   G L  L  +YL +NN+ G +P  + NL +LE+L L +N+L G IP ++ NL  +
Sbjct  305  SIPKSLGNLTYLSRIYLYHNNLEGTIPDEISNLPQLEILGLMINNLNGVIPPKLFNLSMI  364

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
            +++ LS N  SGS P +I   +      L   +     PL   ++  KL++  M SN F+
Sbjct  365  RVIGLSLNPLSGSLPANIGLNAPNLESLLVDGTNLVAGPLPNLSNASKLRVLDMGSNSFT  424

Query  284  GEIPSSLSKCSL----------------------------------LQTLSLPFNNFSGH  207
            G +PS+L  CSL                                  L  LSL  N  +  
Sbjct  425  GFLPSTL--CSLKNLERLYLYLNSLTIDASAPQVESPLSCLFNLRKLTGLSLGGNPLNTT  482

Query  206  VPREFGNL-TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF---IQNLDTP  39
            +P   GNL T LE + L  + + G IP +IG LSSL+ ++L NN+L G     IQNL   
Sbjct  483  IPVFRGNLSTSLEDVDLSFSNIRGNIPVDIGNLSSLIALNLENNQLSGPIPSSIQNLQAL  542

Query  38   *LK  30
             LK
Sbjct  543  YLK  545


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 92/237 (39%), Positives = 124/237 (52%), Gaps = 6/237 (3%)
 Frame = -1

Query  770  GNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            GNLS  L  ++LS +N   + P ++  L  L  L    N  SG IPS    +QNL+ LYL
Sbjct  488  GNLSTSLEDVDLSFSNIRGNIPVDIGNLSSLIALNLENNQLSGPIPSS---IQNLQALYL  544

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL-FQLKLLNLSDNHFSGSFPL  417
             +N + G +P  L  L+ L  LHLG N L GSIP  +GNL   L+ L L  N  +   P 
Sbjct  545  KDNVLQGHIPYELCQLNNLAELHLGGNRLSGSIPSCLGNLSVALRHLWLGSNLLTSKIPS  604

Query  416  DIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL  237
                L  + +L+LS NSL G L  D+G  L  +    + +N FSG IP S+     + + 
Sbjct  605  SFWQLKNMLHLNLSSNSLVGPLSEDIG-KLKDVVDMDLSNNHFSGNIPGSIGGLQNMISF  663

Query  236  SLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            SL  N+  G +P  F  L  LE L L  N L+G IP+ + AL  L  ++LS NKL G
Sbjct  664  SLANNSLEGPIPSSFKTLLSLEFLDLSKNNLSGVIPKSLEALLYLKHLNLSFNKLQG  720


 Score = 92.0 bits (227),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 108/222 (49%), Gaps = 5/222 (2%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +  D+GNLS L++LNL  N      P   S ++ L+ L    N   G+IP     L N
Sbjct  506  GNIPVDIGNLSSLIALNLENNQLSGPIP---SSIQNLQALYLKDNVLQGHIPYELCQLNN  562

Query  611  LRFLYLGNNNISGFLPTSLFNLS-KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            L  L+LG N +SG +P+ L NLS  L  L LG N L   IP     L  +  LNLS N  
Sbjct  563  LAELHLGGNRLSGSIPSCLGNLSVALRHLWLGSNLLTSKIPSSFWQLKNMLHLNLSSNSL  622

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
             G    DI  L  + ++ LS N   G +P  +G  L  +  F + +N   G IPSS    
Sbjct  623  VGPLSEDIGKLKDVVDMDLSNNHFSGNIPGSIGG-LQNMISFSLANNSLEGPIPSSFKTL  681

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
              L+ L L  NN SG +P+    L  L+ L L  N+L G IP
Sbjct  682  LSLEFLDLSKNNLSGVIPKSLEALLYLKHLNLSFNKLQGEIP  723


 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 112/243 (46%), Gaps = 28/243 (12%)
 Frame = -1

Query  767  NLSFLVSLNLSQNNFHNSFPRELSQLR-RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLG  591
            NL  L  L+L  N  + + P     L   L+ +  SF++  GNIP   G L +L  L L 
Sbjct  465  NLRKLTGLSLGGNPLNTTIPVFRGNLSTSLEDVDLSFSNIRGNIPVDIGNLSSLIALNLE  524

Query  590  NNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDI  411
            NN +SG +P+S+ NL   + L+L  N L+G IP E+  L  L  L+L  N  SGS     
Sbjct  525  NNQLSGPIPSSIQNL---QALYLKDNVLQGHIPYELCQLNNLAELHLGGNRLSGS-----  576

Query  410  lnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSL  231
                               +P  LGN    L+   + SN  + +IPSS  +   +  L+L
Sbjct  577  -------------------IPSCLGNLSVALRHLWLGSNLLTSKIPSSFWQLKNMLHLNL  617

Query  230  PFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQN  51
              N+  G +  + G L  +  + L +N  +G IP  IG L +++   L+NN L G    +
Sbjct  618  SSNSLVGPLSEDIGKLKDVVDMDLSNNHFSGNIPGSIGGLQNMISFSLANNSLEGPIPSS  677

Query  50   LDT  42
              T
Sbjct  678  FKT  680


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 62/109 (57%), Gaps = 0/109 (0%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            LNL +  LVG L+ D+G L  +V ++LS N+F  + P  +  L+ +     + N   G I
Sbjct  615  LNLSSNSLVGPLSEDIGKLKDVVDMDLSNNHFSGNIPGSIGGLQNMISFSLANNSLEGPI  674

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIP  492
            PS F  L +L FL L  NN+SG +P SL  L  L+ L+L  N L+G IP
Sbjct  675  PSSFKTLLSLEFLDLSKNNLSGVIPKSLEALLYLKHLNLSFNKLQGEIP  723


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 67/139 (48%), Gaps = 1/139 (1%)
 Frame = -1

Query  833  NRVSALNLFNMGLVGELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFN  657
            N ++ L+L    L G +   LGNLS  L  L L  N   +  P    QL+ +  L  S N
Sbjct  561  NNLAELHLGGNRLSGSIPSCLGNLSVALRHLWLGSNLLTSKIPSSFWQLKNMLHLNLSSN  620

Query  656  DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN  477
               G +    G L+++  + L NN+ SG +P S+  L  +    L  NSLEG IP     
Sbjct  621  SLVGPLSEDIGKLKDVVDMDLSNNHFSGNIPGSIGGLQNMISFSLANNSLEGPIPSSFKT  680

Query  476  LFQLKLLNLSDNHFSGSFP  420
            L  L+ L+LS N+ SG  P
Sbjct  681  LLSLEFLDLSKNNLSGVIP  699



>ref|XP_009376751.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Pyrus x bretschneideri]
Length=1134

 Score =   249 bits (636),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 197/332 (59%), Gaps = 24/332 (7%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLF  807
            AHTN +TD+ ALLSLK+ I  DP +IL  NWS  S +  C W+GVTC +RH+RV+ALNL 
Sbjct  43   AHTNFSTDQSALLSLKAHIISDPQNILTANWSSASNSDICTWVGVTCGARHHRVTALNLS  102

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
             MGL G + P LGNLSFLV L L  N+FH   P+ELS+LRRLK +    N+F G IPSWF
Sbjct  103  YMGLAGVIPPHLGNLSFLVELGLENNSFHGPLPQELSRLRRLKTINFVNNNFMGTIPSWF  162

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
            G    L+   L  N  SGF+P ++FNLS LE++ L  N L GSIPREIGNL  +K ++L 
Sbjct  163  GSFPKLQTFKLLGNGFSGFIPAAIFNLSALEIIDLSSNQLSGSIPREIGNLTMVKSIHLD  222

Query  446  DNHFS-----------------------GSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
            DN F                        GS  +  LN+S L  L+L  N++ G LP ++ 
Sbjct  223  DNKFEELPKEIGSLGQLEELLVQDNALKGSAFVPALNISSLITLALFGNNMSGSLPDNMC  282

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
             HLP ++   +  N+F G IPS L +C  L+ +S  +NNF G +P+  GNLT L +++L 
Sbjct  283  EHLPSVRGINLGQNQFDGLIPSKLWQCKELRVVSFEYNNFRGSIPKSLGNLTYLSRIYLY  342

Query  155  SNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             N L G IP EI  L  L I+ L  N L G  
Sbjct  343  HNNLEGTIPDEISNLPQLEILGLMINNLNGVI  374


 Score =   110 bits (275),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 99/303 (33%), Positives = 148/303 (49%), Gaps = 41/303 (14%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSG  645
             L LF   + G L  ++  +L  +  +NL QN F    P +L Q + L+++   +N+F G
Sbjct  265  TLALFGNNMSGSLPDNMCEHLPSVRGINLGQNQFDGLIPSKLWQCKELRVVSFEYNNFRG  324

Query  644  NIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQL  465
            +IP   G L  L  +YL +NN+ G +P  + NL +LE+L L +N+L G IP ++ NL  +
Sbjct  325  SIPKSLGNLTYLSRIYLYHNNLEGTIPDEISNLPQLEILGLMINNLNGVIPPKLFNLSMI  384

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
            +++ LS N  SGS P +I   +      L   +     PL   ++  KL++  M SN F+
Sbjct  385  RVIGLSLNPLSGSLPANIGLNAPNLESLLVDGTNLVAGPLPNLSNASKLRVLDMGSNSFT  444

Query  284  GEIPSSLSKCSL----------------------------------LQTLSLPFNNFSGH  207
            G +PS+L  CSL                                  L  LSL  N  +  
Sbjct  445  GFLPSTL--CSLKNLERLYLYLNSLTIDASAPQVESPLSCLFNLRKLTGLSLGGNPLNTT  502

Query  206  VPREFGNL-TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF---IQNLDTP  39
            +P   GNL T LE + L  + + G IP +IG LSSL+ ++L NN+L G     IQNL   
Sbjct  503  IPVFRGNLSTSLEDVDLSFSNIRGNIPVDIGNLSSLIALNLENNQLSGPIPSSIQNLQAL  562

Query  38   *LK  30
             LK
Sbjct  563  YLK  565


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 124/239 (52%), Gaps = 6/239 (3%)
 Frame = -1

Query  770  GNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            GNLS  L  ++LS +N   + P ++  L  L  L    N  SG IPS    +QNL+ LYL
Sbjct  508  GNLSTSLEDVDLSFSNIRGNIPVDIGNLSSLIALNLENNQLSGPIPSS---IQNLQALYL  564

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL-FQLKLLNLSDNHFSGSFPL  417
             +N + G +P  L  L+ L  LHLG N L GSIP  +GNL   L+ L L  N  +   P 
Sbjct  565  KDNVLQGHIPYELCQLNNLAELHLGGNRLSGSIPSCLGNLSVALRHLWLGSNLLTSKIPS  624

Query  416  DIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL  237
                L  + +L+LS NSL G L  D+G  L  +    + +N FSG IP S+     + + 
Sbjct  625  SFWQLKNMLHLNLSSNSLVGPLSEDIG-KLKDVVDMDLSNNHFSGNIPGSIGGLQNMISF  683

Query  236  SLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            SL  N+  G +P  F  L  LE L L  N L+G IP+ + AL  L  ++LS NKL G  
Sbjct  684  SLANNSLEGPIPSSFKTLLSLEFLDLSKNNLSGVIPKSLEALLYLKHLNLSFNKLQGEI  742


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 108/222 (49%), Gaps = 5/222 (2%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +  D+GNLS L++LNL  N      P   S ++ L+ L    N   G+IP     L N
Sbjct  526  GNIPVDIGNLSSLIALNLENNQLSGPIP---SSIQNLQALYLKDNVLQGHIPYELCQLNN  582

Query  611  LRFLYLGNNNISGFLPTSLFNLS-KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            L  L+LG N +SG +P+ L NLS  L  L LG N L   IP     L  +  LNLS N  
Sbjct  583  LAELHLGGNRLSGSIPSCLGNLSVALRHLWLGSNLLTSKIPSSFWQLKNMLHLNLSSNSL  642

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
             G    DI  L  + ++ LS N   G +P  +G  L  +  F + +N   G IPSS    
Sbjct  643  VGPLSEDIGKLKDVVDMDLSNNHFSGNIPGSIGG-LQNMISFSLANNSLEGPIPSSFKTL  701

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
              L+ L L  NN SG +P+    L  L+ L L  N+L G IP
Sbjct  702  LSLEFLDLSKNNLSGVIPKSLEALLYLKHLNLSFNKLQGEIP  743


 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 112/243 (46%), Gaps = 28/243 (12%)
 Frame = -1

Query  767  NLSFLVSLNLSQNNFHNSFPRELSQLR-RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLG  591
            NL  L  L+L  N  + + P     L   L+ +  SF++  GNIP   G L +L  L L 
Sbjct  485  NLRKLTGLSLGGNPLNTTIPVFRGNLSTSLEDVDLSFSNIRGNIPVDIGNLSSLIALNLE  544

Query  590  NNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDI  411
            NN +SG +P+S+ NL   + L+L  N L+G IP E+  L  L  L+L  N  SGS     
Sbjct  545  NNQLSGPIPSSIQNL---QALYLKDNVLQGHIPYELCQLNNLAELHLGGNRLSGS-----  596

Query  410  lnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSL  231
                               +P  LGN    L+   + SN  + +IPSS  +   +  L+L
Sbjct  597  -------------------IPSCLGNLSVALRHLWLGSNLLTSKIPSSFWQLKNMLHLNL  637

Query  230  PFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQN  51
              N+  G +  + G L  +  + L +N  +G IP  IG L +++   L+NN L G    +
Sbjct  638  SSNSLVGPLSEDIGKLKDVVDMDLSNNHFSGNIPGSIGGLQNMISFSLANNSLEGPIPSS  697

Query  50   LDT  42
              T
Sbjct  698  FKT  700


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 62/109 (57%), Gaps = 0/109 (0%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            LNL +  LVG L+ D+G L  +V ++LS N+F  + P  +  L+ +     + N   G I
Sbjct  635  LNLSSNSLVGPLSEDIGKLKDVVDMDLSNNHFSGNIPGSIGGLQNMISFSLANNSLEGPI  694

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIP  492
            PS F  L +L FL L  NN+SG +P SL  L  L+ L+L  N L+G IP
Sbjct  695  PSSFKTLLSLEFLDLSKNNLSGVIPKSLEALLYLKHLNLSFNKLQGEIP  743


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 67/139 (48%), Gaps = 1/139 (1%)
 Frame = -1

Query  833  NRVSALNLFNMGLVGELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFN  657
            N ++ L+L    L G +   LGNLS  L  L L  N   +  P    QL+ +  L  S N
Sbjct  581  NNLAELHLGGNRLSGSIPSCLGNLSVALRHLWLGSNLLTSKIPSSFWQLKNMLHLNLSSN  640

Query  656  DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN  477
               G +    G L+++  + L NN+ SG +P S+  L  +    L  NSLEG IP     
Sbjct  641  SLVGPLSEDIGKLKDVVDMDLSNNHFSGNIPGSIGGLQNMISFSLANNSLEGPIPSSFKT  700

Query  476  LFQLKLLNLSDNHFSGSFP  420
            L  L+ L+LS N+ SG  P
Sbjct  701  LLSLEFLDLSKNNLSGVIP  719



>ref|XP_009351430.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL1 
[Pyrus x bretschneideri]
Length=381

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 143/333 (43%), Positives = 188/333 (56%), Gaps = 47/333 (14%)
 Frame = -1

Query  992  TINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALN  813
            T+ A TNI+TD+ ALL+LK+ I+ DP  IL  NWS ++   CNW+GVTC   H RV+ALN
Sbjct  29   TVAAQTNISTDQAALLALKAHITSDPQKILTTNWSTSNSNICNWVGVTCGVGHLRVTALN  88

Query  812  LFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPS  633
            L  MGL G + P LGNLSFL  L    N+FH + P ELS+LRRLK+++ SFN+F G IPS
Sbjct  89   LSYMGLTGSIPPQLGNLSFLAQLEFRNNSFHGTLPSELSRLRRLKLIRFSFNNFIGTIPS  148

Query  632  WFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHL-----------------------  522
            WFG L  L+   L  N  SGF+P ++FNLS L+VL L                       
Sbjct  149  WFGSLSELQTFDLYGNQFSGFIPNAIFNLSALQVLDLRNNELSGSIPREVEKLKMLEEIL  208

Query  521  -GVNSLEGSIPREIGNLFQLKLLNLSDNHFS-----------------------GSFPLD  414
             G N+  GSIPREIGNL  LK++ L  N F                        G  PL+
Sbjct  209  LGHNNFTGSIPREIGNLTMLKVIYLDYNMFEEIPNLVGSKDQVEKLYVQVNDLKGPVPLE  268

Query  413  IlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLS  234
            + N+S L+ L+L++N L G +P D   HLP +QI  +  NK  G +PS   +C  L   S
Sbjct  269  VFNMSSLKILALTINHLTGSIPDDFCQHLPSIQISSLARNKLDGPLPSKFWQCKELLQFS  328

Query  233  LPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGA  135
            L +NNF G +P+  GN T+L ++ +  N LTG 
Sbjct  329  LDYNNFGGSIPKSIGNSTQLAEITISYNNLTGT  361


 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P  LGN L  L     R+N F G +PS LS+   L+ +   FNNF G +P  FG+L+
Sbjct  96   GSIPPQLGN-LSFLAQLEFRNNSFHGTLPSELSRLRRLKLIRFSFNNFIGTIPSWFGSLS  154

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLD  45
            +L+   L  NQ +G IP  I  LS+L ++DL NN+L G+  + ++
Sbjct  155  ELQTFDLYGNQFSGFIPNAIFNLSALQVLDLRNNELSGSIPREVE  199


 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 76/184 (41%), Gaps = 50/184 (27%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +  L+L N  L G +  ++  L  L  + L  NNF  S PRE+  L  LK++   +N F 
Sbjct  180  LQVLDLRNNELSGSIPREVEKLKMLEEILLGHNNFTGSIPREIGNLTMLKVIYLDYNMFE  239

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIP--------  492
              IP+  G    +  LY+  N++ G +P  +FN+S L++L L +N L GSIP        
Sbjct  240  -EIPNLVGSKDQVEKLYVQVNDLKGPVPLEVFNMSSLKILALTINHLTGSIPDDFCQHLP  298

Query  491  -----------------------------------------REIGNLFQLKLLNLSDNHF  435
                                                     + IGN  QL  + +S N+ 
Sbjct  299  SIQISSLARNKLDGPLPSKFWQCKELLQFSLDYNNFGGSIPKSIGNSTQLAEITISYNNL  358

Query  434  SGSF  423
            +G+F
Sbjct  359  TGTF  362



>ref|XP_004293986.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Fragaria vesca subsp. vesca]
Length=1105

 Score =   248 bits (634),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 195/327 (60%), Gaps = 23/327 (7%)
 Frame = -1

Query  980  HTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNM  801
             TNI+TD+ ALL+LK++IS DP + +  NW+ NS   CNW+GVTC  RH RV  LNL   
Sbjct  6    QTNISTDQSALLALKAQISSDPQNKILTNWTSNSDV-CNWLGVTCGERHLRVVFLNLSEF  64

Query  800  GLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
             L G + P+LGNLSFL  + L  N+FH + PREL+ LRRL +    FN+F G IPSW G 
Sbjct  65   HLTGTIPPELGNLSFLAGMRLENNSFHGNIPRELAGLRRLTLFSIGFNNFVGEIPSWLGS  124

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            L  L+ L L  N  SG +PT +FNLS L+VL L  N L G+IP+EIGNL  LK+L L  N
Sbjct  125  LSKLQILNLYGNGFSGSIPTVIFNLSALQVLDLKYNQLSGTIPKEIGNLTMLKMLYLDSN  184

Query  440  HF----------------------SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
            +F                       G  P  + N+S +  L+L  N L G +P +L  +L
Sbjct  185  NFKELPNEIGALDLEELFVQENSLEGLVPAGVFNMSSMTTLNLLGNRLNGRIPDNLCRNL  244

Query  326  PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ  147
            P LQ   +  N+F G +PSSL +C+ L  L+L  NNFSG +PR  GNLT+++ L L SN 
Sbjct  245  PNLQGLNLAYNQFEGSLPSSLEQCNQLLVLTLGSNNFSGSIPRNIGNLTQIKYLHLGSNN  304

Query  146  LTGAIPREIGALSSLLIVDLSNNKLYG  66
            LTG IP EIG L +L  + L  N L G
Sbjct  305  LTGTIPHEIGHLGNLETLSLGANNLNG  331


 Score =   114 bits (285),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 105/347 (30%), Positives = 149/347 (43%), Gaps = 64/347 (18%)
 Frame = -1

Query  908  ILADNWSVNSITPCNWIGVTCNSRHN--------RVSALNLFNMGLVGELTPDLGNLSFL  753
            + A  ++++S+T  N +G   N R           +  LNL      G L   L   + L
Sbjct  212  VPAGVFNMSSMTTLNLLGNRLNGRIPDNLCRNLPNLQGLNLAYNQFEGSLPSSLEQCNQL  271

Query  752  VSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISG  573
            + L L  NNF  S PR +  L ++K L    N+ +G IP   G L NL  L LG NN++G
Sbjct  272  LVLTLGSNNFSGSIPRNIGNLTQIKYLHLGSNNLTGTIPHEIGHLGNLETLSLGANNLNG  331

Query  572  FLPTSLFNLS-------------------------KLEVLHLGVNSLEGSIPREIGNLFQ  468
             +P+ +FNLS                          L+ +H+G N+L G IP  I N  +
Sbjct  332  IIPSEIFNLSLLTGIDLSLNQLTGSLPANIGLAIPNLQEIHIGGNNLSGEIPNFISNASK  391

Query  467  LKLLNLSDNHFSGSFP-----------LDIlnlsklenlslsvnsLFG------------  357
            L  L++  N FSG  P           L +   + + + S    ++F             
Sbjct  392  LTKLDMGPNLFSGFIPATLCALPNLQWLLLSLNNLMIDTSSPEANIFSCLPNLRNLRMLS  451

Query  356  --------ELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVP  201
                     LP  LGN    LQ    R   F G IPS +   S L TL L FN  SG +P
Sbjct  452  LVGNPLSTTLPASLGNLSTSLQYIDFRGCNFRGNIPSKIGNLSGLTTLYLAFNELSGTIP  511

Query  200  REFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
               G L  L+ L+L  N+L G IP E+  L +L  ++L +N+L GT 
Sbjct  512  MTLGKLRNLQGLYLTGNKLQGNIPDELCQLDNLADLELYSNELSGTI  558


 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 131/257 (51%), Gaps = 8/257 (3%)
 Frame = -1

Query  815  NLFNMGLVG-----ELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND  654
            NL  + LVG      L   LGNLS  L  ++    NF  + P ++  L  L  L  +FN+
Sbjct  446  NLRMLSLVGNPLSTTLPASLGNLSTSLQYIDFRGCNFRGNIPSKIGNLSGLTTLYLAFNE  505

Query  653  FSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
             SG IP   G L+NL+ LYL  N + G +P  L  L  L  L L  N L G+IP  +GNL
Sbjct  506  LSGTIPMTLGKLRNLQGLYLTGNKLQGNIPDELCQLDNLADLELYSNELSGTIPSCLGNL  565

Query  473  FQLKLLNLSD-NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRS  297
             +     L   N  + + P  +  L  +  L LS NSL G L  D+GN L  +    + +
Sbjct  566  SRSLRRLLLSYNMLTSTIPSSLWELRYILLLGLSSNSLSGPLAEDVGN-LEVVAYIDLSN  624

Query  296  NKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIG  117
            N  SG +PSS      L +LSL  NNF G++P   GN   L  L L +N L+G IP+ + 
Sbjct  625  NHLSGSMPSSFGGLENLVSLSLANNNFVGNIPSSIGNSLSLALLDLSNNSLSGVIPKSLE  684

Query  116  ALSSLLIVDLSNNKLYG  66
            ALS L  ++LS NKL G
Sbjct  685  ALSHLQSLNLSFNKLEG  701


 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 83/269 (31%), Positives = 113/269 (42%), Gaps = 49/269 (18%)
 Frame = -1

Query  773  LGNLSFLVSLNLSQNNFHNSFPRELSQLR-RLKILQCSFNDFSGNIPSWFGLLQNLRFLY  597
            L NL  L  L+L  N    + P  L  L   L+ +     +F GNIPS  G L  L  LY
Sbjct  441  LPNLRNLRMLSLVGNPLSTTLPASLGNLSTSLQYIDFRGCNFRGNIPSKIGNLSGLTTLY  500

Query  596  LGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPL  417
            L  N +SG +P +L  L  L+ L+L  N L+G+IP E+  L  L  L L  N  SG+   
Sbjct  501  LAFNELSGTIPMTLGKLRNLQGLYLTGNKLQGNIPDELCQLDNLADLELYSNELSGT---  557

Query  416  DIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL---------  264
                                 +P  LGN    L+  ++  N  +  IPSSL         
Sbjct  558  ---------------------IPSCLGNLSRSLRRLLLSYNMLTSTIPSSLWELRYILLL  596

Query  263  ---------------SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
                               ++  + L  N+ SG +P  FG L  L  L L +N   G IP
Sbjct  597  GLSSNSLSGPLAEDVGNLEVVAYIDLSNNHLSGSMPSSFGGLENLVSLSLANNNFVGNIP  656

Query  128  REIGALSSLLIVDLSNNKLYGTFIQNLDT  42
              IG   SL ++DLSNN L G   ++L+ 
Sbjct  657  SSIGNSLSLALLDLSNNSLSGVIPKSLEA  685


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (57%), Gaps = 1/104 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P +LGN L  L    + +N F G IP  L+    L   S+ FNNF G +P   G+L+
Sbjct  68   GTIPPELGN-LSFLAGMRLENNSFHGNIPRELAGLRRLTLFSIGFNNFVGEIPSWLGSLS  126

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            KL+ L L  N  +G+IP  I  LS+L ++DL  N+L GT  + +
Sbjct  127  KLQILNLYGNGFSGSIPTVIFNLSALQVLDLKYNQLSGTIPKEI  170


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 62/117 (53%), Gaps = 6/117 (5%)
 Frame = -1

Query  785  LTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLR  606
            L  D+GNL  +  ++LS N+   S P     L  L  L  + N+F GNIPS  G   +L 
Sbjct  607  LAEDVGNLEVVAYIDLSNNHLSGSMPSSFGGLENLVSLSLANNNFVGNIPSSIGNSLSLA  666

Query  605  FLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             L L NN++SG +P SL  LS L+ L+L  N LEG IP   G  F+    N S N F
Sbjct  667  LLDLSNNSLSGVIPKSLEALSHLQSLNLSFNKLEGEIP--TGGPFE----NFSSNSF  717


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 53/96 (55%), Gaps = 0/96 (0%)
 Frame = -1

Query  707  RELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVL  528
             ++  L  +  +  S N  SG++PS FG L+NL  L L NNN  G +P+S+ N   L +L
Sbjct  609  EDVGNLEVVAYIDLSNNHLSGSMPSSFGGLENLVSLSLANNNFVGNIPSSIGNSLSLALL  668

Query  527  HLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
             L  NSL G IP+ +  L  L+ LNLS N   G  P
Sbjct  669  DLSNNSLSGVIPKSLEALSHLQSLNLSFNKLEGEIP  704



>ref|XP_008225314.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Prunus mume]
Length=1160

 Score =   249 bits (635),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 161/356 (45%), Positives = 215/356 (60%), Gaps = 30/356 (8%)
 Frame = -1

Query  1052  ITRHYFCLSIFFFHSLMLCLTIN----AHTNITTDKHALLSLKSKISFDPHSILADNWSV  885
             + R  F LSI F   L  C ++     A TNITTD+ ALL+LKS I+  PH+IL  NWS 
Sbjct  34    MERIGFLLSITFLLVLQ-CSSVGTVGVAQTNITTDQSALLALKSHITSYPHNILV-NWST  91

Query  884   NSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPR  705
              + + CNW+GVTC +RH RV++LNL  MGL G + P LGNLSFLV L    N+FH + P+
Sbjct  92    TT-SVCNWVGVTCGARHLRVASLNLSYMGLTGTIPPHLGNLSFLVELLFINNSFHGTLPK  150

Query  704   ELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLH  525
             EL+ LRRLK++   +N+F G+IP WFG    L+ + L  N  SG +P  +FNLS L+V++
Sbjct  151   ELAYLRRLKLISFGYNNFMGSIPLWFGSFPKLQSIDLRGNQFSGSIPAIIFNLSTLQVIN  210

Query  524   LGVNSLEGSIPREIGNLFQLKLLNLSDNHF-----------------------SGSFPLD  414
             L  N L GS+PREI NL  LK +NLS N F                        G  PL 
Sbjct  211   LSNNQLSGSVPREIRNLTMLKEINLSYNKFNEIPNEIGSLDELEKLYVQSNALKGHVPLG  270

Query  413   IlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLS  234
             + N+S L NL+L  N+L G LP ++   LP LQ   +  N+F G +PS L +C+ L  L+
Sbjct  271   VFNMSSLTNLNLHGNNLSGSLPDNICQQLPSLQELDLGLNQFDGPLPSKLWQCTQLLFLN  330

Query  233   LPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             L  NNFSG +PR+ GNLT+L K++L  N LTG IP E+G L +L ++ +  N L G
Sbjct  331   LEENNFSGSIPRKIGNLTQLRKIYLGVNNLTGIIPDEMGDLQNLELLSIEQNNLNG  386


 Score =   104 bits (260),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 86/252 (34%), Positives = 125/252 (50%), Gaps = 28/252 (11%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            LNL    L G L  ++   L  L  L+L  N F    P +L Q  +L  L    N+FSG+
Sbjct  280  LNLHGNNLSGSLPDNICQQLPSLQELDLGLNQFDGPLPSKLWQCTQLLFLNLEENNFSGS  339

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IP   G L  LR +YLG NN++G +P  + +L  LE+L +  N+L G IP  I N+ +L+
Sbjct  340  IPRKIGNLTQLRKIYLGVNNLTGIIPDEMGDLQNLELLSIEQNNLNGLIPSSIFNISKLR  399

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             L+L+ N  SGS                        LP ++G  +P LQ+  + +   SG
Sbjct  400  ALSLTLNKLSGS------------------------LPANIGLGVPNLQLLYIGATDVSG  435

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT--GAIPREIGALS  108
             IP +LS  S L  +S+ +N+F+G +PR    L  L+ L L  N LT   +    +  L 
Sbjct  436  VIP-NLSNASKLTRISMSYNSFTGFIPRTLCALINLQWLGLYMNNLTIDTSTLSCLANLK  494

Query  107  SLLIVDLSNNKL  72
            +L  +DL NN L
Sbjct  495  NLTTLDLGNNPL  506


 Score =   101 bits (252),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 97/272 (36%), Positives = 135/272 (50%), Gaps = 32/272 (12%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G L   L   + L+ LNL +NNF  S PR++  L +L+ +    N+ +G IP   G LQN
Sbjct  314  GPLPSKLWQCTQLLFLNLEENNFSGSIPRKIGNLTQLRKIYLGVNNLTGIIPDEMGDLQN  373

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG-NLFQLKLLNLSDNHF  435
            L  L +  NN++G +P+S+FN+SKL  L L +N L GS+P  IG  +  L+LL +     
Sbjct  374  LELLSIEQNNLNGLIPSSIFNISKLRALSLTLNKLSGSLPANIGLGVPNLQLLYIGATDV  433

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIP--SSLS  261
            SG  P ++ N SKL  +S+S NS  G +P  L   L  LQ   +  N  + +    S L+
Sbjct  434  SGVIP-NLSNASKLTRISMSYNSFTGFIPRTLC-ALINLQWLGLYMNNLTIDTSTLSCLA  491

Query  260  KCSLLQTLSL-----------PFNNFS----------------GHVPREFGNLTKLEKLF  162
                L TL L            F NFS                G++P   GNL+ L  L 
Sbjct  492  NLKNLTTLDLGNNPLNVRLDDSFRNFSLTSSLQYIFLPNCIMRGNIPIGIGNLSSLVALE  551

Query  161  LRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            L  NQL+G+IP  +G L  L  + L  NKL G
Sbjct  552  LGYNQLSGSIPTSVGRLGDLQGLSLGGNKLQG  583


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 139/283 (49%), Gaps = 19/283 (7%)
 Frame = -1

Query  863  WIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNF-------------  723
            W+G+  N+     S L+     L    T DLGN    V L+ S  NF             
Sbjct  472  WLGLYMNNLTIDTSTLSCL-ANLKNLTTLDLGNNPLNVRLDDSFRNFSLTSSLQYIFLPN  530

Query  722  ---HNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLF  552
                 + P  +  L  L  L+  +N  SG+IP+  G L +L+ L LG N + G++P  L 
Sbjct  531  CIMRGNIPIGIGNLSSLVALELGYNQLSGSIPTSVGRLGDLQGLSLGGNKLQGYIPYQLC  590

Query  551  NLSKLEVLHLGVNSLEGSIPREIGNLF-QLKLLNLSDNHFSGSFPLDIlnlsklenlsls  375
             L  L  L+LG N L  SIP  +GNL   L+ L+L  N  + + P  +  L+ L  L++S
Sbjct  591  QLDNLAYLYLGSNQLSSSIPSCLGNLAPSLRGLSLGFNLLTSTIPSSLWKLTYLLYLNVS  650

Query  374  vnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPRE  195
             NSL G L  D+GN L  +    + +N  SG IPS++     L  LSL  NN  G +P  
Sbjct  651  SNSLIGPLSQDIGN-LKVVLAVDLSNNHLSGVIPSTIGPLRDLVNLSLANNNLEGPIPSS  709

Query  194  FGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            F  L  L+ L L  N L+G IP+ + ALS L  +DLS N+L G
Sbjct  710  FHYLLSLQLLNLSRNNLSGVIPKSLEALSLLKHLDLSFNRLQG  752


 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 111/222 (50%), Gaps = 2/222 (1%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +   +GNLS LV+L L  N    S P  + +L  L+ L    N   G IP     L N
Sbjct  535  GNIPIGIGNLSSLVALELGYNQLSGSIPTSVGRLGDLQGLSLGGNKLQGYIPYQLCQLDN  594

Query  611  LRFLYLGNNNISGFLPTSLFNLS-KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            L +LYLG+N +S  +P+ L NL+  L  L LG N L  +IP  +  L  L  LN+S N  
Sbjct  595  LAYLYLGSNQLSSSIPSCLGNLAPSLRGLSLGFNLLTSTIPSSLWKLTYLLYLNVSSNSL  654

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
             G    DI NL  +  + LS N L G +P  +G  L  L    + +N   G IPSS    
Sbjct  655  IGPLSQDIGNLKVVLAVDLSNNHLSGVIPSTIG-PLRDLVNLSLANNNLEGPIPSSFHYL  713

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
              LQ L+L  NN SG +P+    L+ L+ L L  N+L G IP
Sbjct  714  LSLQLLNLSRNNLSGVIPKSLEALSLLKHLDLSFNRLQGEIP  755


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P  LGN L  L   +  +N F G +P  L+    L+ +S  +NNF G +P  FG+  
Sbjct  122  GTIPPHLGN-LSFLVELLFINNSFHGTLPKELAYLRRLKLISFGYNNFMGSIPLWFGSFP  180

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGT  63
            KL+ + LR NQ +G+IP  I  LS+L +++LSNN+L G+
Sbjct  181  KLQSIDLRGNQFSGSIPAIIFNLSTLQVINLSNNQLSGS  219


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 67/117 (57%), Gaps = 2/117 (2%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            LN+ +  L+G L+ D+GNL  +++++LS N+     P  +  LR L  L  + N+  G I
Sbjct  647  LNVSSNSLIGPLSQDIGNLKVVLAVDLSNNHLSGVIPSTIGPLRDLVNLSLANNNLEGPI  706

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            PS F  L +L+ L L  NN+SG +P SL  LS L+ L L  N L+G IP   G  FQ
Sbjct  707  PSSFHYLLSLQLLNLSRNNLSGVIPKSLEALSLLKHLDLSFNRLQGEIP--TGGPFQ  761


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 72/130 (55%), Gaps = 1/130 (1%)
 Frame = -1

Query  809  FNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSW  630
            FN+ L   +   L  L++L+ LN+S N+      +++  L+ +  +  S N  SG IPS 
Sbjct  627  FNL-LTSTIPSSLWKLTYLLYLNVSSNSLIGPLSQDIGNLKVVLAVDLSNNHLSGVIPST  685

Query  629  FGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
             G L++L  L L NNN+ G +P+S   L  L++L+L  N+L G IP+ +  L  LK L+L
Sbjct  686  IGPLRDLVNLSLANNNLEGPIPSSFHYLLSLQLLNLSRNNLSGVIPKSLEALSLLKHLDL  745

Query  449  SDNHFSGSFP  420
            S N   G  P
Sbjct  746  SFNRLQGEIP  755



>ref|XP_011099195.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1210

 Score =   249 bits (636),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 212/326 (65%), Gaps = 3/326 (1%)
 Frame = -1

Query  1040  YFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CN  864
             +  + I   +   +C    AH N+T+D+ ALL+ KS+I+ DP +ILA NWS+ S +  C+
Sbjct  6     FHIVVIILLNCFSVCCFGQAHLNLTSDEEALLAFKSRITSDPLNILASNWSITSPSSVCS  65

Query  863   WIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRR  684
             WIGV+C  +  R+ ALNL ++ L G + P LGNL+FL SL+LS N F    P EL++LRR
Sbjct  66    WIGVSCGVKE-RIVALNLSHLSLGGTIHPHLGNLTFLTSLDLSLNRFTGHVPDELARLRR  124

Query  683   LKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLE  504
             LK +   FN+F+G++PS  G +  L  ++L NN+ +G +P +L NLSKL  L L  NS+ 
Sbjct  125   LKGINLGFNNFTGDVPSCLGSMTKLENVFLRNNSFTGAIP-NLLNLSKLVTLVLSYNSIH  183

Query  503   GSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLP  324
             G+IP+EIGN+  L+ L+L  N  +GS P  I NLS LE   L+ NSL G +P+D+ ++LP
Sbjct  184   GNIPKEIGNISNLESLDLKYNKLTGSIPSSIFNLSYLEKFDLTNNSLSGPIPMDMCDNLP  243

Query  323   KLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQL  144
             +L+      N+ SG IPSS+SKC  LQ LSL FN FSG +P+  G LT L+ L+L +N  
Sbjct  244   RLRGVSFSLNQLSGPIPSSISKCRALQQLSLSFNQFSGSIPKGIGELTMLKNLYLGANNF  303

Query  143   TGAIPREIGALSSLLIVDLSNNKLYG  66
              GAIP+EIG LS+L I  +  + L G
Sbjct  304   QGAIPQEIGNLSNLEIFSMRRSSLTG  329


 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 133/253 (53%), Gaps = 28/253 (11%)
 Frame = -1

Query  815  NLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            +L N  L G +  D+  NL  L  ++ S N      P  +S+ R L+ L  SFN FSG+I
Sbjct  224  DLTNNSLSGPIPMDMCDNLPRLRGVSFSLNQLSGPIPSSISKCRALQQLSLSFNQFSGSI  283

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKL  459
            P   G L  L+ LYLG NN  G +P  + NLS LE+  +  +SL G +P  + N+  LK 
Sbjct  284  PKGIGELTMLKNLYLGANNFQGAIPQEIGNLSNLEIFSMRRSSLTGKLPSFVFNISSLKQ  343

Query  458  LNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGE  279
            ++LS N  SGS P DI                         ++LP L+   ++SN+ +G+
Sbjct  344  IDLSYNRLSGSLPPDIH------------------------HNLPNLEQLFLQSNQLTGQ  379

Query  278  IPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALS-SL  102
            I SSL  C  L  L L  N F+  +P++ GN+T+L+ L+L  N +TG IP E+G L+   
Sbjct  380  IFSSLLDCKKLWLLQLNDNQFTSTIPKQVGNMTQLKILYLVKNNMTGEIPSELGNLNLER  439

Query  101  LIVDLSNNKLYGT  63
            L VD   NK +G+
Sbjct  440  LAVDA--NKFFGS  450


 Score =   124 bits (311),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 90/267 (34%), Positives = 129/267 (48%), Gaps = 29/267 (11%)
 Frame = -1

Query  857  GVTCNSRHNRVSALNLFNM---GLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLR  687
            G+   S  N  +++ +F      + G +  ++GNLS L SL L  N    S PREL +L+
Sbjct  576  GILPRSVGNLSTSIQMFRAIGCKIKGSIPAEIGNLSSLKSLYLDHNELTGSIPRELGKLK  635

Query  686  RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSL  507
            +++++    N   G IP+    +  L  LYL  N ++G +P  L  L  L  + L  N L
Sbjct  636  QVELVTLDHNRLEGQIPTGLCQISRLGELYLSGNVLNGTIPACLGELKSLRRILLDSNRL  695

Query  506  EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
              S+P  + NL  +  LNLS N  SG  P DI                          +L
Sbjct  696  TSSVP-NLWNLTDVWALNLSTNLLSGQIPSDI-------------------------ENL  729

Query  326  PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ  147
              L    +  N+FSG+IPSS+     L TLS   NN  G +P+  G L  LE L L +N 
Sbjct  730  KALIYLDLSRNRFSGDIPSSIGSIDSLVTLSFAHNNLQGTIPQSLGGLRGLESLDLSNNN  789

Query  146  LTGAIPREIGALSSLLIVDLSNNKLYG  66
            L+G+IPR + AL+SL   D+S+N L G
Sbjct  790  LSGSIPRSLEALTSLQYFDVSHNGLAG  816


 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 99/306 (32%), Positives = 143/306 (47%), Gaps = 38/306 (12%)
 Frame = -1

Query  827  VSALNLFNMG---LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRE-------LSQLRRLK  678
             S L++ +MG     G L PD  NL  +  L +  NN     P +       L   R L+
Sbjct  507  ASKLSVIDMGSNSFTGPL-PDFSNLRLVQRLIIPGNNLTGEAPDQELRFFSSLQNCRNLQ  565

Query  677  ILQCSFNDFSGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEG  501
            +L+ S N  +G +P   G L  +++        I G +P  + NLS L+ L+L  N L G
Sbjct  566  MLELSSNQLNGILPRSVGNLSTSIQMFRAIGCKIKGSIPAEIGNLSSLKSLYLDHNELTG  625

Query  500  SIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPK  321
            SIPRE+G L Q++L+ L  N   G  P  +  +S+L  L LS N L G +P  LG  L  
Sbjct  626  SIPRELGKLKQVELVTLDHNRLEGQIPTGLCQISRLGELYLSGNVLNGTIPACLG-ELKS  684

Query  320  LQIFVMRSNKF-----------------------SGEIPSSLSKCSLLQTLSLPFNNFSG  210
            L+  ++ SN+                        SG+IPS +     L  L L  N FSG
Sbjct  685  LRRILLDSNRLTSSVPNLWNLTDVWALNLSTNLLSGQIPSDIENLKALIYLDLSRNRFSG  744

Query  209  HVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDTP*LK  30
             +P   G++  L  L    N L G IP+ +G L  L  +DLSNN L G+  ++L+   L 
Sbjct  745  DIPSSIGSIDSLVTLSFAHNNLQGTIPQSLGGLRGLESLDLSNNNLSGSIPRSLEA--LT  802

Query  29   *LSYYN  12
             L Y++
Sbjct  803  SLQYFD  808


 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 148/276 (54%), Gaps = 16/276 (6%)
 Frame = -1

Query  827  VSALNLFNM---GLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQ-LRRLKILQCSF  660
            +S L +F+M    L G+L   + N+S L  ++LS N    S P ++   L  L+ L    
Sbjct  314  LSNLEIFSMRRSSLTGKLPSFVFNISSLKQIDLSYNRLSGSLPPDIHHNLPNLEQLFLQS  373

Query  659  NDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG  480
            N  +G I S     + L  L L +N  +  +P  + N+++L++L+L  N++ G IP E+G
Sbjct  374  NQLTGQIFSSLLDCKKLWLLQLNDNQFTSTIPKQVGNMTQLKILYLVKNNMTGEIPSELG  433

Query  479  NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMR  300
            NL  L+ L +  N F GS P  I N+S L  L L  N   G+LP ++G  LP L+   + 
Sbjct  434  NL-NLERLAVDANKFFGSVPYSIFNISMLIELGLGFNRFTGQLPANMGYSLPNLEFLYLT  492

Query  299  SNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP-RE  123
             N FSG IP S+S  S L  + +  N+F+G +P +F NL  +++L +  N LTG  P +E
Sbjct  493  ENSFSGPIPRSISNASKLSVIDMGSNSFTGPLP-DFSNLRLVQRLIIPGNNLTGEAPDQE  551

Query  122  IGALSS------LLIVDLSNNKLYGTF---IQNLDT  42
            +   SS      L +++LS+N+L G     + NL T
Sbjct  552  LRFFSSLQNCRNLQMLELSSNQLNGILPRSVGNLST  587


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = -1

Query  782  TPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRF  603
             P+L NL+ + +LNLS N      P ++  L+ L  L  S N FSG+IPS  G + +L  
Sbjct  699  VPNLWNLTDVWALNLSTNLLSGQIPSDIENLKALIYLDLSRNRFSGDIPSSIGSIDSLVT  758

Query  602  LYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSF  423
            L   +NN+ G +P SL  L  LE L L  N+L GSIPR +  L  L+  ++S N  +G  
Sbjct  759  LSFAHNNLQGTIPQSLGGLRGLESLDLSNNNLSGSIPRSLEALTSLQYFDVSHNGLAGEV  818

Query  422  P  420
            P
Sbjct  819  P  819


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 59/112 (53%), Gaps = 0/112 (0%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            V ALNL    L G++  D+ NL  L+ L+LS+N F    P  +  +  L  L  + N+  
Sbjct  708  VWALNLSTNLLSGQIPSDIENLKALIYLDLSRNRFSGDIPSSIGSIDSLVTLSFAHNNLQ  767

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIP  492
            G IP   G L+ L  L L NNN+SG +P SL  L+ L+   +  N L G +P
Sbjct  768  GTIPQSLGGLRGLESLDLSNNNLSGSIPRSLEALTSLQYFDVSHNGLAGEVP  819



>emb|CDP11295.1| unnamed protein product [Coffea canephora]
Length=1131

 Score =   248 bits (634),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 191/326 (59%), Gaps = 44/326 (13%)
 Frame = -1

Query  977  TNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMG  798
            +NITTDK +LL+L++ IS DP  ILA NWSV S + C WIGVTC SRH+RV+ALN+ N+G
Sbjct  27   SNITTDKSSLLALRAHISVDPLQILAKNWSVGS-SVCEWIGVTCGSRHHRVTALNIANLG  85

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            LVG + P LGNLSFLVSL++S NNFH   P E   LRRLK+   S N+  G +P W G  
Sbjct  86   LVGIIPPQLGNLSFLVSLDMSANNFHGELPHEFVGLRRLKLFNLSVNNLEGELPWWIGSF  145

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
              L  L L NN+ +G +P+S+ N+SKLE + L  N L+G+IP  I N+  L+L+ L+ N 
Sbjct  146  PQLLRLSLSNNSFTGLIPSSISNMSKLEEISLSYNLLQGNIPTGIFNISSLQLMRLTGNG  205

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             SG+                        +P D+ +HL  L +  +  NK +G++PSSL +
Sbjct  206  LSGT------------------------IPSDMCHHLRGLSLLALSQNKLNGQLPSSLGQ  241

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGA-------------------  135
            CS LQTLSL FN F G +P+E G+L KLE LFL  N L G                    
Sbjct  242  CSELQTLSLSFNGFRGSIPKEIGDLKKLEVLFLSHNYLEGKILANFFTIDKLRAKTYSCQ  301

Query  134  IPREIGALSSLLIVDLSNNKLYGTFI  57
            IP+EIG  + + + +   N L GT I
Sbjct  302  IPKEIGNSTMIKMQNFGFNNLTGTTI  327


 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 135/276 (49%), Gaps = 38/276 (14%)
 Frame = -1

Query  836  HNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFN  657
            H+ +  LN+    L G +  ++GN  FL  L+L  N+   S P E+  L +L+I+  + N
Sbjct  337  HDLIYVLNII---LAGVIPREIGNWYFLQQLSLQFNSLTGSIPMEIFNLSKLRIMSVTQN  393

Query  656  DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN  477
              SGN+PS F  L+   +LYLGNN++SG LP+S+ N S L ++ +  N   G IP  +G+
Sbjct  394  QLSGNLPSTFPYLE---YLYLGNNHLSGALPSSISNSSNLHLIEIADNKFTGPIPTSMGD  450

Query  476  LFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPK---LQIFV  306
            L  L+LL+LS N     FP                        L     L K   L I  
Sbjct  451  LRFLELLDLSGNLLVRDFP---------------------SPELSFITSLAKCKYLAILF  489

Query  305  MRSNKFSGEIPSSLSKCSL-LQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
            +  N  +G IP+SLS  S  L+ L+ P     G +P   GNLT L  L L +N LTG++P
Sbjct  490  LGGNPLNGIIPNSLSNLSTSLEQLNAPNCKIKGSIPDGIGNLTSLILLDLSNNDLTGSLP  549

Query  128  REIGALSSLLIVDLSNNKLYGTF-------IQNLDT  42
              I  L  L  +DLS NKL           + NLDT
Sbjct  550  ATIKDLRKLQYMDLSMNKLISRVPLHLLCALHNLDT  585


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 110/243 (45%), Gaps = 36/243 (15%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            L L N  L G L   + N S L  + ++ N F    P  +  LR L++L  S N    + 
Sbjct  409  LYLGNNHLSGALPSSISNSSNLHLIEIADNKFTGPIPTSMGDLRFLELLDLSGNLLVRDF  468

Query  638  PS-------WFGLLQNLRFLYLGNNNISGFLPTSLFNLS-KLEVLHLGVNSLEGSIPREI  483
            PS            + L  L+LG N ++G +P SL NLS  LE L+     ++GSIP  I
Sbjct  469  PSPELSFITSLAKCKYLAILFLGGNPLNGIIPNSLSNLSTSLEQLNAPNCKIKGSIPDGI  528

Query  482  GNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVM  303
            GNL  L LL+LS+N  +GS P  I                           L KLQ   +
Sbjct  529  GNLTSLILLDLSNNDLTGSLPATI-------------------------KDLRKLQYMDL  563

Query  302  RSNKFSGEIPSSLSKCSL--LQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
              NK    +P  L  C+L  L T++L  N F   +P+ FGNLT L  L L  N+L  A P
Sbjct  564  SMNKLISRVPLHL-LCALHNLDTMNLGQNQFMASIPKCFGNLTSLRHLNLSHNRLYSAPP  622

Query  128  REI  120
             EI
Sbjct  623  EEI  625


 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 91/268 (34%), Positives = 127/268 (47%), Gaps = 29/268 (11%)
 Frame = -1

Query  857  GVTCNSRHN---RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLR  687
            G+  NS  N    +  LN  N  + G +   +GNL+ L+ L+LS N+   S P  +  LR
Sbjct  497  GIIPNSLSNLSTSLEQLNAPNCKIKGSIPDGIGNLTSLILLDLSNNDLTGSLPATIKDLR  556

Query  686  RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSL  507
            +L+ +  S N     +P           L+L            L  L  L+ ++LG N  
Sbjct  557  KLQYMDLSMNKLISRVP-----------LHL------------LCALHNLDTMNLGQNQF  593

Query  506  EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
              SIP+  GNL  L+ LNLS N    + P +I NL  L  L LS N L G LP  + N  
Sbjct  594  MASIPKCFGNLTSLRHLNLSHNRLYSAPPEEIWNLKDLLELDLSSNLLSGSLPYAITNM-  652

Query  326  PKLQIFV-MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN  150
             K+  +V + +N+FSG IP S+     LQ LSL  N   G +P   G +  LE L L  N
Sbjct  653  -KMANWVDLSTNQFSGGIPGSIGDMQNLQNLSLAHNRLQGSIPESIGKVFSLESLDLSHN  711

Query  149  QLTGAIPREIGALSSLLIVDLSNNKLYG  66
             L+ +IP  +  L  L  ++LS N L G
Sbjct  712  FLSESIPISMENLRYLKNINLSFNNLSG  739


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 75/163 (46%), Gaps = 25/163 (15%)
 Frame = -1

Query  836  HNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL--------------  699
            HN +  +NL     +  +    GNL+ L  LNLS N  +++ P E+              
Sbjct  581  HN-LDTMNLGQNQFMASIPKCFGNLTSLRHLNLSHNRLYSAPPEEIWNLKDLLELDLSSN  639

Query  698  ----------SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN  549
                      + ++    +  S N FSG IP   G +QNL+ L L +N + G +P S+  
Sbjct  640  LLSGSLPYAITNMKMANWVDLSTNQFSGGIPGSIGDMQNLQNLSLAHNRLQGSIPESIGK  699

Query  548  LSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
            +  LE L L  N L  SIP  + NL  LK +NLS N+ SG  P
Sbjct  700  VFSLESLDLSHNFLSESIPISMENLRYLKNINLSFNNLSGEIP  742



>ref|XP_006355253.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Solanum tuberosum]
Length=479

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/306 (45%), Positives = 196/306 (64%), Gaps = 1/306 (0%)
 Frame = -1

Query  977  TNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMG  798
            TN +TD+ ALLSLKS+I  DP  +L ++WS  + + C+W+GVTC SRH RV +LN+ NM 
Sbjct  9    TNFSTDQSALLSLKSQIILDPFHLLDESWSPTT-SVCHWVGVTCGSRHQRVRSLNISNMA  67

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L+G++   +GNL+FLVSL+LS NN + + P+E++ LRRL+ L    N  SG +PSWFG L
Sbjct  68   LIGKIPSHIGNLTFLVSLDLSHNNLYGNLPQEIAHLRRLRFLNLGVNMLSGEVPSWFGNL  127

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
              L+ L L NN+ +GF+P+ L N+S L+ L+L  NSL G IP +IG L  LK LN+  N 
Sbjct  128  HKLQVLNLRNNSFNGFIPSLLSNISGLQTLNLRFNSLGGQIPEKIGKLQNLKELNIEANR  187

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             +GS P  I N+S ++ ++L+ N+L G LP D+ +    L+   +  N+  G +P SL  
Sbjct  188  LTGSIPFSIFNISGIKVIALTDNTLSGNLPPDMCDRQSMLEELYLSFNELRGHMPLSLPN  247

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
            C  LQ LSL  N F G +  E G+L+ L  L+L  NQ  G IP++IG L +L ++ L  N
Sbjct  248  CLKLQLLSLSVNKFDGPIHSEIGHLSDLRILYLGQNQFEGTIPQDIGILDNLEVLGLERN  307

Query  77   KLYGTF  60
             L G+ 
Sbjct  308  HLTGSI  313


 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 98/281 (35%), Positives = 144/281 (51%), Gaps = 26/281 (9%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +  LNL    L G++   +G L  L  LN+  N    S P  +  +  +K++  + N  S
Sbjct  154  LQTLNLRFNSLGGQIPEKIGKLQNLKELNIEANRLTGSIPFSIFNISGIKVIALTDNTLS  213

Query  647  GNIPSWFGLLQN-LRFLYLGNNNISGFLPTSLFN------------------------LS  543
            GN+P      Q+ L  LYL  N + G +P SL N                        LS
Sbjct  214  GNLPPDMCDRQSMLEELYLSFNELRGHMPLSLPNCLKLQLLSLSVNKFDGPIHSEIGHLS  273

Query  542  KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsL  363
             L +L+LG N  EG+IP++IG L  L++L L  NH +GS P+ I N+S L+ +SL +N+L
Sbjct  274  DLRILYLGQNQFEGTIPQDIGILDNLEVLGLERNHLTGSIPISIFNISSLQTMSLEMNNL  333

Query  362  FGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNL  183
             G LP ++GN L KL+I  +  N  +G IP  +     L  L L  N  +GH+P    N+
Sbjct  334  MGSLPREIGN-LNKLRILYLGYNMLTGTIPQEIGILDNLVELGLDSNQITGHIPISIFNI  392

Query  182  TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            + LE L+L  N L G++P E+G L+ L  + L+ NKL G  
Sbjct  393  SSLETLYLERNHLIGSLPGEVGNLTKLQSLRLTENKLTGKI  433


 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 89/229 (39%), Positives = 122/229 (53%), Gaps = 26/229 (11%)
 Frame = -1

Query  746  LNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFL  567
            L+LS N F      E+  L  L+IL    N F G IP   G+L NL  L L  N+++G +
Sbjct  254  LSLSVNKFDGPIHSEIGHLSDLRILYLGQNQFEGTIPQDIGILDNLEVLGLERNHLTGSI  313

Query  566  PTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklen  387
            P S+FN+S L+ + L +N+L GS+PREIGNL +L++L L  N  +G+ P +I  L  L  
Sbjct  314  PISIFNISSLQTMSLEMNNLMGSLPREIGNLNKLRILYLGYNMLTGTIPQEIGILDNLV-  372

Query  386  lslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGH  207
                      EL LD              SN+ +G IP S+   S L+TL L  N+  G 
Sbjct  373  ----------ELGLD--------------SNQITGHIPISIFNISSLETLYLERNHLIGS  408

Query  206  VPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            +P E GNLTKL+ L L  N+LTG IP ++  L  L+ + L  NK  G  
Sbjct  409  LPGEVGNLTKLQSLRLTENKLTGKIP-DVSNLVELVEIYLGLNKFTGAL  456


 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 101/189 (53%), Gaps = 26/189 (14%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +   + N+S L +++L  NN   S PRE+  L +L+IL   +N  +G IP   G+L
Sbjct  309  LTGSIPISIFNISSLQTMSLEMNNLMGSLPREIGNLNKLRILYLGYNMLTGTIPQEIGIL  368

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
             NL  L L +N I+G +P S+FN+S LE L+L  N L GS+P E+GNL +L+ L L++N 
Sbjct  369  DNLVELGLDSNQITGHIPISIFNISSLETLYLERNHLIGSLPGEVGNLTKLQSLRLTENK  428

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             +G  P                         D+ N +  ++I+ +  NKF+G +P+ L  
Sbjct  429  LTGKIP-------------------------DVSNLVELVEIY-LGLNKFTGALPTELFN  462

Query  257  CSLLQTLSL  231
             S ++ + L
Sbjct  463  MSGMRVIEL  471



>ref|XP_011039410.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Populus 
euphratica]
Length=1140

 Score =   248 bits (634),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 215/323 (67%), Gaps = 6/323 (2%)
 Frame = -1

Query  1025  IFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTC  846
             +     L++CL I  HTN TTD+ AL+SLK  I+FDP +ILA+NWS  + + C+W GVTC
Sbjct  9     LLLISCLIVCLAI-PHTN-TTDELALMSLKKHITFDPGNILANNWST-ATSFCSWTGVTC  65

Query  845   NSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQC  666
             ++ H RV++LNL +M L G L P +GNLSFLVSLNLS N+FH   PREL+ L R+K +  
Sbjct  66    SAGHQRVTSLNLSSMRLEGTLPPQVGNLSFLVSLNLSNNSFHGYLPRELTHLHRMKDMNL  125

Query  665   SFNDFSGNIP-SWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR  489
             ++N+FSG+IP SWF +L  L+ L+L NN+++G +P+SLFN++ LE L+L  N +EG+I  
Sbjct  126   AYNNFSGDIPSSWFAMLPQLQHLFLTNNSLAGSIPSSLFNVTALETLNLEGNFIEGNISE  185

Query  488   EIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLD--LGNHLPKLQ  315
             EI +L  LK+L+L  NHFSG     + N+  L+ ++L  NSL G L +D  + N    L+
Sbjct  186   EIRSLSNLKILDLGHNHFSGVISPVLFNMPSLQLINLRANSLSGILQVDMIMSNISSTLE  245

Query  314   IFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGA  135
             +  +  N+  G  PS+L KC+ L+ L L  N F+G +P+E   LTKL++L+L  N LTG 
Sbjct  246   VLNLGYNQLHGRTPSNLHKCTELRVLDLESNRFTGSIPKEICTLTKLKELYLGKNNLTGQ  305

Query  134   IPREIGALSSLLIVDLSNNKLYG  66
             IP EI  L SL  + L  N+L G
Sbjct  306   IPGEIARLVSLEKLGLEVNRLNG  328


 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 119/233 (51%), Gaps = 26/233 (11%)
 Frame = -1

Query  761  SFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNN  582
            S L  LNL  N  H   P  L +   L++L    N F+G+IP     L  L+ LYLG NN
Sbjct  242  STLEVLNLGYNQLHGRTPSNLHKCTELRVLDLESNRFTGSIPKEICTLTKLKELYLGKNN  301

Query  581  ISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnl  402
            ++G +P  +  L  LE L L VN L G+IPREIGN   L  +++ +N+ +G         
Sbjct  302  LTGQIPGEIARLVSLEKLGLEVNRLNGNIPREIGNCTNLMEIHMENNNLTGV--------  353

Query  401  sklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFN  222
                            +P ++GN L  LQ   +  N  +G IPS+    S+L+ +++ +N
Sbjct  354  ----------------IPNEMGN-LHTLQELDLGFNNITGSIPSTFFNFSILRRVNMAYN  396

Query  221  NFSGHVPREFG-NLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
              SGH+P   G  L  LE+L+L  N+L+G IP  I   S L+++DLS N   G
Sbjct  397  YLSGHLPSNTGLGLPNLEELYLEKNELSGQIPDSISNASKLIVLDLSYNSFSG  449


 Score =   117 bits (293),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 92/265 (35%), Positives = 139/265 (52%), Gaps = 0/265 (0%)
 Frame = -1

Query  935  SKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSF  756
            S + F+  S+   N   NS++    + +  ++  + +  LNL    L G    +L   + 
Sbjct  208  SPVLFNMPSLQLINLRANSLSGILQVDMIMSNISSTLEVLNLGYNQLHGRTPSNLHKCTE  267

Query  755  LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNIS  576
            L  L+L  N F  S P+E+  L +LK L    N+ +G IP     L +L  L L  N ++
Sbjct  268  LRVLDLESNRFTGSIPKEICTLTKLKELYLGKNNLTGQIPGEIARLVSLEKLGLEVNRLN  327

Query  575  GFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsk  396
            G +P  + N + L  +H+  N+L G IP E+GNL  L+ L+L  N+ +GS P    N S 
Sbjct  328  GNIPREIGNCTNLMEIHMENNNLTGVIPNEMGNLHTLQELDLGFNNITGSIPSTFFNFSI  387

Query  395  lenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNF  216
            L  ++++ N L G LP + G  LP L+   +  N+ SG+IP S+S  S L  L L +N+F
Sbjct  388  LRRVNMAYNYLSGHLPSNTGLGLPNLEELYLEKNELSGQIPDSISNASKLIVLDLSYNSF  447

Query  215  SGHVPREFGNLTKLEKLFLRSNQLT  141
            SG +P   GNL  L+KL L  N LT
Sbjct  448  SGIIPDLLGNLRNLQKLNLAENILT  472


 Score =   117 bits (292),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 85/258 (33%), Positives = 128/258 (50%), Gaps = 26/258 (10%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +  L  F+  ++G +   +GNLS L+ L L QN    + P E+ +L+ L+    + N   
Sbjct  517  LEELYAFDCRIIGNIPRGIGNLSNLIGLILQQNELTGAIPSEIGRLKHLQDFSLASNKLR  576

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G+IP+    L+ L +LYL  N +SG LP  L N++ L  L+LG N    SIP    +L  
Sbjct  577  GHIPNEICHLERLSYLYLLENGLSGSLPECLSNITSLRELYLGSNRFT-SIPTTFWSLKD  635

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
            L  +NLS N  +G+                        LPL++GN L  + +    SN+ 
Sbjct  636  LLQINLSFNSLTGT------------------------LPLEIGN-LKVVTVIDFSSNQL  670

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALS  108
            SG+IP+S++    L   SL  N   G +P  FG+L  LE L L  N L+GAIP+ +  L 
Sbjct  671  SGDIPTSIADLQNLAHFSLSDNRMQGPIPSSFGDLVSLEFLDLSRNNLSGAIPKSLEKLV  730

Query  107  SLLIVDLSNNKLYGTFIQ  54
             L   ++S N+L G  + 
Sbjct  731  HLKTFNVSFNRLQGEILD  748


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 58/105 (55%), Gaps = 2/105 (2%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPRE-FGNL  183
            G LP  +GN L  L    + +N F G +P  L+    ++ ++L +NNFSG +P   F  L
Sbjct  84   GTLPPQVGN-LSFLVSLNLSNNSFHGYLPRELTHLHRMKDMNLAYNNFSGDIPSSWFAML  142

Query  182  TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             +L+ LFL +N L G+IP  +  +++L  ++L  N + G   + +
Sbjct  143  PQLQHLFLTNNSLAGSIPSSLFNVTALETLNLEGNFIEGNISEEI  187



>ref|XP_008371720.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=634

 Score =   243 bits (619),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 202/358 (56%), Gaps = 49/358 (14%)
 Frame = -1

Query  992  TINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALN  813
            T+ A TNI+TD+ ALL+LK+ I+ DP +IL  NWS ++   CNW+GVTC   H RV+ALN
Sbjct  29   TVAAQTNISTDQAALLALKAHITSDPQNILTTNWSTSNSNICNWVGVTCGVGHLRVTALN  88

Query  812  LFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPS  633
            L  MGL G + P LGNLSFLV L    N+FH + P ELS+LRRLK+++ SFN+F G IPS
Sbjct  89   LSYMGLTGSIPPQLGNLSFLVQLEFRNNSFHGTLPSELSRLRRLKLIRFSFNNFIGTIPS  148

Query  632  WFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHL-----------------------  522
            WFG L  L+   L  N  SGF+P ++FNLS L+VL L                       
Sbjct  149  WFGSLSELQTFDLYGNQFSGFIPNAIFNLSALQVLDLRNNELSGSIPREVEKLKMLEEIL  208

Query  521  -GVNSLEGSIPREIGNLFQLKLLNLSDNHFS-----------------------GSFPLD  414
             G N+  GSIPREIGNL  LK++ L  N F                        G  PL+
Sbjct  209  LGHNNFTGSIPREIGNLTMLKVIYLDYNMFEEIPNLIGSKDLVEKLYVQVNDLKGPVPLE  268

Query  413  IlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLS  234
            + N+S L+ L+L++N L G +P D   HLP +QI  +  NK  G +PS   +C  L   S
Sbjct  269  VFNMSSLKILALTINHLTGSIPDDFCQHLPSIQILSLARNKLDGPLPSKFXQCKELLQFS  328

Query  233  LPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            L +NNF G +P+  GN T+L ++ +  N LTG +    G   ++ +++L   + + TF
Sbjct  329  LDYNNFGGSIPKSIGNSTQLAEITISYNNLTGTLSN--GMEVAVKVLNLQLEEAFKTF  384


 Score = 70.9 bits (172),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P  LGN L  L     R+N F G +PS LS+   L+ +   FNNF G +P  FG+L+
Sbjct  96   GSIPPQLGN-LSFLVQLEFRNNSFHGTLPSELSRLRRLKLIRFSFNNFIGTIPSWFGSLS  154

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLD  45
            +L+   L  NQ +G IP  I  LS+L ++DL NN+L G+  + ++
Sbjct  155  ELQTFDLYGNQFSGFIPNAIFNLSALQVLDLRNNELSGSIPREVE  199



>ref|XP_007020361.1| Serine-threonine protein kinase, putative [Theobroma cacao]
 gb|EOY11886.1| Serine-threonine protein kinase, putative [Theobroma cacao]
Length=615

 Score =   242 bits (617),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 142/301 (47%), Positives = 184/301 (61%), Gaps = 25/301 (8%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            NI TD+ ALL+LK+++++DP ++LA NW+ ++ + CNW GVTC S H RV+ L+L NM L
Sbjct  30   NIATDQLALLALKAQVTYDPQNLLATNWT-SATSVCNWTGVTCGSDHQRVTTLDLSNMSL  88

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            +G + P LGNLSFL  L +  N+FH   P EL+ L  LK +    N+F G IPSWF    
Sbjct  89   IGTIPPHLGNLSFLSQLIIRFNHFHGPLPMELANLSSLKYINFGHNNFHGEIPSWFDSFT  148

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             L+ L+L +NN SG +P+SL +LS LE L L  N LEG IP  I NL  LK L+L +N  
Sbjct  149  QLQSLFLYHNNFSGIIPSSLGSLSNLEKLMLYDNYLEGHIPIAIKNLSNLKWLHLDNNQL  208

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            S                        G+LP  L +HLPKLQ  V+  N FSG IP+SL KC
Sbjct  209  S------------------------GQLPSTLFDHLPKLQDLVLEYNFFSGRIPTSLFKC  244

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              L+ LSL  N   G VP+E GNLTKL +++L SN LTG IP  IG+L  L  +DLS+N 
Sbjct  245  QELEVLSLSTNALEGSVPQEIGNLTKLSEVYLYSNNLTGEIPSIIGSLPFLEYLDLSDNN  304

Query  74   L  72
            L
Sbjct  305  L  305


 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 77/258 (30%), Positives = 123/258 (48%), Gaps = 23/258 (9%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            ++S + L++  L GE+   +G+L FL  L+LS NN        L+ +R         N+ 
Sbjct  270  KLSEVYLYSNNLTGEIPSIIGSLPFLEYLDLSDNN--------LTDVRN--------NNL  313

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLP--TSLFNLSKLEVLHLGVNSLEGSIPREI-G  480
            +   P+W G L NL+ L L  N   G +      F+ S L ++ L  N   G +P    G
Sbjct  314  NDTFPNWLGTL-NLQVLILRRNRFHGLIDNFEGKFSFSHLRIIDLSHNDFNGLLPMNFFG  372

Query  479  NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMR  300
            NL  ++  + S+N    ++ + I +            +  G L ++  N L  L +    
Sbjct  373  NLHAIR--SGSENKGDSNYMMYIGSDQVKYFYDSLYITTKG-LDMEFPNILKILMVIDFS  429

Query  299  SNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREI  120
            +N+F G+IP  L +   L  L+L  N  +G +P   GNL+ LE L L SN+L G IP ++
Sbjct  430  NNQFHGQIPEILGELHSLIVLNLSHNGLTGPIPSLLGNLSALESLDLSSNKLEGKIPTQL  489

Query  119  GALSSLLIVDLSNNKLYG  66
              L  L +++LS N L G
Sbjct  490  VNLIFLEVLNLSWNNLMG  507


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 54/99 (55%), Gaps = 2/99 (2%)
 Frame = -1

Query  764  LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNN  585
            L  L+ ++ S N FH   P  L +L  L +L  S N  +G IPS  G L  L  L L +N
Sbjct  420  LKILMVIDFSNNQFHGQIPEILGELHSLIVLNLSHNGLTGPIPSLLGNLSALESLDLSSN  479

Query  584  NISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
             + G +PT L NL  LEVL+L  N+L G IPR  GN F 
Sbjct  480  KLEGKIPTQLVNLIFLEVLNLSWNNLMGLIPR--GNQFD  516


 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 62/113 (55%), Gaps = 3/113 (3%)
 Frame = -1

Query  758  FLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNI  579
            F  SL ++       FP   + L+ L ++  S N F G IP   G L +L  L L +N +
Sbjct  401  FYDSLYITTKGLDMEFP---NILKILMVIDFSNNQFHGQIPEILGELHSLIVLNLSHNGL  457

Query  578  SGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
            +G +P+ L NLS LE L L  N LEG IP ++ NL  L++LNLS N+  G  P
Sbjct  458  TGPIPSLLGNLSALESLDLSSNKLEGKIPTQLVNLIFLEVLNLSWNNLMGLIP  510



>ref|XP_009772313.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana sylvestris]
Length=1202

 Score =   248 bits (633),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 155/380 (41%), Positives = 215/380 (57%), Gaps = 50/380 (13%)
 Frame = -1

Query  1058  MEITRHYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNS  879
             ME     F  ++  FH +M    +  HTNI+TD+ ALLSLKS+I  DP     +NW   +
Sbjct  1     MEKAFTTFISTLLLFHYVMATSAM-THTNISTDQLALLSLKSQIISDPFHFFDENW-FPT  58

Query  878   ITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL  699
              + C+W GVTC SRH RV +LN+ NM L G + PD GNL+FLVSL+L  NNF+   P+E+
Sbjct  59    TSVCHWEGVTCGSRHQRVKSLNISNMALTGRIPPDFGNLTFLVSLDLGSNNFYGKLPQEM  118

Query  698   SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG  519
             ++LRRLK L  S N+F G++P WFG+L  L+FL L NN+  G +P+++ N+SKLE L L 
Sbjct  119   ARLRRLKFLDLSLNNFGGDVPVWFGILHQLQFLSLWNNSFIGSIPSTVSNISKLETLDLT  178

Query  518   VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL  339
              NSLEG IP+EIG+L  ++LL+L  N   GS P  I N S+LE LSLS N + G +P  +
Sbjct  179   FNSLEGQIPKEIGHLENIRLLSLGGNKLVGSIPTSISNASRLEILSLSFNLIQGNIPEGI  238

Query  338   G------------------------------------------------NHLPKLQIFVM  303
             G                                                N LP L++  +
Sbjct  239   GNLHNLNSLDIEYSQLTGSIPFSIFNISKLEVIGFTNNSLSGSLPNDLCNGLPLLKMLGL  298

Query  302   RSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPRE  123
               NK  G +P+SLS CS LQ LSL  N F G +  + G L+ L +L+L SN  TG IP+ 
Sbjct  299   SLNKLRGHLPTSLSNCSELQILSLSNNEFDGPIHSDIGRLSNLRRLYLGSNHFTGIIPQG  358

Query  122   IGALSSLLIVDLSNNKLYGT  63
             +G L +L+ + +  N++ G+
Sbjct  359   VGNLVNLVKLGMEKNQIIGS  378


 Score =   115 bits (288),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 98/282 (35%), Positives = 142/282 (50%), Gaps = 32/282 (11%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGN-LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND  654
            ++  +   N  L G L  DL N L  L  L LS N      P  LS    L+IL  S N+
Sbjct  267  KLEVIGFTNNSLSGSLPNDLCNGLPLLKMLGLSLNKLRGHLPTSLSNCSELQILSLSNNE  326

Query  653  FSGNIPSWFGLLQNLRFLYLGNNNISGFLPT------------------------SLFNL  546
            F G I S  G L NLR LYLG+N+ +G +P                         S+FN+
Sbjct  327  FDGPIHSDIGRLSNLRRLYLGSNHFTGIIPQGVGNLVNLVKLGMEKNQIIGSVPISIFNI  386

Query  545  SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvns  366
            S L+ + L  N+L GS+PREIGNL +L++L+L +N F+G  P +I NL  LE   +  N 
Sbjct  387  SSLQFIALRENNLTGSLPREIGNLTKLQVLDLVENMFAGEIPKEISNLVDLEKFDIEFND  446

Query  365  LFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLS----LPFNNFSGHVPR  198
              G L +++ N +  L++  + +N  S  +PS++   S+L  +     L   N  G +P 
Sbjct  447  FSGSLAMEIFN-ISGLRLVGLSANNLSRSLPSNIG--SILPNIERLYLLDLANLVGTIPH  503

Query  197  EFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKL  72
               N ++L  L L  N+LTG IP  +G L+ L ++DL  N L
Sbjct  504  SISNCSELTHLELSYNKLTGLIPNCLGYLTHLQLLDLQQNNL  545


 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 96/275 (35%), Positives = 145/275 (53%), Gaps = 8/275 (3%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCS  663
            S  + +  L+L N    G +  D+G LS L  L L  N+F    P+ +  L  L  L   
Sbjct  312  SNCSELQILSLSNNEFDGPIHSDIGRLSNLRRLYLGSNHFTGIIPQGVGNLVNLVKLGME  371

Query  662  FNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREI  483
             N   G++P     + +L+F+ L  NN++G LP  + NL+KL+VL L  N   G IP+EI
Sbjct  372  KNQIIGSVPISIFNISSLQFIALRENNLTGSLPREIGNLTKLQVLDLVENMFAGEIPKEI  431

Query  482  GNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQ-IFV  306
             NL  L+  ++  N FSGS  ++I N+S L  + LS N+L   LP ++G+ LP ++ +++
Sbjct  432  SNLVDLEKFDIEFNDFSGSLAMEIFNISGLRLVGLSANNLSRSLPSNIGSILPNIERLYL  491

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG----  138
            +      G IP S+S CS L  L L +N  +G +P   G LT L+ L L+ N LT     
Sbjct  492  LDLANLVGTIPHSISNCSELTHLELSYNKLTGLIPNCLGYLTHLQLLDLQQNNLTSDSSL  551

Query  137  AIPREIGALSSLLIVDLSNNKLYGTF---IQNLDT  42
            +    +    +L+ +DLS+N L G     I NL T
Sbjct  552  SFLTSLTNCKNLISLDLSSNPLNGKLPLSIGNLST  586


 Score =   107 bits (268),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 83/253 (33%), Positives = 134/253 (53%), Gaps = 2/253 (1%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDLGNLS-FLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSG  645
            +L+L +  L G+L   +GNLS +L ++           P E+  L  L   + S ND  G
Sbjct  565  SLDLSSNPLNGKLPLSIGNLSTYLKNIFAIDCKIKGRIPNEVGNLSSLFQFEISENDLVG  624

Query  644  NIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQL  465
            +IP+  G L+NL+   L NN +SGF+  +L  L  L+ ++L  N L GS+P  +GN+  L
Sbjct  625  SIPTSIGNLRNLQGFTLSNNKLSGFIGDNLCQLQHLDTIYLDQNQLSGSLPNCLGNVTSL  684

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
            + ++L  N  + + P  + +L  L  L +S N++ G LP ++GN +  +Q+  +  N+F+
Sbjct  685  RKIHLGSNKLNSNIPASLWSLKDLIVLDISSNNMGGSLPPEIGNLMAAIQM-DLSMNQFT  743

Query  284  GEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSS  105
             +IP  +     L  LSL  N   G +P    N+  L+ L L  N ++G IP+    L  
Sbjct  744  NDIPREIGGLQNLVNLSLSHNRLQGSLPDSMSNMVGLKFLDLSHNNISGTIPKSFEKLQY  803

Query  104  LLIVDLSNNKLYG  66
            L   ++S NKLYG
Sbjct  804  LKYFNVSYNKLYG  816


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 138/277 (50%), Gaps = 8/277 (3%)
 Frame = -1

Query  869  CNWIGVTCNSRHN--RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFP  708
             N +G   +S  N   ++ L L    L G +   LG L+ L  L+L QNN  +    SF 
Sbjct  495  ANLVGTIPHSISNCSELTHLELSYNKLTGLIPNCLGYLTHLQLLDLQQNNLTSDSSLSFL  554

Query  707  RELSQLRRLKILQCSFNDFSGNIPSWFGLLQN-LRFLYLGNNNISGFLPTSLFNLSKLEV  531
              L+  + L  L  S N  +G +P   G L   L+ ++  +  I G +P  + NLS L  
Sbjct  555  TSLTNCKNLISLDLSSNPLNGKLPLSIGNLSTYLKNIFAIDCKIKGRIPNEVGNLSSLFQ  614

Query  530  LHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGEL  351
              +  N L GSIP  IGNL  L+   LS+N  SG    ++  L  L+ + L  N L G L
Sbjct  615  FEISENDLVGSIPTSIGNLRNLQGFTLSNNKLSGFIGDNLCQLQHLDTIYLDQNQLSGSL  674

Query  350  PLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLE  171
            P  LGN +  L+   + SNK +  IP+SL     L  L +  NN  G +P E GNL    
Sbjct  675  PNCLGN-VTSLRKIHLGSNKLNSNIPASLWSLKDLIVLDISSNNMGGSLPPEIGNLMAAI  733

Query  170  KLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            ++ L  NQ T  IPREIG L +L+ + LS+N+L G+ 
Sbjct  734  QMDLSMNQFTNDIPREIGGLQNLVNLSLSHNRLQGSL  770


 Score = 98.2 bits (243),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 90/251 (36%), Positives = 130/251 (52%), Gaps = 13/251 (5%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            +G + P   N+  L  L+L+  N   + P  +S    L  L+ S+N  +G IP+  G L 
Sbjct  479  IGSILP---NIERLYLLDLA--NLVGTIPHSISNCSELTHLELSYNKLTGLIPNCLGYLT  533

Query  614  NLRFLYLGNNNISG-----FLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ-LKLLN  453
            +L+ L L  NN++      FL TSL N   L  L L  N L G +P  IGNL   LK + 
Sbjct  534  HLQLLDLQQNNLTSDSSLSFL-TSLTNCKNLISLDLSSNPLNGKLPLSIGNLSTYLKNIF  592

Query  452  LSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIP  273
              D    G  P ++ NLS L    +S N L G +P  +GN L  LQ F + +NK SG I 
Sbjct  593  AIDCKIKGRIPNEVGNLSSLFQFEISENDLVGSIPTSIGN-LRNLQGFTLSNNKLSGFIG  651

Query  272  SSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIV  93
             +L +   L T+ L  N  SG +P   GN+T L K+ L SN+L   IP  + +L  L+++
Sbjct  652  DNLCQLQHLDTIYLDQNQLSGSLPNCLGNVTSLRKIHLGSNKLNSNIPASLWSLKDLIVL  711

Query  92   DLSNNKLYGTF  60
            D+S+N + G+ 
Sbjct  712  DISSNNMGGSL  722


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 69/223 (31%), Positives = 104/223 (47%), Gaps = 25/223 (11%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            LVG +   +GNL  L    LS N         L QL+ L  +    N  SG++P+  G +
Sbjct  622  LVGSIPTSIGNLRNLQGFTLSNNKLSGFIGDNLCQLQHLDTIYLDQNQLSGSLPNCLGNV  681

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
             +LR ++LG+N ++  +P SL++L  L VL +  N++ GS+P EIGNL     ++LS N 
Sbjct  682  TSLRKIHLGSNKLNSNIPASLWSLKDLIVLDISSNNMGGSLPPEIGNLMAAIQMDLSMNQ  741

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
            F+   P +I                           L  L    +  N+  G +P S+S 
Sbjct  742  FTNDIPREI-------------------------GGLQNLVNLSLSHNRLQGSLPDSMSN  776

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
               L+ L L  NN SG +P+ F  L  L+   +  N+L G IP
Sbjct  777  MVGLKFLDLSHNNISGTIPKSFEKLQYLKYFNVSYNKLYGEIP  819



>ref|XP_008225333.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=1522

 Score =   249 bits (637),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 149/307 (49%), Positives = 200/307 (65%), Gaps = 3/307 (1%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSR-HNRVSALNLF  807
            A TNITTD+ ALL+++S I+ DPH+IL  NWS  S + CNW+GVTC +R H RV +LNL 
Sbjct  25   AKTNITTDQSALLAMRSHITSDPHNILV-NWST-STSVCNWVGVTCGARRHLRVVSLNLS  82

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
             M   G + P LGNLSFLV+L+ + N+F+ + P ELS LRRLK +   FN+F G+IPSWF
Sbjct  83   YMVFTGTIPPHLGNLSFLVALSFNNNSFYGTLPHELSYLRRLKFISLRFNNFMGSIPSWF  142

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
            G    L+ L L  N  SG +P ++FNLS L+ ++L  N L G+IP+EIGNL  LK + L 
Sbjct  143  GSFPKLQRLDLYGNQFSGTIPLTIFNLSTLQDINLSSNELLGAIPKEIGNLTMLKKIYLD  202

Query  446  DNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSS  267
             N+F+G  P+ + N+S L  L+L  NSL G LP ++  HLP LQ   +  N+F G +PS 
Sbjct  203  SNNFNGPVPMAVFNMSSLITLALYGNSLCGGLPDNICQHLPSLQKLNLGRNQFDGPLPSK  262

Query  266  LSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDL  87
            L +C+ L  L L  NNFSG +P+  GNLT+L  L   +N LTG IP E+  L +L +  +
Sbjct  263  LWQCTELLNLILEKNNFSGSIPKTIGNLTQLAVLAFETNNLTGTIPDEVANLQNLELFSV  322

Query  86   SNNKLYG  66
             NN L G
Sbjct  323  GNNNLNG  329


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 86/248 (35%), Positives = 116/248 (47%), Gaps = 26/248 (10%)
 Frame = -1

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
            N  + G +   +GN+S LV+L+L  N    S P  L +LR L+ L    N   G IP   
Sbjct  477  NSSMRGNIPIGIGNISSLVTLSLGYNELSGSIPTSLGRLRNLQSLNLKDNKLRGYIPYQL  536

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSK-LEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
              L NL  LYLG N +SG +PT L NLS  L  L L  NS   +IP  +  L  +  +N+
Sbjct  537  CQLDNLFELYLGRNQLSGSIPTCLGNLSAYLRTLSLESNSFSSTIPSTLWRLAYILHVNI  596

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
            S N  +G    DI  L  +             + +DL N            N  S  +PS
Sbjct  597  SSNSLTGPLSQDIAQLKVV-------------IGIDLSN------------NNLSSILPS  631

Query  269  SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVD  90
            ++     L  LSL  NN  G +P  F  L  L+ L L  N L+G IP+ + ALS L  +D
Sbjct  632  TIGGLQDLVNLSLANNNLEGPIPSSFDGLLSLQLLDLSRNNLSGVIPKSLEALSLLKYMD  691

Query  89   LSNNKLYG  66
            +S N+L G
Sbjct  692  VSFNRLQG  699


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 86/248 (35%), Positives = 116/248 (47%), Gaps = 26/248 (10%)
 Frame = -1

Query  806   NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
             N  + G +   +GN+S LV+L+L  N    S P  L +LR L+ L    N   G IP   
Sbjct  888   NSSMRGNIPIGIGNISSLVTLSLGYNELSGSIPTSLGRLRNLQSLNLKDNKLRGYIPYQL  947

Query  626   GLLQNLRFLYLGNNNISGFLPTSLFNLSK-LEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
               L NL  LYLG N +SG +PT L NLS  L  L L  NS   +IP  +  L  +  +N+
Sbjct  948   CQLDNLFELYLGRNQLSGSIPTCLGNLSAYLRTLSLESNSFSSTIPSTLWRLAYILHVNI  1007

Query  449   SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
             S N  +G    DI  L  +             + +DL N            N  S  +PS
Sbjct  1008  SSNSLTGPLSQDIAQLKVV-------------IGIDLSN------------NNLSSILPS  1042

Query  269   SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVD  90
             ++     L  LSL  NN  G +P  F  L  L+ L L  N L+G IP+ + ALS L  +D
Sbjct  1043  TIGGLQDLVNLSLANNNLEGPIPSSFDGLLSLQLLDLSRNNLSGVIPKSLEALSLLKYMD  1102

Query  89    LSNNKLYG  66
             +S N+L G
Sbjct  1103  VSFNRLQG  1110


 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 128/283 (45%), Gaps = 33/283 (12%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLK-------------------IL  672
            V  + P+L N S L +++LS N+     PR L  L  L+                   IL
Sbjct  376  VSGVIPNLSNASMLTNIDLSINSLTGFIPRTLCALTNLQGLNLFGNNLTIDTSTPEASIL  435

Query  671  QC------------SFNDFSGNIPSWFGLLQNLRFLYL--GNNNISGFLPTSLFNLSKLE  534
             C             +N  +  +  +F       F Y+   N+++ G +P  + N+S L 
Sbjct  436  SCLSNLGKLTEIHLGYNPLNARLDEFFRNCSTSSFQYICFSNSSMRGNIPIGIGNISSLV  495

Query  533  VLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGE  354
             L LG N L GSIP  +G L  L+ LNL DN   G  P  +  L  L  L L  N L G 
Sbjct  496  TLSLGYNELSGSIPTSLGRLRNLQSLNLKDNKLRGYIPYQLCQLDNLFELYLGRNQLSGS  555

Query  353  LPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKL  174
            +P  LGN    L+   + SN FS  IPS+L + + +  +++  N+ +G + ++   L  +
Sbjct  556  IPTCLGNLSAYLRTLSLESNSFSSTIPSTLWRLAYILHVNISSNSLTGPLSQDIAQLKVV  615

Query  173  EKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLD  45
              + L +N L+  +P  IG L  L+ + L+NN L G    + D
Sbjct  616  IGIDLSNNNLSSILPSTIGGLQDLVNLSLANNNLEGPIPSSFD  658


 Score = 91.7 bits (226),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 105/229 (46%), Gaps = 28/229 (12%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPD--LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
             L L+   L G L PD    +L  L  LNL +N F    P +L Q   L  L    N+FS
Sbjct  222  TLALYGNSLCGGL-PDNICQHLPSLQKLNLGRNQFDGPLPSKLWQCTELLNLILEKNNFS  280

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G+IP   G L  L  L    NN++G +P  + NL  LE+  +G N+L G IP  I N+  
Sbjct  281  GSIPKTIGNLTQLAVLAFETNNLTGTIPDEVANLQNLELFSVGNNNLNGLIPPSIFNISA  340

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
            ++ + L  N  SGS                        LP ++G  +P LQ   +     
Sbjct  341  IRQMGLVQNPLSGS------------------------LPANIGLGVPNLQHLFIAETDV  376

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
            SG IP +LS  S+L  + L  N+ +G +PR    LT L+ L L  N LT
Sbjct  377  SGVIP-NLSNASMLTNIDLSINSLTGFIPRTLCALTNLQGLNLFGNNLT  424


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 82/260 (32%), Positives = 124/260 (48%), Gaps = 9/260 (3%)
 Frame = -1

Query  797   LVGELTPDLGNLSFLVSLNLSQNN--FHNSFPRE-----LSQLRRLKILQCSFNDFSGNI  639
             L G +   L  L+ L  LNL  NN     S P       LS L +L  +   +N  +  +
Sbjct  810   LTGFIPRTLCALTNLQGLNLFGNNLTIDTSTPEASILSCLSNLGKLTEIHLGYNPLNARL  869

Query  638   PSWFGLLQNLRFLYL--GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQL  465
               +F       F Y+   N+++ G +P  + N+S L  L LG N L GSIP  +G L  L
Sbjct  870   DEFFRNCSTSSFQYICFSNSSMRGNIPIGIGNISSLVTLSLGYNELSGSIPTSLGRLRNL  929

Query  464   KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
             + LNL DN   G  P  +  L  L  L L  N L G +P  LGN    L+   + SN FS
Sbjct  930   QSLNLKDNKLRGYIPYQLCQLDNLFELYLGRNQLSGSIPTCLGNLSAYLRTLSLESNSFS  989

Query  284   GEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSS  105
               IPS+L + + +  +++  N+ +G + ++   L  +  + L +N L+  +P  IG L  
Sbjct  990   STIPSTLWRLAYILHVNISSNSLTGPLSQDIAQLKVVIGIDLSNNNLSSILPSTIGGLQD  1049

Query  104   LLIVDLSNNKLYGTFIQNLD  45
             L+ + L+NN L G    + D
Sbjct  1050  LVNLSLANNNLEGPIPSSFD  1069


 Score = 90.5 bits (223),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 92/284 (32%), Positives = 139/284 (49%), Gaps = 34/284 (12%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            LNL      G L   L   + L++L L +NNF  S P+ +  L +L +L    N+ +G I
Sbjct  248  LNLGRNQFDGPLPSKLWQCTELLNLILEKNNFSGSIPKTIGNLTQLAVLAFETNNLTGTI  307

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG-NLFQLK  462
            P     LQNL    +GNNN++G +P S+FN+S +  + L  N L GS+P  IG  +  L+
Sbjct  308  PDEVANLQNLELFSVGNNNLNGLIPPSIFNISAIRQMGLVQNPLSGSLPANIGLGVPNLQ  367

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL------------GNHL---  327
             L +++   SG  P ++ N S L N+ LS+NSL G +P  L            GN+L   
Sbjct  368  HLFIAETDVSGVIP-NLSNASMLTNIDLSINSLTGFIPRTLCALTNLQGLNLFGNNLTID  426

Query  326  ---PKLQIFVMRS------------NKFSGEIPSSLSKCSLLQTLSLPFNNFS--GHVPR  198
               P+  I    S            N  +  +      CS      + F+N S  G++P 
Sbjct  427  TSTPEASILSCLSNLGKLTEIHLGYNPLNARLDEFFRNCSTSSFQYICFSNSSMRGNIPI  486

Query  197  EFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
              GN++ L  L L  N+L+G+IP  +G L +L  ++L +NKL G
Sbjct  487  GIGNISSLVTLSLGYNELSGSIPTSLGRLRNLQSLNLKDNKLRG  530


 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 88/177 (50%), Gaps = 25/177 (14%)
 Frame = -1

Query  578  SGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnls  399
            +G +P  L NLS L  L    NS  G++P E+  L +LK ++L  N+F GS P       
Sbjct  87   TGTIPPHLGNLSFLVALSFNNNSFYGTLPHELSYLRRLKFISLRFNNFMGSIP-------  139

Query  398  klenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNN  219
                      S FG  P        KLQ   +  N+FSG IP ++   S LQ ++L  N 
Sbjct  140  ----------SWFGSFP--------KLQRLDLYGNQFSGTIPLTIFNLSTLQDINLSSNE  181

Query  218  FSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
              G +P+E GNLT L+K++L SN   G +P  +  +SSL+ + L  N L G    N+
Sbjct  182  LLGAIPKEIGNLTMLKKIYLDSNNFNGPVPMAVFNMSSLITLALYGNSLCGGLPDNI  238


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 68/118 (58%), Gaps = 0/118 (0%)
 Frame = -1

Query  773  LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            L  L++++ +N+S N+      ++++QL+ +  +  S N+ S  +PS  G LQ+L  L L
Sbjct  585  LWRLAYILHVNISSNSLTGPLSQDIAQLKVVIGIDLSNNNLSSILPSTIGGLQDLVNLSL  644

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
             NNN+ G +P+S   L  L++L L  N+L G IP+ +  L  LK +++S N   G  P
Sbjct  645  ANNNLEGPIPSSFDGLLSLQLLDLSRNNLSGVIPKSLEALSLLKYMDVSFNRLQGEIP  702


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 68/118 (58%), Gaps = 0/118 (0%)
 Frame = -1

Query  773   LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
             L  L++++ +N+S N+      ++++QL+ +  +  S N+ S  +PS  G LQ+L  L L
Sbjct  996   LWRLAYILHVNISSNSLTGPLSQDIAQLKVVIGIDLSNNNLSSILPSTIGGLQDLVNLSL  1055

Query  593   GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
              NNN+ G +P+S   L  L++L L  N+L G IP+ +  L  LK +++S N   G  P
Sbjct  1056  ANNNLEGPIPSSFDGLLSLQLLDLSRNNLSGVIPKSLEALSLLKYMDVSFNRLQGEIP  1113



>ref|XP_009783779.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Nicotiana 
sylvestris]
Length=1182

 Score =   248 bits (632),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 208/332 (63%), Gaps = 5/332 (2%)
 Frame = -1

Query  1037  FCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISF-DPHS-ILADNWSVNSITPCN  864
             F L++F        L I    +I+TDK ALL+LKS IS  DP+  I+A NWS +S   C+
Sbjct  9     FGLAVFILLHYHTSLAIVP--SISTDKDALLALKSHISSSDPNDKIIASNWSSSSPV-CS  65

Query  863   WIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRR  684
             WIG+TC+SRHNRV+AL++ +M L G + P +GNLSFLVSL++S NNFH   P ELS L+R
Sbjct  66    WIGITCSSRHNRVTALDISSMQLYGTVPPHVGNLSFLVSLDISNNNFHGKLPEELSHLQR  125

Query  683   LKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLE  504
             LK      N+F+G IPS+  LL NLR L L +N   G +P SL NL+KLE L +  N LE
Sbjct  126   LKFFIVESNNFTGVIPSFISLLPNLRILRLSSNQFHGKIPPSLSNLTKLEGLSVAHNFLE  185

Query  503   GSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLP  324
             G IP+E+G+L  + +L+L  N  +GS P  I N++ ++ ++L  N++ G LP  +  +LP
Sbjct  186   GKIPQELGDLRYMTILDLQQNQLTGSIPPSIFNITTMQIITLFENNVAGNLPTTICENLP  245

Query  323   KLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQL  144
              L++  +  N   G IP +L KC  LQ LSL  N F+G VP+E  NL  L +L L S  L
Sbjct  246   NLEVLHIPENNLDGVIPPNLGKCRKLQILSLSDNKFTGTVPKELANLKDLTELILGSQHL  305

Query  143   TGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
              G IP E+G L  L ++ L+ N+  G+   N+
Sbjct  306   QGEIPAELGNLKKLRLLGLNKNEFTGSIPTNI  337


 Score =   138 bits (347),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 103/261 (39%), Positives = 151/261 (58%), Gaps = 1/261 (0%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQ-LRRLKILQCSFNDF  651
            ++ L+L    L G + P + N++ +  + L +NN   + P  + + L  L++L    N+ 
Sbjct  198  MTILDLQQNQLTGSIPPSIFNITTMQIITLFENNVAGNLPTTICENLPNLEVLHIPENNL  257

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
             G IP   G  + L+ L L +N  +G +P  L NL  L  L LG   L+G IP E+GNL 
Sbjct  258  DGVIPPNLGKCRKLQILSLSDNKFTGTVPKELANLKDLTELILGSQHLQGEIPAELGNLK  317

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
            +L+LL L+ N F+GS P +I N+S LE L LS N L G LP D G  +P L+ F  RSN 
Sbjct  318  KLRLLGLNKNEFTGSIPTNIFNISALEILDLSENRLSGRLPSDFGRGIPSLEGFSCRSNN  377

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
             SG I +S+S  S L+TL L +N+F+G +P E GNL  L+ L L  N+ T +IP  I  +
Sbjct  378  LSGSISASISNSSRLRTLDLSYNSFTGEIPAELGNLKNLQYLDLTVNEFTSSIPTSIFNI  437

Query  110  SSLLIVDLSNNKLYGTFIQNL  48
            S+L+++ L  N+L GT   +L
Sbjct  438  STLMVLGLGVNRLSGTLPSDL  458


 Score =   118 bits (296),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 93/268 (35%), Positives = 140/268 (52%), Gaps = 5/268 (2%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            R+  L+L      GE+  +LGNL  L  L+L+ N F +S P  +  +  L +L    N  
Sbjct  391  RLRTLDLSYNSFTGEIPAELGNLKNLQYLDLTVNEFTSSIPTSIFNISTLMVLGLGVNRL  450

Query  650  SGNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
            SG +PS  G  + +L  L  G+NN+SGF+  ++ N S+L  L L +N   G IP  +GNL
Sbjct  451  SGTLPSDLGRKMPSLEDLLCGDNNLSGFISATISNSSRLRKLDLTLNRFTGPIPESLGNL  510

Query  473  FQLKLLNLSDNHFSG----SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
              L++L L  N+FS     SF   + N  KL +L  S N   G LP  +GN    LQI  
Sbjct  511  EYLEVLALGANNFSSDSTLSFLTPLTNCRKLRSLRFSDNPFDGVLPPSVGNFSNSLQILD  570

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
             +  K  G IP  +   + +  +SL  N  SG++P+    + KL++++L  N++ G IP 
Sbjct  571  GQGCKLKGFIPEEIGNVTGMTRMSLFNNELSGYIPKTIERMLKLQEIYLHKNKIGGTIPD  630

Query  125  EIGALSSLLIVDLSNNKLYGTFIQNLDT  42
             I  L +L  +DLS N++ G+    L T
Sbjct  631  VICNLQNLGELDLSGNQITGSVPPCLGT  658


 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 88/255 (35%), Positives = 125/255 (49%), Gaps = 25/255 (10%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            ++  L+L +    G +  +L NL  L  L L   +     P EL  L++L++L  + N+F
Sbjct  270  KLQILSLSDNKFTGTVPKELANLKDLTELILGSQHLQGEIPAELGNLKKLRLLGLNKNEF  329

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPT-------SLFNLS-----------------  543
            +G+IP+    +  L  L L  N +SG LP+       SL   S                 
Sbjct  330  TGSIPTNIFNISALEILDLSENRLSGRLPSDFGRGIPSLEGFSCRSNNLSGSISASISNS  389

Query  542  -KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvns  366
             +L  L L  NS  G IP E+GNL  L+ L+L+ N F+ S P  I N+S L  L L VN 
Sbjct  390  SRLRTLDLSYNSFTGEIPAELGNLKNLQYLDLTVNEFTSSIPTSIFNISTLMVLGLGVNR  449

Query  365  LFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGN  186
            L G LP DLG  +P L+  +   N  SG I +++S  S L+ L L  N F+G +P   GN
Sbjct  450  LSGTLPSDLGRKMPSLEDLLCGDNNLSGFISATISNSSRLRKLDLTLNRFTGPIPESLGN  509

Query  185  LTKLEKLFLRSNQLT  141
            L  LE L L +N  +
Sbjct  510  LEYLEVLALGANNFS  524


 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 144/271 (53%), Gaps = 11/271 (4%)
 Frame = -1

Query  827  VSALNLFNMG---LVGELTPDLG-NLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSF  660
            +SAL + ++    L G L  D G  +  L   +   NN   S    +S   RL+ L  S+
Sbjct  340  ISALEILDLSENRLSGRLPSDFGRGIPSLEGFSCRSNNLSGSISASISNSSRLRTLDLSY  399

Query  659  NDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG  480
            N F+G IP+  G L+NL++L L  N  +  +PTS+FN+S L VL LGVN L G++P ++G
Sbjct  400  NSFTGEIPAELGNLKNLQYLDLTVNEFTSSIPTSIFNISTLMVLGLGVNRLSGTLPSDLG  459

Query  479  -NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVM  303
              +  L+ L   DN+ SG     I N S+L  L L++N   G +P  LGN L  L++  +
Sbjct  460  RKMPSLEDLLCGDNNLSGFISATISNSSRLRKLDLTLNRFTGPIPESLGN-LEYLEVLAL  518

Query  302  RSNKFSGEIP----SSLSKCSLLQTLSLPFNNFSGHVPREFGNLT-KLEKLFLRSNQLTG  138
             +N FS +      + L+ C  L++L    N F G +P   GN +  L+ L  +  +L G
Sbjct  519  GANNFSSDSTLSFLTPLTNCRKLRSLRFSDNPFDGVLPPSVGNFSNSLQILDGQGCKLKG  578

Query  137  AIPREIGALSSLLIVDLSNNKLYGTFIQNLD  45
             IP EIG ++ +  + L NN+L G   + ++
Sbjct  579  FIPEEIGNVTGMTRMSLFNNELSGYIPKTIE  609


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 116/223 (52%), Gaps = 1/223 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +  ++GN++ +  ++L  N      P+ + ++ +L+ +    N   G IP     L
Sbjct  576  LKGFIPEEIGNVTGMTRMSLFNNELSGYIPKTIERMLKLQEIYLHKNKIGGTIPDVICNL  635

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            QNL  L L  N I+G +P  L  ++ L  L+L  N L   +P  +G+L  +   N+S N 
Sbjct  636  QNLGELDLSGNQITGSVPPCLGTITSLRKLNLAYNRLNSRLPASLGSLRDIIEFNVSSNL  695

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             SG  PL+I NL     + LS N+  G +P  +G  L +L  F +  NK  G IP SL K
Sbjct  696  LSGQIPLEIGNLKAATLIELSKNNFSGNIPSSIGG-LDRLTNFSLAHNKLDGPIPDSLGK  754

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
               L+ L L FNN SG +P+   +L  +++L +  N+L+G IP
Sbjct  755  ILALEFLDLSFNNLSGEIPKSLEDLVYIKQLNISFNKLSGEIP  797


 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 94/295 (32%), Positives = 142/295 (48%), Gaps = 30/295 (10%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLKI  675
            S  +R+  L+L      G +   LGNL +L  L L  NNF +    SF   L+  R+L+ 
Sbjct  484  SNSSRLRKLDLTLNRFTGPIPESLGNLEYLEVLALGANNFSSDSTLSFLTPLTNCRKLRS  543

Query  674  LQCSFNDFSGN-------------------------IPSWFGLLQNLRFLYLGNNNISGF  570
            L+ S N F G                          IP   G +  +  + L NN +SG+
Sbjct  544  LRFSDNPFDGVLPPSVGNFSNSLQILDGQGCKLKGFIPEEIGNVTGMTRMSLFNNELSGY  603

Query  569  LPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlskle  390
            +P ++  + KL+ ++L  N + G+IP  I NL  L  L+LS N  +GS P  +  ++ L 
Sbjct  604  IPKTIERMLKLQEIYLHKNKIGGTIPDVICNLQNLGELDLSGNQITGSVPPCLGTITSLR  663

Query  389  nlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSG  210
             L+L+ N L   LP  LG+ L  +  F + SN  SG+IP  +        + L  NNFSG
Sbjct  664  KLNLAYNRLNSRLPASLGS-LRDIIEFNVSSNLLSGQIPLEIGNLKAATLIELSKNNFSG  722

Query  209  HVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLD  45
            ++P   G L +L    L  N+L G IP  +G + +L  +DLS N L G   ++L+
Sbjct  723  NIPSSIGGLDRLTNFSLAHNKLDGPIPDSLGKILALEFLDLSFNNLSGEIPKSLE  777


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 119/243 (49%), Gaps = 2/243 (1%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSF-PRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            G L P +GN S  + +   Q      F P E+  +  +  +    N+ SG IP     + 
Sbjct  553  GVLPPSVGNFSNSLQILDGQGCKLKGFIPEEIGNVTGMTRMSLFNNELSGYIPKTIERML  612

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             L+ +YL  N I G +P  + NL  L  L L  N + GS+P  +G +  L+ LNL+ N  
Sbjct  613  KLQEIYLHKNKIGGTIPDVICNLQNLGELDLSGNQITGSVPPCLGTITSLRKLNLAYNRL  672

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            +   P  + +L  +   ++S N L G++PL++GN L    +  +  N FSG IPSS+   
Sbjct  673  NSRLPASLGSLRDIIEFNVSSNLLSGQIPLEIGN-LKAATLIELSKNNFSGNIPSSIGGL  731

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              L   SL  N   G +P   G +  LE L L  N L+G IP+ +  L  +  +++S NK
Sbjct  732  DRLTNFSLAHNKLDGPIPDSLGKILALEFLDLSFNNLSGEIPKSLEDLVYIKQLNISFNK  791

Query  74   LYG  66
            L G
Sbjct  792  LSG  794


 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 81/162 (50%), Gaps = 7/162 (4%)
 Frame = -1

Query  905  LADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNN  726
            L+ N    S+ PC  +G   + R      LNL    L   L   LG+L  ++  N+S N 
Sbjct  643  LSGNQITGSVPPC--LGTITSLRK-----LNLAYNRLNSRLPASLGSLRDIIEFNVSSNL  695

Query  725  FHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNL  546
                 P E+  L+   +++ S N+FSGNIPS  G L  L    L +N + G +P SL  +
Sbjct  696  LSGQIPLEIGNLKAATLIELSKNNFSGNIPSSIGGLDRLTNFSLAHNKLDGPIPDSLGKI  755

Query  545  SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
              LE L L  N+L G IP+ + +L  +K LN+S N  SG  P
Sbjct  756  LALEFLDLSFNNLSGEIPKSLEDLVYIKQLNISFNKLSGEIP  797


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 2/145 (1%)
 Frame = -1

Query  854  VTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKI  675
            V CN ++  +  L+L    + G + P LG ++ L  LNL+ N  ++  P  L  LR +  
Sbjct  631  VICNLQN--LGELDLSGNQITGSVPPCLGTITSLRKLNLAYNRLNSRLPASLGSLRDIIE  688

Query  674  LQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSI  495
               S N  SG IP   G L+    + L  NN SG +P+S+  L +L    L  N L+G I
Sbjct  689  FNVSSNLLSGQIPLEIGNLKAATLIELSKNNFSGNIPSSIGGLDRLTNFSLAHNKLDGPI  748

Query  494  PREIGNLFQLKLLNLSDNHFSGSFP  420
            P  +G +  L+ L+LS N+ SG  P
Sbjct  749  PDSLGKILALEFLDLSFNNLSGEIP  773



>emb|CDP11291.1| unnamed protein product [Coffea canephora]
Length=1190

 Score =   248 bits (632),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 152/356 (43%), Positives = 209/356 (59%), Gaps = 50/356 (14%)
 Frame = -1

Query  977  TNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMG  798
            TNITTD+ +LL+ ++ IS DP  ILA NWSV+S + C+WIGV+C SRH RV+AL++ NM 
Sbjct  28   TNITTDQSSLLAFRAHISVDPLQILAKNWSVSS-SVCDWIGVSCGSRHRRVTALDISNMN  86

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL-  621
            L G L P LGNLSFLVSLN+S NNFH   P E+++LRRLK+L  + N+  G +P W G  
Sbjct  87   LSGTLPPQLGNLSFLVSLNMSMNNFHGEMPHEIARLRRLKVLILAINNLKGELPWWIGSF  146

Query  620  -----------------------LQNLRFLYLGNNNISGFLPTSLFNLSKLE--------  534
                                   + NL+++ L NN++ G +PT +FN+S L+        
Sbjct  147  HQLRHLNLRNNSFTGLIPSSISNMSNLQYIVLSNNHLLGDIPTGIFNISSLQFIDLRNNG  206

Query  533  ----------------VLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnl  402
                            VL L  N   GSIP+EIG L +L+ L L  N+  G+ P+ I N+
Sbjct  207  LSGVLPSDMSQCSELRVLSLSYNEFGGSIPKEIGALKKLEELYLGYNYLEGNIPIGIFNI  266

Query  401  sklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSS-LSKCSLLQTLSLPF  225
            S L+ + L+ N LFG LP D+  HLP L    + +NK +G++PSS L++CS L+ LSL +
Sbjct  267  SSLQIIDLTNNGLFGVLPSDMCYHLPGLSFVGLSNNKLNGQLPSSNLAQCSELRVLSLSY  326

Query  224  NNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFI  57
            N F G +P+E G L KLE+L+L  N L G IP+EIG  + +       N L GT I
Sbjct  327  NEFGGSIPKEIGALKKLEELYLGHNYLEGQIPKEIGNSTMIKWQHFGYNNLTGTTI  382


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 87/253 (34%), Positives = 121/253 (48%), Gaps = 44/253 (17%)
 Frame = -1

Query  812  LFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPS  633
            + N+ L G +  ++GN  FL  LNL  N+   S P E+  L +L  +    N  SGN+PS
Sbjct  397  VLNIILAGVIPREIGNWYFLQQLNLQFNSLTGSIPMEIFNLSKLSAMSLLQNQLSGNLPS  456

Query  632  WFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLL  456
             FG  L NL +L LG N++SG LP+S+ N S L  + LG N   G IP  +G+L  L+LL
Sbjct  457  IFGYRLPNLEYLDLGINHLSGALPSSISNSSNLRRIELGDNKFTGPIPTSMGDLRFLELL  516

Query  455  NLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEI  276
             LS N                                          + V  S+      
Sbjct  517  ELSGN------------------------------------------LLVSDSSSPELSF  534

Query  275  PSSLSKCSLLQTLSLPFNNFSGHVPREFGNL-TKLEKLFLRSNQLTGAIPREIGALSSLL  99
             +SL+KC  L  L L  N  +G +P    NL T LE+L   + ++ G+IP  IG L+SL+
Sbjct  535  ITSLTKCKYLSILVLGGNPLNGIIPNSVSNLSTSLEQLNATNCKIKGSIPDGIGNLTSLI  594

Query  98   IVDLSNNKLYGTF  60
            I+DLSNN L G+ 
Sbjct  595  ILDLSNNDLNGSL  607


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 91/288 (32%), Positives = 134/288 (47%), Gaps = 38/288 (13%)
 Frame = -1

Query  887  VNSITPCNWI-----------GVTCNSRHN---RVSALNLFNMGLVGELTPDLGNLSFLV  750
            + S+T C ++           G+  NS  N    +  LN  N  + G +   +GNL+ L+
Sbjct  535  ITSLTKCKYLSILVLGGNPLNGIIPNSVSNLSTSLEQLNATNCKIKGSIPDGIGNLTSLI  594

Query  749  SLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGF  570
             L+LS N+ + S P  +  L++L+ +  S N     +P        L FL   NN     
Sbjct  595  ILDLSNNDLNGSLPATIKDLQKLQYMDLSMNKPISRVP--------LHFLCALNN-----  641

Query  569  LPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlskle  390
                      L+ ++LG N    SIP+ +GNL  L+ L+LS N    + P +I NL  L 
Sbjct  642  ----------LDTMNLGQNQFMASIPKCLGNLTSLRHLDLSHNRQYSAPPEEIWNLKYLL  691

Query  389  nlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSG  210
             L LS N L G L   + N + K     + +N+FSG IP+S+     LQ LSL  N   G
Sbjct  692  ELDLSSNLLSGSLSYAITN-MKKAYWVDLSTNQFSGGIPNSIGDMQNLQNLSLAHNRLQG  750

Query  209  HVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             +P   G +  LE L L  N L+G+IP  +  L  L   ++S N L G
Sbjct  751  SIPESIGKMLSLESLDLSHNFLSGSIPMSMEILRYLRHFNVSFNNLSG  798


 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 91/296 (31%), Positives = 138/296 (47%), Gaps = 35/296 (12%)
 Frame = -1

Query  830  RVSALNLFNMG---LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSF  660
            R+  L   ++G   L G L   + N S L  + L  N F    P  +  LR L++L+ S 
Sbjct  461  RLPNLEYLDLGINHLSGALPSSISNSSNLRRIELGDNKFTGPIPTSMGDLRFLELLELSG  520

Query  659  N----DFSGNIPSWFGLLQNLRFL---YLGNNNISGFLPTSLFNLS-KLEVLHLGVNSLE  504
            N    D S    S+   L   ++L    LG N ++G +P S+ NLS  LE L+     ++
Sbjct  521  NLLVSDSSSPELSFITSLTKCKYLSILVLGGNPLNGIIPNSVSNLSTSLEQLNATNCKIK  580

Query  503  GSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLP  324
            GSIP  IGNL  L +L+LS+N  +GS P  I +L KL+ + LS+N     +PL     L 
Sbjct  581  GSIPDGIGNLTSLIILDLSNNDLNGSLPATIKDLQKLQYMDLSMNKPISRVPLHFLCALN  640

Query  323  KLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNL-------------  183
             L    +  N+F   IP  L   + L+ L L  N      P E  NL             
Sbjct  641  NLDTMNLGQNQFMASIPKCLGNLTSLRHLDLSHNRQYSAPPEEIWNLKYLLELDLSSNLL  700

Query  182  --------TKLEKLF---LRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
                    T ++K +   L +NQ +G IP  IG + +L  + L++N+L G+  +++
Sbjct  701  SGSLSYAITNMKKAYWVDLSTNQFSGGIPNSIGDMQNLQNLSLAHNRLQGSIPESI  756



>ref|XP_008223924.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=1317

 Score =   248 bits (634),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 165/379 (44%), Positives = 213/379 (56%), Gaps = 54/379 (14%)
 Frame = -1

Query  1058  MEITRHYFCLSIFFFHSLMLCL----TINA-HTNITTDKHALLSLKSKISFDPHSILADN  894
             M + R  F LS+ F   L L      TI A  TNIT D+ ALL+LKS I+ DPH+IL  N
Sbjct  1     MVMERRCFLLSVTFLLVLQLQYSSLGTIGAAQTNITMDQSALLALKSHITSDPHNILV-N  59

Query  893   WSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNS  714
             WS  + + CNW+GVTC +RH RVS LNL  MGL G + P LGNLSFLV L+L  N+FH +
Sbjct  60    WSTTT-SVCNWVGVTCGARHLRVSVLNLSYMGLSGTIPPPLGNLSFLVELDLRNNSFHGT  118

Query  713   FPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLE  534
              P+ELS LRRLK++    N+F G+IPSWFG    L+  YL  N  SG +PT++FNLS L+
Sbjct  119   LPKELSYLRRLKLISFISNNFMGSIPSWFGSFSKLQNFYLYGNQFSGSIPTTIFNLSTLQ  178

Query  533   VLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF---------------------------  435
             VL LG N L G IP+EI NL  LK + L  N F                           
Sbjct  179   VLDLGANKLSGGIPKEIRNLTMLKEIYLDSNKFNGAIPKEIGNLTMLKGIYLDSNNFNEI  238

Query  434   --------------------SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQ  315
                                  G  P+ + N+S L  L L  N+L G LP ++  HL  LQ
Sbjct  239   PKEIGFLDHVEALFVQNNALKGPVPVVVFNMSSLTMLILYGNNLSGGLPDNICQHLTSLQ  298

Query  314   IFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGA  135
             I  +  N+F G +PS L +C  L  L+L  NNFSG +P+   NLT +E+++L +N LTGA
Sbjct  299   ILNLGRNQFDGPLPSKLWQCRELLILNLEENNFSGSIPKNIRNLTMIEEIYLANNNLTGA  358

Query  134   IPREIGALSSLLIVDLSNN  78
             IP+EIG L+ L  + L +N
Sbjct  359   IPKEIGNLTMLKGIYLDSN  377


 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 134/233 (58%), Gaps = 1/233 (0%)
 Frame = -1

Query  764  LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNN  585
            L+ L  LNL +N F    P +L Q R L IL    N+FSG+IP     L  +  +YL NN
Sbjct  294  LTSLQILNLGRNQFDGPLPSKLWQCRELLILNLEENNFSGSIPKNIRNLTMIEEIYLANN  353

Query  584  NISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIln  405
            N++G +P  + NL+ L+ ++L  N+    IP+EIG L  ++ L + +N   G  P+ + N
Sbjct  354  NLTGAIPKEIGNLTMLKGIYLDSNNFN-EIPKEIGFLDHVEALFVQNNALKGPVPVVVFN  412

Query  404  lsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPF  225
            +S L  L L  N+L G LP ++  HL  LQI  +  N+F G +PS L +C  L  L+L  
Sbjct  413  MSSLTMLILYGNNLSGGLPDNICQHLTSLQILNLGRNQFDGPLPSKLWQCRELLILNLEE  472

Query  224  NNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            NNFSG +P+   NLT +E+++L +N LTG IP EIG L +L+ +    N   G
Sbjct  473  NNFSGSIPKNIRNLTMIEEIYLANNNLTGTIPDEIGDLQNLVSLSFRYNNFNG  525


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 126/235 (54%), Gaps = 3/235 (1%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            LNL      G +  ++ NL+ +  + L+ NN   + P+E+  L  LK +    N+F+  I
Sbjct  324  LNLEENNFSGSIPKNIRNLTMIEEIYLANNNLTGAIPKEIGNLTMLKGIYLDSNNFN-EI  382

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREI-GNLFQLK  462
            P   G L ++  L++ NN + G +P  +FN+S L +L L  N+L G +P  I  +L  L+
Sbjct  383  PKEIGFLDHVEALFVQNNALKGPVPVVVFNMSSLTMLILYGNNLSGGLPDNICQHLTSLQ  442

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
            +LNL  N F G  P  +    +L  L+L  N+  G +P ++ N L  ++   + +N  +G
Sbjct  443  ILNLGRNQFDGPLPSKLWQCRELLILNLEENNFSGSIPKNIRN-LTMIEEIYLANNNLTG  501

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIG  117
             IP  +     L +LS  +NNF+G +P    N++ + ++ L  NQL+G++P  IG
Sbjct  502  TIPDEIGDLQNLVSLSFRYNNFNGLIPSSIFNISTIREMSLSRNQLSGSLPANIG  556


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 138/260 (53%), Gaps = 4/260 (2%)
 Frame = -1

Query  833  NRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQ-LRRLKILQCSFN  657
            + V AL + N  L G +   + N+S L  L L  NN     P  + Q L  L+IL    N
Sbjct  246  DHVEALFVQNNALKGPVPVVVFNMSSLTMLILYGNNLSGGLPDNICQHLTSLQILNLGRN  305

Query  656  DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN  477
             F G +PS     + L  L L  NN SG +P ++ NL+ +E ++L  N+L G+IP+EIGN
Sbjct  306  QFDGPLPSKLWQCRELLILNLEENNFSGSIPKNIRNLTMIEEIYLANNNLTGAIPKEIGN  365

Query  476  LFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRS  297
            L  LK + L  N+F+   P +I  L  +E L +  N+L G +P+ + N +  L + ++  
Sbjct  366  LTMLKGIYLDSNNFN-EIPKEIGFLDHVEALFVQNNALKGPVPVVVFN-MSSLTMLILYG  423

Query  296  NKFSGEIPSSLSK-CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREI  120
            N  SG +P ++ +  + LQ L+L  N F G +P +     +L  L L  N  +G+IP+ I
Sbjct  424  NNLSGGLPDNICQHLTSLQILNLGRNQFDGPLPSKLWQCRELLILNLEENNFSGSIPKNI  483

Query  119  GALSSLLIVDLSNNKLYGTF  60
              L+ +  + L+NN L GT 
Sbjct  484  RNLTMIEEIYLANNNLTGTI  503


 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 142/277 (51%), Gaps = 28/277 (10%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +  + L N  L G +  ++GNL+ L  + L  NNF N  P+E+  L  ++ L    N   
Sbjct  345  IEEIYLANNNLTGAIPKEIGNLTMLKGIYLDSNNF-NEIPKEIGFLDHVEALFVQNNALK  403

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN-LSKLEVLHLGVNSLEGSIPREIGNLF  471
            G +P     + +L  L L  NN+SG LP ++   L+ L++L+LG N  +G +P ++    
Sbjct  404  GPVPVVVFNMSSLTMLILYGNNLSGGLPDNICQHLTSLQILNLGRNQFDGPLPSKLWQCR  463

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
            +L +LNL +N+FSGS P +I NL+ +E + L+ N+L G +P ++G+ L  L     R N 
Sbjct  464  ELLILNLEENNFSGSIPKNIRNLTMIEEIYLANNNLTGTIPDEIGD-LQNLVSLSFRYNN  522

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG------------------------NL  183
            F+G IPSS+   S ++ +SL  N  SG +P   G                        N 
Sbjct  523  FNGLIPSSIFNISTIREMSLSRNQLSGSLPANIGLGVPNLQHLYIIANDLSGVIPNLSNA  582

Query  182  TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKL  72
            + L  L L  N  TG IPR + AL +L  ++L NN L
Sbjct  583  SMLTWLSLGENTFTGFIPRTLCAL-NLQRLELQNNNL  618


 Score = 95.1 bits (235),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 88/233 (38%), Positives = 122/233 (52%), Gaps = 2/233 (1%)
 Frame = -1

Query  761  SFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNN  582
            S L  + L + +   + P  ++    L  L    N  SG+IP+  G L NL+ LYL  NN
Sbjct  663  SSLQYIRLRECSIRGNIPIGIANFNNLIFLSLGDNQLSGSIPTSLGRLGNLQGLYLDGNN  722

Query  581  ISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ-LKLLNLSDNHFSGSFPLDIln  405
            + G +P  L  L  L  L LG N L GSIP  +GNL   L+ L+L  N  S + P     
Sbjct  723  LQGHIPYELCQLDNLVELSLGSNQLSGSIPSCLGNLAASLRTLSLESNSLSFTIPSTFWR  782

Query  404  lsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPF  225
            L+ + +++LS NSL G L  D+GN    L++  + +N  S  IPS++     L  LSL  
Sbjct  783  LAYILHVNLSSNSLIGPLSQDIGNLKVVLEV-DLSNNHLSSVIPSTIGGLRDLVNLSLAN  841

Query  224  NNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            NN  G +P  F +L  L+ L L  N L+G IP+ + ALS L  +DLS N L G
Sbjct  842  NNLEGPIPSSFHDLLSLQLLNLSRNNLSGVIPKSLEALSLLKYLDLSFNMLQG  894


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 104/208 (50%), Gaps = 26/208 (13%)
 Frame = -1

Query  764  LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNN  585
            L+ L  LNL +N F    P +L Q R L IL    N+FSG+IP     L  +  +YL NN
Sbjct  438  LTSLQILNLGRNQFDGPLPSKLWQCRELLILNLEENNFSGSIPKNIRNLTMIEEIYLANN  497

Query  584  NISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIln  405
            N++G +P  + +L  L  L    N+  G IP  I N+  ++ ++LS N  SGS       
Sbjct  498  NLTGTIPDEIGDLQNLVSLSFRYNNFNGLIPSSIFNISTIREMSLSRNQLSGS-------  550

Query  404  lsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPF  225
                             LP ++G  +P LQ   + +N  SG IP +LS  S+L  LSL  
Sbjct  551  -----------------LPANIGLGVPNLQHLYIIANDLSGVIP-NLSNASMLTWLSLGE  592

Query  224  NNFSGHVPREFGNLTKLEKLFLRSNQLT  141
            N F+G +PR    L  L++L L++N LT
Sbjct  593  NTFTGFIPRTLCAL-NLQRLELQNNNLT  619


 Score = 92.0 bits (227),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 82/249 (33%), Positives = 121/249 (49%), Gaps = 35/249 (14%)
 Frame = -1

Query  812  LFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPS  633
            L N+G + EL   LGN    V+L+ S  N   S       L+ +++ +CS     GNIP 
Sbjct  633  LANLGNLTELY--LGNNPLNVTLDDSFRNISTS------SLQYIRLRECSI---RGNIPI  681

Query  632  WFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLN  453
                  NL FL LG+N +SG +PTSL  L  L+ L+L  N+L+G IP E+  L  L  L+
Sbjct  682  GIANFNNLIFLSLGDNQLSGSIPTSLGRLGNLQGLYLDGNNLQGHIPYELCQLDNLVELS  741

Query  452  LSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIP  273
            L  N  SGS                        +P  LGN    L+   + SN  S  IP
Sbjct  742  LGSNQLSGS------------------------IPSCLGNLAASLRTLSLESNSLSFTIP  777

Query  272  SSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIV  93
            S+  + + +  ++L  N+  G + ++ GNL  + ++ L +N L+  IP  IG L  L+ +
Sbjct  778  STFWRLAYILHVNLSSNSLIGPLSQDIGNLKVVLEVDLSNNHLSSVIPSTIGGLRDLVNL  837

Query  92   DLSNNKLYG  66
             L+NN L G
Sbjct  838  SLANNNLEG  846


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 78/161 (48%), Gaps = 25/161 (16%)
 Frame = -1

Query  542  KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsL  363
            ++ VL+L    L G+IP  +GNL  L  L+L +N F G+ P ++                
Sbjct  80   RVSVLNLSYMGLSGTIPPPLGNLSFLVELDLRNNSFHGTLPKEL----------------  123

Query  362  FGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNL  183
                     ++L +L++    SN F G IPS     S LQ   L  N FSG +P    NL
Sbjct  124  ---------SYLRRLKLISFISNNFMGSIPSWFGSFSKLQNFYLYGNQFSGSIPTTIFNL  174

Query  182  TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            + L+ L L +N+L+G IP+EI  L+ L  + L +NK  G  
Sbjct  175  STLQVLDLGANKLSGGIPKEIRNLTMLKEIYLDSNKFNGAI  215


 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 67/117 (57%), Gaps = 2/117 (2%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            +NL +  L+G L+ D+GNL  ++ ++LS N+  +  P  +  LR L  L  + N+  G I
Sbjct  789  VNLSSNSLIGPLSQDIGNLKVVLEVDLSNNHLSSVIPSTIGGLRDLVNLSLANNNLEGPI  848

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            PS F  L +L+ L L  NN+SG +P SL  LS L+ L L  N L+G IP   G  FQ
Sbjct  849  PSSFHDLLSLQLLNLSRNNLSGVIPKSLEALSLLKYLDLSFNMLQGEIPT--GGPFQ  903


 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = -1

Query  764  LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNN  585
            L++++ +NLS N+      +++  L+ +  +  S N  S  IPS  G L++L  L L NN
Sbjct  783  LAYILHVNLSSNSLIGPLSQDIGNLKVVLEVDLSNNHLSSVIPSTIGGLRDLVNLSLANN  842

Query  584  NISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
            N+ G +P+S  +L  L++L+L  N+L G IP+ +  L  LK L+LS N   G  P
Sbjct  843  NLEGPIPSSFHDLLSLQLLNLSRNNLSGVIPKSLEALSLLKYLDLSFNMLQGEIP  897



>emb|CAN65889.1| hypothetical protein VITISV_030571 [Vitis vinifera]
Length=562

 Score =   240 bits (612),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 144/297 (48%), Positives = 194/297 (65%), Gaps = 2/297 (1%)
 Frame = -1

Query  965  TDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGE  786
            TD+ +LL+LK+ I+ DPH +LA NWS  + + C WIGV+CN++   V AL+L N+GL G 
Sbjct  138  TDQSSLLALKAHITLDPHHVLAGNWSTKT-SFCEWIGVSCNAQQQSVIALDLSNLGLRGT  196

Query  785  LTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLR  606
            + PDLGNLSFLVSL+LS+NNFH   P E+ QL  L+     +N FSG IP  FG L  L+
Sbjct  197  IPPDLGNLSFLVSLDLSRNNFHCPVPVEVDQLTSLQSSNLQYNLFSGQIPPSFGNLNRLQ  256

Query  605  FLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGS  426
             L+LGN++ +G +P S  N+S LE L LG N L+G+IP EI  L  LK+L +  N   G+
Sbjct  257  SLFLGNDSFTGTIPLSFGNMSMLETLGLGGNHLQGNIPEEIAKLSNLKILEIQSNQLVGA  316

Query  425  FPLDIlnlsklenlslsvnsLFGELPLDLGNH-LPKLQIFVMRSNKFSGEIPSSLSKCSL  249
             PL I N+S L+ ++L+ NSL G++P  + NH L  L+   +  N+F G IPS+LSKC  
Sbjct  317  IPLAIFNISSLQEIALTYNSLSGDIPSSMCNHDLSALRGIRLSGNQFIGPIPSNLSKCGE  376

Query  248  LQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
            LQ LS  FN F+G  PR  G+LTKL  L L +N L+G IP E+  L SL  + L +N
Sbjct  377  LQILSSAFNKFTGGSPRSIGSLTKLTMLSLAANSLSGTIPEELSFLPSLEYLYLRSN  433


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 88/185 (48%), Gaps = 23/185 (12%)
 Frame = -1

Query  767  NLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGN  588
            +LS L  + LS N F    P  LS+   L+IL  +FN F+G  P   G L  L  L L  
Sbjct  349  DLSALRGIRLSGNQFIGPIPSNLSKCGELQILSSAFNKFTGGSPRSIGSLTKLTMLSLAA  408

Query  587  NNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIl  408
            N++SG +P  L  L  LE L+L  NS    IP  I N+  LK ++L  N FSGS PLDI 
Sbjct  409  NSLSGTIPEELSFLPSLEYLYLRSNSFTNPIPSAIFNISTLKEIDLGKNGFSGSMPLDI-  467

Query  407  nlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLP  228
                                  +  H P LQ+  + +N F+G I   ++ C+ L+ L L 
Sbjct  468  ----------------------MCAHSPSLQLIGLYNNIFTGTIHGGIANCTSLRELYLS  505

Query  227  FNNFS  213
             N+ +
Sbjct  506  GNDLT  510


 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 89/148 (60%), Gaps = 1/148 (1%)
 Frame = -1

Query  509  LEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNH  330
            L G+IP ++GNL  L  L+LS N+F    P+++  L+ L++ +L  N   G++P   GN 
Sbjct  193  LRGTIPPDLGNLSFLVSLDLSRNNFHCPVPVEVDQLTSLQSSNLQYNLFSGQIPPSFGN-  251

Query  329  LPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN  150
            L +LQ   + ++ F+G IP S    S+L+TL L  N+  G++P E   L+ L+ L ++SN
Sbjct  252  LNRLQSLFLGNDSFTGTIPLSFGNMSMLETLGLGGNHLQGNIPEEIAKLSNLKILEIQSN  311

Query  149  QLTGAIPREIGALSSLLIVDLSNNKLYG  66
            QL GAIP  I  +SSL  + L+ N L G
Sbjct  312  QLVGAIPLAIFNISSLQEIALTYNSLSG  339


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 75/144 (52%), Gaps = 2/144 (1%)
 Frame = -1

Query  848  CNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ  669
            CN   + +  + L     +G +  +L     L  L+ + N F    PR +  L +L +L 
Sbjct  346  CNHDLSALRGIRLSGNQFIGPIPSNLSKCGELQILSSAFNKFTGGSPRSIGSLTKLTMLS  405

Query  668  CSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR  489
             + N  SG IP     L +L +LYL +N+ +  +P+++FN+S L+ + LG N   GS+P 
Sbjct  406  LAANSLSGTIPEELSFLPSLEYLYLRSNSFTNPIPSAIFNISTLKEIDLGKNGFSGSMPL  465

Query  488  EI--GNLFQLKLLNLSDNHFSGSF  423
            +I   +   L+L+ L +N F+G+ 
Sbjct  466  DIMCAHSPSLQLIGLYNNIFTGTI  489


 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 56/104 (54%), Gaps = 1/104 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P DLGN L  L    +  N F   +P  + + + LQ+ +L +N FSG +P  FGNL 
Sbjct  195  GTIPPDLGN-LSFLVSLDLSRNNFHCPVPVEVDQLTSLQSSNLQYNLFSGQIPPSFGNLN  253

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            +L+ LFL ++  TG IP   G +S L  + L  N L G   + +
Sbjct  254  RLQSLFLGNDSFTGTIPLSFGNMSMLETLGLGGNHLQGNIPEEI  297



>ref|XP_008225337.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Prunus 
mume]
Length=1122

 Score =   247 bits (630),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 202/343 (59%), Gaps = 25/343 (7%)
 Frame = -1

Query  1025  IFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTC  846
             +   H   +C      TNITTD+ ALL+LKS I+ DP++IL  NWS  + + CNW+G+TC
Sbjct  2     LLLVHHNSICTVGATQTNITTDQSALLALKSHITSDPYNILV-NWSTTT-SVCNWVGITC  59

Query  845   NSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQC  666
              + H RV++LNL  M   G + P LGNLSFLV+L+   N+FH  FP ELS LRRLK++  
Sbjct  60    GAHHLRVASLNLLYMSFTGTIPPHLGNLSFLVALSFKNNSFHGYFPHELSYLRRLKLISF  119

Query  665   SFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
              FN+F G+IPSWFG    L+   L  N  S  +P+++FNLS L+ ++L  N L G+IP+E
Sbjct  120   RFNNFMGSIPSWFGSFPKLQSFDLYGNQFSSTIPSTIFNLSTLQDINLSANKLSGAIPKE  179

Query  485   IGNLFQLKLLNLSDNHF-----------------------SGSFPLDIlnlsklenlsls  375
             IGNL  LK + L  N+F                        G  P+ I N+S L  L+L 
Sbjct  180   IGNLTMLKEIYLDSNNFNEIPKEIGFLQQLEKLYVQSNALKGPIPMAIFNMSFLTTLALF  239

Query  374   vnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPRE  195
              NSL G LP ++  HLP LQI  +  NKF G +PS L +C  L +L L  NNFSG +P+ 
Sbjct  240   GNSLSGGLPDNICQHLPSLQILNLGRNKFDGPLPSKLWQCKELLSLLLGQNNFSGSIPKN  299

Query  194   FGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
              GNLT +  ++L  N LTG IP EIG L +L  + +  N L G
Sbjct  300   IGNLTMMNGIYLDFNNLTGTIPDEIGDLQNLEFLSIEQNNLNG  342


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 91/266 (34%), Positives = 138/266 (52%), Gaps = 13/266 (5%)
 Frame = -1

Query  821  ALNLFNMG---LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            +L + N+G     G L   L     L+SL L QNNF  S P+ +  L  +  +   FN+ 
Sbjct  257  SLQILNLGRNKFDGPLPSKLWQCKELLSLLLGQNNFSGSIPKNIGNLTMMNGIYLDFNNL  316

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG-NL  474
            +G IP   G LQNL FL +  NN++G +P+SLFN+S +  L L  N L GS+P  IG  L
Sbjct  317  TGTIPDEIGDLQNLEFLSIEQNNLNGLIPSSLFNISTMRALSLTFNQLSGSLPANIGLGL  376

Query  473  FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLG--NHLPKLQI----  312
              L+ L ++  + SG  P ++ N S L  L L  NS  G +P+ L    +L +L++    
Sbjct  377  PNLRQLYIASTNLSGVIP-NLSNASMLTELDLGQNSFTGFIPITLCALTNLKRLRLSMNN  435

Query  311  FVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNL--TKLEKLFLRSNQLTG  138
              + ++       S L+    L  LSL  N  +  +   F N   + L+++ LR+  + G
Sbjct  436  LAIDTSTPETTTLSCLANLRSLTALSLDANPLNATLDDFFSNFSTSTLQRIGLRNCSMRG  495

Query  137  AIPREIGALSSLLIVDLSNNKLYGTF  60
             IP  IG +SSL+ +DL NN+L G+ 
Sbjct  496  NIPIGIGNISSLISLDLGNNQLSGSI  521


 Score = 92.0 bits (227),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 90/267 (34%), Positives = 127/267 (48%), Gaps = 36/267 (13%)
 Frame = -1

Query  773  LGNLSFLVSLNLSQN-------NFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            L NL  L +L+L  N       +F ++F    S L+R+ +  CS     GNIP   G + 
Sbjct  451  LANLRSLTALSLDANPLNATLDDFFSNF--STSTLQRIGLRNCSMR---GNIPIGIGNIS  505

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            +L  L LGNN +SG +P SL  L  L+ ++L  N L+G IP ++  L+ L  L L+ N F
Sbjct  506  SLISLDLGNNQLSGSIPNSLGRLGNLQGMNLNYNKLQGYIPYQLCQLYNLVYLQLASNQF  565

Query  434  SGSFP---------------------LDIlnlsklenlslsvnsLFGELPLDLGNHLPKL  318
            SGS P                       I +        L VN     L   +   + KL
Sbjct  566  SGSIPSCLGNLAASLRYLSLESNLLSSTIPSTFWRLAYILQVNLSSNSLIGPISQDIAKL  625

Query  317  QIFV---MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ  147
            ++ V   + +N  SG IPS++     L  LSL  NN  G +P  F +L  L+ L L  N 
Sbjct  626  KVVVEVDLSNNHLSGAIPSTIGGLQDLVNLSLANNNLEGPIPSSFHDLLSLQLLNLSRNN  685

Query  146  LTGAIPREIGALSSLLIVDLSNNKLYG  66
            L+G IP+ + ALS L  +DLS N+L G
Sbjct  686  LSGVIPKSLEALSLLKYLDLSFNRLQG  712


 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 78/231 (34%), Positives = 112/231 (48%), Gaps = 28/231 (12%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPD--LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND  654
            ++ L LF   L G L PD    +L  L  LNL +N F    P +L Q + L  L    N+
Sbjct  233  LTTLALFGNSLSGGL-PDNICQHLPSLQILNLGRNKFDGPLPSKLWQCKELLSLLLGQNN  291

Query  653  FSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
            FSG+IP   G L  +  +YL  NN++G +P  + +L  LE L +  N+L G IP  + N+
Sbjct  292  FSGSIPKNIGNLTMMNGIYLDFNNLTGTIPDEIGDLQNLEFLSIEQNNLNGLIPSSLFNI  351

Query  473  FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSN  294
              ++ L+L+ N  SGS                        LP ++G  LP L+   + S 
Sbjct  352  STMRALSLTFNQLSGS------------------------LPANIGLGLPNLRQLYIAST  387

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
              SG IP +LS  S+L  L L  N+F+G +P     LT L++L L  N L 
Sbjct  388  NLSGVIP-NLSNASMLTELDLGQNSFTGFIPITLCALTNLKRLRLSMNNLA  437


 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 97/305 (32%), Positives = 143/305 (47%), Gaps = 41/305 (13%)
 Frame = -1

Query  995  LTINAHTNITTDKHALLSLKS--KISFDPH---SILADNWSVNSITPCNWIGV-TCNSRH  834
            L I+  T  TT    L +L+S   +S D +   + L D +S  S +    IG+  C+ R 
Sbjct  436  LAIDTSTPETTTLSCLANLRSLTALSLDANPLNATLDDFFSNFSTSTLQRIGLRNCSMRG  495

Query  833  N---------RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRL  681
            N          + +L+L N  L G +   LG L  L  +NL+ N      P +L QL  L
Sbjct  496  NIPIGIGNISSLISLDLGNNQLSGSIPNSLGRLGNLQGMNLNYNKLQGYIPYQLCQLYNL  555

Query  680  KILQCSFNDFSGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLE  504
              LQ + N FSG+IPS  G L  +LR+L L +N +S  +P++ + L+ +  ++L  NSL 
Sbjct  556  VYLQLASNQFSGSIPSCLGNLAASLRYLSLESNLLSSTIPSTFWRLAYILQVNLSSNSLI  615

Query  503  GSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLP  324
            G I ++I  L  +  ++LS+NH SG+ P  I                           L 
Sbjct  616  GPISQDIAKLKVVVEVDLSNNHLSGAIPSTI-------------------------GGLQ  650

Query  323  KLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQL  144
             L    + +N   G IPSS      LQ L+L  NN SG +P+    L+ L+ L L  N+L
Sbjct  651  DLVNLSLANNNLEGPIPSSFHDLLSLQLLNLSRNNLSGVIPKSLEALSLLKYLDLSFNRL  710

Query  143  TGAIP  129
             G IP
Sbjct  711  QGEIP  715



>emb|CDP08227.1| unnamed protein product [Coffea canephora]
Length=1115

 Score =   246 bits (628),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 146/318 (46%), Positives = 200/318 (63%), Gaps = 3/318 (1%)
 Frame = -1

Query  1007  LMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP--CNWIGVTCNSRH  834
             +M   T     ++ TD+ ALL+LK+ I+ + H  L+ NWS  +  P  C+WIG  C+SRH
Sbjct  21    MMPGCTAMKRLSLGTDQSALLALKAHITSEQHEFLSKNWSSRAAPPSVCDWIGFQCSSRH  80

Query  833   NRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND  654
              RV+ALN+ NMGL G + PDLGNLS LVSL+L  N+FH + P ELS LRRL+ ++ S N+
Sbjct  81    QRVTALNISNMGLTGTIPPDLGNLSLLVSLDLRNNSFHGNLPEELSHLRRLRFIRFSKNN  140

Query  653   FSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
             F+G IP WFG    L+FL+L +N  SGF+P  + NLSKLE L+L  N L G++P ++GNL
Sbjct  141   FTGEIPMWFGHFPELQFLFLDSNGFSGFIPPPISNLSKLETLNLLDNFLGGNMPEQMGNL  200

Query  473   FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSN  294
               LK L  S N F G  PL +  LS+L+ L L+ N   G +P ++ N L KL+   + +N
Sbjct  201   TVLKELYSSRNEFVGPIPLSLCKLSQLQVLDLAFNRFSGHIPKEIAN-LEKLKELYLITN  259

Query  293   KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGA  114
              F+G IP  + K   L+ L L  NN +G +PRE GNL  L+ L L  NQ+ G IP+EIG 
Sbjct  260   NFTGVIPREIGKLHGLKVLVLGRNNLTGTIPREIGNLQNLQGLNLEWNQIMGMIPKEIGN  319

Query  113   LSSLLIVDLSNNKLYGTF  60
             L+ L  +  + N L GT 
Sbjct  320   LTMLTELYFAYNSLTGTI  337


 Score =   135 bits (339),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 121/217 (56%), Gaps = 0/217 (0%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +  ++ NL  L  L L  NNF    PRE+ +L  LK+L    N+ +G IP   G LQN
Sbjct  239  GHIPKEIANLEKLKELYLITNNFTGVIPREIGKLHGLKVLVLGRNNLTGTIPREIGNLQN  298

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFS  432
            L+ L L  N I G +P  + NL+ L  L+   NSL G+IP E+GNL+QL+ L L  N  +
Sbjct  299  LQGLNLEWNQIMGMIPKEIGNLTMLTELYFAYNSLTGTIPPEMGNLYQLENLQLPYNGLN  358

Query  431  GSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCS  252
            GS P  + N+S L N+ L+ N L G LP DLG  LPKL    +  N   G IP S+S CS
Sbjct  359  GSIPPGLFNVSALRNIHLASNLLSGNLPRDLGYRLPKLLFIELGGNNLGGVIPVSISNCS  418

Query  251  LLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
             L+ L    N F+G +P   G+L  L+ L L  N LT
Sbjct  419  QLEILDFAINRFTGPIPDALGDLRLLQYLVLFGNNLT  455


 Score =   101 bits (252),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 110/223 (49%), Gaps = 26/223 (12%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +     +L  + +L +  NN + +    L  L+RL  +  + N FSG+IP  FG +
Sbjct  534  LTGGIPTAFKDLQSMQTLAVGDNNLNGTL-DNLCNLQRLAYVYLTANRFSGSIPECFGNM  592

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
             +LR L LGNN +   +P S +NL  L  L+L  NSL GS+P E+G L  +  +++S N 
Sbjct  593  TSLRELDLGNNFLVSAIPNSFWNLKDLLQLNLSSNSLNGSLPLEVGTLKAVTSIDISVNQ  652

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
            F                        FG++P  +G+ L  L I  +  N+F G IP S   
Sbjct  653  F------------------------FGDIPSTIGD-LQNLLILNLSQNQFHGSIPESCGS  687

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
               LQ L L  NN SG++P+    L  LE+L +  N L+G IP
Sbjct  688  MLSLQGLYLSHNNLSGYIPKSLEALRDLEELDVSYNHLSGEIP  730


 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 132/243 (54%), Gaps = 3/243 (1%)
 Frame = -1

Query  791  GELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            G L   +GNLS  L  L +  +    + P +  +L  L +L    N  +G IP+ F  LQ
Sbjct  487  GLLPASIGNLSATLQKLYIYSSEIKGTIPSQTGKLTNLLLLDLQSNHLTGGIPTAFKDLQ  546

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            +++ L +G+NN++G L  +L NL +L  ++L  N   GSIP   GN+  L+ L+L +N  
Sbjct  547  SMQTLAVGDNNLNGTL-DNLCNLQRLAYVYLTANRFSGSIPECFGNMTSLRELDLGNNFL  605

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
              + P    NL  L  L+LS NSL G LPL++G  L  +    +  N+F G+IPS++   
Sbjct  606  VSAIPNSFWNLKDLLQLNLSSNSLNGSLPLEVGT-LKAVTSIDISVNQFFGDIPSTIGDL  664

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              L  L+L  N F G +P   G++  L+ L+L  N L+G IP+ + AL  L  +D+S N 
Sbjct  665  QNLLILNLSQNQFHGSIPESCGSMLSLQGLYLSHNNLSGYIPKSLEALRDLEELDVSYNH  724

Query  74   LYG  66
            L G
Sbjct  725  LSG  727


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 89/277 (32%), Positives = 136/277 (49%), Gaps = 35/277 (13%)
 Frame = -1

Query  797  LVGELTPDLG-NLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L  DLG  L  L+ + L  NN     P  +S   +L+IL  + N F+G IP   G 
Sbjct  381  LSGNLPRDLGYRLPKLLFIELGGNNLGGVIPVSISNCSQLEILDFAINRFTGPIPDALGD  440

Query  620  L-------------------------------QNLRFLYLGNNNISGFLPTSLFNLSK-L  537
            L                               +NL +L LG N+++G LP S+ NLS  L
Sbjct  441  LRLLQYLVLFGNNLTSDPTSTELSFITSLTKCKNLVYLELGANSLNGLLPASIGNLSATL  500

Query  536  EVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFG  357
            + L++  + ++G+IP + G L  L LL+L  NH +G  P    +L  ++ L++  N+L G
Sbjct  501  QKLYIYSSEIKGTIPSQTGKLTNLLLLDLQSNHLTGGIPTAFKDLQSMQTLAVGDNNLNG  560

Query  356  ELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTK  177
             L  D   +L +L    + +N+FSG IP      + L+ L L  N     +P  F NL  
Sbjct  561  TL--DNLCNLQRLAYVYLTANRFSGSIPECFGNMTSLRELDLGNNFLVSAIPNSFWNLKD  618

Query  176  LEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            L +L L SN L G++P E+G L ++  +D+S N+ +G
Sbjct  619  LLQLNLSSNSLNGSLPLEVGTLKAVTSIDISVNQFFG  655


 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 75/143 (52%), Gaps = 0/143 (0%)
 Frame = -1

Query  848  CNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ  669
            C      +  L+L N  LV  +     NL  L+ LNLS N+ + S P E+  L+ +  + 
Sbjct  588  CFGNMTSLRELDLGNNFLVSAIPNSFWNLKDLLQLNLSSNSLNGSLPLEVGTLKAVTSID  647

Query  668  CSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR  489
             S N F G+IPS  G LQNL  L L  N   G +P S  ++  L+ L+L  N+L G IP+
Sbjct  648  ISVNQFFGDIPSTIGDLQNLLILNLSQNQFHGSIPESCGSMLSLQGLYLSHNNLSGYIPK  707

Query  488  EIGNLFQLKLLNLSDNHFSGSFP  420
             +  L  L+ L++S NH SG  P
Sbjct  708  SLEALRDLEELDVSYNHLSGEIP  730


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P DLGN L  L    +R+N F G +P  LS    L+ +    NNF+G +P  FG+  
Sbjct  95   GTIPPDLGN-LSLLVSLDLRNNSFHGNLPEELSHLRRLRFIRFSKNNFTGEIPMWFGHFP  153

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            +L+ LFL SN  +G IP  I  LS L  ++L +N L G   + +
Sbjct  154  ELQFLFLDSNGFSGFIPPPISNLSKLETLNLLDNFLGGNMPEQM  197



>ref|XP_011091710.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1217

 Score =   246 bits (629),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 203/312 (65%), Gaps = 1/312 (0%)
 Frame = -1

Query  995  LTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSAL  816
            LT + + NI TD+ +LLSLKS +  +P  IL+ NWS  S   C W+GV+C+ RHNR++AL
Sbjct  23   LTSSKNLNIITDQTSLLSLKSHLHLEPSDILSQNWSTPSDV-CTWVGVSCSRRHNRITAL  81

Query  815  NLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIP  636
            N+ +MGL G + P LGNLSFLVS+++  N+F  + P EL+QLRRL+ L  S N+F+G IP
Sbjct  82   NISDMGLKGTIPPHLGNLSFLVSIDMKGNSFQGNLPVELAQLRRLRFLDLSSNNFTGQIP  141

Query  635  SWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLL  456
            +  G L  ++ L L NN  SGF+P ++FNLSKLE+L L  NSL G +P +IG L  L +L
Sbjct  142  ASLGFLSEIQSLSLKNNKFSGFIPATIFNLSKLEMLELSFNSLGGKLPEQIGKLQNLMVL  201

Query  455  NLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEI  276
            ++  N  +GS P ++ N+S LE L+L+ NSL GELP D+   LP L+   +  N  SG I
Sbjct  202  SIQYNRLTGSIPFELYNVSSLETLALTNNSLSGELPDDICGRLPGLEAIYLSWNAISGRI  261

Query  275  PSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLI  96
            P S  +C  L  LSL  N F+G +PRE GN+T LE ++L  N LTG IP EIG L  L +
Sbjct  262  PVSFPECRRLTLLSLSNNAFAGPIPREIGNVTMLEAVYLGGNYLTGEIPEEIGNLRRLQL  321

Query  95   VDLSNNKLYGTF  60
            + +  N   G+ 
Sbjct  322  LSMELNIFSGSI  333


 Score =   157 bits (396),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 148/251 (59%), Gaps = 1/251 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL-SQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G +  +L N+S L +L L+ N+     P ++  +L  L+ +  S+N  SG IP  F  
Sbjct  208  LTGSIPFELYNVSSLETLALTNNSLSGELPDDICGRLPGLEAIYLSWNAISGRIPVSFPE  267

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
             + L  L L NN  +G +P  + N++ LE ++LG N L G IP EIGNL +L+LL++  N
Sbjct  268  CRRLTLLSLSNNAFAGPIPREIGNVTMLEAVYLGGNYLTGEIPEEIGNLRRLQLLSMELN  327

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
             FSGS PL I N+S L  L L+ + L G LP ++ +HLP LQ   +  N   G IPS+  
Sbjct  328  IFSGSIPLSIFNISSLVLLDLARSGLSGTLPSNMCSHLPNLQYLELHYNDLYGPIPSTWD  387

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
             CS LQ LSL  +NF+G +PRE GNLT L  L L  N+LTG IPRE+G L  L  + L+ 
Sbjct  388  GCSRLQDLSLRDSNFTGFIPREIGNLTMLRTLRLFHNRLTGEIPRELGKLQQLEQLHLAV  447

Query  80   NKLYGTFIQNL  48
            N L G+  + +
Sbjct  448  NLLTGSIPEEI  458


 Score =   117 bits (293),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 136/281 (48%), Gaps = 51/281 (18%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            R++ L+L N    G +  ++GN++ L ++ L  N      P E+  LRRL++L    N F
Sbjct  270  RLTLLSLSNNAFAGPIPREIGNVTMLEAVYLGGNYLTGEIPEEIGNLRRLQLLSMELNIF  329

Query  650  SGNIP--------------------------------------------------SWFGL  621
            SG+IP                                                  +W G 
Sbjct  330  SGSIPLSIFNISSLVLLDLARSGLSGTLPSNMCSHLPNLQYLELHYNDLYGPIPSTWDG-  388

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
               L+ L L ++N +GF+P  + NL+ L  L L  N L G IPRE+G L QL+ L+L+ N
Sbjct  389  CSRLQDLSLRDSNFTGFIPREIGNLTMLRTLRLFHNRLTGEIPRELGKLQQLEQLHLAVN  448

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              +GS P +I N+S L  L+L+ N L G LP  +G+ LP L +  + +N  SG IP S+ 
Sbjct  449  LLTGSIPEEIANISTLTLLALTANRLSGSLPKSIGSRLPDLDLISLETNLLSGHIPDSIG  508

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
              S L  ++L  N+FSG +P   G+L  L+ L++  N LTG
Sbjct  509  NSSKLTYINLGNNHFSGTIPSSLGSLRLLQHLYVHGNNLTG  549


 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 94/293 (32%), Positives = 148/293 (51%), Gaps = 32/293 (11%)
 Frame = -1

Query  872  PCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQ  693
            P  W G +      R+  L+L +    G +  ++GNL+ L +L L  N      PREL +
Sbjct  383  PSTWDGCS------RLQDLSLRDSNFTGFIPREIGNLTMLRTLRLFHNRLTGEIPRELGK  436

Query  692  LRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN-LSKLEVLHLGV  516
            L++L+ L  + N  +G+IP     +  L  L L  N +SG LP S+ + L  L+++ L  
Sbjct  437  LQQLEQLHLAVNLLTGSIPEEIANISTLTLLALTANRLSGSLPKSIGSRLPDLDLISLET  496

Query  515  NSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGE------  354
            N L G IP  IGN  +L  +NL +NHFSG+ P  + +L  L++L +  N+L G       
Sbjct  497  NLLSGHIPDSIGNSSKLTYINLGNNHFSGTIPSSLGSLRLLQHLYVHGNNLTGLSFITSL  556

Query  353  -------------------LPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSL  231
                               LP  +GN    L++F  R++   G IP+ +S  + L  L L
Sbjct  557  ANCRFLTDFWMHNNRADDFLPPSIGNLSTSLRVFRARNSTIKGSIPNEISNLTSLVELDL  616

Query  230  PFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKL  72
              N+ SG +P   G+L  L+ L L  N+++G+IP  I  L++L  + LSNN++
Sbjct  617  SSNDLSGFLPSGLGSLALLQGLSLSDNRISGSIPTGICELTNLGELRLSNNQI  669


 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 137/279 (49%), Gaps = 29/279 (10%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            L+L   GL G L  ++  +L  L  L L  N+ +   P       RL+ L    ++F+G 
Sbjct  346  LDLARSGLSGTLPSNMCSHLPNLQYLELHYNDLYGPIPSTWDGCSRLQDLSLRDSNFTGF  405

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IP   G L  LR L L +N ++G +P  L  L +LE LHL VN L GSIP EI N+  L 
Sbjct  406  IPREIGNLTMLRTLRLFHNRLTGEIPRELGKLQQLEQLHLAVNLLTGSIPEEIANISTLT  465

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLF-GELPLDLGNHLPKLQIFVMRSNKFS  285
            LL L+ N  SGS P  I +     +L     +L  G +P  +GN   KL    + +N FS
Sbjct  466  LLALTANRLSGSLPKSIGSRLPDLDLISLETNLLSGHIPDSIGNS-SKLTYINLGNNHFS  524

Query  284  GEIPSSLSKCSLLQTLSLPFNNFSG-------------------------HVPREFGNLT  180
            G IPSSL    LLQ L +  NN +G                          +P   GNL+
Sbjct  525  GTIPSSLGSLRLLQHLYVHGNNLTGLSFITSLANCRFLTDFWMHNNRADDFLPPSIGNLS  584

Query  179  KLEKLF-LRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
               ++F  R++ + G+IP EI  L+SL+ +DLS+N L G
Sbjct  585  TSLRVFRARNSTIKGSIPNEISNLTSLVELDLSSNDLSG  623


 Score = 95.1 bits (235),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 123/241 (51%), Gaps = 2/241 (1%)
 Frame = -1

Query  785  LTPDLGNLSFLVSLNLSQNN-FHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNL  609
            L P +GNLS  + +  ++N+    S P E+S L  L  L  S ND SG +PS  G L  L
Sbjct  576  LPPSIGNLSTSLRVFRARNSTIKGSIPNEISNLTSLVELDLSSNDLSGFLPSGLGSLALL  635

Query  608  RFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSG  429
            + L L +N ISG +PT +  L+ L  L L  N +   IP  IGN   L+ L L  N  S 
Sbjct  636  QGLSLSDNRISGSIPTGICELTNLGELRLSNNQISSQIPGCIGNGISLRQLYLDSNRLSW  695

Query  428  SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSL  249
              P  + +L  L  L+LS N L G L   +GN L    +  +  N+F+  IP ++   + 
Sbjct  696  GIPSSLWSLKNLLELNLSSNLLNGSLSPQIGN-LEAAILIDLSFNQFTQNIPITVGGLNN  754

Query  248  LQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLY  69
            L   SL  N   G +P   GN+  LE L L  N L+G+IP+ + AL  L I ++S N L 
Sbjct  755  LINFSLSHNRLLGSIPNTTGNMISLEVLDLAHNNLSGSIPKSLEALKHLKIFNVSYNSLS  814

Query  68   G  66
            G
Sbjct  815  G  815


 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 88/278 (32%), Positives = 123/278 (44%), Gaps = 59/278 (21%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +   +GN S L  +NL  N+F  + P  L  LR L+ L    N+ +G   S+   L
Sbjct  499  LSGHIPDSIGNSSKLTYINLGNNHFSGTIPSSLGSLRLLQHLYVHGNNLTG--LSFITSL  556

Query  617  QNLRFL---YLGNNNISGFLPTSLFNLS-KLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
             N RFL   ++ NN    FLP S+ NLS  L V     ++++GSIP EI NL  L  L+L
Sbjct  557  ANCRFLTDFWMHNNRADDFLPPSIGNLSTSLRVFRARNSTIKGSIPNEISNLTSLVELDL  616

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
            S N  SG  P                 S  G L L        LQ   +  N+ SG IP+
Sbjct  617  SSNDLSGFLP-----------------SGLGSLAL--------LQGLSLSDNRISGSIPT  651

Query  269  SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR------------  126
             + + + L  L L  N  S  +P   GN   L +L+L SN+L+  IP             
Sbjct  652  GICELTNLGELRLSNNQISSQIPGCIGNGISLRQLYLDSNRLSWGIPSSLWSLKNLLELN  711

Query  125  ------------EIGALSSLLIVDLSNNKLYGTFIQNL  48
                        +IG L + +++DLS N+    F QN+
Sbjct  712  LSSNLLNGSLSPQIGNLEAAILIDLSFNQ----FTQNI  745


 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 84/233 (36%), Positives = 124/233 (53%), Gaps = 6/233 (3%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            L+L +  L G L   LG+L+ L  L+LS N    S P  + +L  L  L+ S N  S  I
Sbjct  614  LDLSSNDLSGFLPSGLGSLALLQGLSLSDNRISGSIPTGICELTNLGELRLSNNQISSQI  673

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKL  459
            P   G   +LR LYL +N +S  +P+SL++L  L  L+L  N L GS+  +IGNL    L
Sbjct  674  PGCIGNGISLRQLYLDSNRLSWGIPSSLWSLKNLLELNLSSNLLNGSLSPQIGNLEAAIL  733

Query  458  LNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGE  279
            ++LS N F+ + P+ +  L+ L N SLS N L G +P   GN +  L++  +  N  SG 
Sbjct  734  IDLSFNQFTQNIPITVGGLNNLINFSLSHNRLLGSIPNTTGNMI-SLEVLDLAHNNLSGS  792

Query  278  IPSSLSKCSLLQTLSLPFNNFSGHVP--REFGNLTKLEKLFLRSNQLTGAIPR  126
            IP SL     L+  ++ +N+ SG +P    F N T+   +F   N+    +PR
Sbjct  793  IPKSLEALKHLKIFNVSYNSLSGEIPPGGPFVNFTRESFMF---NEALCGLPR  842



>ref|XP_008372676.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=1233

 Score =   246 bits (629),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 155/343 (45%), Positives = 200/343 (58%), Gaps = 31/343 (9%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLF  807
            AHTN +TD+ ALL+LK+ I+ DP +IL  NWS  S +  CNWIGVTC +RH RV+ALNL 
Sbjct  129  AHTNFSTDQSALLALKAHITSDPQNILTANWSSASNSNICNWIGVTCGARHQRVTALNLS  188

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
            +MGL G + P LGNLSFLV L  + N F+   P+ELS+LRRLK +    N+F+G IPSWF
Sbjct  189  DMGLAGVIPPHLGNLSFLVVLYANNNFFNGPLPQELSRLRRLKAIYFQENNFTGTIPSWF  248

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
            G    L+   L  N  SG +PTS+FNLS LE++ +  N L GSIPREIGNL  LK +NL 
Sbjct  249  GSFPKLQTFILSGNGFSGSIPTSIFNLSALEIISVSSNQLSGSIPREIGNLTMLKGINLD  308

Query  446  DNHFS------------------------------GSFPLDIlnlsklenlslsvnsLFG  357
            DN F                               GS  + +LN+S L  L+L  N++ G
Sbjct  309  DNKFEDTRIDFIELPNEIGSLGQLEELFVQENALKGSAFVPVLNISSLTTLTLFGNNMSG  368

Query  356  ELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTK  177
             LP ++  HL  ++ F +  N+  G IPS L +C  L+ ++L  NNF G +P+  GNLT 
Sbjct  369  SLPDNICEHLSSIRRFSLGRNQLDGLIPSKLWQCKELREITLGSNNFRGSIPKSLGNLTY  428

Query  176  LEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            L K+ L  N LTG IP EI  L  L I+ L  N L G     L
Sbjct  429  LTKILLGDNNLTGTIPYEIVDLPQLEILTLHANNLSGVIPSKL  471


 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 133/273 (49%), Gaps = 23/273 (8%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +   LGNL++L  + L  NN   + P E+  + +L+IL    N+ +G IPS    L  
Sbjct  52   GSIPKSLGNLTYLRKIYLYNNNLEGTIPDEIGDISQLEILGLMINNLNGVIPSKLFNLSM  111

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREI-----------------  483
            +R + L +N +SG L  +  N S  +   L + +   S P+ I                 
Sbjct  112  IRLIGLSSNPLSGALAIAHTNFSTDQSALLALKAHITSDPQNILTANWSSASNSNICNWI  171

Query  482  ----GNLFQ-LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKL  318
                G   Q +  LNLSD   +G  P  + NLS L  L  + N   G LP +L + L +L
Sbjct  172  GVTCGARHQRVTALNLSDMGLAGVIPPHLGNLSFLVVLYANNNFFNGPLPQEL-SRLRRL  230

Query  317  QIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
            +    + N F+G IPS       LQT  L  N FSG +P    NL+ LE + + SNQL+G
Sbjct  231  KAIYFQENNFTGTIPSWFGSFPKLQTFILSGNGFSGSIPTSIFNLSALEIISVSSNQLSG  290

Query  137  AIPREIGALSSLLIVDLSNNKLYGTFIQNLDTP  39
            +IPREIG L+ L  ++L +NK   T I  ++ P
Sbjct  291  SIPREIGNLTMLKGINLDDNKFEDTRIDFIELP  323


 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 123/256 (48%), Gaps = 21/256 (8%)
 Frame = -1

Query  764  LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNN  585
            LS +  +NL QN F    P +L Q + L+++   +N+F G+IP   G L  LR +YL NN
Sbjct  13   LSSVRLINLGQNQFDGLIPSKLWQCKELRLVSFEYNNFRGSIPKSLGNLTYLRKIYLYNN  72

Query  584  NISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIln  405
            N+ G +P  + ++S+LE+L L +N+L G IP ++ NL  ++L+ LS N  SG+  +   N
Sbjct  73   NLEGTIPDEIGDISQLEILGLMINNLNGVIPSKLFNLSMIRLIGLSSNPLSGALAIAHTN  132

Query  404  lsklenlslsvnsLFGELPLDL---------------------GNHLPKLQIFVMRSNKF  288
             S  ++  L++ +     P ++                     G    ++    +     
Sbjct  133  FSTDQSALLALKAHITSDPQNILTANWSSASNSNICNWIGVTCGARHQRVTALNLSDMGL  192

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALS  108
            +G IP  L   S L  L    N F+G +P+E   L +L+ ++ + N  TG IP   G+  
Sbjct  193  AGVIPPHLGNLSFLVVLYANNNFFNGPLPQELSRLRRLKAIYFQENNFTGTIPSWFGSFP  252

Query  107  SLLIVDLSNNKLYGTF  60
             L    LS N   G+ 
Sbjct  253  KLQTFILSGNGFSGSI  268


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 81/232 (35%), Positives = 114/232 (49%), Gaps = 2/232 (1%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
             ++L +  + G +  D+GNLS L+ LNL  N    + P  + +L+ L+ L+ + N   G+
Sbjct  609  TVDLTSSNVRGNVPVDIGNLSSLIELNLGNNQLSGAIPTSIQRLQNLQGLRLNDNVLRGH  668

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLS-KLEVLHLGVNSLEGSIPREIGNLFQL  465
            IP     L NL  L L  N ++G +P+ L  LS  L  L LG N L   IP  +  L  +
Sbjct  669  IPYELCQLNNLAELRLDGNQLTGSIPSCLVTLSVALRSLSLGSNLLTSKIPPSLWELKYI  728

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
              LNLS N   G    DI  L  + ++ LS N   G +P  LG  L  +  F + +NK  
Sbjct  729  LHLNLSSNSLVGPLSEDIGKLKHVVDMDLSNNHFSGNIPRSLGGLLNMIN-FSLANNKLE  787

Query  284  GEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
            G IPSS      L+ L L  NN SG +P+    L  L+ L L  N+L G  P
Sbjct  788  GPIPSSFETLLSLEFLDLSKNNLSGEIPKSLEALLYLKHLNLSFNKLQGEXP  839


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 127/246 (52%), Gaps = 29/246 (12%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            ++ L LF   + G L  ++  +LS +   +L +N      P +L Q + L+ +    N+F
Sbjct  356  LTTLTLFGNNMSGSLPDNICEHLSSIRRFSLGRNQLDGLIPSKLWQCKELREITLGSNNF  415

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
             G+IP   G L  L  + LG+NN++G +P  + +L +LE+L L  N+L G IP ++ N  
Sbjct  416  RGSIPKSLGNLTYLTKILLGDNNLTGTIPYEIVDLPQLEILTLHANNLSGVIPSKLFNKS  475

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQ-IFVMRSN  294
             ++ ++LS N  SGS                        LP ++G ++P L+ ++V ++N
Sbjct  476  TIREISLSINQLSGS------------------------LPANIGLNVPNLEFLYVAQNN  511

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT--GAIPREI  120
              +G +P +LS  S L+ L +  N+F+G +P    +L  LE L L SN LT   ++P+  
Sbjct  512  LVAGLLP-NLSNASKLRELDMNTNSFTGILPTTLCSLKSLEYLLLFSNNLTIDASVPQAA  570

Query  119  GALSSL  102
              LS L
Sbjct  571  STLSCL  576


 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 87/285 (31%), Positives = 138/285 (48%), Gaps = 33/285 (12%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS--GNIPSWFG  624
            LV  L P+L N S L  L+++ N+F    P  L  L+ L+ L    N+ +   ++P    
Sbjct  512  LVAGLLPNLSNASKLRELDMNTNSFTGILPTTLCSLKSLEYLLLFSNNLTIDASVPQAAS  571

Query  623  LL------QNLRFLYLGNNNISGFLPTSLFNLS-KLEVLHLGVNSLEGSIPREIGNLFQL  465
             L      +NL  LYLG+N ++  +P S  N+S  L  + L  +++ G++P +IGNL  L
Sbjct  572  TLSCLFNLRNLIGLYLGDNPLNTTIPASRGNISTSLLTVDLTSSNVRGNVPVDIGNLSSL  631

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL------------GNHLP-  324
              LNL +N  SG+ P  I  L  L+ L L+ N L G +P +L            GN L  
Sbjct  632  IELNLGNNQLSGAIPTSIQRLQNLQGLRLNDNVLRGHIPYELCQLNNLAELRLDGNQLTG  691

Query  323  -----------KLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTK  177
                        L+   + SN  + +IP SL +   +  L+L  N+  G +  + G L  
Sbjct  692  SIPSCLVTLSVALRSLSLGSNLLTSKIPPSLWELKYILHLNLSSNSLVGPLSEDIGKLKH  751

Query  176  LEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
            +  + L +N  +G IPR +G L +++   L+NNKL G    + +T
Sbjct  752  VVDMDLSNNHFSGNIPRSLGGLLNMINFSLANNKLEGPIPSSFET  796


 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 80/244 (33%), Positives = 116/244 (48%), Gaps = 3/244 (1%)
 Frame = -1

Query  767  NLSFLVSLNLSQNNFHNSFPRELSQLR-RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLG  591
            NL  L+ L L  N  + + P     +   L  +  + ++  GN+P   G L +L  L LG
Sbjct  578  NLRNLIGLYLGDNPLNTTIPASRGNISTSLLTVDLTSSNVRGNVPVDIGNLSSLIELNLG  637

Query  590  NNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP-LD  414
            NN +SG +PTS+  L  L+ L L  N L G IP E+  L  L  L L  N  +GS P   
Sbjct  638  NNQLSGAIPTSIQRLQNLQGLRLNDNVLRGHIPYELCQLNNLAELRLDGNQLTGSIPSCL  697

Query  413  IlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLS  234
            +     L +LSL  N L  ++P  L   L  +    + SN   G +   + K   +  + 
Sbjct  698  VTLSVALRSLSLGSNLLTSKIPPSLW-ELKYILHLNLSSNSLVGPLSEDIGKLKHVVDMD  756

Query  233  LPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQ  54
            L  N+FSG++PR  G L  +    L +N+L G IP     L SL  +DLS N L G   +
Sbjct  757  LSNNHFSGNIPRSLGGLLNMINFSLANNKLEGPIPSSFETLLSLEFLDLSKNNLSGEIPK  816

Query  53   NLDT  42
            +L+ 
Sbjct  817  SLEA  820


 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 61/104 (59%), Gaps = 0/104 (0%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G LP ++  HL  +++  +  N+F G IPS L +C  L+ +S  +NNF G +P+  GNLT
Sbjct  3    GSLPDNICEHLSSVRLINLGQNQFDGLIPSKLWQCKELRLVSFEYNNFRGSIPKSLGNLT  62

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             L K++L +N L G IP EIG +S L I+ L  N L G     L
Sbjct  63   YLRKIYLYNNNLEGTIPDEIGDISQLEILGLMINNLNGVIPSKL  106


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 68/151 (45%), Gaps = 26/151 (17%)
 Frame = -1

Query  509  LEGSIPREI-GNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGN  333
            + GS+P  I  +L  ++L+NL  N F G  P  +                          
Sbjct  1    MSGSLPDNICEHLSSVRLINLGQNQFDGLIPSKLW-------------------------  35

Query  332  HLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRS  153
               +L++     N F G IP SL   + L+ + L  NN  G +P E G++++LE L L  
Sbjct  36   QCKELRLVSFEYNNFRGSIPKSLGNLTYLRKIYLYNNNLEGTIPDEIGDISQLEILGLMI  95

Query  152  NQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            N L G IP ++  LS + ++ LS+N L G  
Sbjct  96   NNLNGVIPSKLFNLSMIRLIGLSSNPLSGAL  126


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 66/139 (47%), Gaps = 1/139 (1%)
 Frame = -1

Query  833  NRVSALNLFNMGLVGELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFN  657
            N ++ L L    L G +   L  LS  L SL+L  N   +  P  L +L+ +  L  S N
Sbjct  677  NNLAELRLDGNQLTGSIPSCLVTLSVALRSLSLGSNLLTSKIPPSLWELKYILHLNLSSN  736

Query  656  DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN  477
               G +    G L+++  + L NN+ SG +P SL  L  +    L  N LEG IP     
Sbjct  737  SLVGPLSEDIGKLKHVVDMDLSNNHFSGNIPRSLGGLLNMINFSLANNKLEGPIPSSFET  796

Query  476  LFQLKLLNLSDNHFSGSFP  420
            L  L+ L+LS N+ SG  P
Sbjct  797  LLSLEFLDLSKNNLSGEIP  815



>ref|XP_006362616.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Solanum tuberosum]
Length=1053

 Score =   245 bits (625),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 214/333 (64%), Gaps = 21/333 (6%)
 Frame = -1

Query  998  CLTINAHTNITTDKHALLSLKSKIS-FDPHSILADNWSVNSITP-CNWIGVTCNSRHNRV  825
            CL+I    NITTD+ ALL L+S+IS ++PHS+LA NWS +  TP C+WIGVTC+ RH R+
Sbjct  74   CLSI---VNITTDQTALLVLQSQISLYNPHSVLARNWSTS--TPVCSWIGVTCSLRHQRI  128

Query  824  SALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSG  645
            +ALNL +M L G + P LGNLSFL+SL++  NNFH + P EL+ LRRLK++    N+F+G
Sbjct  129  TALNLSSMNLKGMVPPQLGNLSFLISLDIRNNNFHGTLPEELAHLRRLKMINAMNNNFTG  188

Query  644  NIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQL  465
             IPS+FGLL NL  LYL  N  +G +P SLFN++KL+ L L  N L G IP+EI +L  L
Sbjct  189  AIPSFFGLLPNLHSLYLSFNQFAGNIPLSLFNITKLKYLRLRGNFLGGEIPQEISSLCCL  248

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
             L++L DN  +GS P  I N S L+ + L+ N L+G+LP ++ ++LP L++  + SN+F 
Sbjct  249  NLIDLQDNKLTGSIPPTIFNQSSLKQIGLTKNILYGKLPRNICDNLPNLEVLGLSSNRFD  308

Query  284  GEIPSSLSKCSLLQTLSLPFNNFSG-----HVPREFGNLTKLEKLFLRSNQLT-------  141
              IP +L  CS LQ LSL  N+FSG      +PRE G L +L+   L  N+L+       
Sbjct  309  DLIPPNLQNCSKLQILSLSVNDFSGTIPASEIPRELGYLQRLQLFGLYQNRLSLFNSSKP  368

Query  140  --GAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
                 P  +     L ++DLSNN L G+   +L
Sbjct  369  FQHFNPPNLDNCGLLTVLDLSNNILSGSIPDSL  401


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 137/286 (48%), Gaps = 34/286 (12%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNN--FHN-----SFPRELSQLRRLK---  678
            ++ L+L N  L G +   LGNL FLV L +  N   + N     +F   L++ R L+   
Sbjct  383  LTVLDLSNNILSGSIPDSLGNLEFLVVLQIGLNKLIYQNPSSQLTFLTSLTRCRNLRELV  442

Query  677  --------ILQCSFNDFS--------------GNIPSWFGLLQNLRFLYLGNNNISGFLP  564
                    IL  S  +FS              G IP   G L N+ ++ L  N+++GF+P
Sbjct  443  IARNPLNDILPVSIGNFSSSLQIFSAPGCKLRGIIPEEIGNLTNVLWISLFANDLTGFIP  502

Query  563  TSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenl  384
             ++  L KL+ + +  N + G+IP EI  L  L  L +  N  + S P  + NL  L  L
Sbjct  503  KTVRGLQKLQRILIQSNMISGTIPDEICYLQNLGDL-IPQNKLNSSLPETLWNLQDLLEL  561

Query  383  slsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHV  204
              + NS  G L   +GN L  +    +  N FSG IP+++     L TLSL  N   G +
Sbjct  562  DAASNSFSGVLSPQIGN-LKNVIDIDLSYNDFSGMIPTTMGSLQKLITLSLSDNRIDGPI  620

Query  203  PREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            P  FG +  LE L L  N LTG IP+ + AL  L  +++S NKL G
Sbjct  621  PESFGKMLSLEFLDLSYNNLTGGIPKSLEALEYLKYLNVSFNKLSG  666


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 81/243 (33%), Positives = 113/243 (47%), Gaps = 21/243 (9%)
 Frame = -1

Query  767  NLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPS--------------W  630
            NL  L  L LS N F +  P  L    +L+IL  S NDFSG IP+               
Sbjct  293  NLPNLEVLGLSSNRFDDLIPPNLQNCSKLQILSLSVNDFSGTIPASEIPRELGYLQRLQL  352

Query  629  FGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
            FGL QN   L+  +     F P +L N   L VL L  N L GSIP  +GNL  L +L +
Sbjct  353  FGLYQNRLSLFNSSKPFQHFNPPNLDNCGLLTVLDLSNNILSGSIPDSLGNLEFLVVLQI  412

Query  449  SDNHF-------SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
              N           +F   +     L  L ++ N L   LP+ +GN    LQIF     K
Sbjct  413  GLNKLIYQNPSSQLTFLTSLTRCRNLRELVIARNPLNDILPVSIGNFSSSLQIFSAPGCK  472

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
              G IP  +   + +  +SL  N+ +G +P+    L KL+++ ++SN ++G IP EI  L
Sbjct  473  LRGIIPEEIGNLTNVLWISLFANDLTGFIPKTVRGLQKLQRILIQSNMISGTIPDEICYL  532

Query  110  SSL  102
             +L
Sbjct  533  QNL  535


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 88/286 (31%), Positives = 129/286 (45%), Gaps = 32/286 (11%)
 Frame = -1

Query  779  PDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSW-------FGL  621
            P+L N   L  L+LS N    S P  L  L  L +LQ   N      PS           
Sbjct  375  PNLDNCGLLTVLDLSNNILSGSIPDSLGNLEFLVVLQIGLNKLIYQNPSSQLTFLTSLTR  434

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSK-LEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
             +NLR L +  N ++  LP S+ N S  L++       L G IP EIGNL  +  ++L  
Sbjct  435  CRNLRELVIARNPLNDILPVSIGNFSSSLQIFSAPGCKLRGIIPEEIGNLTNVLWISLFA  494

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLD------LGNHLPK-------------  321
            N  +G  P  +  L KL+ + +  N + G +P +      LG+ +P+             
Sbjct  495  NDLTGFIPKTVRGLQKLQRILIQSNMISGTIPDEICYLQNLGDLIPQNKLNSSLPETLWN  554

Query  320  LQIFV---MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN  150
            LQ  +     SN FSG +   +     +  + L +N+FSG +P   G+L KL  L L  N
Sbjct  555  LQDLLELDAASNSFSGVLSPQIGNLKNVIDIDLSYNDFSGMIPTTMGSLQKLITLSLSDN  614

Query  149  QLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDTP*LK*LSYYN  12
            ++ G IP   G + SL  +DLS N L G   ++L+   L+ L Y N
Sbjct  615  RIDGPIPESFGKMLSLEFLDLSYNNLTGGIPKSLEA--LEYLKYLN  658


 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 109/235 (46%), Gaps = 29/235 (12%)
 Frame = -1

Query  824  SALNLFNM---GLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND  654
            S+L +F+     L G +  ++GNL+ ++ ++L  N+     P+ +  L++L+ +    N 
Sbjct  461  SSLQIFSAPGCKLRGIIPEEIGNLTNVLWISLFANDLTGFIPKTVRGLQKLQRILIQSNM  520

Query  653  FSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
             SG IP     LQNL  L +  N ++  LP +L+NL  L  L    NS  G +  +IGNL
Sbjct  521  ISGTIPDEICYLQNLGDL-IPQNKLNSSLPETLWNLQDLLELDAASNSFSGVLSPQIGNL  579

Query  473  FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSN  294
              +  ++LS N FSG  P  +                           L KL    +  N
Sbjct  580  KNVIDIDLSYNDFSGMIPTTM-------------------------GSLQKLITLSLSDN  614

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
            +  G IP S  K   L+ L L +NN +G +P+    L  L+ L +  N+L+G IP
Sbjct  615  RIDGPIPESFGKMLSLEFLDLSYNNLTGGIPKSLEALEYLKYLNVSFNKLSGEIP  669


 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 66/123 (54%), Gaps = 0/123 (0%)
 Frame = -1

Query  785  LTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLR  606
            L   L NL  L+ L+ + N+F      ++  L+ +  +  S+NDFSG IP+  G LQ L 
Sbjct  548  LPETLWNLQDLLELDAASNSFSGVLSPQIGNLKNVIDIDLSYNDFSGMIPTTMGSLQKLI  607

Query  605  FLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGS  426
             L L +N I G +P S   +  LE L L  N+L G IP+ +  L  LK LN+S N  SG 
Sbjct  608  TLSLSDNRIDGPIPESFGKMLSLEFLDLSYNNLTGGIPKSLEALEYLKYLNVSFNKLSGE  667

Query  425  FPL  417
             P+
Sbjct  668  IPI  670


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 74/132 (56%), Gaps = 0/132 (0%)
 Frame = -1

Query  740  LSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPT  561
            + QN  ++S P  L  L+ L  L  + N FSG +    G L+N+  + L  N+ SG +PT
Sbjct  539  IPQNKLNSSLPETLWNLQDLLELDAASNSFSGVLSPQIGNLKNVIDIDLSYNDFSGMIPT  598

Query  560  SLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenls  381
            ++ +L KL  L L  N ++G IP   G +  L+ L+LS N+ +G  P  +  L  L+ L+
Sbjct  599  TMGSLQKLITLSLSDNRIDGPIPESFGKMLSLEFLDLSYNNLTGGIPKSLEALEYLKYLN  658

Query  380  lsvnsLFGELPL  345
            +S N L GE+P+
Sbjct  659  VSFNKLSGEIPI  670



>ref|XP_009606161.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Nicotiana 
tomentosiformis]
Length=1170

 Score =   246 bits (627),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 208/343 (61%), Gaps = 29/343 (8%)
 Frame = -1

Query  1022  FFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCN  843
              FFH +  CL +N    I+TD+ +LL+LK+ I+ DP+ IL+ NWS +S + CNWIG+ C 
Sbjct  36    LFFHVIATCLAMN----ISTDQTSLLALKAHITSDPYRILSTNWS-SSTSVCNWIGIACG  90

Query  842   SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCS  663
             SRH RV+ LN+ +MG  G + P LGNLSFLVSL+LS NNF    P ELS+L++L+ +  S
Sbjct  91    SRHQRVTVLNVSDMGFSGTIPPQLGNLSFLVSLDLSYNNFQGELPPELSRLQKLRAINLS  150

Query  662   FNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREI  483
             FN+ +G IP + G LQ+L    + NN+ SGF+P+S+ N+  L  L+L  N LEG+IP  I
Sbjct  151   FNNLTGEIPKFLGDLQDLEMFAVENNSFSGFIPSSISNMKNLGFLNLRYNDLEGNIPIGI  210

Query  482   GNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVM  303
               L  LK L++  N  +GS  L I N+S LE L L    L G+LP DL   LP+LQ   +
Sbjct  211   ATLQSLKWLSVGFNKLNGSNVLSIFNISTLEYLDLRNAGLTGDLPSDLCRRLPRLQRLGL  270

Query  302   RSNKFSGEIPSSLSKCS------------------------LLQTLSLPFNNFSGHVPRE  195
               N  SGEIP S+S+CS                        LLQ L+L FN   G +P E
Sbjct  271   NFNMLSGEIPRSISECSELQVLLLLQNNLIGAIPRELGKLQLLQILALGFNKLQGTIPDE  330

Query  194   FGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
              G+L  L++L +  N+LTG+IP  I  +SSL ++ + +NKL G
Sbjct  331   IGHLYNLKQLGMEKNKLTGSIPFTIFNISSLQVLSMWDNKLEG  373


 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 97/258 (38%), Positives = 130/258 (50%), Gaps = 26/258 (10%)
 Frame = -1

Query  818  LNLFNMG---LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            LN+ ++G   L G L  ++GNL  L+ L L  N F  S P  +  +  L  +  + N  S
Sbjct  385  LNVLDLGVNNLTGVLPDEIGNLQQLLKLKLDFNTFSGSIPVSIFNISTLVSISLTQNHIS  444

Query  647  GNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
            GN+PS  G  L NL  ++LG NNI+GFLP+S+ NLSKL +L L  N L GS+P  +GNL 
Sbjct  445  GNLPSTIGHGLPNLERIFLGANNINGFLPSSISNLSKLTILELSANELTGSVPDSLGNLR  504

Query  470  QLKLLNLSDNHF-SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSN  294
             +++LNL  N F S S PL  +                   PL    HL +L   ++  N
Sbjct  505  LIEILNLQGNSFTSESSPLSFIT------------------PLANCKHLREL---ILSLN  543

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGA  114
              +  +P S+   S LQ       N  GHVP E GNL  L  L L  N LTG +PR I +
Sbjct  544  PLNAMLPKSIGNLSSLQIFEADGCNIRGHVPIEIGNLRNLSYLKLEDNDLTGIVPRTISS  603

Query  113  LSSLLIVDLSNNKLYGTF  60
            L  L    L  N++ G F
Sbjct  604  LKKLQQFSLGANRISGPF  621


 Score =   120 bits (300),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 143/266 (54%), Gaps = 28/266 (11%)
 Frame = -1

Query  839  RHNRVSALNL-FNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCS  663
            R  R+  L L FNM L GE+   +   S L  L L QNN   + PREL +L+ L+IL   
Sbjct  261  RLPRLQRLGLNFNM-LSGEIPRSISECSELQVLLLLQNNLIGAIPRELGKLQLLQILALG  319

Query  662  FNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREI  483
            FN   G IP   G L NL+ L +  N ++G +P ++FN+S L+VL +  N LEG +PRE+
Sbjct  320  FNKLQGTIPDEIGHLYNLKQLGMEKNKLTGSIPFTIFNISSLQVLSMWDNKLEGPLPREV  379

Query  482  GNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVM  303
            GNL  L +L+L  N+ +G                         LP ++GN   +L    +
Sbjct  380  GNLNMLNVLDLGVNNLTGV------------------------LPDEIGNLQ-QLLKLKL  414

Query  302  RSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGN-LTKLEKLFLRSNQLTGAIPR  126
              N FSG IP S+   S L ++SL  N+ SG++P   G+ L  LE++FL +N + G +P 
Sbjct  415  DFNTFSGSIPVSIFNISTLVSISLTQNHISGNLPSTIGHGLPNLERIFLGANNINGFLPS  474

Query  125  EIGALSSLLIVDLSNNKLYGTFIQNL  48
             I  LS L I++LS N+L G+   +L
Sbjct  475  SISNLSKLTILELSANELTGSVPDSL  500


 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 94/270 (35%), Positives = 137/270 (51%), Gaps = 3/270 (1%)
 Frame = -1

Query  875  TPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELS  696
            +P ++I    N +H R   L+L  +  +  L   +GNLS L        N     P E+ 
Sbjct  521  SPLSFITPLANCKHLRELILSLNPLNAM--LPKSIGNLSSLQIFEADGCNIRGHVPIEIG  578

Query  695  QLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGV  516
             LR L  L+   ND +G +P     L+ L+   LG N ISG  P  L  LS L +L+L  
Sbjct  579  NLRNLSYLKLEDNDLTGIVPRTISSLKKLQQFSLGANRISGPFPNGLCELSNLGLLNLSQ  638

Query  515  NSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
            N ++GSIPR +G++  L+ + L  N+F+   P  + NL  +  L+LS N   G LPL++G
Sbjct  639  NQMQGSIPRCLGDVTSLREVYLDSNNFTAGIPSSLWNLKDILKLNLSSNIFNGSLPLEVG  698

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
            N L    I  +  N+ SG IP++L     L  LS   N   G +P   G L  LE L L 
Sbjct  699  N-LKAAIILDLSWNQISGNIPNTLGSLQKLTQLSFAHNRIEGSIPDTLGELINLEALDLS  757

Query  155  SNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             N ++G IP+ + AL  L   ++S N+L+G
Sbjct  758  YNNISGVIPKSLEALKQLNFFNVSFNRLHG  787


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 96/304 (32%), Positives = 147/304 (48%), Gaps = 36/304 (12%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN-----SFPRELSQLRRLKILQC  666
            +++ L L    L G +   LGNL  +  LNL  N+F +     SF   L+  + L+ L  
Sbjct  481  KLTILELSANELTGSVPDSLGNLRLIEILNLQGNSFTSESSPLSFITPLANCKHLRELIL  540

Query  665  SFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            S N  +  +P   G L +L+       NI G +P  + NL  L  L L  N L G +PR 
Sbjct  541  SLNPLNAMLPKSIGNLSSLQIFEADGCNIRGHVPIEIGNLRNLSYLKLEDNDLTGIVPRT  600

Query  485  IGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
            I +L +L+  +L  N  SG FP  +  LS L  L+LS N + G +P  LG+ +  L+   
Sbjct  601  ISSLKKLQQFSLGANRISGPFPNGLCELSNLGLLNLSQNQMQGSIPRCLGD-VTSLREVY  659

Query  305  MRSNKFSGEIPSSLS--------------------------KCSLLQTLSLPFNNFSGHV  204
            + SN F+  IPSSL                           K +++  L L +N  SG++
Sbjct  660  LDSNNFTAGIPSSLWNLKDILKLNLSSNIFNGSLPLEVGNLKAAII--LDLSWNQISGNI  717

Query  203  PREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDTP*LK*L  24
            P   G+L KL +L    N++ G+IP  +G L +L  +DLS N + G   ++L+   LK L
Sbjct  718  PNTLGSLQKLTQLSFAHNRIEGSIPDTLGELINLEALDLSYNNISGVIPKSLEA--LKQL  775

Query  23   SYYN  12
            +++N
Sbjct  776  NFFN  779


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 72/233 (31%), Positives = 107/233 (46%), Gaps = 25/233 (11%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +S L L +  L G +   + +L  L   +L  N     FP  L +L  L +L  S N   
Sbjct  583  LSYLKLEDNDLTGIVPRTISSLKKLQQFSLGANRISGPFPNGLCELSNLGLLNLSQNQMQ  642

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G+IP   G + +LR +YL +NN +  +P+SL+NL  +  L+L  N   GS+P E+GNL  
Sbjct  643  GSIPRCLGDVTSLREVYLDSNNFTAGIPSSLWNLKDILKLNLSSNIFNGSLPLEVGNLKA  702

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
              +L+LS N  SG+ P  +                           L KL       N+ 
Sbjct  703  AIILDLSWNQISGNIPNTL-------------------------GSLQKLTQLSFAHNRI  737

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             G IP +L +   L+ L L +NN SG +P+    L +L    +  N+L G IP
Sbjct  738  EGSIPDTLGELINLEALDLSYNNISGVIPKSLEALKQLNFFNVSFNRLHGEIP  790


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 100/206 (49%), Gaps = 30/206 (15%)
 Frame = -1

Query  650  SGNIPSWFGLL-----QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            S ++ +W G+      Q +  L + +   SG +P  L NLS L  L L  N+ +G +P E
Sbjct  78   STSVCNWIGIACGSRHQRVTVLNVSDMGFSGTIPPQLGNLSFLVSLDLSYNNFQGELPPE  137

Query  485  IGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
            +  L +L+ +NLS N+ +G                        E+P  LG+ L  L++F 
Sbjct  138  LSRLQKLRAINLSFNNLTG------------------------EIPKFLGD-LQDLEMFA  172

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
            + +N FSG IPSS+S    L  L+L +N+  G++P     L  L+ L +  N+L G+   
Sbjct  173  VENNSFSGFIPSSISNMKNLGFLNLRYNDLEGNIPIGIATLQSLKWLSVGFNKLNGSNVL  232

Query  125  EIGALSSLLIVDLSNNKLYGTFIQNL  48
             I  +S+L  +DL N  L G    +L
Sbjct  233  SIFNISTLEYLDLRNAGLTGDLPSDL  258



>ref|XP_009595556.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Nicotiana tomentosiformis]
 ref|XP_009595557.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Nicotiana tomentosiformis]
Length=419

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 148/355 (42%), Positives = 199/355 (56%), Gaps = 51/355 (14%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLF  807
             HTNITTD+ ALLSLKS+I  DP   L ++WS    TP C+W+GVTC  RH+RV +LNL 
Sbjct  25   THTNITTDQLALLSLKSQIISDPSHFLDESWS--RATPLCHWVGVTCGFRHHRVKSLNLS  82

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
            NM L G +  D GNL+FLVSL+L  NNF+   P+E+++L RLK L  SFN+F G +P WF
Sbjct  83   NMALTGRIPQDFGNLTFLVSLDLGSNNFYGKLPQEMTRLCRLKFLDLSFNNFGGEVPVWF  142

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
            G L  L+FL L NN   G +P+S  N+S LE L L  NS+EG +P+EIGNL  L+LL  +
Sbjct  143  GFLHQLQFLSLWNNRFIGSIPSSFANISTLESLDLRSNSIEGQLPKEIGNLKNLRLLGFT  202

Query  446  DNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGN----------------------  333
             N  +GS P+ + N ++LE L LS N L G +P  + N                      
Sbjct  203  KNKLTGSIPVSLSNATRLETLRLSRNFLQGNIPEGIDNLHNLNLLSIENNRLTGSIPMSV  262

Query  332  --------------------------HLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSL  231
                                       LP L+   + +NK  G +P+SLS CS LQ LSL
Sbjct  263  ANISKLEVIAFTNNSLSGSLPNGLCNCLPLLKELYLSTNKLHGHMPTSLSNCSELQILSL  322

Query  230  PFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
              N F G +  E G+L  L+ L++  N  TG IP+ IG L +L+ + +  N++ G
Sbjct  323  SENEFDGPIHSEIGSLRNLQILYIGGNHFTGIIPQRIGNLVNLVKLSIEENQIIG  377


 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 96/201 (48%), Gaps = 30/201 (15%)
 Frame = -1

Query  632  WFGLLQNLRF-----LYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            W G+    R      L L N  ++G +P    NL+ L  L LG N+  G +P+E+  L +
Sbjct  64   WVGVTCGFRHHRVKSLNLSNMALTGRIPQDFGNLTFLVSLDLGSNNFYGKLPQEMTRLCR  123

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
            LK L+LS N+F G  P+                  FG         L +LQ   + +N+F
Sbjct  124  LKFLDLSFNNFGGEVPV-----------------WFG--------FLHQLQFLSLWNNRF  158

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALS  108
             G IPSS +  S L++L L  N+  G +P+E GNL  L  L    N+LTG+IP  +   +
Sbjct  159  IGSIPSSFANISTLESLDLRSNSIEGQLPKEIGNLKNLRLLGFTKNKLTGSIPVSLSNAT  218

Query  107  SLLIVDLSNNKLYGTFIQNLD  45
             L  + LS N L G   + +D
Sbjct  219  RLETLRLSRNFLQGNIPEGID  239



>gb|KEH29237.1| LRR receptor-like kinase [Medicago truncatula]
Length=1038

 Score =   244 bits (624),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 145/311 (47%), Positives = 196/311 (63%), Gaps = 3/311 (1%)
 Frame = -1

Query  1004  MLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRV  825
             M CL  N+  NITTD+ ALL+ KS I+ DP+ +L +NWS +S + CNW+GV C+ RH RV
Sbjct  1     MACLASNSE-NITTDQSALLAFKSLITSDPYDMLTNNWSTSS-SVCNWVGVVCDERHGRV  58

Query  824   SALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSG  645
              +L L NM L G ++P+LGNLSFLV+L+L  N+F    P+EL +LRRLK L  S+N+F G
Sbjct  59    YSLILQNMRLRGNISPNLGNLSFLVTLDLKNNSFGGQLPKELFRLRRLKFLHISYNEFEG  118

Query  644   NIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQL  465
              IP   G L  L++LYLG NN SG +P S+ NL +L+ L    N L G IP+ I N+  L
Sbjct  119   GIPVVLGDLSQLQYLYLGVNNFSGIIPQSIGNLQRLKELDTSYNRLSGPIPQSISNMSSL  178

Query  464   KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
             +LLNL  N+FSG  P  +  ++ L  + L+ N+L G LP D  N LP+L+   +  N+F 
Sbjct  179   ELLNLYSNYFSGKIP-SLNKMTSLRVVELANNNLNGRLPNDFFNQLPQLEDLTLTDNQFE  237

Query  284   GEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSS  105
             G IP S+  C+ L  L L  N F+G +  E G L KLE L L +N  +GAIP +I  +SS
Sbjct  238   GSIPRSIGNCTSLINLDLQSNFFTGSILEEIGYLDKLELLVLHNNSFSGAIPSKIFNMSS  297

Query  104   LLIVDLSNNKL  72
             L  + L  N L
Sbjct  298   LTGLSLGINHL  308


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 118/245 (48%), Gaps = 25/245 (10%)
 Frame = -1

Query  800  GLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            G+ G +  ++GN+S L+  +LS NN     P     L++L+IL  S N   G+    F  
Sbjct  431  GIDGNIPLEVGNMSNLLRFSLSVNNITGPIPSTFKGLQKLQILNLSSNGLQGSFIEEFCE  490

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            +++L  LYL  N +SG LPT + N++ L  +H+G N+L   IP  + +L  +  +N S N
Sbjct  491  MKSLGDLYLEKNKLSGVLPTCMGNMTSLIRIHVGSNNLNSKIPLSLWSLRDILEINFSSN  550

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              SG+ P  I                          +L  + +  +  N  S  IP++++
Sbjct  551  SLSGNLPPQI-------------------------ENLRAIILLDLSRNHISSNIPTTIN  585

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
                LQ LSL  N  +G +P+  G +  L  L L  N LT  IP+ + +L  L  ++LS 
Sbjct  586  SLITLQILSLAENELNGSIPKLLGQMAGLISLDLSQNMLTSVIPKSLESLLYLENINLSY  645

Query  80   NKLYG  66
            N+L G
Sbjct  646  NRLEG  650


 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 138/291 (47%), Gaps = 30/291 (10%)
 Frame = -1

Query  839  RHNRVSALNLFNMGLVGELTPDLGN-LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCS  663
            +   +  + L N  L G L  D  N L  L  L L+ N F  S PR +     L  L   
Sbjct  197  KMTSLRVVELANNNLNGRLPNDFFNQLPQLEDLTLTDNQFEGSIPRSIGNCTSLINLDLQ  256

Query  662  FNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREI  483
             N F+G+I    G L  L  L L NN+ SG +P+ +FN+S L  L LG+N L   IP  +
Sbjct  257  SNFFTGSILEEIGYLDKLELLVLHNNSFSGAIPSKIFNMSSLTGLSLGINHLSRIIPSNM  316

Query  482  G-NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
            G +L  L+ L+L  N+F+G+ P  I N S L    L  N+  G LP  +GN L  L+IF 
Sbjct  317  GYSLPSLQYLHLYGNNFTGNIPNSIFNSSNLIEFRLGGNAFSGTLPNFVGN-LRFLKIFD  375

Query  305  MRSNKFSGEIP----SSLSKCSLLQTLSLPFNN-----------------------FSGH  207
               N F+ E      +SLS C  L+ L L  N+                         G+
Sbjct  376  TFHNNFTIEDSHQFFTSLSNCRNLKFLDLSRNHILPNLPKSIGNLTAEFFWAASCGIDGN  435

Query  206  VPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQ  54
            +P E GN++ L +  L  N +TG IP     L  L I++LS+N L G+FI+
Sbjct  436  IPLEVGNMSNLLRFSLSVNNITGPIPSTFKGLQKLQILNLSSNGLQGSFIE  486


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 85/277 (31%), Positives = 125/277 (45%), Gaps = 28/277 (10%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNF----HNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
            G L   +GNL FL   +   NNF     + F   LS  R LK L  S N    N+P   G
Sbjct  359  GTLPNFVGNLRFLKIFDTFHNNFTIEDSHQFFTSLSNCRNLKFLDLSRNHILPNLPKSIG  418

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
             L    F +  +  I G +P  + N+S L    L VN++ G IP     L +L++LNLS 
Sbjct  419  NLT-AEFFWAASCGIDGNIPLEVGNMSNLLRFSLSVNNITGPIPSTFKGLQKLQILNLSS  477

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV--------------  306
            N   GSF  +   +  L +L L  N L G LP  +GN    ++I V              
Sbjct  478  NGLQGSFIEEFCEMKSLGDLYLEKNKLSGVLPTCMGNMTSLIRIHVGSNNLNSKIPLSLW  537

Query  305  ---------MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRS  153
                       SN  SG +P  +     +  L L  N+ S ++P    +L  L+ L L  
Sbjct  538  SLRDILEINFSSNSLSGNLPPQIENLRAIILLDLSRNHISSNIPTTINSLITLQILSLAE  597

Query  152  NQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
            N+L G+IP+ +G ++ L+ +DLS N L     ++L++
Sbjct  598  NELNGSIPKLLGQMAGLISLDLSQNMLTSVIPKSLES  634


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 72/148 (49%), Gaps = 25/148 (17%)
 Frame = -1

Query  509  LEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNH  330
            L G+I   +GNL  L  L+L +N F G  P ++                           
Sbjct  68   LRGNISPNLGNLSFLVTLDLKNNSFGGQLPKELF-------------------------R  102

Query  329  LPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN  150
            L +L+   +  N+F G IP  L   S LQ L L  NNFSG +P+  GNL +L++L    N
Sbjct  103  LRRLKFLHISYNEFEGGIPVVLGDLSQLQYLYLGVNNFSGIIPQSIGNLQRLKELDTSYN  162

Query  149  QLTGAIPREIGALSSLLIVDLSNNKLYG  66
            +L+G IP+ I  +SSL +++L +N   G
Sbjct  163  RLSGPIPQSISNMSSLELLNLYSNYFSG  190


 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 59/104 (57%), Gaps = 1/104 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +  +LGN L  L    +++N F G++P  L +   L+ L + +N F G +P   G+L+
Sbjct  70   GNISPNLGN-LSFLVTLDLKNNSFGGQLPKELFRLRRLKFLHISYNEFEGGIPVVLGDLS  128

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            +L+ L+L  N  +G IP+ IG L  L  +D S N+L G   Q++
Sbjct  129  QLQYLYLGVNNFSGIIPQSIGNLQRLKELDTSYNRLSGPIPQSI  172


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 60/118 (51%), Gaps = 0/118 (0%)
 Frame = -1

Query  773  LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            L +L  ++ +N S N+   + P ++  LR + +L  S N  S NIP+    L  L+ L L
Sbjct  536  LWSLRDILEINFSSNSLSGNLPPQIENLRAIILLDLSRNHISSNIPTTINSLITLQILSL  595

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
              N ++G +P  L  ++ L  L L  N L   IP+ + +L  L+ +NLS N   G  P
Sbjct  596  AENELNGSIPKLLGQMAGLISLDLSQNMLTSVIPKSLESLLYLENINLSYNRLEGEIP  653



>ref|XP_008383875.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Malus domestica]
Length=910

 Score =   244 bits (622),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 193/315 (61%), Gaps = 6/315 (2%)
 Frame = -1

Query  992  TINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALN  813
             + A TNI+TD+ AL +LK+ I+ DP +IL  NWS +    CNW+GVTC  R+ RV+ALN
Sbjct  29   AVAAQTNISTDESALRALKAHITSDPENILTTNWSTSDSNICNWVGVTCGVRNLRVTALN  88

Query  812  LFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPS  633
            L  MGL G + P LGNLSFLV L    N+F  + P ELS LRRLK++  SF +F+G IPS
Sbjct  89   LSYMGLTGTIPPHLGNLSFLVQLEFRNNSFGGTLPSELSHLRRLKLISFSFXNFAGXIPS  148

Query  632  WFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLN  453
            WFG L  L+   L  N  SG +P  +FNLS L+VL L  N L GSIP+E+ N  Q++ L 
Sbjct  149  WFGSLSELQTFDLYGNQFSGSIPNDIFNLSALQVLDLRNNQLSGSIPKEVENKDQVEKLY  208

Query  452  LSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIP  273
            +  N   G  PL + N+S L+ L+LSVN + G +P +L  HLP +QI  +  N F G +P
Sbjct  209  VQFNALKGPLPLSVFNMSSLKILALSVNKMTGRIPDNLCQHLPSIQILSLAGNNFDGPLP  268

Query  272  SSLSKCSLLQTLSLP------FNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
            S L +C  L TL L       F N  G  P + GN + L  L + SNQL+G+IP  +G L
Sbjct  269  SKLWQCKELLTLLLSNNHLTGFCNLRGSFPNDIGNFSGLISLTMGSNQLSGSIPTSVGRL  328

Query  110  SSLLIVDLSNNKLYG  66
             +L  + L +NKL G
Sbjct  329  RNLQGLSLHDNKLQG  343


 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 92/252 (37%), Positives = 131/252 (52%), Gaps = 14/252 (6%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQN------NFHNSFPRELSQLRRLKILQCSFNDFSGNIPSW  630
            G L   L     L++L LS N      N   SFP ++     L  L    N  SG+IP+ 
Sbjct  265  GPLPSKLWQCKELLTLLLSNNHLTGFCNLRGSFPNDIGNFSGLISLTMGSNQLSGSIPTS  324

Query  629  FGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL-FQLKLLN  453
             G L+NL+ L L +N + G++P  L  L  L  L++  N L GS+P  +GNL  + + ++
Sbjct  325  VGRLRNLQGLSLHDNKLQGYIPDELCQLDNLVELNISGNQLSGSVPSCLGNLTAKFRKIS  384

Query  452  LSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV---MRSNKFSG  282
            L  N  + + P  +  L+ +  L LS NSL G L  D+G    KL++     + +N   G
Sbjct  385  LESNLLTSTIPSTLWKLTYILILDLSSNSLVGPLSEDVG----KLKVVTEVNLSNNHLYG  440

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
             IPSS+S    L +LSL +NN  G +P  FGNL  LE L L  N L+G IP+ + AL  L
Sbjct  441  AIPSSMSGLQDLVSLSLEYNNLEGQIPSSFGNLLSLELLDLSKNNLSGVIPKSLEALIHL  500

Query  101  LIVDLSNNKLYG  66
              ++LS N L G
Sbjct  501  KYLNLSFNTLQG  512


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 80/251 (32%), Positives = 121/251 (48%), Gaps = 39/251 (16%)
 Frame = -1

Query  758  FLVSLNLSQNNFHNSFPRELSQLRRLK---------ILQCSFNDFSGNIPSWFGL---LQ  615
            ++  L +       +   + S LR LK         IL  +++    NI +W G+   ++
Sbjct  21   YMPKLTIGAVAAQTNISTDESALRALKAHITSDPENILTTNWSTSDSNICNWVGVTCGVR  80

Query  614  NLRF--LYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
            NLR   L L    ++G +P  L NLS L  L    NS  G++P E+ +L +LKL++ S  
Sbjct  81   NLRVTALNLSYMGLTGTIPPHLGNLSFLVQLEFRNNSFGGTLPSELSHLRRLKLISFSFX  140

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
            +F+G  P                 S FG L         +LQ F +  N+FSG IP+ + 
Sbjct  141  NFAGXIP-----------------SWFGSLS--------ELQTFDLYGNQFSGSIPNDIF  175

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
              S LQ L L  N  SG +P+E  N  ++EKL+++ N L G +P  +  +SSL I+ LS 
Sbjct  176  NLSALQVLDLRNNQLSGSIPKEVENKDQVEKLYVQFNALKGPLPLSVFNMSSLKILALSV  235

Query  80   NKLYGTFIQNL  48
            NK+ G    NL
Sbjct  236  NKMTGRIPDNL  246


 Score = 85.9 bits (211),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 107/224 (48%), Gaps = 2/224 (1%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G    D+GN S L+SL +  N    S P  + +LR L+ L    N   G IP     L
Sbjct  293  LRGSFPNDIGNFSGLISLTMGSNQLSGSIPTSVGRLRNLQGLSLHDNKLQGYIPDELCQL  352

Query  617  QNLRFLYLGNNNISGFLPTSLFNL-SKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
             NL  L +  N +SG +P+ L NL +K   + L  N L  +IP  +  L  + +L+LS N
Sbjct  353  DNLVELNISGNQLSGSVPSCLGNLTAKFRKISLESNLLTSTIPSTLWKLTYILILDLSSN  412

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
               G    D+  L  +  ++LS N L+G +P  + + L  L    +  N   G+IPSS  
Sbjct  413  SLVGPLSEDVGKLKVVTEVNLSNNHLYGAIPSSM-SGLQDLVSLSLEYNNLEGQIPSSFG  471

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
                L+ L L  NN SG +P+    L  L+ L L  N L G IP
Sbjct  472  NLLSLELLDLSKNNLSGVIPKSLEALIHLKYLNLSFNTLQGEIP  515


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P  LGN L  L     R+N F G +PS LS    L+ +S  F NF+G +P  FG+L+
Sbjct  96   GTIPPHLGN-LSFLVQLEFRNNSFGGTLPSELSHLRRLKLISFSFXNFAGXIPSWFGSLS  154

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLD  45
            +L+   L  NQ +G+IP +I  LS+L ++DL NN+L G+  + ++
Sbjct  155  ELQTFDLYGNQFSGSIPNDIFNLSALQVLDLRNNQLSGSIPKEVE  199


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 6/134 (4%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            L+L +  LVG L+ D+G L  +  +NLS N+ + + P  +S L+ L  L   +N+  G I
Sbjct  407  LDLSSNSLVGPLSEDVGKLKVVTEVNLSNNHLYGAIPSSMSGLQDLVSLSLEYNNLEGQI  466

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKL  459
            PS FG L +L  L L  NN+SG +P SL  L  L+ L+L  N+L+G IP   G  FQ   
Sbjct  467  PSSFGNLLSLELLDLSKNNLSGVIPKSLEALIHLKYLNLSFNTLQGEIP--TGGPFQ---  521

Query  458  LNLSDNHFSGSFPL  417
             NLS   F  + PL
Sbjct  522  -NLSAQSFVPNGPL  534


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 70/134 (52%), Gaps = 1/134 (1%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            LN+    L G +   LGNL+     ++L  N   ++ P  L +L  + IL  S N   G 
Sbjct  358  LNISGNQLSGSVPSCLGNLTAKFRKISLESNLLTSTIPSTLWKLTYILILDLSSNSLVGP  417

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            +    G L+ +  + L NN++ G +P+S+  L  L  L L  N+LEG IP   GNL  L+
Sbjct  418  LSEDVGKLKVVTEVNLSNNHLYGAIPSSMSGLQDLVSLSLEYNNLEGQIPSSFGNLLSLE  477

Query  461  LLNLSDNHFSGSFP  420
            LL+LS N+ SG  P
Sbjct  478  LLDLSKNNLSGVIP  491



>ref|XP_007021887.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY13412.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
Length=1136

 Score =   245 bits (625),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 204/320 (64%), Gaps = 2/320 (1%)
 Frame = -1

Query  1025  IFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTC  846
             +  FH+ +  L+  +  NITTD+ ALL+LKS ++FDP ++L  NWS  + + CNWIGVTC
Sbjct  13    VLLFHNFVTSLSAQS-PNITTDQLALLALKSHVTFDPQNLLETNWST-ATSVCNWIGVTC  70

Query  845   NSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQC  666
              +RH RV+AL+L  MGL+G + P LGNLSFL  LN+  N+F  S P +L+ L RL  +  
Sbjct  71    GTRHLRVTALDLSGMGLIGTIPPHLGNLSFLSRLNMGNNSFPGSLPNQLANLHRLNFIDF  130

Query  665   SFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
             + N+ SG IPSWFG    L+ LYL +NN +G +P+SL  L KLE L L  N + GSIP  
Sbjct  131   NNNNISGEIPSWFGSFTQLQDLYLYDNNFTGVIPSSLCFLPKLERLVLQNNHISGSIPPS  190

Query  485   IGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
             I NL  L++L+LS+N  S S P   LN S L+ + LSVN L G LP DL N  P LQ+  
Sbjct  191   IFNLSSLQVLDLSNNKLSDSIPSIPLNTSSLQLIDLSVNLLSGNLPSDLCNRFPNLQVLS  250

Query  305   MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
             +  N  +G+IP+SL KC  L  L+L +N+F G +P E GNLT L+KL L    L G IP 
Sbjct  251   LGGNLLTGKIPTSLFKCKELMELTLSYNHFDGSLPLEIGNLTMLKKLLLEEINLKGQIPW  310

Query  125   EIGALSSLLIVDLSNNKLYG  66
             +IG+L  L  +D S N L G
Sbjct  311   QIGSLLKLESLDCSKNNLEG  330


 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 100/287 (35%), Positives = 142/287 (49%), Gaps = 27/287 (9%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            ++  L L N  + G + P + NLS L  L+LS N   +S P        L+++  S N  
Sbjct  172  KLERLVLQNNHISGSIPPSIFNLSSLQVLDLSNNKLSDSIPSIPLNTSSLQLIDLSVNLL  231

Query  650  SGNIPSWF-GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
            SGN+PS       NL+ L LG N ++G +PTSLF   +L  L L  N  +GS+P EIGNL
Sbjct  232  SGNLPSDLCNRFPNLQVLSLGGNLLTGKIPTSLFKCKELMELTLSYNHFDGSLPLEIGNL  291

Query  473  FQLKLL------------------------NLSDNHFSGSFPLDIlnlsklenlslsvns  366
              LK L                        + S N+  G  P  I NL+ L+ LS   +S
Sbjct  292  TMLKKLLLEEINLKGQIPWQIGSLLKLESLDCSKNNLEGPIPSSIGNLTLLKRLSFRSSS  351

Query  365  LFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG-  189
            + G LP  +GN L  L++ ++ +N  +G IP S+   S  +++ L FN FSG +P   G 
Sbjct  352  MSGTLPFQIGN-LQNLEVLILENNSLTGFIPPSIFNISTAKSIGLDFNRFSGQLPSTTGL  410

Query  188  NLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             L KL+ L+L  N+L+G IP  I   S L+ + L NN   G     L
Sbjct  411  GLPKLQSLYLSKNELSGPIPISISNASQLISLQLLNNSFSGVIPDTL  457


 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 86/234 (37%), Positives = 125/234 (53%), Gaps = 3/234 (1%)
 Frame = -1

Query  833  NRVSALNLFNMG---LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCS  663
            NR   L + ++G   L G++   L     L+ L LS N+F  S P E+  L  LK L   
Sbjct  241  NRFPNLQVLSLGGNLLTGKIPTSLFKCKELMELTLSYNHFDGSLPLEIGNLTMLKKLLLE  300

Query  662  FNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREI  483
              +  G IP   G L  L  L    NN+ G +P+S+ NL+ L+ L    +S+ G++P +I
Sbjct  301  EINLKGQIPWQIGSLLKLESLDCSKNNLEGPIPSSIGNLTLLKRLSFRSSSMSGTLPFQI  360

Query  482  GNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVM  303
            GNL  L++L L +N  +G  P  I N+S  +++ L  N   G+LP   G  LPKLQ   +
Sbjct  361  GNLQNLEVLILENNSLTGFIPPSIFNISTAKSIGLDFNRFSGQLPSTTGLGLPKLQSLYL  420

Query  302  RSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
              N+ SG IP S+S  S L +L L  N+FSG +P   GNL  L++L L  N ++
Sbjct  421  SKNELSGPIPISISNASQLISLQLLNNSFSGVIPDTLGNLRYLQRLDLSHNNIS  474


 Score =   105 bits (261),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 128/246 (52%), Gaps = 10/246 (4%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSL-NLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            GEL   +GNLS  ++L   S  N   S PRE+  L RL  L    ND +G IP+  G L+
Sbjct  507  GELPAAVGNLSASLTLFYASLCNIKGSIPREIGNLTRLFWLGLDHNDLTGKIPTTIGRLR  566

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            +L+ + LGNN + G +P  L +L KL  L L  N L G IP  +G++  L+ L L  N F
Sbjct  567  DLQNVNLGNNRLEGSIPFELCHLEKLAYLTLTGNKLSGPIPSCLGDVVSLRELFLGSNKF  626

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV---MRSNKFSGEIPSSL  264
            + S P  +  L  +  L LS NSL   LP D+G    K ++     +  N+FSG IPSS+
Sbjct  627  T-SIPSTLTRLDGILFLELSSNSLSSSLP-DIG----KWKVVTNLNLSDNQFSGSIPSSI  680

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
                 L  +SL  N   G +P     L  LE L L  N L+G IP+ +  LS L   ++S
Sbjct  681  GDLKDLTHVSLSGNVLQGCIPESVSELISLEFLDLSRNNLSGTIPKSLEQLSYLKYFNVS  740

Query  83   NNKLYG  66
             N+L G
Sbjct  741  FNRLEG  746


 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 104/309 (34%), Positives = 150/309 (49%), Gaps = 36/309 (12%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN-------SFPRELSQLRR  684
            S  +++ +L L N    G +   LGNL +L  L+LS NN  +       SF   L+  + 
Sbjct  434  SNASQLISLQLLNNSFSGVIPDTLGNLRYLQRLDLSHNNISSNPSSPELSFLPSLTNCKD  493

Query  683  LKILQCSFNDF-SGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNS  510
            LK L    N    G +P+  G L  +L   Y    NI G +P  + NL++L  L L  N 
Sbjct  494  LKELTFDGNPLIRGELPAAVGNLSASLTLFYASLCNIKGSIPREIGNLTRLFWLGLDHND  553

Query  509  LEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNH  330
            L G IP  IG L  L+ +NL +N   GS P ++ +L KL  L+L+ N L G +P  LG+ 
Sbjct  554  LTGKIPTTIGRLRDLQNVNLGNNRLEGSIPFELCHLEKLAYLTLTGNKLSGPIPSCLGDV  613

Query  329  LPKLQIFVMRSNKFSGEIPSSLS-----------------------KCSLLQTLSLPFNN  219
            +   ++F + SNKF+  IPS+L+                       K  ++  L+L  N 
Sbjct  614  VSLRELF-LGSNKFT-SIPSTLTRLDGILFLELSSNSLSSSLPDIGKWKVVTNLNLSDNQ  671

Query  218  FSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDTP  39
            FSG +P   G+L  L  + L  N L G IP  +  L SL  +DLS N L GT  ++L+  
Sbjct  672  FSGSIPSSIGDLKDLTHVSLSGNVLQGCIPESVSELISLEFLDLSRNNLSGTIPKSLEQ-  730

Query  38   *LK*LSYYN  12
             L  L Y+N
Sbjct  731  -LSYLKYFN  738


 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 87/237 (37%), Positives = 126/237 (53%), Gaps = 8/237 (3%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            R+  L L +  L G++   +G L  L ++NL  N    S P EL  L +L  L  + N  
Sbjct  543  RLFWLGLDHNDLTGKIPTTIGRLRDLQNVNLGNNRLEGSIPFELCHLEKLAYLTLTGNKL  602

Query  650  SGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
            SG IPS  G + +LR L+LG+N  +  +P++L  L  +  L L  NSL  S+P +IG   
Sbjct  603  SGPIPSCLGDVVSLRELFLGSNKFTS-IPSTLTRLDGILFLELSSNSLSSSLP-DIGKWK  660

Query  470  QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
             +  LNLSDN FSGS P  I +L  L ++SLS N L G +P  + + L  L+   +  N 
Sbjct  661  VVTNLNLSDNQFSGSIPSSIGDLKDLTHVSLSGNVLQGCIPESV-SELISLEFLDLSRNN  719

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPR--EFGNLTKLEKLFLRSNQLTGAIPR  126
             SG IP SL + S L+  ++ FN   G +P    FGN +   + F+ +  L G+ PR
Sbjct  720  LSGTIPKSLEQLSYLKYFNVSFNRLEGEIPNGGSFGNYSI--QSFMGNKALCGS-PR  773


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 90/165 (55%), Gaps = 1/165 (1%)
 Frame = -1

Query  542  KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsL  363
            ++  L L    L G+IP  +GNL  L  LN+ +N F GS P  + NL +L  +  + N++
Sbjct  76   RVTALDLSGMGLIGTIPPHLGNLSFLSRLNMGNNSFPGSLPNQLANLHRLNFIDFNNNNI  135

Query  362  FGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNL  183
             GE+P   G+   +LQ   +  N F+G IPSSL     L+ L L  N+ SG +P    NL
Sbjct  136  SGEIPSWFGS-FTQLQDLYLYDNNFTGVIPSSLCFLPKLERLVLQNNHISGSIPPSIFNL  194

Query  182  TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            + L+ L L +N+L+ +IP      SSL ++DLS N L G    +L
Sbjct  195  SSLQVLDLSNNKLSDSIPSIPLNTSSLQLIDLSVNLLSGNLPSDL  239



>ref|XP_006358722.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Solanum tuberosum]
Length=1482

 Score =   246 bits (629),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 161/378 (43%), Positives = 217/378 (57%), Gaps = 60/378 (16%)
 Frame = -1

Query  1031  LSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGV  852
             LSIF     +L L   +  NI+TD  ALL+LKS IS  P++ILA NWS +S + C+WIG+
Sbjct  12    LSIF-----ILLLNHTSLANISTDGAALLALKSHISSHPNNILASNWS-SSTSVCSWIGI  65

Query  851   TCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKIL  672
             TC+SRH+RV+AL++ +M L G +TP LGNLSFLVSLN+S N FH   P+EL++L+RLK++
Sbjct  66    TCSSRHHRVTALDISSMQLHGTITPHLGNLSFLVSLNISNNAFHGDLPQELARLQRLKVI  125

Query  671   QCSFNDFSGNIPSWFGLLQNLRFLYL-----GNNNISGFLPTS-----------------  558
               + N+F+G  PS+  LL NL  +YL       NN++G LP +                 
Sbjct  126   DVTSNNFTGEFPSFLSLLPNLHIMYLWRNQFSGNNLTGKLPKTICDHLPNLEGLHLTSNS  185

Query  557   --------------------------------LFNLSKLEVLHLGVNSLEGSIPREIGNL  474
                                             L NL+ L  L+LG   LEG IPREI +L
Sbjct  186   LDGVIPPNLEKCRKLQILSLSYNEFIGIVPRELANLTALTELYLGDLHLEGEIPREISDL  245

Query  473   FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSN  294
               L +L+L  N  SGS P  I N++ ++ ++L+ N+L G+LP  + +HLP LQ   +  N
Sbjct  246   RYLTILDLQFNQLSGSIPPSIFNITTMQVIALTGNNLTGKLPKTICDHLPNLQRLYLSKN  305

Query  293   KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGA  114
                G IP SL KC  LQ LSL +N F G VPRE  NLT L +L+LR+  L G IPREI  
Sbjct  306   SLDGVIPPSLEKCRKLQILSLSYNEFIGIVPRELANLTALTELYLRALHLEGEIPREISD  365

Query  113   LSSLLIVDLSNNKLYGTF  60
             L  L I+DL  N+L G+ 
Sbjct  366   LRYLTILDLQFNQLSGSI  383


 Score =   155 bits (393),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/269 (38%), Positives = 142/269 (53%), Gaps = 24/269 (9%)
 Frame = -1

Query  794   VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             +G +  ++ NL+ L  L L   +     PRE+S LR L IL   FN  SG+IP     + 
Sbjct  812   IGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQLSGSIPPSIFNIT  871

Query  614   NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNS------------------------L  507
              ++ +    NN++G LP SL    KL+VL L +N                         L
Sbjct  872   TMQIIDFTGNNLTGKLPPSLEKCRKLQVLALSLNEFIGTIPREIANLTVLTELYLKALHL  931

Query  506   EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
             EG IPREI +L  L +L+L  N  SGS P  I N++ ++ +  + N+L G+LP  + +HL
Sbjct  932   EGEIPREISDLRYLTILDLQFNQLSGSIPPSIFNITTMQIIDFTGNNLTGKLPTTICDHL  991

Query  326   PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ  147
             P L+   + SN   G IP SL KC  LQ L+L  N F G +PRE  NLT L +L+L++  
Sbjct  992   PNLEGLHLTSNSLDGVIPPSLEKCRKLQVLALSLNEFIGTIPREIANLTVLTELYLKALH  1051

Query  146   LTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             L G IPREI  L  L I+DL  N+L G+ 
Sbjct  1052  LEGEIPREISDLRYLTILDLQFNQLSGSI  1080


 Score =   151 bits (382),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 133/245 (54%), Gaps = 1/245 (0%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            +G +  ++ NL+ L  L L   +     PRE+S LR L IL   FN  SG+IP     + 
Sbjct  524  IGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQLSGSIPPSIFNIT  583

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             ++ +    NN++G LP SL    KL+VL L +N   G+IPREI NL  L  L L   H 
Sbjct  584  TMQIIDFTGNNLTGKLPPSLEKCRKLQVLALSLNEFIGTIPREIANLTVLTELYLKALHL  643

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
             G  P +I +L  L  L L  N L G +P  + N +  +QI     N  +G++P SL KC
Sbjct  644  EGEIPREISDLRYLTILDLQFNQLSGSIPPSIFN-ITTMQIIDFTGNNLTGKLPPSLEKC  702

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              LQ L+L  N F G +PRE  NLT L +L+L++  L G IPREI  L  L I+DL  N+
Sbjct  703  RKLQVLALSLNEFIGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQ  762

Query  74   LYGTF  60
            L G+ 
Sbjct  763  LSGSI  767


 Score =   151 bits (382),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 133/245 (54%), Gaps = 1/245 (0%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            +G +  ++ NL+ L  L L   +     PRE+S LR L IL   FN  SG+IP     + 
Sbjct  716  IGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQLSGSIPPSIFNIT  775

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             ++ +    NN++G LP SL    KL+VL L +N   G+IPREI NL  L  L L   H 
Sbjct  776  TMQIIDFTGNNLTGKLPPSLEKCRKLQVLALSLNEFIGTIPREIANLTVLTELYLKALHL  835

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
             G  P +I +L  L  L L  N L G +P  + N +  +QI     N  +G++P SL KC
Sbjct  836  EGEIPREISDLRYLTILDLQFNQLSGSIPPSIFN-ITTMQIIDFTGNNLTGKLPPSLEKC  894

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              LQ L+L  N F G +PRE  NLT L +L+L++  L G IPREI  L  L I+DL  N+
Sbjct  895  RKLQVLALSLNEFIGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQ  954

Query  74   LYGTF  60
            L G+ 
Sbjct  955  LSGSI  959


 Score =   150 bits (379),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 133/245 (54%), Gaps = 1/245 (0%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            +G +  +L NL+ L  L L   +     PRE+S LR L IL   FN  SG+IP     + 
Sbjct  332  IGIVPRELANLTALTELYLRALHLEGEIPREISDLRYLTILDLQFNQLSGSIPPSIFNIT  391

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             ++ +    NN++G LP SL    KL+VL L +N   G+IPREI NL  L  L L   H 
Sbjct  392  TMQIIDFTGNNLTGKLPPSLEKCRKLQVLALSLNEFIGTIPREIANLTVLTELYLKALHL  451

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
             G  P +I +L  L  L L  N L G +P  + N +  +QI     N  +G++P SL KC
Sbjct  452  EGEIPREISDLRYLTILDLQFNQLSGSIPPSIFN-ITTMQIIDFTGNNLTGKLPPSLEKC  510

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              LQ L+L  N F G +PRE  NLT L +L+L++  L G IPREI  L  L I+DL  N+
Sbjct  511  RKLQVLALSLNEFIGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQ  570

Query  74   LYGTF  60
            L G+ 
Sbjct  571  LSGSI  575


 Score =   144 bits (363),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 138/269 (51%), Gaps = 26/269 (10%)
 Frame = -1

Query  794   VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIP-SWFGL-  621
             +G +  ++ NL+ L  L L   +     PRE+S LR L IL   FN  SG+IP S F + 
Sbjct  908   IGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQLSGSIPPSIFNIT  967

Query  620   -----------------------LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNS  510
                                    L NL  L+L +N++ G +P SL    KL+VL L +N 
Sbjct  968   TMQIIDFTGNNLTGKLPTTICDHLPNLEGLHLTSNSLDGVIPPSLEKCRKLQVLALSLNE  1027

Query  509   LEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNH  330
               G+IPREI NL  L  L L   H  G  P +I +L  L  L L  N L G +P  + N 
Sbjct  1028  FIGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQLSGSIPPSIFN-  1086

Query  329   LPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN  150
             +  +QI  +  N  +G++P SL KC  LQ L+L  N F G +PRE  NLT L +L+L + 
Sbjct  1087  ITTMQIITLTDNNLTGKLPPSLEKCRKLQVLALSLNEFIGTIPREIANLTALTELYLETL  1146

Query  149   QLTGAIPREIGALSSLLIVDLSNNKLYGT  63
              L G IP E+G L  L ++ L+ N+L G+
Sbjct  1147  HLEGEIPMELGNLKKLQVLQLAENELTGS  1175


 Score =   139 bits (350),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 138/274 (50%), Gaps = 25/274 (9%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            +G +  ++ NL+ L  L L   +     PRE+S LR L IL   FN  SG+IP     + 
Sbjct  428  IGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQLSGSIPPSIFNIT  487

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             ++ +    NN++G LP SL    KL+VL L +N   G+IPREI NL  L  L L   H 
Sbjct  488  TMQIIDFTGNNLTGKLPPSLEKCRKLQVLALSLNEFIGTIPREIANLTVLTELYLKALHL  547

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
             G  P +I +L  L  L L  N L G +P  + N +  +QI     N  +G++P SL KC
Sbjct  548  EGEIPREISDLRYLTILDLQFNQLSGSIPPSIFN-ITTMQIIDFTGNNLTGKLPPSLEKC  606

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRS------------------------NQ  147
              LQ L+L  N F G +PRE  NLT L +L+L++                        NQ
Sbjct  607  RKLQVLALSLNEFIGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQ  666

Query  146  LTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLD  45
            L+G+IP  I  ++++ I+D + N L G    +L+
Sbjct  667  LSGSIPPSIFNITTMQIIDFTGNNLTGKLPPSLE  700


 Score =   139 bits (350),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 138/274 (50%), Gaps = 25/274 (9%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            +G +  ++ NL+ L  L L   +     PRE+S LR L IL   FN  SG+IP     + 
Sbjct  620  IGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQLSGSIPPSIFNIT  679

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             ++ +    NN++G LP SL    KL+VL L +N   G+IPREI NL  L  L L   H 
Sbjct  680  TMQIIDFTGNNLTGKLPPSLEKCRKLQVLALSLNEFIGTIPREIANLTVLTELYLKALHL  739

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
             G  P +I +L  L  L L  N L G +P  + N +  +QI     N  +G++P SL KC
Sbjct  740  EGEIPREISDLRYLTILDLQFNQLSGSIPPSIFN-ITTMQIIDFTGNNLTGKLPPSLEKC  798

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRS------------------------NQ  147
              LQ L+L  N F G +PRE  NLT L +L+L++                        NQ
Sbjct  799  RKLQVLALSLNEFIGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQ  858

Query  146  LTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLD  45
            L+G+IP  I  ++++ I+D + N L G    +L+
Sbjct  859  LSGSIPPSIFNITTMQIIDFTGNNLTGKLPPSLE  892


 Score =   132 bits (331),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 102/320 (32%), Positives = 146/320 (46%), Gaps = 77/320 (24%)
 Frame = -1

Query  794   VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             +G +  ++ NL+ L  L L   +     PRE+S LR L IL   FN  SG+IP     + 
Sbjct  1029  IGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQLSGSIPPSIFNIT  1088

Query  614   NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREI----------------  483
              ++ + L +NN++G LP SL    KL+VL L +N   G+IPREI                
Sbjct  1089  TMQIITLTDNNLTGKLPPSLEKCRKLQVLALSLNEFIGTIPREIANLTALTELYLETLHL  1148

Query  482   --------GNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
                     GNL +L++L L++N  +GS P  I N+S L+ +    N L G LP DLG  +
Sbjct  1149  EGEIPMELGNLKKLQVLQLAENELTGSVPDSIFNMSALKIIDFGQNKLSGTLPSDLGRRI  1208

Query  326   PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN-  150
             P L++F+   N  SG I  S++  S L+   + FN+F+G +P+ FGNL  LE L L  N 
Sbjct  1209  PNLEVFLCGGNNLSGFISDSITNSSRLRMFDISFNSFTGPIPKSFGNLEYLEILNLEMNN  1268

Query  149   ----------------------------------------------------QLTGAIPR  126
                                                                 +L G IPR
Sbjct  1269  FISDSSLSFLTSLTNCRKLRALRFNENALDGALPASVGNFSNSMQNFQGNGCKLKGVIPR  1328

Query  125   EIGALSSLLIVDLSNNKLYG  66
             EIG L+ ++ + L NNKL G
Sbjct  1329  EIGNLTGVIHMSLFNNKLAG  1348


 Score =   130 bits (326),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 105/331 (32%), Positives = 153/331 (46%), Gaps = 56/331 (17%)
 Frame = -1

Query  890  SVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSF  711
            S++ + P N        +  ++  L+L     +G +  +L NL+ L  L L   +     
Sbjct  185  SLDGVIPPNL------EKCRKLQILSLSYNEFIGIVPRELANLTALTELYLGDLHLEGEI  238

Query  710  PRELSQLRRLKILQCSFNDFSGNIP-SWFGL------------------------LQNLR  606
            PRE+S LR L IL   FN  SG+IP S F +                        L NL+
Sbjct  239  PREISDLRYLTILDLQFNQLSGSIPPSIFNITTMQVIALTGNNLTGKLPKTICDHLPNLQ  298

Query  605  FLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGS  426
             LYL  N++ G +P SL    KL++L L  N   G +PRE+ NL  L  L L   H  G 
Sbjct  299  RLYLSKNSLDGVIPPSLEKCRKLQILSLSYNEFIGIVPRELANLTALTELYLRALHLEGE  358

Query  425  FPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLL  246
             P +I +L  L  L L  N L G +P  + N +  +QI     N  +G++P SL KC  L
Sbjct  359  IPREISDLRYLTILDLQFNQLSGSIPPSIFN-ITTMQIIDFTGNNLTGKLPPSLEKCRKL  417

Query  245  QTLSLPFNNFSGHVPREFGNLTKLEKLFLRS------------------------NQLTG  138
            Q L+L  N F G +PRE  NLT L +L+L++                        NQL+G
Sbjct  418  QVLALSLNEFIGTIPREIANLTVLTELYLKALHLEGEIPREISDLRYLTILDLQFNQLSG  477

Query  137  AIPREIGALSSLLIVDLSNNKLYGTFIQNLD  45
            +IP  I  ++++ I+D + N L G    +L+
Sbjct  478  SIPPSIFNITTMQIIDFTGNNLTGKLPPSLE  508


 Score =   115 bits (288),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 135/260 (52%), Gaps = 5/260 (2%)
 Frame = -1

Query  827   VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
             ++ L L  + L GE+  +LGNL  L  L L++N    S P  +  +  LKI+    N  S
Sbjct  1138  LTELYLETLHLEGEIPMELGNLKKLQVLQLAENELTGSVPDSIFNMSALKIIDFGQNKLS  1197

Query  647   GNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
             G +PS  G  + NL     G NN+SGF+  S+ N S+L +  +  NS  G IP+  GNL 
Sbjct  1198  GTLPSDLGRRIPNLEVFLCGGNNLSGFISDSITNSSRLRMFDISFNSFTGPIPKSFGNLE  1257

Query  470   QLKLLNLSDNHF----SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVM  303
              L++LNL  N+F    S SF   + N  KL  L  + N+L G LP  +GN    +Q F  
Sbjct  1258  YLEILNLEMNNFISDSSLSFLTSLTNCRKLRALRFNENALDGALPASVGNFSNSMQNFQG  1317

Query  302   RSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPRE  123
                K  G IP  +   + +  +SL  N  +GH+P    ++  L++ +L SN++ G IP  
Sbjct  1318  NGCKLKGVIPREIGNLTGVIHMSLFNNKLAGHIPNTVQDMLNLQEFYLHSNEIKGTIPNV  1377

Query  122   IGALSSLLIVDLSNNKLYGT  63
             I +L +L  +DLS N   G+
Sbjct  1378  ICSLKNLGALDLSGNHFSGS  1397


 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 137/291 (47%), Gaps = 42/291 (14%)
 Frame = -1

Query  827   VSALNLFNMG---LVGELTPDLG----NLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ  669
             +SAL + + G   L G L  DLG    NL   +      NN        ++   RL++  
Sbjct  1183  MSALKIIDFGQNKLSGTLPSDLGRRIPNLEVFLC---GGNNLSGFISDSITNSSRLRMFD  1239

Query  668   CSFNDFSGNIPSWFGLLQNLRFLYLGNNN-IS----GFLPTSLFNLSKLEVLHLGVNSLE  504
              SFN F+G IP  FG L+ L  L L  NN IS     FL TSL N  KL  L    N+L+
Sbjct  1240  ISFNSFTGPIPKSFGNLEYLEILNLEMNNFISDSSLSFL-TSLTNCRKLRALRFNENALD  1298

Query  503   GS-------------------------IPREIGNLFQLKLLNLSDNHFSGSFPLDIlnls  399
             G+                         IPREIGNL  +  ++L +N  +G  P  + ++ 
Sbjct  1299  GALPASVGNFSNSMQNFQGNGCKLKGVIPREIGNLTGVIHMSLFNNKLAGHIPNTVQDML  1358

Query  398   klenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNN  219
              L+   L  N + G +P ++   L  L    +  N FSG +PS L   + L+ L+L +N 
Sbjct  1359  NLQEFYLHSNEIKGTIP-NVICSLKNLGALDLSGNHFSGSVPSCLGNVTSLRYLNLAYNR  1417

Query  218   FSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
              +  +P   G+L  L +L + SN L+G IP E+G L ++ ++DLS N   G
Sbjct  1418  LNSRLPANLGSLQDLIELSVSSNSLSGHIPLELGNLKAVTLIDLSKNDFSG  1468


 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 77/270 (29%), Positives = 121/270 (45%), Gaps = 57/270 (21%)
 Frame = -1

Query  824   SALNLFNMGL---VGELTPDLGNLSFLVSLNLSQNNFHN----SFPRELSQLRRLKILQC  666
             S L +F++      G +    GNL +L  LNL  NNF +    SF   L+  R+L+ L+ 
Sbjct  1233  SRLRMFDISFNSFTGPIPKSFGNLEYLEILNLEMNNFISDSSLSFLTSLTNCRKLRALRF  1292

Query  665   ------------------SFNDFSGN-------IPSWFGLLQNLRFLYLGNNNISGFLPT  561
                               S  +F GN       IP   G L  +  + L NN ++G +P 
Sbjct  1293  NENALDGALPASVGNFSNSMQNFQGNGCKLKGVIPREIGNLTGVIHMSLFNNKLAGHIPN  1352

Query  560   SLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenls  381
             ++ ++  L+  +L  N ++G+IP  I +L  L  L+LS NHFSGS               
Sbjct  1353  TVQDMLNLQEFYLHSNEIKGTIPNVICSLKNLGALDLSGNHFSGS---------------  1397

Query  380   lsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVP  201
                      +P  LGN +  L+   +  N+ +  +P++L     L  LS+  N+ SGH+P
Sbjct  1398  ---------VPSCLGN-VTSLRYLNLAYNRLNSRLPANLGSLQDLIELSVSSNSLSGHIP  1447

Query  200   REFGNLTKLEKLFLRSNQLTGAIPREIGAL  111
              E GNL  +  + L  N  +G IP  +G +
Sbjct  1448  LELGNLKAVTLIDLSKNDFSGKIPSTLGVV  1477


 Score = 77.0 bits (188),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 77/152 (51%), Gaps = 2/152 (1%)
 Frame = -1

Query  869   CNWIGVTCNSRHN--RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELS  696
             C   GV      N   V  ++LFN  L G +   + ++  L    L  N    + P  + 
Sbjct  1320  CKLKGVIPREIGNLTGVIHMSLFNNKLAGHIPNTVQDMLNLQEFYLHSNEIKGTIPNVIC  1379

Query  695   QLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGV  516
              L+ L  L  S N FSG++PS  G + +LR+L L  N ++  LP +L +L  L  L +  
Sbjct  1380  SLKNLGALDLSGNHFSGSVPSCLGNVTSLRYLNLAYNRLNSRLPANLGSLQDLIELSVSS  1439

Query  515   NSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
             NSL G IP E+GNL  + L++LS N FSG  P
Sbjct  1440  NSLSGHIPLELGNLKAVTLIDLSKNDFSGKIP  1471



>emb|CDP00850.1| unnamed protein product [Coffea canephora]
Length=2175

 Score =   247 bits (631),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 145/335 (43%), Positives = 204/335 (61%), Gaps = 6/335 (2%)
 Frame = -1

Query  1058  MEITRHYFCLSIFFFH----SLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNW  891
             M+ T   F  ++   H    S    +  N+  N  +D +ALL+ K+ I FDP  I+  NW
Sbjct  1     MQRTYFLFAGALVLLHFIATSSATIIVANSQNNSASDLNALLAFKATI-FDPQRIIPTNW  59

Query  890   SVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSF  711
             S +S + CNWIG+TCN+RH+RV+A+NL  MG+VG + P+LGNLSFLV LN+  N+FH   
Sbjct  60    STSS-SVCNWIGITCNARHHRVAAINLSYMGIVGTIPPELGNLSFLVWLNVRNNSFHGHL  118

Query  710   PRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEV  531
             P ELS+L RLK +  + NDF G  PSW G L  L ++    N  SG L   L N +KLE 
Sbjct  119   PTELSRLHRLKYINLASNDFEGEFPSWLGCLSALWYINFEYNRFSGSLSGRLSNFTKLET  178

Query  530   LHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGEL  351
             + L  N   G++  E   L +L +L++  N  +G  P  + NLS L+ +  + NSL G L
Sbjct  179   IRLDYNFFTGNLSEEFSALPKLTVLDIQFNQLAGPLPQALFNLSSLQIIGFTNNSLSGYL  238

Query  350   PLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLE  171
             P  + ++LP+L+   +  N F GEIPS + +CS LQ LSL +N F G++PRE  NLT L 
Sbjct  239   PAHICDYLPQLKGLYLSLNNFEGEIPSGIGECSGLQVLSLSYNKFRGYIPREIWNLTTLT  298

Query  170   KLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             +L L  N LTG +P+E+G LS L +V L++N+L G
Sbjct  299   RLVLGGNDLTGILPQEVGNLSKLEVVQLTSNRLRG  333


 Score =   244 bits (623),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 193/314 (61%), Gaps = 3/314 (1%)
 Frame = -1

Query  986   NAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLF  807
             N H N  +D +ALL+ K+ I FDP  I+  NWS  S + CNWIG+TCN+RH+RV+A++L 
Sbjct  1090  NNHNNSASDLNALLAFKAAI-FDPQRIIPTNWST-STSVCNWIGITCNARHHRVAAIDLS  1147

Query  806   NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
              MG+ G + P+LGNLSFLV LN+  N+FH   P ELS+LR+LK +    N F G +PSW 
Sbjct  1148  YMGIAGTIPPELGNLSFLVRLNVMNNSFHGHLPTELSRLRQLKYISLEGNAFEGELPSWL  1207

Query  626   GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
             G L  LR+L   +N  SG L   L N +KLE + L  N L G+IP E   L +LKLL++ 
Sbjct  1208  GGLTALRYLSFRDNRFSGSLSGRLSNFTKLETIELAYNFLTGNIPEEFSALPKLKLLDIQ  1267

Query  446   DNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSS  267
              N   G  P  + NLS L  +S + NS  G LP  + ++LP+LQ   +  N F GEIPS 
Sbjct  1268  SNQLVGPLPWALFNLSSLRIISFTGNSFSGYLPAHVCDYLPQLQGLYLSRNYFEGEIPSG  1327

Query  266   LSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT-GAIPREIGALSSLLIVD  90
             + +CS LQ LSL +N F G++P+EF NLT L ++ L  N LT G IP+ I  L +L I+ 
Sbjct  1328  IGECSRLQVLSLSYNKFRGYIPKEFWNLTTLTQIALGGNDLTAGEIPKGIDNLYNLEILG  1387

Query  89    LSNNKLYGTFIQNL  48
             +    + G   Q +
Sbjct  1388  MERANVTGIIPQEV  1401


 Score =   114 bits (285),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 127/232 (55%), Gaps = 1/232 (0%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQ-LRRLKILQCSFND  654
            +++ L++    L G L   L NLS L  +  + N+     P  +   L +LK L  S N+
Sbjct  199  KLTVLDIQFNQLAGPLPQALFNLSSLQIIGFTNNSLSGYLPAHICDYLPQLKGLYLSLNN  258

Query  653  FSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
            F G IPS  G    L+ L L  N   G++P  ++NL+ L  L LG N L G +P+E+GNL
Sbjct  259  FEGEIPSGIGECSGLQVLSLSYNKFRGYIPREIWNLTTLTRLVLGGNDLTGILPQEVGNL  318

Query  473  FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSN  294
             +L+++ L+ N   G   L + N+S L+ +SLS NS  GELP  LG  LP L+   +  N
Sbjct  319  SKLEVVQLTSNRLRGPITLKLFNISTLQFISLSENSFSGELPSTLGVFLPNLEELYLGEN  378

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
             F+G I +S+S  S L+ L +  N+F+G +P   GNL  LE L + +N   G
Sbjct  379  TFTGAILTSISNASRLRVLDIGGNHFTGAIPHSLGNLRLLEVLSVTNNDFFG  430


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/241 (33%), Positives = 118/241 (49%), Gaps = 31/241 (13%)
 Frame = -1

Query  791   GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF-SGNIPSWFGLLQ  615
             GE+   +G  S L  L+LS N F    P+E   L  L  +    ND  +G IP     L 
Sbjct  1322  GEIPSGIGECSRLQVLSLSYNKFRGYIPKEFWNLTTLTQIALGGNDLTAGEIPKGIDNLY  1381

Query  614   NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             NL  L +   N++G +P  + NLSKLEVL+LG+N L G IP ++ N   ++++ L++N  
Sbjct  1382  NLEILGMERANVTGIIPQEVGNLSKLEVLNLGLNRLRGPIPLKLFNSSTVRVIALTENDL  1441

Query  434   SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
             S                        GELP  +G  LP L+   +  N+F+G I  S+S  
Sbjct  1442  S------------------------GELPSTIGAFLPNLEELYLGRNEFTGTILKSISNA  1477

Query  254   SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT-GAIPREIGALSSLLIVDLSNN  78
             S L+ L L  N+F+G +P   GNL  LE+  +  N  +  ++ +E+       I+ LSN 
Sbjct  1478  SRLKMLELEMNHFTGAIPHSLGNLRLLEQFAIWQNDFSEDSLSKELS-----FIISLSNC  1532

Query  77    K  75
             K
Sbjct  1533  K  1533


 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 131/260 (50%), Gaps = 8/260 (3%)
 Frame = -1

Query  818   LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
             L +    + G +  ++GNLS L  LNL  N      P +L     ++++  + ND SG +
Sbjct  1386  LGMERANVTGIIPQEVGNLSKLEVLNLGLNRLRGPIPLKLFNSSTVRVIALTENDLSGEL  1445

Query  638   PSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
             PS  G  L NL  LYLG N  +G +  S+ N S+L++L L +N   G+IP  +GNL  L+
Sbjct  1446  PSTIGAFLPNLEELYLGRNEFTGTILKSISNASRLKMLELEMNHFTGAIPHSLGNLRLLE  1505

Query  461   LLNLSDNHFSG-------SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVM  303
                +  N FS        SF + + N   L  L +  N L G LP  +GN    L+  + 
Sbjct  1506  QFAIWQNDFSEDSLSKELSFIISLSNCKHLTELWIDDNPLNGFLPKSIGNLSSSLESIIA  1565

Query  302   RSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPRE  123
              +     EIPSS+   S L  LS   N+ +G +P     L+KL+ + L  NQ+ GAIP E
Sbjct  1566  SNCGIISEIPSSIGNLSNLVMLSFATNSLTGVIPTTIKWLSKLQMIDLSDNQIQGAIPSE  1625

Query  122   IGALSSLLIVDLSNNKLYGT  63
             +  L +L  + L+ NKL G 
Sbjct  1626  LCYLLNLGGLYLAKNKLSGV  1645


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 91/277 (33%), Positives = 128/277 (46%), Gaps = 33/277 (12%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPS------  633
             G +   + N S L  L++  N+F  + P  L  LR L++L  + NDF G++ S      
Sbjct  381  TGAILTSISNASRLRVLDIGGNHFTGAIPHSLGNLRLLEVLSVTNNDFFGDLRSNGLSFI  440

Query  632  -WFGLLQNLRFLYLGNNNISGFLPTSLFNLSK-LEVLHLGVNSLEGSIPREIGNL-----  474
                  +NL+ L +  N ++GFLP S  NLS  LE  H G   ++  IP  IGNL     
Sbjct  441  TSLANCKNLKSLRITGNPLNGFLPKSTGNLSSSLESFHAGRCGIKSEIPSSIGNLSNLVE  500

Query  473  -------------------FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGEL  351
                                +L+ ++LSDN   G+ P +  NL  L  L L  N L G +
Sbjct  501  LYFENNSLTGLIPATMKWFLKLQRIDLSDNQILGAIPSEFCNLLNLGELGLGQNKLSGMV  560

Query  350  PLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLE  171
            P  LGN +  L+   + SN  S  IP+S      +  L +  N  +G +P E GN   L 
Sbjct  561  PSCLGN-VTTLRYVYLNSNNLSSVIPTSFWSLRDILELDMSGNYLTGSLPAEIGNFKALV  619

Query  170  KLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             L L +NQ  G IP  IGAL  L  + L +NKL G+ 
Sbjct  620  TLNLSNNQYLGGIPNTIGALQDLQELSLEHNKLQGSI  656


 Score = 99.4 bits (246),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 115/226 (51%), Gaps = 1/226 (0%)
 Frame = -1

Query  806   NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
             N G++ E+   +GNLS LV L+ + N+     P  +  L +L+++  S N   G IPS  
Sbjct  1567  NCGIISEIPSSIGNLSNLVMLSFATNSLTGVIPTTIKWLSKLQMIDLSDNQIQGAIPSEL  1626

Query  626   GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
               L NL  LYL  N +SG +P+ L N++ L  + L  NSL   IP    +L  +  L++S
Sbjct  1627  CYLLNLGGLYLAKNKLSGVVPSCLGNVTTLRYVDLNSNSLSSMIPTSFWSLIYILELDMS  1686

Query  446   DNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSS  267
              N+ +G  P +I     +  L+LS N   G +P  +G  L  LQ   +  NK  G IP+S
Sbjct  1687  GNYLTGPLPAEIGTFKAIVFLNLSNNQYLGGIPSTIG-ALQGLQELSLEHNKLQGLIPNS  1745

Query  266   LSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             +     LQ L L FN+  G +P     L+ L+   +  N+L G IP
Sbjct  1746  MKNMLQLQHLDLSFNHLEGEIPNSLQVLSDLQYFNVSYNRLRGPIP  1791


 Score = 96.3 bits (238),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 90/267 (34%), Positives = 126/267 (47%), Gaps = 9/267 (3%)
 Frame = -1

Query  842   SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN-------SFPRELSQLRR  684
             S  +R+  L L      G +   LGNL  L    + QN+F         SF   LS  + 
Sbjct  1475  SNASRLKMLELEMNHFTGAIPHSLGNLRLLEQFAIWQNDFSEDSLSKELSFIISLSNCKH  1534

Query  683   LKILQCSFNDFSGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSL  507
             L  L    N  +G +P   G L  +L  +   N  I   +P+S+ NLS L +L    NSL
Sbjct  1535  LTELWIDDNPLNGFLPKSIGNLSSSLESIIASNCGIISEIPSSIGNLSNLVMLSFATNSL  1594

Query  506   EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
              G IP  I  L +L++++LSDN   G+ P ++  L  L  L L+ N L G +P  LGN +
Sbjct  1595  TGVIPTTIKWLSKLQMIDLSDNQIQGAIPSELCYLLNLGGLYLAKNKLSGVVPSCLGN-V  1653

Query  326   PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ  147
               L+   + SN  S  IP+S      +  L +  N  +G +P E G    +  L L +NQ
Sbjct  1654  TTLRYVDLNSNSLSSMIPTSFWSLIYILELDMSGNYLTGPLPAEIGTFKAIVFLNLSNNQ  1713

Query  146   LTGAIPREIGALSSLLIVDLSNNKLYG  66
               G IP  IGAL  L  + L +NKL G
Sbjct  1714  YLGGIPSTIGALQGLQELSLEHNKLQG  1740


 Score = 92.0 bits (227),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 83/270 (31%), Positives = 111/270 (41%), Gaps = 52/270 (19%)
 Frame = -1

Query  857  GVTCNSRHNRVSALNLFNMGLVG---ELTPDLGNLSFLVSL-------------------  744
            G    S  N  S+L  F+ G  G   E+   +GNLS LV L                   
Sbjct  461  GFLPKSTGNLSSSLESFHAGRCGIKSEIPSSIGNLSNLVELYFENNSLTGLIPATMKWFL  520

Query  743  -----NLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNI  579
                 +LS N    + P E   L  L  L    N  SG +PS  G +  LR++YL +NN+
Sbjct  521  KLQRIDLSDNQILGAIPSEFCNLLNLGELGLGQNKLSGMVPSCLGNVTTLRYVYLNSNNL  580

Query  578  SGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnls  399
            S  +PTS ++L  +  L +  N L GS+P EIGN   L  LNLS+N + G  P  I    
Sbjct  581  SSVIPTSFWSLRDILELDMSGNYLTGSLPAEIGNFKALVTLNLSNNQYLGGIPNTI----  636

Query  398  klenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNN  219
                                   L  LQ   +  NK  G IP S+     L+ L L FN+
Sbjct  637  ---------------------GALQDLQELSLEHNKLQGSIPDSMKNMLQLRHLDLSFNH  675

Query  218  FSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
              G +P     L  L+   +  N+L G IP
Sbjct  676  LEGVIPNSLQVLLDLQYFNVSYNRLRGPIP  705


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 75/165 (45%), Gaps = 25/165 (15%)
 Frame = -1

Query  542  KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsL  363
            ++  ++L    + G+IP E+GNL  L  LN+ +N F G  P ++                
Sbjct  79   RVAAINLSYMGIVGTIPPELGNLSFLVWLNVRNNSFHGHLPTEL----------------  122

Query  362  FGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNL  183
                     + L +L+   + SN F GE PS L   S L  ++  +N FSG +     N 
Sbjct  123  ---------SRLHRLKYINLASNDFEGEFPSWLGCLSALWYINFEYNRFSGSLSGRLSNF  173

Query  182  TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
            TKLE + L  N  TG +  E  AL  L ++D+  N+L G   Q L
Sbjct  174  TKLETIRLDYNFFTGNLSEEFSALPKLTVLDIQFNQLAGPLPQAL  218



>ref|XP_004295582.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Fragaria vesca subsp. vesca]
Length=1092

 Score =   244 bits (623),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 146/362 (40%), Positives = 208/362 (57%), Gaps = 50/362 (14%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLF  807
            A TNI TD+ ALL+LK +I+ D H+++  NWS  + TP CNW+G+TC +RH+RV+ LN+ 
Sbjct  3    AQTNINTDQSALLALKPRITSDHHNMIFTNWS--TTTPVCNWVGITCGARHHRVTHLNIS  60

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
              GL G + P+LGNLSFLV L+ + N+F+ S P+EL++L+RLK +    N F+G IPSWF
Sbjct  61   YFGLAGTVPPELGNLSFLVDLDFTNNSFYGSLPQELARLQRLKFINMGNNVFTGIIPSWF  120

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN----------  477
            G L  L+ LYL  N  SG +P ++FNLS L+++ L  N L GSIPREIGN          
Sbjct  121  GSLAKLQALYLYGNKFSGSIPAAIFNLSALQIIDLRYNQLSGSIPREIGNLTELKEIYLD  180

Query  476  -------------LFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
                         L QL++L++  N  +G  P+ + N+S L  L    N+L G LP ++ 
Sbjct  181  SNKFKEIPNEIGALIQLEMLSVKHNALNGPIPITVFNMSSLVILDFYGNNLSGNLPDNIC  240

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
             HLP +Q   +  N+  G +PS  S+C  L ++    NNFSG +P   GNLT+++ +   
Sbjct  241  QHLPSIQGLYLGYNQLDGPLPSKWSQCKQLLSVLSATNNFSGRIPTSIGNLTQIKTIDFS  300

Query  155  SNQLTGAIPREIGAL------------------------SSLLIVDLSNNKLYGTFIQNL  48
             N LTG IP EIG L                        S++ ++ L NN+L GTF  N+
Sbjct  301  YNSLTGTIPDEIGHLPNLEVLSLGINNLNGIIPSSIFNMSTITVISLPNNQLSGTFPANI  360

Query  47   DT  42
             T
Sbjct  361  GT  362


 Score =   104 bits (260),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 83/246 (34%), Positives = 119/246 (48%), Gaps = 36/246 (15%)
 Frame = -1

Query  746  LNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFL  567
            L L  N      P + SQ ++L  +  + N+FSG IP+  G L  ++ +    N+++G +
Sbjct  249  LYLGYNQLDGPLPSKWSQCKQLLSVLSATNNFSGRIPTSIGNLTQIKTIDFSYNSLTGTI  308

Query  566  PTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklen  387
            P  + +L  LEVL LG+N+L G IP  I N+  + +++L +N  SG+FP +I        
Sbjct  309  PDEIGHLPNLEVLSLGINNLNGIIPSSIFNMSTITVISLPNNQLSGTFPANI--------  360

Query  386  lslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGH  207
                            G  LP LQI  +  NK SG  P S+S  S L  +S+  N FSG 
Sbjct  361  ----------------GTALPNLQILFLGENKLSGVFPKSISNASQLIAISIGANLFSGF  404

Query  206  VPREFGNLTKLEKLFLRSNQLT--GAIPREIGALSSLL------IVDLSNNKLYGTF---  60
            +P     LTKL++L L  N  T   + P E+  LS L        V LS N L   F   
Sbjct  405  IPSTICALTKLQRLKLLINNFTIDSSTP-EVNVLSCLANLRNLREVALSRNPLNAMFPVS  463

Query  59   IQNLDT  42
            I+NL T
Sbjct  464  IRNLST  469


 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 120/234 (51%), Gaps = 10/234 (4%)
 Frame = -1

Query  767  NLSFLVSLNLSQNNFHNSFPREL-SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLG  591
            N+S +  ++L  N    +FP  + + L  L+IL    N  SG  P        L  + +G
Sbjct  338  NMSTITVISLPNNQLSGTFPANIGTALPNLQILFLGENKLSGVFPKSISNASQLIAISIG  397

Query  590  NNNISGFLPTSLFNLSKLEVLHLGVN--SLEGSIPRE-----IGNLFQLKLLNLSDNHFS  432
             N  SGF+P+++  L+KL+ L L +N  +++ S P       + NL  L+ + LS N  +
Sbjct  398  ANLFSGFIPSTICALTKLQRLKLLINNFTIDSSTPEVNVLSCLANLRNLREVALSRNPLN  457

Query  431  GSFPLDIlnlsklenlslsvnsLF-GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
              FP+ I NLS         NS   GE+P D+GN L  L +F + +N+ SG IP+S+ + 
Sbjct  458  AMFPVSIRNLSTSLQKVYLYNSNMRGEIPSDIGN-LSSLTVFALGTNQLSGSIPTSMGRV  516

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIV  93
              LQ L L +N   GH+P E   L  L  L L  NQL+ +IP  +G L + L V
Sbjct  517  QNLQALDLSYNKLQGHIPGELCQLQSLAILDLSGNQLSSSIPSCLGQLVTSLRV  570


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 80/250 (32%), Positives = 116/250 (46%), Gaps = 26/250 (10%)
 Frame = -1

Query  812  LFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPS  633
            L+N  + GE+  D+GNLS L    L  N    S P  + +++ L+ L  S+N   G+IP 
Sbjct  476  LYNSNMRGEIPSDIGNLSSLTVFALGTNQLSGSIPTSMGRVQNLQALDLSYNKLQGHIPG  535

Query  632  WFGLLQNLRFLYLGNNNISGFLPTSLFNL-SKLEVLHLGVNSLEGSIPREIGNLFQLKLL  456
                LQ+L  L L  N +S  +P+ L  L + L VL + +N L  +IP  +  L  +  L
Sbjct  536  ELCQLQSLAILDLSGNQLSSSIPSCLGQLVTSLRVLSVELNLLNSTIPATLWGLTDILQL  595

Query  455  NLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEI  276
            +LS N  +G+    + NL                  +DL N            N+ SG I
Sbjct  596  SLSSNFLTGTLSESVGNLK-------------AATDIDLSN------------NQLSGII  630

Query  275  PSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLI  96
            P++      L  LSL  N   G +P   GN   LE+L L  N L G IP+ +  LS L  
Sbjct  631  PNNFGSLQNLVNLSLANNKLEGPIPSSLGNALSLERLDLSKNNLYGVIPKSLEELSYLKY  690

Query  95   VDLSNNKLYG  66
            +++S NKL G
Sbjct  691  MNVSFNKLRG  700


 Score = 96.3 bits (238),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 122/256 (48%), Gaps = 5/256 (2%)
 Frame = -1

Query  773  LGNLSFLVSLNLSQNNFHNSFPRELSQLR-RLKILQCSFNDFSGNIPSWFGLLQNLRFLY  597
            L NL  L  + LS+N  +  FP  +  L   L+ +    ++  G IPS  G L +L    
Sbjct  440  LANLRNLREVALSRNPLNAMFPVSIRNLSTSLQKVYLYNSNMRGEIPSDIGNLSSLTVFA  499

Query  596  LGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPL  417
            LG N +SG +PTS+  +  L+ L L  N L+G IP E+  L  L +L+LS N  S S P 
Sbjct  500  LGTNQLSGSIPTSMGRVQNLQALDLSYNKLQGHIPGELCQLQSLAILDLSGNQLSSSIPS  559

Query  416  DIlnlsklenlslsvnsLF-GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQT  240
             +  L     +     +L    +P  L      LQ+  + SN  +G +  S+        
Sbjct  560  CLGQLVTSLRVLSVELNLLNSTIPATLWGLTDILQL-SLSSNFLTGTLSESVGNLKAATD  618

Query  239  LSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            + L  N  SG +P  FG+L  L  L L +N+L G IP  +G   SL  +DLS N LYG  
Sbjct  619  IDLSNNQLSGIIPNNFGSLQNLVNLSLANNKLEGPIPSSLGNALSLERLDLSKNNLYGVI  678

Query  59   IQNLDTP*LK*LSYYN  12
             ++L+   L  L Y N
Sbjct  679  PKSLEE--LSYLKYMN  692


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 62/118 (53%), Gaps = 0/118 (0%)
 Frame = -1

Query  773  LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYL  594
            L  L+ ++ L+LS N    +    +  L+    +  S N  SG IP+ FG LQNL  L L
Sbjct  586  LWGLTDILQLSLSSNFLTGTLSESVGNLKAATDIDLSNNQLSGIIPNNFGSLQNLVNLSL  645

Query  593  GNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFP  420
             NN + G +P+SL N   LE L L  N+L G IP+ +  L  LK +N+S N   G  P
Sbjct  646  ANNKLEGPIPSSLGNALSLERLDLSKNNLYGVIPKSLEELSYLKYMNVSFNKLRGEIP  703



>emb|CDO96827.1| unnamed protein product [Coffea canephora]
Length=1058

 Score =   243 bits (621),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 184/321 (57%), Gaps = 41/321 (13%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFN  804
            A  NIT+D+ ALLSLK+KI+ DPH ILA NWS  S + C+W GVTC SRH RV+ALN+ N
Sbjct  26   AAPNITSDQSALLSLKAKITGDPHEILASNWSATS-SVCDWRGVTCGSRHRRVTALNISN  84

Query  803  MGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
            +GL G + P LGNLSFL+SL++S NNF+   P EL +L RL++L    N  SGNIPSW G
Sbjct  85   LGLTGTIPPQLGNLSFLMSLDMSGNNFYGELPHELIRLSRLRVLSLGINMLSGNIPSWVG  144

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN-----------  477
              Q LR   L NN+ +GF+P S+ N+SKLE  +L  NSL+G+IP EIG            
Sbjct  145  SFQQLRHFSLKNNSFTGFIPPSISNMSKLETFNLQFNSLQGAIPMEIGKLNNLSGSLSSS  204

Query  476  ----LFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIF  309
                L  L  L+LS N  SG  P  +                         +   KLQ+ 
Sbjct  205  ICARLQGLSWLDLSSNELSGMIPASL-------------------------SECSKLQVL  239

Query  308  VMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             +  N FSG IP      + L+ L L  NN  G +P E G L  LEKL L  N LTG+IP
Sbjct  240  RLFDNNFSGVIPEGFGNLTALKQLYLNENNLIGSIPLELGCLKHLEKLRLGLNSLTGSIP  299

Query  128  REIGALSSLLIVDLSNNKLYG  66
             +I  +S+L ++DLSNN L G
Sbjct  300  AQIFNISTLQVLDLSNNTLSG  320


 Score =   112 bits (279),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 91/274 (33%), Positives = 128/274 (47%), Gaps = 40/274 (15%)
 Frame = -1

Query  746  LNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFL  567
            L+LS N      P  LS+  +L++L+   N+FSG IP  FG L  L+ LYL  NN+ G +
Sbjct  215  LDLSSNELSGMIPASLSECSKLQVLRLFDNNFSGVIPEGFGNLTALKQLYLNENNLIGSI  274

Query  566  PTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklen  387
            P  L  L  LE L LG+NSL GSIP +I N+  L++L+LS+N  SG  P  +        
Sbjct  275  PLELGCLKHLEKLRLGLNSLTGSIPAQIFNISTLQVLDLSNNTLSGRLPSSMGCGLINLE  334

Query  386  lslsvnsLF-GELPLDLGNHLPKLQIFVMRSNKFSGEIPSS-------------------  267
                  + F G +P  + N   K+ I  +  N FSG IP+S                   
Sbjct  335  ELYLFWNEFDGVIPASISNA-SKVTILELIGNIFSGPIPNSLGNLRLLRHLGLFGNHLTT  393

Query  266  ------------LSKCSLLQTLSLPFNNFSGHVPREFGNL-TKLEKLFLRSNQLTGAIPR  126
                        L+ C  L+ L    N   G +P   GNL T LE+ +     + G+IP 
Sbjct  394  EPSSRELSFISYLTNCKYLKFLGFAENPLHGFLPMSVGNLSTSLERFYAYGCGIKGSIPD  453

Query  125  EIGALSSLLIVDLSNNKLYG------TFIQNLDT  42
             IG LS+L+++ L  N L G       ++QNL  
Sbjct  454  AIGNLSNLMLLTLEGNHLSGPIPSTMKYLQNLQA  487


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 85/227 (37%), Positives = 112/227 (49%), Gaps = 1/227 (0%)
 Frame = -1

Query  809  FNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSW  630
            +  G+ G +   +GNLS L+ L L  N+     P  +  L+ L+ L    N  SG+IP  
Sbjct  443  YGCGIKGSIPDAIGNLSNLMLLTLEGNHLSGPIPSTMKYLQNLQALDLDDNQLSGSIPDC  502

Query  629  FGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNL  450
               L+ L  +YLG N   G +P+ L N+S L  +    N L  SIP  + NL  L  LNL
Sbjct  503  ICKLKRLYLIYLGQNQFRGSMPSCLNNISSLREIDFAGNLLNSSIPGSLWNLTDLLRLNL  562

Query  449  SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS  270
            S N  SG  P +  NL  +  L LS N L G +P  LG+ L  L    +  NK  G IP 
Sbjct  563  SYNSLSGLLPYETGNLKVVTLLDLSGNHLNGNIPSSLGD-LQSLATLSLAQNKLQGPIPD  621

Query  269  SLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
            SLS    LQ L L  NN SG +P+    L  L+ + L  N+L G IP
Sbjct  622  SLSHVLSLQFLDLSNNNLSGPIPKSLETLLYLKHINLSFNRLRGEIP  668


 Score = 94.7 bits (234),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 103/317 (32%), Positives = 136/317 (43%), Gaps = 58/317 (18%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLG-NLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            +  L+L N  L G L   +G  L  L  L L  N F    P  +S   ++ IL+   N F
Sbjct  308  LQVLDLSNNTLSGRLPSSMGCGLINLEELYLFWNEFDGVIPASISNASKVTILELIGNIF  367

Query  650  SGNIPSWFGLLQNLR-------------------------------FLYLGNNNISGFLP  564
            SG IP+  G L+ LR                               FL    N + GFLP
Sbjct  368  SGPIPNSLGNLRLLRHLGLFGNHLTTEPSSRELSFISYLTNCKYLKFLGFAENPLHGFLP  427

Query  563  TSLFNLS-KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklen  387
             S+ NLS  LE  +     ++GSIP  IGNL  L LL L  NH SG  P  +  L  L+ 
Sbjct  428  MSVGNLSTSLERFYAYGCGIKGSIPDAIGNLSNLMLLTLEGNHLSGPIPSTMKYLQNLQA  487

Query  386  lslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQT-----------  240
            L L  N L G +P D    L +L +  +  N+F G +PS L+  S L+            
Sbjct  488  LDLDDNQLSGSIP-DCICKLKRLYLIYLGQNQFRGSMPSCLNNISSLREIDFAGNLLNSS  546

Query  239  -------------LSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLL  99
                         L+L +N+ SG +P E GNL  +  L L  N L G IP  +G L SL 
Sbjct  547  IPGSLWNLTDLLRLNLSYNSLSGLLPYETGNLKVVTLLDLSGNHLNGNIPSSLGDLQSLA  606

Query  98   IVDLSNNKLYGTFIQNL  48
             + L+ NKL G    +L
Sbjct  607  TLSLAQNKLQGPIPDSL  623


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 119/248 (48%), Gaps = 8/248 (3%)
 Frame = -1

Query  773  LGNLSFLVSLNLSQNNFHNSFPREL----SQLRRLKILQCSFNDFSGNIPSWFGLLQNLR  606
            L N  +L  L  ++N  H   P  +    + L R     C      G+IP   G L NL 
Sbjct  406  LTNCKYLKFLGFAENPLHGFLPMSVGNLSTSLERFYAYGCGIK---GSIPDAIGNLSNLM  462

Query  605  FLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGS  426
             L L  N++SG +P+++  L  L+ L L  N L GSIP  I  L +L L+ L  N F GS
Sbjct  463  LLTLEGNHLSGPIPSTMKYLQNLQALDLDDNQLSGSIPDCICKLKRLYLIYLGQNQFRGS  522

Query  425  FPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLL  246
             P  + N+S L  +  + N L   +P  L N L  L    +  N  SG +P       ++
Sbjct  523  MPSCLNNISSLREIDFAGNLLNSSIPGSLWN-LTDLLRLNLSYNSLSGLLPYETGNLKVV  581

Query  245  QTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
              L L  N+ +G++P   G+L  L  L L  N+L G IP  +  + SL  +DLSNN L G
Sbjct  582  TLLDLSGNHLNGNIPSSLGDLQSLATLSLAQNKLQGPIPDSLSHVLSLQFLDLSNNNLSG  641

Query  65   TFIQNLDT  42
               ++L+T
Sbjct  642  PIPKSLET  649


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 71/134 (53%), Gaps = 4/134 (3%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            A NL N  + G L     NL+ L+ LNLS N+     P E   L+ + +L  S N  +GN
Sbjct  539  AGNLLNSSIPGSLW----NLTDLLRLNLSYNSLSGLLPYETGNLKVVTLLDLSGNHLNGN  594

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IPS  G LQ+L  L L  N + G +P SL ++  L+ L L  N+L G IP+ +  L  LK
Sbjct  595  IPSSLGDLQSLATLSLAQNKLQGPIPDSLSHVLSLQFLDLSNNNLSGPIPKSLETLLYLK  654

Query  461  LLNLSDNHFSGSFP  420
             +NLS N   G  P
Sbjct  655  HINLSFNRLRGEIP  668


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 74/143 (52%), Gaps = 0/143 (0%)
 Frame = -1

Query  848  CNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ  669
            C  +  R+  + L      G +   L N+S L  ++ + N  ++S P  L  L  L  L 
Sbjct  502  CICKLKRLYLIYLGQNQFRGSMPSCLNNISSLREIDFAGNLLNSSIPGSLWNLTDLLRLN  561

Query  668  CSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR  489
             S+N  SG +P   G L+ +  L L  N+++G +P+SL +L  L  L L  N L+G IP 
Sbjct  562  LSYNSLSGLLPYETGNLKVVTLLDLSGNHLNGNIPSSLGDLQSLATLSLAQNKLQGPIPD  621

Query  488  EIGNLFQLKLLNLSDNHFSGSFP  420
             + ++  L+ L+LS+N+ SG  P
Sbjct  622  SLSHVLSLQFLDLSNNNLSGPIP  644



>gb|EYU28102.1| hypothetical protein MIMGU_mgv1a000498mg [Erythranthe guttata]
Length=1115

 Score =   244 bits (622),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 157/350 (45%), Positives = 206/350 (59%), Gaps = 28/350 (8%)
 Frame = -1

Query  1037  FCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWI  858
             F + I   H L +     + TNITTD+ ALLSLK  +S DP   L+ NW+V+S   C W 
Sbjct  10    FTVLIITLHCLFISSAAVSGTNITTDQSALLSLKFHVSSDPTGGLS-NWTVSSPV-CTWA  67

Query  857   GVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLK  678
             G+TC +RH RV+ALN+ NMGL G + P+LGNLSFLVS++L  N F  + P +LS+LRRLK
Sbjct  68    GITCGARHRRVTALNISNMGLAGAIPPELGNLSFLVSIDLRNNTFAGTLPEDLSRLRRLK  127

Query  677   ILQCSFNDFSGNIPSWFGLL--------------------------QNLRFLYLGNNNIS  576
              ++ S+N+FSG +P WF LL                            L  L +  N++ 
Sbjct  128   FIRLSYNNFSGEVPPWFALLPQLQLLSLKNNSFTNMNSFFDSFANESKLETLDMSFNSLQ  187

Query  575   GFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsk  396
             G +P+S+ N+S LE L L  N L G IP+ IGNL  L  LN+  N  +GS P  + N+S 
Sbjct  188   GRIPSSIANMSNLETLILSNNLLRGVIPQSIGNLRNLNWLNIEGNELTGSIPSSLFNVST  247

Query  395   lenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNF  216
             LE +S S N L G LP D+   +P LQ   +  NK  G IPSS+S CS LQTLSL  N F
Sbjct  248   LELVSFSRNRLSGSLPDDMCIGVPFLQGVYLSFNKIGGNIPSSISSCSQLQTLSLSNNKF  307

Query  215   SGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             SG +PRE  +L  L+ L+L  N+LTG IP EIG L +L  + + NN L G
Sbjct  308   SGAIPREIASLEMLQILYLGFNELTGEIPSEIGKLQNLGFLAMENNFLRG  357


 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 89/243 (37%), Positives = 126/243 (52%), Gaps = 27/243 (11%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +   + + S L +L+LS N F  + PRE++ L  L+IL   FN+ +G IPS  G LQN
Sbjct  285  GNIPSSISSCSQLQTLSLSNNKFSGAIPREIASLEMLQILYLGFNELTGEIPSEIGKLQN  344

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFS  432
            L FL + NN + G +P  +FN+S L+ L L  N L+G I  EIGNL  L  L L  N+F+
Sbjct  345  LGFLAMENNFLRGPIPFGIFNMSFLQRLSLAQNELDGPIAEEIGNLTMLTELYLGHNNFT  404

Query  431  GSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCS  252
            G+ P  +                 G+L          L+I  + +N+ +G I S +   S
Sbjct  405  GAIPRGL-----------------GKL---------ALEILDLGTNRLTGNIHSDIFNIS  438

Query  251  LLQTLSLPFNNFSGHVPREFGN-LTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
             L  +SL  N+FSG +P   G  L  L +LFL  N L G +P  I   S L+++DLS N 
Sbjct  439  TLILISLTSNSFSGKLPANVGEFLPNLAQLFLGQNNLEGVLPSSIVNSSQLMVLDLSVNN  498

Query  74   LYG  66
              G
Sbjct  499  FNG  501


 Score =   111 bits (278),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 141/282 (50%), Gaps = 31/282 (11%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLR----------------  687
            L+L    L G +  ++GNL+ L  L L  NNF  + PR L +L                 
Sbjct  372  LSLAQNELDGPIAEEIGNLTMLTELYLGHNNFTGAIPRGLGKLALEILDLGTNRLTGNIH  431

Query  686  -------RLKILQCSFNDFSGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEV  531
                    L ++  + N FSG +P+  G  L NL  L+LG NN+ G LP+S+ N S+L V
Sbjct  432  SDIFNISTLILISLTSNSFSGKLPANVGEFLPNLAQLFLGQNNLEGVLPSSIVNSSQLMV  491

Query  530  LHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSG-------SFPLDIlnlsklenlslsv  372
            L L VN+  G IP  IGNL  L++LNL  N+F+        SF   + N   L  L++S 
Sbjct  492  LDLSVNNFNGPIPNSIGNLELLQVLNLEMNNFTSESASSDLSFIASLTNSRYLTELAVSY  551

Query  371  nsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREF  192
            N L G LP  +GN    LQ       K  G IP  +   S L +L    N+ +G +P   
Sbjct  552  NPLNGVLPSSIGNFSSSLQTIYASDCKIKGGIPIEIGNLSGLVSLYFYGNDLTGFIPTPL  611

Query  191  GNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             +L  L++L L +N+L G+I  ++ AL++L  + L+ N+L G
Sbjct  612  HDLQSLQRLSLGNNRLVGSISNDLCALNNLGALYLNENQLTG  653


 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 98/292 (34%), Positives = 143/292 (49%), Gaps = 35/292 (12%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHN-------SFPRELSQLRRLKILQCSFNDFSGNIPS  633
            G +   +GNL  L  LNL  NNF +       SF   L+  R L  L  S+N  +G +PS
Sbjct  501  GPIPNSIGNLELLQVLNLEMNNFTSESASSDLSFIASLTNSRYLTELAVSYNPLNGVLPS  560

Query  632  WFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLL  456
              G    +L+ +Y  +  I G +P  + NLS L  L+   N L G IP  + +L  L+ L
Sbjct  561  SIGNFSSSLQTIYASDCKIKGGIPIEIGNLSGLVSLYFYGNDLTGFIPTPLHDLQSLQRL  620

Query  455  NLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEI  276
            +L +N   GS   D+  L+ L  L L+ N L G++P  LGN +  L+   + SN  S  +
Sbjct  621  SLGNNRLVGSISNDLCALNNLGALYLNENQLTGQIPECLGN-VSTLRSIHLYSNNLSSVV  679

Query  275  PSSL-----------SKCSLLQTLS-------------LPFNNFSGHVPREFGNLTKLEK  168
            P+S+           S  S+  +LS             L  N FS ++P  FG L K+  
Sbjct  680  PNSIWNLQDLLELDISSNSITGSLSPQIGNLKAATFIDLSMNRFSDNIPTTFGGLQKVTN  739

Query  167  LFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDTP*LK*LSYYN  12
            L L  N   G IP  +G + SL+ +DLS+NKL G   ++L++  LK L Y+N
Sbjct  740  LSLAYNNFQGPIPDSMGTMLSLVSLDLSHNKLSGKIPKSLES--LKHLEYFN  789


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 78/247 (32%), Positives = 113/247 (46%), Gaps = 25/247 (10%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G +  ++GNLS LVSL    N+     P  L  L+ L+ L    N   G+I +    L N
Sbjct  581  GGIPIEIGNLSGLVSLYFYGNDLTGFIPTPLHDLQSLQRLSLGNNRLVGSISNDLCALNN  640

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFS  432
            L  LYL  N ++G +P  L N+S L  +HL  N+L   +P  I NL  L  L++S N  +
Sbjct  641  LGALYLNENQLTGQIPECLGNVSTLRSIHLYSNNLSSVVPNSIWNLQDLLELDISSNSIT  700

Query  431  GSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCS  252
            GS                        L   +GN L       +  N+FS  IP++     
Sbjct  701  GS------------------------LSPQIGN-LKAATFIDLSMNRFSDNIPTTFGGLQ  735

Query  251  LLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKL  72
             +  LSL +NNF G +P   G +  L  L L  N+L+G IP+ + +L  L   ++S N+L
Sbjct  736  KVTNLSLAYNNFQGPIPDSMGTMLSLVSLDLSHNKLSGKIPKSLESLKHLEYFNVSYNEL  795

Query  71   YGTFIQN  51
             G    N
Sbjct  796  SGEIPTN  802


 Score = 89.0 bits (219),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 84/249 (34%), Positives = 126/249 (51%), Gaps = 9/249 (4%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIP----SW  630
            L G L   + N S L+ L+LS NNF+   P  +  L  L++L    N+F+        S+
Sbjct  475  LEGVLPSSIVNSSQLMVLDLSVNNFNGPIPNSIGNLELLQVLNLEMNNFTSESASSDLSF  534

Query  629  FGLLQNLRF---LYLGNNNISGFLPTSLFNL-SKLEVLHLGVNSLEGSIPREIGNLFQLK  462
               L N R+   L +  N ++G LP+S+ N  S L+ ++     ++G IP EIGNL  L 
Sbjct  535  IASLTNSRYLTELAVSYNPLNGVLPSSIGNFSSSLQTIYASDCKIKGGIPIEIGNLSGLV  594

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             L    N  +G  P  + +L  L+ LSL  N L G +  DL   L  L    +  N+ +G
Sbjct  595  SLYFYGNDLTGFIPTPLHDLQSLQRLSLGNNRLVGSISNDLC-ALNNLGALYLNENQLTG  653

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
            +IP  L   S L+++ L  NN S  VP    NL  L +L + SN +TG++  +IG L + 
Sbjct  654  QIPECLGNVSTLRSIHLYSNNLSSVVPNSIWNLQDLLELDISSNSITGSLSPQIGNLKAA  713

Query  101  LIVDLSNNK  75
              +DLS N+
Sbjct  714  TFIDLSMNR  722


 Score = 85.9 bits (211),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 104/231 (45%), Gaps = 25/231 (11%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            +L  +   L G +   L +L  L  L+L  N    S   +L  L  L  L  + N  +G 
Sbjct  595  SLYFYGNDLTGFIPTPLHDLQSLQRLSLGNNRLVGSISNDLCALNNLGALYLNENQLTGQ  654

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IP   G +  LR ++L +NN+S  +P S++NL  L  L +  NS+ GS+  +IGNL    
Sbjct  655  IPECLGNVSTLRSIHLYSNNLSSVVPNSIWNLQDLLELDISSNSITGSLSPQIGNLKAAT  714

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             ++LS N FS + P                 + FG         L K+    +  N F G
Sbjct  715  FIDLSMNRFSDNIP-----------------TTFG--------GLQKVTNLSLAYNNFQG  749

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             IP S+     L +L L  N  SG +P+   +L  LE   +  N+L+G IP
Sbjct  750  PIPDSMGTMLSLVSLDLSHNKLSGKIPKSLESLKHLEYFNVSYNELSGEIP  800


 Score = 77.0 bits (188),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 103/208 (50%), Gaps = 8/208 (4%)
 Frame = -1

Query  650  SGNIPSWFGLLQNLR-----FLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            S  + +W G+    R      L + N  ++G +P  L NLS L  + L  N+  G++P +
Sbjct  60   SSPVCTWAGITCGARHRRVTALNISNMGLAGAIPPELGNLSFLVSIDLRNNTFAGTLPED  119

Query  485  IGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELP--LDLGNHLPKLQI  312
            +  L +LK + LS N+FSG  P     L     L    N+ F  +    D   +  KL+ 
Sbjct  120  LSRLRRLKFIRLSYNNFSGEVP-PWFALLPQLQLLSLKNNSFTNMNSFFDSFANESKLET  178

Query  311  FVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAI  132
              M  N   G IPSS++  S L+TL L  N   G +P+  GNL  L  L +  N+LTG+I
Sbjct  179  LDMSFNSLQGRIPSSIANMSNLETLILSNNLLRGVIPQSIGNLRNLNWLNIEGNELTGSI  238

Query  131  PREIGALSSLLIVDLSNNKLYGTFIQNL  48
            P  +  +S+L +V  S N+L G+   ++
Sbjct  239  PSSLFNVSTLELVSFSRNRLSGSLPDDM  266


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 90/209 (43%), Gaps = 36/209 (17%)
 Frame = -1

Query  833  NRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND  654
            N + AL L    L G++   LGN+S L S++L  NN  +  P  +  L+ L  L  S N 
Sbjct  639  NNLGALYLNENQLTGQIPECLGNVSTLRSIHLYSNNLSSVVPNSIWNLQDLLELDISSNS  698

Query  653  FSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
             +G++    G L+   F+ L  N  S  +PT+   L K+  L L  N+ +G IP  +G +
Sbjct  699  ITGSLSPQIGNLKAATFIDLSMNRFSDNIPTTFGGLQKVTNLSLAYNNFQGPIPDSMGTM  758

Query  473  FQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSN  294
              L  L+LS N  SG  P  +                           L  L+ F +  N
Sbjct  759  LSLVSLDLSHNKLSGKIPKSL-------------------------ESLKHLEYFNVSYN  793

Query  293  KFSGEIPSSLSKCSLLQTLSLPFNNFSGH  207
            + SGEIP+           + PF+NF+  
Sbjct  794  ELSGEIPT-----------NGPFSNFTSQ  811



>ref|XP_006449526.1| hypothetical protein CICLE_v10017696mg [Citrus clementina]
 gb|ESR62766.1| hypothetical protein CICLE_v10017696mg [Citrus clementina]
Length=413

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 149/329 (45%), Positives = 200/329 (61%), Gaps = 6/329 (2%)
 Frame = -1

Query  1034  CLSIFFFHSLMLCLTI---NAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCN  864
             CLSI     L+   T    +A TN+  D+ ALL+LK+ ++ DP ++LA NWS N+ + CN
Sbjct  5     CLSILAEAFLVYYFTFGIAHAVTNVGRDQSALLALKAHVTNDPLNVLASNWSTNT-SVCN  63

Query  863   WIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRR  684
             W GVTC+ RH RV+ALNL  MGL+G + P+LGNLSFL  LN++ N+F  + P +LS LRR
Sbjct  64    WFGVTCSPRHRRVTALNLAYMGLLGTIPPELGNLSFLSLLNVTNNSFSGTLPIQLSNLRR  123

Query  683   LKILQCSFNDFSG-NIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSL  507
             LK L    N+FS   IP W      L  LYL  N+  G +P S+ N+S L  L L  N  
Sbjct  124   LKYLSFRSNNFSSIEIPPWLDSFPKLEHLYLDGNSFIGTIPPSICNISSLLTLDLSFNQH  183

Query  506   EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
             +G +P  I N+  L  ++LS+N FSG  P  I N S L+N+ +  NSL G LP ++   L
Sbjct  184   QGHVPSSILNIPSLLAIDLSNNQFSGPMP-SIYNTSSLQNIDMQYNSLSGALPENMFRFL  242

Query  326   PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ  147
             P L+      N+ SG+IPS+L +C  L  LSL  NNF G +PRE GN+T L+ L+L    
Sbjct  243   PHLEELHFAYNQLSGQIPSTLFECKQLNILSLSVNNFIGSIPREIGNITMLKGLYLVYTN  302

Query  146   LTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             LTG IP EIG L  L ++ LS+N+L G  
Sbjct  303   LTGEIPGEIGNLQGLQVLALSSNRLTGVI  331


 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 98/194 (51%), Gaps = 24/194 (12%)
 Frame = -1

Query  764  LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNN  585
            L  L  L+ + N      P  L + ++L IL  S N+F G+IP   G +  L+ LYL   
Sbjct  242  LPHLEELHFAYNQLSGQIPSTLFECKQLNILSLSVNNFIGSIPREIGNITMLKGLYLVYT  301

Query  584  NISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIln  405
            N++G +P  + NL  L+VL L  N L G IP EI N+  L +L+L+ N            
Sbjct  302  NLTGEIPGEIGNLQGLQVLALSSNRLTGVIPPEIFNISSLTVLSLTANKL----------  351

Query  404  lsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPF  225
                           G LP ++G+ LP LQ  ++  N+ +G IPSS+S  S+L  + +P+
Sbjct  352  --------------LGNLPSNIGHSLPNLQQLILGGNRLTGPIPSSISNASMLTLIDMPY  397

Query  224  NNFSGHVPREFGNL  183
            N FSG +P   GNL
Sbjct  398  NLFSGFIPNSLGNL  411


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 62/119 (52%), Gaps = 1/119 (1%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +  L L    L GE+  ++GNL  L  L LS N      P E+  +  L +L  + N   
Sbjct  293  LKGLYLVYTNLTGEIPGEIGNLQGLQVLALSSNRLTGVIPPEIFNISSLTVLSLTANKLL  352

Query  647  GNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNL  474
            GN+PS  G  L NL+ L LG N ++G +P+S+ N S L ++ +  N   G IP  +GNL
Sbjct  353  GNLPSNIGHSLPNLQQLILGGNRLTGPIPSSISNASMLTLIDMPYNLFSGFIPNSLGNL  411



>ref|XP_007021926.1| Serine-threonine protein kinase, putative [Theobroma cacao]
 gb|EOY13451.1| Serine-threonine protein kinase, putative [Theobroma cacao]
Length=1051

 Score =   243 bits (620),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 146/305 (48%), Positives = 185/305 (61%), Gaps = 27/305 (9%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTC--NSRHNRVSALNLFNM  801
            NI  D+ ALL+LK+ ++ DP ++LA NWS  + + CNWIGVTC  NS H RV+ LNL NM
Sbjct  29   NIVHDQLALLALKAHVTHDPQNLLATNWSTTT-SVCNWIGVTCGSNSSHQRVTGLNLSNM  87

Query  800  GLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            GL+G + P LGNLSFL  LN   N+FH S P +L  L  LK +    N+FSG IPSWF  
Sbjct  88   GLIGTIPPRLGNLSFLTLLNTQFNHFHGSLPVDLVNLSWLKYINFGNNNFSGQIPSWFDS  147

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDN  441
               L+ L+L +NN SG +P+SL +LS LE L L  N LEG IP  IGNLF LK LNLS+N
Sbjct  148  FTQLQSLFLNDNNFSGVIPSSLGSLSNLEKLFLQENDLEGHIPIAIGNLFNLKWLNLSNN  207

Query  440  HFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLS  261
              S                        G+L   + +HLPKLQ   + SN  SG+IP++L 
Sbjct  208  QLS------------------------GQLTPAIFDHLPKLQYLNLESNHLSGKIPTNLF  243

Query  260  KCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSN  81
            KC  L+ L L  N   G VP++ GN+T L++L+L  N LTG IP  I  +SSL I+DL  
Sbjct  244  KCQELKILILSRNALEGSVPQKIGNMTTLKELYLNGNSLTGPIPFSIFNISSLQIIDLGY  303

Query  80   NKLYG  66
            NKL G
Sbjct  304  NKLSG  308


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 89/278 (32%), Positives = 134/278 (48%), Gaps = 25/278 (9%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            LNL N  L G+LTP +  +L  L  LNL  N+     P  L + + LKIL  S N   G+
Sbjct  202  LNLSNNQLSGQLTPAIFDHLPKLQYLNLESNHLSGKIPTNLFKCQELKILILSRNALEGS  261

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR-EIGNLFQL  465
            +P   G +  L+ LYL  N+++G +P S+FN+S L+++ LG N L G +       L  L
Sbjct  262  VPQKIGNMTTLKELYLNGNSLTGPIPFSIFNISSLQIIDLGYNKLSGHLSSNTFDQLAML  321

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFS  285
            +  +L  N  SG  P  +     LE L L  N L G +P ++GN L  L+   +++N   
Sbjct  322  QEFSLYRNQVSGRIPTSLFKCKHLEYLFLDDNQLEGSVPTEIGN-LTSLKFLALQNNNLE  380

Query  284  GEIPSSLSKCSLLQTLSLPFNN----------------------FSGHVPREFGNLTKLE  171
            G IPS++ + +LL  L    NN                      F G VP+   N   L 
Sbjct  381  GVIPSTIRRLTLLTYLDFSSNNLTAGIIFPKSCFLRSFRINSNQFEGPVPQCLINCKDLV  440

Query  170  KLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFI  57
             L L +N      P+ +G L++L I+ L +N+ +G  +
Sbjct  441  ILDLGNNNFNDTFPKWLGNLNNLQILVLRSNRFHGQIV  478


 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 79/275 (29%), Positives = 119/275 (43%), Gaps = 60/275 (22%)
 Frame = -1

Query  800  GLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN-------  642
             L G +   +GN++ L  L L+ N+     P  +  +  L+I+   +N  SG+       
Sbjct  257  ALEGSVPQKIGNMTTLKELYLNGNSLTGPIPFSIFNISSLQIIDLGYNKLSGHLSSNTFD  316

Query  641  ------------------IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGV  516
                              IP+     ++L +L+L +N + G +PT + NL+ L+ L L  
Sbjct  317  QLAMLQEFSLYRNQVSGRIPTSLFKCKHLEYLFLDDNQLEGSVPTEIGNLTSLKFLALQN  376

Query  515  NSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
            N+LEG IP  I  L  L  L+ S N+ +                               G
Sbjct  377  NNLEGVIPSTIRRLTLLTYLDFSSNNLTA------------------------------G  406

Query  335  NHLPK---LQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKL  165
               PK   L+ F + SN+F G +P  L  C  L  L L  NNF+   P+  GNL  L+ L
Sbjct  407  IIFPKSCFLRSFRINSNQFEGPVPQCLINCKDLVILDLGNNNFNDTFPKWLGNLNNLQIL  466

Query  164  FLRSNQLTGAI-PREIGALSSLL-IVDLSNNKLYG  66
             LRSN+  G I   E+ +  SLL I+D+S+N   G
Sbjct  467  VLRSNRFHGQIVSAEVASSFSLLRIIDISHNDFSG  501


 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 123/290 (42%), Gaps = 46/290 (16%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFND------------  654
            L G +  ++GNL+ L  L L  NN     P  + +L  L  L  S N+            
Sbjct  355  LEGSVPTEIGNLTSLKFLALQNNNLEGVIPSTIRRLTLLTYLDFSSNNLTAGIIFPKSCF  414

Query  653  ----------FSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLE  504
                      F G +P      ++L  L LGNNN +   P  L NL+ L++L L  N   
Sbjct  415  LRSFRINSNQFEGPVPQCLINCKDLVILDLGNNNFNDTFPKWLGNLNNLQILVLRSNRFH  474

Query  503  GSI-PREIGNLFQL-KLLNLSDNHFSGSFP----------------------LDIlnlsk  396
            G I   E+ + F L +++++S N FSG  P                      +     S 
Sbjct  475  GQIVSAEVASSFSLLRIIDISHNDFSGCLPSKFFESLLAMSNGIEKITGPIYMRYEYSSN  534

Query  395  lenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNF  216
            +     S         LD       L I    +N+F+G+IP  + +   L  L+L  N+ 
Sbjct  535  IVYYDDSFIFTIKGFELDYMRVYTFLAIIDFSNNRFNGQIPEIIGRLQSLFALNLSHNSL  594

Query  215  SGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            +G +P   GNL+ LE L L SN+L G IP ++  L  L++++LS N L G
Sbjct  595  TGPIPSSLGNLSNLESLDLSSNRLEGKIPAQLINLEFLMVLNLSWNNLIG  644


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 106/229 (46%), Gaps = 36/229 (16%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI-----PSWF  627
            G +   L N   LV L+L  NNF+++FP+ L  L  L+IL    N F G I      S F
Sbjct  427  GPVPQCLINCKDLVILDLGNNNFNDTFPKWLGNLNNLQILVLRSNRFHGQIVSAEVASSF  486

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN----------  477
             LL   R + + +N+ SG LP+  F    L  +  G+  + G I                
Sbjct  487  SLL---RIIDISHNDFSGCLPSKFF--ESLLAMSNGIEKITGPIYMRYEYSSNIVYYDDS  541

Query  476  -LFQLK--------------LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLD  342
             +F +K              +++ S+N F+G  P  I  L  L  L+LS NSL G +P  
Sbjct  542  FIFTIKGFELDYMRVYTFLAIIDFSNNRFNGQIPEIIGRLQSLFALNLSHNSLTGPIPSS  601

Query  341  LGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPRE  195
            LGN L  L+   + SN+  G+IP+ L     L  L+L +NN  G +PRE
Sbjct  602  LGN-LSNLESLDLSSNRLEGKIPAQLINLEFLMVLNLSWNNLIGPIPRE  649



>ref|XP_006356908.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230-like [Solanum tuberosum]
Length=327

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 139/286 (49%), Positives = 185/286 (65%), Gaps = 10/286 (3%)
 Frame = -1

Query  977  TNITTDKHALLSLKSKISFDPHS------ILADNWSVNSI--TPCNWIGVTCNSRHNRVS  822
             NI TD+ ALL+ KS IS           +L  NWS +SI  + C WIG+TCN RH RV+
Sbjct  14   ANIATDEAALLAFKSHISSSSDPNNNNVVVLQTNWS-SSIPSSVCTWIGITCNGRH-RVT  71

Query  821  ALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            AL++ +M L G + P LGNLSFL+SL++S N FH   P ELS LRRLK++  + N+FSG 
Sbjct  72   ALDISSMQLHGTIPPHLGNLSFLLSLDISNNTFHGDLPEELSHLRRLKLIDVTRNNFSGT  131

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IPS+  LL NLRF+YL NN  SG +P+SL NL+ L+ L +  N L+G IP EIGNL  L 
Sbjct  132  IPSFLSLLPNLRFVYLSNNQYSGEIPSSLSNLTNLQELRIQRNFLQGKIPPEIGNLRYLT  191

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             L+L  N  +GS P  I N++ L  L++  N L G+LP+D+ ++LP L++ ++ +N   G
Sbjct  192  FLDLQGNRLTGSIPSSIFNMTSLTTLAIIHNRLVGKLPVDICDNLPNLEVLLLSTNNLDG  251

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQL  144
             IP +L KCS LQ L+L  N F+G +PRE GNLT L  L L  N L
Sbjct  252  LIPPNLQKCSKLQLLTLSGNEFTGPIPRELGNLTMLTVLHLGENHL  297


 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 107/205 (52%), Gaps = 33/205 (16%)
 Frame = -1

Query  656  DFSGNIPS----WFGLLQNLRF----LYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEG  501
            ++S +IPS    W G+  N R     L + +  + G +P  L NLS L  L +  N+  G
Sbjct  47   NWSSSIPSSVCTWIGITCNGRHRVTALDISSMQLHGTIPPHLGNLSFLLSLDISNNTFHG  106

Query  500  SIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPK  321
             +P E+ +L +LKL++++ N+FSG+ P                   F  L       LP 
Sbjct  107  DLPEELSHLRRLKLIDVTRNNFSGTIP------------------SFLSL-------LPN  141

Query  320  LQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
            L+   + +N++SGEIPSSLS  + LQ L +  N   G +P E GNL  L  L L+ N+LT
Sbjct  142  LRFVYLSNNQYSGEIPSSLSNLTNLQELRIQRNFLQGKIPPEIGNLRYLTFLDLQGNRLT  201

Query  140  GAIPREIGALSSLLIVDLSNNKLYG  66
            G+IP  I  ++SL  + + +N+L G
Sbjct  202  GSIPSSIFNMTSLTTLAIIHNRLVG  226


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 79/161 (49%), Gaps = 25/161 (16%)
 Frame = -1

Query  542  KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsL  363
            ++  L +    L G+IP  +GNL  L  L++S+N F G  P ++                
Sbjct  69   RVTALDISSMQLHGTIPPHLGNLSFLLSLDISNNTFHGDLPEEL----------------  112

Query  362  FGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNL  183
                     +HL +L++  +  N FSG IPS LS    L+ + L  N +SG +P    NL
Sbjct  113  ---------SHLRRLKLIDVTRNNFSGTIPSFLSLLPNLRFVYLSNNQYSGEIPSSLSNL  163

Query  182  TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            T L++L ++ N L G IP EIG L  L  +DL  N+L G+ 
Sbjct  164  TNLQELRIQRNFLQGKIPPEIGNLRYLTFLDLQGNRLTGSI  204



>ref|XP_007212752.1| hypothetical protein PRUPE_ppa016624mg, partial [Prunus persica]
 gb|EMJ13951.1| hypothetical protein PRUPE_ppa016624mg, partial [Prunus persica]
Length=1066

 Score =   243 bits (619),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 152/329 (46%), Positives = 203/329 (62%), Gaps = 25/329 (8%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFN  804
            A TNITTD+ ALL+LKS I+  PH+IL  NWS  + + CNW+GVTC +RH RV++LNL  
Sbjct  25   AQTNITTDQSALLALKSHITSYPHNILF-NWSTTT-SVCNWVGVTCGARHLRVASLNLSY  82

Query  803  MGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
            MGL G + P LGNLSFLV L    N+F  + P+EL+ LRRLK++   +N+F G+IP WFG
Sbjct  83   MGLTGTIPPHLGNLSFLVELLFINNSFQGTLPQELAYLRRLKLISFRYNNFMGSIPLWFG  142

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
                L+ + L  N  SG +P  +FNLS L+V++L  N L GS+PREI NL  LK +NLS 
Sbjct  143  SFPKLQSIDLCGNQFSGSIPAIIFNLSTLQVINLSNNQLSGSVPREIRNLTMLKEINLSY  202

Query  443  NHF-----------------------SGSFPLDIlnlsklenlslsvnsLFGELPLDLGN  333
            N F                        G  PL + N+S L NL+L  N+L G LP ++  
Sbjct  203  NKFNEIPNEIGSLDELEKLYVQSNALKGHVPLGVFNMSSLTNLNLHGNNLSGSLPDNICQ  262

Query  332  HLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRS  153
             LP LQ   +  N+F G +PS L +C+ L  LSL  NNFSG +PR+ GNLT+L +++L  
Sbjct  263  QLPSLQELDLGLNQFDGPLPSKLWQCTQLLFLSLEENNFSGSIPRKIGNLTQLREIYLGV  322

Query  152  NQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            N LTG IP E+G L +L ++ +  N L G
Sbjct  323  NNLTGIIPNEMGDLQNLELLSIEQNNLNG  351


 Score =   117 bits (292),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 99/323 (31%), Positives = 148/323 (46%), Gaps = 78/323 (24%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G L   L   + L+ L+L +NNF  S PR++  L +L+ +    N+ +G IP+  G LQN
Sbjct  279  GPLPSKLWQCTQLLFLSLEENNFSGSIPRKIGNLTQLREIYLGVNNLTGIIPNEMGDLQN  338

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG----------------  480
            L  L +  NN++G +P+S+FN+SKL  L L +N L GS+P  IG                
Sbjct  339  LELLSIEQNNLNGLIPSSIFNISKLRALSLTLNKLSGSLPANIGLGVPNLQLLYIGATDV  398

Query  479  --------NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLP  324
                    N  +L  +++S N F+G+F L     S L+ +SL    + G +P+ +GN L 
Sbjct  399  SGVIPNLSNASKLTRISMSYNSFTGNFSL----TSSLQYISLHNCIMRGNIPIGIGN-LS  453

Query  323  KLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQL  144
             L    +  N+FSG IP+S+ +   LQ L+L  N   G++P +   L  L  L+L SNQL
Sbjct  454  SLVALELGDNQFSGSIPTSVGRLGDLQGLNLGGNKLQGYIPYQLCQLDNLAYLYLGSNQL  513

Query  143  TGAIP-------------------------------------------------REIGAL  111
            +G+IP                                                 ++IG L
Sbjct  514  SGSIPSCLGNLAPSLRSLLLESNSLSSTIPSTLWRLTYILHVNLSSNSLIGPLSQDIGNL  573

Query  110  SSLLIVDLSNNKLYGTFIQNLDT  42
              +L VDLSNN L G     + T
Sbjct  574  KVVLEVDLSNNHLSGVIPSTIGT  596


 Score =   113 bits (283),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 90/272 (33%), Positives = 131/272 (48%), Gaps = 46/272 (17%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            LNL    L G L  ++   L  L  L+L  N F    P +L Q  +L  L    N+FSG+
Sbjct  245  LNLHGNNLSGSLPDNICQQLPSLQELDLGLNQFDGPLPSKLWQCTQLLFLSLEENNFSGS  304

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IP   G L  LR +YLG NN++G +P  + +L  LE+L +  N+L G IP  I N+ +L+
Sbjct  305  IPRKIGNLTQLREIYLGVNNLTGIIPNEMGDLQNLELLSIEQNNLNGLIPSSIFNISKLR  364

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
             L+L+ N  SGS                        LP ++G  +P LQ+  + +   SG
Sbjct  365  ALSLTLNKLSGS------------------------LPANIGLGVPNLQLLYIGATDVSG  400

Query  281  EIPSSLSKCSLLQTLSLPFNNFS--------------------GHVPREFGNLTKLEKLF  162
             IP +LS  S L  +S+ +N+F+                    G++P   GNL+ L  L 
Sbjct  401  VIP-NLSNASKLTRISMSYNSFTGNFSLTSSLQYISLHNCIMRGNIPIGIGNLSSLVALE  459

Query  161  LRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            L  NQ +G+IP  +G L  L  ++L  NKL G
Sbjct  460  LGDNQFSGSIPTSVGRLGDLQGLNLGGNKLQG  491


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 139/290 (48%), Gaps = 48/290 (17%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL-  621
            L G +  ++G+L  L  L++ QNN +   P  +  + +L+ L  + N  SG++P+  GL 
Sbjct  325  LTGIIPNEMGDLQNLELLSIEQNNLNGLIPSSIFNISKLRALSLTLNKLSGSLPANIGLG  384

Query  620  LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNS--------------------LEG  501
            + NL+ LY+G  ++SG +P +L N SKL  + +  NS                    + G
Sbjct  385  VPNLQLLYIGATDVSGVIP-NLSNASKLTRISMSYNSFTGNFSLTSSLQYISLHNCIMRG  443

Query  500  SIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPK  321
            +IP  IGNL  L  L L DN FSGS P  +  L  L+ L+L  N L G +P  L   L  
Sbjct  444  NIPIGIGNLSSLVALELGDNQFSGSIPTSVGRLGDLQGLNLGGNKLQGYIPYQLC-QLDN  502

Query  320  LQIFVMRSNKFSGEIPSSLS-------------------------KCSLLQTLSLPFNNF  216
            L    + SN+ SG IPS L                          + + +  ++L  N+ 
Sbjct  503  LAYLYLGSNQLSGSIPSCLGNLAPSLRSLLLESNSLSSTIPSTLWRLTYILHVNLSSNSL  562

Query  215  SGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             G + ++ GNL  + ++ L +N L+G IP  IG L  L+ + L+NN L G
Sbjct  563  IGPLSQDIGNLKVVLEVDLSNNHLSGVIPSTIGTLRDLVNLSLANNNLEG  612


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 136/264 (52%), Gaps = 22/264 (8%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSF--------------------PRELSQLRRLKI  675
            V  + P+L N S L  +++S N+F  +F                    P  +  L  L  
Sbjct  398  VSGVIPNLSNASKLTRISMSYNSFTGNFSLTSSLQYISLHNCIMRGNIPIGIGNLSSLVA  457

Query  674  LQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSI  495
            L+   N FSG+IP+  G L +L+ L LG N + G++P  L  L  L  L+LG N L GSI
Sbjct  458  LELGDNQFSGSIPTSVGRLGDLQGLNLGGNKLQGYIPYQLCQLDNLAYLYLGSNQLSGSI  517

Query  494  PREIGNLF-QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKL  318
            P  +GNL   L+ L L  N  S + P  +  L+ + +++LS NSL G L  D+GN    L
Sbjct  518  PSCLGNLAPSLRSLLLESNSLSSTIPSTLWRLTYILHVNLSSNSLIGPLSQDIGNLKVVL  577

Query  317  QIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
            ++  + +N  SG IPS++     L  LSL  NN  G +P  F  L  L+ L L  N L+G
Sbjct  578  EVD-LSNNHLSGVIPSTIGTLRDLVNLSLANNNLEGPIPSSFHYLLSLQLLNLSRNNLSG  636

Query  137  AIPREIGALSSLLIVDLSNNKLYG  66
             IP+ + ALS L  +DLS N+L G
Sbjct  637  VIPKSLEALSLLKHLDLSFNRLQG  660


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/255 (32%), Positives = 112/255 (44%), Gaps = 50/255 (20%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            ++L N  + G +   +GNLS LV+L L  N F  S P  + +L  L+ L    N   G I
Sbjct  434  ISLHNCIMRGNIPIGIGNLSSLVALELGDNQFSGSIPTSVGRLGDLQGLNLGGNKLQGYI  493

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLE-----------------------VL  528
            P     L NL +LYLG+N +SG +P+ L NL+                          +L
Sbjct  494  PYQLCQLDNLAYLYLGSNQLSGSIPSCLGNLAPSLRSLLLESNSLSSTIPSTLWRLTYIL  553

Query  527  H--LGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGE  354
            H  L  NSL G + ++IGNL  +  ++LS+NH SG  P  I                   
Sbjct  554  HVNLSSNSLIGPLSQDIGNLKVVLEVDLSNNHLSGVIPSTI-------------------  594

Query  353  LPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKL  174
                    L  L    + +N   G IPSS      LQ L+L  NN SG +P+    L+ L
Sbjct  595  ------GTLRDLVNLSLANNNLEGPIPSSFHYLLSLQLLNLSRNNLSGVIPKSLEALSLL  648

Query  173  EKLFLRSNQLTGAIP  129
            + L L  N+L G IP
Sbjct  649  KHLDLSFNRLQGEIP  663


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 59/99 (60%), Gaps = 1/99 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P  LGN L  L   +  +N F G +P  L+    L+ +S  +NNF G +P  FG+  
Sbjct  87   GTIPPHLGN-LSFLVELLFINNSFQGTLPQELAYLRRLKLISFRYNNFMGSIPLWFGSFP  145

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGT  63
            KL+ + L  NQ +G+IP  I  LS+L +++LSNN+L G+
Sbjct  146  KLQSIDLCGNQFSGSIPAIIFNLSTLQVINLSNNQLSGS  184


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 66/117 (56%), Gaps = 2/117 (2%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            +NL +  L+G L+ D+GNL  ++ ++LS N+     P  +  LR L  L  + N+  G I
Sbjct  555  VNLSSNSLIGPLSQDIGNLKVVLEVDLSNNHLSGVIPSTIGTLRDLVNLSLANNNLEGPI  614

Query  638  PSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            PS F  L +L+ L L  NN+SG +P SL  LS L+ L L  N L+G IP   G  FQ
Sbjct  615  PSSFHYLLSLQLLNLSRNNLSGVIPKSLEALSLLKHLDLSFNRLQGEIP--TGGPFQ  669



>ref|XP_008344924.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Malus 
domestica]
Length=870

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 151/332 (45%), Positives = 194/332 (58%), Gaps = 24/332 (7%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVTCNSRHNRVSALNLF  807
            AHTN +TD  ALL+LK+ I+ DP +IL  NWS  S +  CNW+GVTC + H+RV+ALNL 
Sbjct  38   AHTNFSTDXSALLALKAHITSDPQNILTANWSSPSSSDICNWVGVTCGAHHHRVTALNLS  97

Query  806  NMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF  627
             MGL G + P LGNLSFL  L L  N+FH   P+ELS+LRRLK +    N+F G IPSWF
Sbjct  98   FMGLAGVIPPHLGNLSFLXELGLKNNSFHGPLPQELSRLRRLKKINFGNNNFMGTIPSWF  157

Query  626  GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLS  447
            G    L    L  N  SGF+P ++FNLS LE ++L  N L GSIPREIGNL  +K + L 
Sbjct  158  GSFAKLESFXLYGNGFSGFIPAAIFNLSALEGINLNRNQLSGSIPREIGNLTMVKGIYLD  217

Query  446  DNHFS-----------------------GSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
            DN F                        GS  L +LN+S L   SL  N++ G LP ++ 
Sbjct  218  DNKFEELPNEIGSLGQLEELXVQDNALKGSAFLPVLNISSLIAFSLFGNNMSGSLPDNIC  277

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
            +HL  +Q+  +  N+  G IPS L +C  L+ ++L  NNF G +P+  GNLT L K+F  
Sbjct  278  DHLWSVQLINLGQNQLDGPIPSKLWQCKELREITLQSNNFRGSIPKSLGNLTYLSKIFFF  337

Query  155  SNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            +N L G IP EIG L  L  + L  N L G  
Sbjct  338  NNDLEGTIPDEIGDLPQLENLALGINNLNGVI  369


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 144/284 (51%), Gaps = 3/284 (1%)
 Frame = -1

Query  911  SILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSF-LVSLNLS  735
            S+ ++N ++++ TP     ++C     ++  L L +  L   +    GNLS  L  + LS
Sbjct  456  SLSSNNLTIDASTPQAESTLSCLFNLRKLKGLYLLDNPLNTTIPASRGNLSTSLQDIYLS  515

Query  734  QNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSL  555
             +N   + P ++  L  L  L    +  +G IP+    LQNL+ LYL +N + G +P  L
Sbjct  516  FSNIRGNIPVDIGNLSSLIALSLEHSQLTGVIPTSIQGLQNLQALYLNDNELQGHIPYEL  575

Query  554  FNLSKLEVLHLGVNSLEGSIPREIGNL-FQLKLLNLSDNHFSGSFPLDIlnlsklenlsl  378
              L+ L  L LG N L GSIP  +G L   L+ L+L  N  +   P  +  L+ + +L+L
Sbjct  576  CQLNNLXELRLGGNRLSGSIPSCLGXLSVALRSLSLGSNLLTSKIPSSMWELNHILHLNL  635

Query  377  svnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPR  198
            S NSL G L  D+GN L  +    + +N FSG IP S+     +   SL  N   G +P 
Sbjct  636  SSNSLVGPLSEDIGN-LRDVVDMDLSNNYFSGNIPGSIGGLQNMINFSLANNYLQGPIPS  694

Query  197  EFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             F  L  LE L L  N L+G IP+ + AL  L  ++LS NKL G
Sbjct  695  SFKTLLSLEFLDLSKNNLSGEIPKSLEALLYLKHLNLSFNKLQG  738


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 86/287 (30%), Positives = 124/287 (43%), Gaps = 33/287 (11%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            V  +NL    L G +   L     L  + L  NNF  S P+ L  L  L  +    ND  
Sbjct  283  VQLINLGQNQLDGPIPSKLWQCKELREITLQSNNFRGSIPKSLGNLTYLSKIFFFNNDLE  342

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG----  480
            G IP   G L  L  L LG NN++G +P  LFN + +  + L  N L G +P  IG    
Sbjct  343  GTIPDEIGDLPQLENLALGINNLNGVIPFKLFNKTTIREISLFFNQLSGGLPANIGLNVP  402

Query  479  ---------------------NLFQLKLLNLSDNHFSGSFPLDI-------lnlsklenl  384
                                 N  +L+ L +S N  +G  P  +              NL
Sbjct  403  NLEYLGVARNNLVAGLLPNLSNASKLRDLEMSQNSLTGFLPSTLCSLKNLEYLSLSSNNL  462

Query  383  slsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSL-LQTLSLPFNNFSGH  207
            ++  ++   E  L    +L KL+   +  N  +  IP+S    S  LQ + L F+N  G+
Sbjct  463  TIDASTPQAESTLSCLFNLRKLKGLYLLDNPLNTTIPASRGNLSTSLQDIYLSFSNIRGN  522

Query  206  VPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            +P + GNL+ L  L L  +QLTG IP  I  L +L  + L++N+L G
Sbjct  523  IPVDIGNLSSLIALSLEHSQLTGVIPTSIQGLQNLQALYLNDNELQG  569


 Score = 85.9 bits (211),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 136/298 (46%), Gaps = 41/298 (14%)
 Frame = -1

Query  821  ALNLFNMGLVGELTPDLGNLSFLVSL-NLSQNNFHNSFPRELSQLRRLKILQCSFNDFSG  645
            A +LF   + G L  ++ +  + V L NL QN      P +L Q + L+ +    N+F G
Sbjct  260  AFSLFGNNMSGSLPDNICDHLWSVQLINLGQNQLDGPIPSKLWQCKELREITLQSNNFRG  319

Query  644  NIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQL  465
            +IP   G L  L  ++  NN++ G +P  + +L +LE L LG+N+L G IP ++ N   +
Sbjct  320  SIPKSLGNLTYLSKIFFFNNDLEGTIPDEIGDLPQLENLALGINNLNGVIPFKLFNKTTI  379

Query  464  KLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLF--GELPLDLGNHLPKLQIFVMRSNK  291
            + ++L  N  SG  P +I              +    G LP +L N   KL+   M  N 
Sbjct  380  REISLFFNQLSGGLPANIGLNVPNLEYLGVARNNLVAGLLP-NLSNA-SKLRDLEMSQNS  437

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFS--------------------------------GH  207
             +G +PS+L     L+ LSL  NN +                                  
Sbjct  438  LTGFLPSTLCSLKNLEYLSLSSNNLTIDASTPQAESTLSCLFNLRKLKGLYLLDNPLNTT  497

Query  206  VPREFGNL-TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG---TFIQNLD  45
            +P   GNL T L+ ++L  + + G IP +IG LSSL+ + L +++L G   T IQ L 
Sbjct  498  IPASRGNLSTSLQDIYLSFSNIRGNIPVDIGNLSSLIALSLEHSQLTGVIPTSIQGLQ  555


 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 87/285 (31%), Positives = 129/285 (45%), Gaps = 33/285 (12%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS----------  648
            LV  L P+L N S L  L +SQN+     P  L  L+ L+ L  S N+ +          
Sbjct  414  LVAGLLPNLSNASKLRDLEMSQNSLTGFLPSTLCSLKNLEYLSLSSNNLTIDASTPQAES  473

Query  647  ----------------------GNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKL  537
                                    IP+  G L  +L+ +YL  +NI G +P  + NLS L
Sbjct  474  TLSCLFNLRKLKGLYLLDNPLNTTIPASRGNLSTSLQDIYLSFSNIRGNIPVDIGNLSSL  533

Query  536  EVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFG  357
              L L  + L G IP  I  L  L+ L L+DN   G  P ++  L+ L  L L  N L G
Sbjct  534  IALSLEHSQLTGVIPTSIQGLQNLQALYLNDNELQGHIPYELCQLNNLXELRLGGNRLSG  593

Query  356  ELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTK  177
             +P  LG     L+   + SN  + +IPSS+ + + +  L+L  N+  G +  + GNL  
Sbjct  594  SIPSCLGXLSVALRSLSLGSNLLTSKIPSSMWELNHILHLNLSSNSLVGPLSEDIGNLRD  653

Query  176  LEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
            +  + L +N  +G IP  IG L +++   L+NN L G    +  T
Sbjct  654  VVDMDLSNNYFSGNIPGSIGGLQNMINFSLANNYLQGPIPSSFKT  698


 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L  ++   +  L+ ++ LNLS N+       ++  LR +  +  S N FSGNIP   G L
Sbjct  616  LTSKIPSSMWELNHILHLNLSSNSLVGPLSEDIGNLRDVVDMDLSNNYFSGNIPGSIGGL  675

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
            QN+    L NN + G +P+S   L  LE L L  N+L G IP+ +  L  LK LNLS N 
Sbjct  676  QNMINFSLANNYLQGPIPSSFKTLLSLEFLDLSKNNLSGEIPKSLEALLYLKHLNLSFNK  735

Query  437  FSGSFP  420
              G  P
Sbjct  736  LQGEVP  741



>ref|XP_002532618.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF29784.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=383

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 150/358 (42%), Positives = 200/358 (56%), Gaps = 28/358 (8%)
 Frame = -1

Query  1058  MEITRHYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNS  879
             ME  R    L I           +   TN+ TD+  LL+LK ++  DP+++LA NWS  +
Sbjct  1     MEKKRTCSILCIMMLLYSFFASLVEGVTNLATDQDGLLALKLRLIRDPNNLLATNWSTTT  60

Query  878   ITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPREL  699
              + C W+GVTC +RH RV+AL+L +MGL G + P LGNLSFLV ++   N+FH S P EL
Sbjct  61    -SVCTWVGVTCGARHGRVAALDLSDMGLTGTVPPHLGNLSFLVFISFYNNSFHGSLPNEL  119

Query  698   SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG  519
             S+LRR+K    + N FSG IPSW G    L+ L LG N  +G +P S FNLSKL    L 
Sbjct  120   SKLRRMKTFWLTKNYFSGEIPSWLGSFARLQQLSLGFNKFTGVIPVSFFNLSKLNFFDLS  179

Query  518   VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELP---  348
              N L+G IP+ IGNL  L++L+L  N+FSGS P  I N+S L+ + LS N L G +P   
Sbjct  180   SNKLQGYIPKAIGNLNSLRILSLEKNNFSGSIPSGIFNISSLQVIDLSDNRLSGSMPAIL  239

Query  347   ----------LDLG-------------NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL  237
                       LD G              HLP L+   +  N F G IPS+L +C  L+ L
Sbjct  240   DNNTMPSLLQLDFGFNNLTGHLPANMFTHLPNLEALYLSWNLFHGPIPSTLIRCKQLKHL  299

Query  236   SLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGA-IPREIGALSSLLIVDLSNNKLYG  66
              LP+N+F G + ++ GNLT L++L L  N   G  IP  IG L  +  + L  N L G
Sbjct  300   ILPYNHFEGSIDKDIGNLTMLQELNLDLNNFKGTEIPTSIGNLFYMERLTLHRNGLIG  357


 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 96/204 (47%), Gaps = 30/204 (15%)
 Frame = -1

Query  641  IPSWFGLLQNLRF-----LYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN  477
            + +W G+    R      L L +  ++G +P  L NLS L  +    NS  GS+P E+  
Sbjct  62   VCTWVGVTCGARHGRVAALDLSDMGLTGTVPPHLGNLSFLVFISFYNNSFHGSLPNELSK  121

Query  476  LFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRS  297
            L ++K   L+ N+FSG                        E+P  LG+   +LQ   +  
Sbjct  122  LRRMKTFWLTKNYFSG------------------------EIPSWLGS-FARLQQLSLGF  156

Query  296  NKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIG  117
            NKF+G IP S    S L    L  N   G++P+  GNL  L  L L  N  +G+IP  I 
Sbjct  157  NKFTGVIPVSFFNLSKLNFFDLSSNKLQGYIPKAIGNLNSLRILSLEKNNFSGSIPSGIF  216

Query  116  ALSSLLIVDLSNNKLYGTFIQNLD  45
             +SSL ++DLS+N+L G+    LD
Sbjct  217  NISSLQVIDLSDNRLSGSMPAILD  240


 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = -1

Query  755  LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNIS  576
            L +L LS N FH   P  L + ++LK L   +N F G+I    G L  L+ L L  NN  
Sbjct  272  LEALYLSWNLFHGPIPSTLIRCKQLKHLILPYNHFEGSIDKDIGNLTMLQELNLDLNNFK  331

Query  575  GF-LPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSF  423
            G  +PTS+ NL  +E L L  N L G IP  +GNL QLK L LS+N  +G F
Sbjct  332  GTEIPTSIGNLFYMERLTLHRNGLIGPIPSSLGNLTQLKRLILSENGLTGYF  383



>ref|XP_008364895.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=596

 Score =   236 bits (602),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 152/357 (43%), Positives = 201/357 (56%), Gaps = 34/357 (10%)
 Frame = -1

Query  1034  CLSIFFFHSLMLCLTIN----AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-  870
             CL   +   +  CLT      +HTNI+TD+ ALLSLK+ I+ DP +IL  NWS  S +  
Sbjct  35    CLCYIYMMIMANCLTAGVLAISHTNISTDQSALLSLKAHITSDPQNILTANWSSASNSNI  94

Query  869   CNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQL  690
             CNW+GV+C + H+RV+ LNL +MGL G + P LGNLSFLV L L  N+FH   P+ELS+L
Sbjct  95    CNWVGVSCGAGHHRVTDLNLSHMGLAGVIPPHLGNLSFLVELGLENNSFHGPLPQELSRL  154

Query  689   RRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNS  510
             RRLK +    N F G IPSWFG    L+ + L  N  SGF+P ++FNLS LE + LG N 
Sbjct  155   RRLKEINFGNNSFMGTIPSWFGSFAKLQTIKLYGNGFSGFIPATIFNLSALETIDLGRNQ  214

Query  509   LEGSIPREIGNLFQLKLLNLSDNHF-----------------------SGSFPLDIlnls  399
             L GSIPREIGNL  +K + L DN F                       + S  + + N+S
Sbjct  215   LSGSIPREIGNLTMVKGIYLDDNKFEELPNEMGSLVQLEELFVQSNALTASALVPVFNIS  274

Query  398   klenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNN  219
              L  L+L  N++ G LP ++  HL  ++IF    N+  G IPS L +C  L+ + L  NN
Sbjct  275   SLTILNLYGNNMSGSLPBNICEHLSSIRIFNFSGNQLDGLIPSKLWQCKELREILLYSNN  334

Query  218   FSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGAL------SSLLIVDLSNNKLYG  66
             F G +P+  GNLT L K+ L  N LT       G L      S L ++D+S N   G
Sbjct  335   FRGSIPKSLGNLTYLTKIXLGENHLTARTNVVAGLLPNLSNASKLRMLDMSENSFTG  391


 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 117/257 (46%), Gaps = 33/257 (13%)
 Frame = -1

Query  740  LSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNL------RFLYLGNNNI  579
            L  NNF  S P+ L  L  L  +    N  +       GLL NL      R L +  N+ 
Sbjct  330  LYSNNFRGSIPKSLGNLTYLTKIXLGENHLTARTNVVAGLLPNLSNASKLRMLDMSENSF  389

Query  578  SGFLPTSLFNLSKLEVLHLGVNSL--EGSIPREIG------NLFQLKLLNLSDNHFSGSF  423
            +GFLP++L +L  LE+L L  N+L  + S P+         NL  L  L+L DN  + + 
Sbjct  390  TGFLPSTLCSLKNLELLSLRSNNLTIDASTPQAASTLSCLFNLRNLTKLDLGDNPLNTTI  449

Query  422  PLDIlnlsklenlslsvnsLF-GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLL  246
            P    NLS          S   G +P+++GN L  L +  + +N+ SG IP+S+ +   L
Sbjct  450  PASRRNLSTSLLYVHLFGSNIRGNIPVEIGN-LSSLILLDLGNNQLSGAIPTSIQRLQNL  508

Query  245  QTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP-----------------REIG  117
            Q L L  N   GH+P E   L  L  L L  N+L+G+IP                   IG
Sbjct  509  QALGLFDNELQGHIPYELCQLNSLGFLNLAGNRLSGSIPSCLGTLALDHSLDGPLSEGIG  568

Query  116  ALSSLLIVDLSNNKLYG  66
             L  ++ +DLSNN   G
Sbjct  569  KLKDVVDMDLSNNHFSG  585


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 87/281 (31%), Positives = 131/281 (47%), Gaps = 23/281 (8%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDL-GNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            ++ LNL+   + G L  ++  +LS +   N S N      P +L Q + L+ +    N+F
Sbjct  276  LTILNLYGNNMSGSLPBNICEHLSSIRIFNFSGNQLDGLIPSKLWQCKELREILLYSNNF  335

Query  650  SGNIPSWFGLLQNLRFLYLGNNN-------ISGFLPTSLFNLSKLEVLHLGVNSLEGSIP  492
             G+IP   G L  L  + LG N+       ++G LP +L N SKL +L +  NS  G +P
Sbjct  336  RGSIPKSLGNLTYLTKIXLGENHLTARTNVVAGLLP-NLSNASKLRMLDMSENSFTGFLP  394

Query  491  REIGNLFQLKLLNLSDNHFS--GSFPLDIlnlsklenlslsvnsLFGELPLD--------  342
              + +L  L+LL+L  N+ +   S P     LS L NL        G+ PL+        
Sbjct  395  STLCSLKNLELLSLRSNNLTIDASTPQAASTLSCLFNLRNLTKLDLGDNPLNTTIPASRR  454

Query  341  -LGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKL  165
             L   L  + +F    +   G IP  +   S L  L L  N  SG +P     L  L+ L
Sbjct  455  NLSTSLLYVHLF---GSNIRGNIPVEIGNLSSLILLDLGNNQLSGAIPTSIQRLQNLQAL  511

Query  164  FLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
             L  N+L G IP E+  L+SL  ++L+ N+L G+    L T
Sbjct  512  GLFDNELQGHIPYELCQLNSLGFLNLAGNRLSGSIPSCLGT  552


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 84/198 (42%), Gaps = 33/198 (17%)
 Frame = -1

Query  767  NLSFLVSLNLSQNNFHNSFPRELSQLR-RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLG  591
            NL  L  L+L  N  + + P     L   L  +    ++  GNIP   G L +L  L LG
Sbjct  431  NLRNLTKLDLGDNPLNTTIPASRRNLSTSLLYVHLFGSNIRGNIPVEIGNLSSLILLDLG  490

Query  590  NNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDI  411
            NN +SG +PTS+  L  L+ L L  N L+G IP E+  L  L  LNL+ N  SGS P   
Sbjct  491  NNQLSGAIPTSIQRLQNLQALGLFDNELQGHIPYELCQLNSLGFLNLAGNRLSGSIP---  547

Query  410  lnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSL  231
                          S  G L LD               +   G +   + K   +  + L
Sbjct  548  --------------SCLGTLALD---------------HSLDGPLSEGIGKLKDVVDMDL  578

Query  230  PFNNFSGHVPREFGNLTK  177
              N+FSG++P   G L K
Sbjct  579  SNNHFSGNIPGSIGGLQK  596


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 98/199 (49%), Gaps = 24/199 (12%)
 Frame = -1

Query  995  LTINAHT-NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSA  819
            LTI+A T    +    L +L++    D    L DN  +N+  P         SR N  ++
Sbjct  413  LTIDASTPQAASTLSCLFNLRNLTKLD----LGDN-PLNTTIPA--------SRRNLSTS  459

Query  818  L---NLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            L   +LF   + G +  ++GNLS L+ L+L  N    + P  + +L+ L+ L    N+  
Sbjct  460  LLYVHLFGSNIRGNIPVEIGNLSSLILLDLGNNQLSGAIPTSIQRLQNLQALGLFDNELQ  519

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G+IP     L +L FL L  N +SG +P+    L  L + H    SL+G +   IG L  
Sbjct  520  GHIPYELCQLNSLGFLNLAGNRLSGSIPSC---LGTLALDH----SLDGPLSEGIGKLKD  572

Query  467  LKLLNLSDNHFSGSFPLDI  411
            +  ++LS+NHFSG+ P  I
Sbjct  573  VVDMDLSNNHFSGNIPGSI  591


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = -1

Query  359  GELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT  180
            G +P  LGN L  L    + +N F G +P  LS+   L+ ++   N+F G +P  FG+  
Sbjct  121  GVIPPHLGN-LSFLVELGLENNSFHGPLPQELSRLRRLKEINFGNNSFMGTIPSWFGSFA  179

Query  179  KLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            KL+ + L  N  +G IP  I  LS+L  +DL  N+L G+ 
Sbjct  180  KLQTIKLYGNGFSGFIPATIFNLSALETIDLGRNQLSGSI  219



>ref|XP_009759632.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR isoform X2 [Nicotiana sylvestris]
Length=1172

 Score =   242 bits (618),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 148/304 (49%), Positives = 199/304 (65%), Gaps = 5/304 (2%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            NI+TD+ +LL+LK++I+ DP++IL+ NWS +S T C WIG+TC SRH RV+ LN+  +G 
Sbjct  45   NISTDQSSLLALKARITSDPNNILSTNWS-SSTTVCKWIGITCGSRHQRVTVLNISGLGF  103

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             G + P LGNLSFLVSL+LS N FH   P E+S L RL+ +  S N  +G IPS+ G   
Sbjct  104  NGTIPPQLGNLSFLVSLDLSHNYFHGELPSEISHLPRLRAIDLSDNYLTGQIPSFSG---  160

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ-LKLLNLSDNH  438
            ++R L L  N+ SGF+P+S+  +  LE L LG N+LEG+IP+ I    Q LKLL+   N 
Sbjct  161  DIRMLSLEINSFSGFIPSSISRIKNLEFLKLGYNNLEGNIPKGIATDLQSLKLLSFGFNK  220

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             +GS  L I N+S LE+L L  + L G LP DL   LP+L+   +  NK  G+IP ++S+
Sbjct  221  LNGSNVLSIFNISLLEDLDLEKSGLSGNLPSDLCRRLPRLRKLELNFNKLRGQIPRTISE  280

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
            CSLLQ LSL  NN  G +PRE GNL  L+ L L +N L G IP EIG L +L ++ +  N
Sbjct  281  CSLLQVLSLMENNLDGTIPRELGNLKLLQDLTLGNNTLEGTIPSEIGHLYNLKLLVMEKN  340

Query  77   KLYG  66
            KL G
Sbjct  341  KLKG  344


 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 92/265 (35%), Positives = 137/265 (52%), Gaps = 26/265 (10%)
 Frame = -1

Query  839  RHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSF  660
            R  R+  L L    L G++   +   S L  L+L +NN   + PREL  L+ L+ L    
Sbjct  256  RLPRLRKLELNFNKLRGQIPRTISECSLLQVLSLMENNLDGTIPRELGNLKLLQDLTLGN  315

Query  659  NDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG  480
            N   G IPS  G L NL+ L +  N + G +P ++FN+S LE L++  N LEG +PR+IG
Sbjct  316  NTLEGTIPSEIGHLYNLKLLVMEKNKLKGPIPLTIFNISSLEFLYMSGNMLEGPLPRDIG  375

Query  479  NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMR  300
            NL  L  L+L +NH +G                         +P +LGN L +L    + 
Sbjct  376  NLTMLTALDLGNNHLTGV------------------------IPDELGN-LQELVDLSLY  410

Query  299  SNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGN-LTKLEKLFLRSNQLTGAIPRE  123
             N FSG IP  +   S L+++SL  N+FSG++P   G+ L  +E +FL  N + G +P  
Sbjct  411  LNNFSGSIPIGIFNISTLESISLSDNHFSGNLPSTIGHGLPNIEGIFLGENNINGILPSS  470

Query  122  IGALSSLLIVDLSNNKLYGTFIQNL  48
            I  LS L  ++L  N+L G+  ++L
Sbjct  471  ISNLSKLTALELGGNELTGSIPKSL  495


 Score =   126 bits (316),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 105/262 (40%), Positives = 146/262 (56%), Gaps = 11/262 (4%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            ++AL+L N  L G +  +LGNL  LV L+L  NNF  S P  +  +  L+ +  S N FS
Sbjct  380  LTALDLGNNHLTGVIPDELGNLQELVDLSLYLNNFSGSIPIGIFNISTLESISLSDNHFS  439

Query  647  GNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
            GN+PS  G  L N+  ++LG NNI+G LP+S+ NLSKL  L LG N L GSIP+ + NL 
Sbjct  440  GNLPSTIGHGLPNIEGIFLGENNINGILPSSISNLSKLTALELGGNELTGSIPKSLVNLR  499

Query  470  QLKLLNLSDNHFSG-----SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
             L++L+L  N F G     SF   I  L  L +L LS N L   LP  +GN    LQ F 
Sbjct  500  LLEVLHLQSNSFIGETSTLSF---ITPLINLVDLRLSFNPLNALLPKSIGNL--SLQWFS  554

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
                   G IP+ +     L +L L  N+F+G VP    +L  L++L L  N+++G  P 
Sbjct  555  AIGCNLKGHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLKNLQQLSLGVNRISGPFPN  614

Query  125  EIGALSSLLIVDLSNNKLYGTF  60
             +  LSSL  + LS N+++G+ 
Sbjct  615  GLCELSSLFFLKLSQNQMWGSI  636


 Score =   107 bits (268),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 115/221 (52%), Gaps = 1/221 (0%)
 Frame = -1

Query  728  NFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN  549
            N     P E+  L  L  L+   NDF+G +P+    L+NL+ L LG N ISG  P  L  
Sbjct  559  NLKGHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLKNLQQLSLGVNRISGPFPNGLCE  618

Query  548  LSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvn  369
            LS L  L L  N + GSIP  +G+L  L+ + L  N+F+ S P  + NL  +  L+LS N
Sbjct  619  LSSLFFLKLSQNQMWGSIPTCLGDLTSLREVYLDSNNFTSSIPSSLWNLKDILKLNLSSN  678

Query  368  sLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG  189
               G LPL+ GN L    +  +  N+ SG IP++L     +  L L  N   G +P  FG
Sbjct  679  FFNGSLPLEFGN-LKAAILLDLSWNQLSGNIPNTLGTLLKVTQLYLAHNRIEGSIPETFG  737

Query  188  NLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             L  LE L L  N ++G IP+ +  L  L   ++S N+L+G
Sbjct  738  KLVNLEALDLSYNNMSGVIPKSLEELKQLDSFNVSFNRLHG  778


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 117/249 (47%), Gaps = 27/249 (11%)
 Frame = -1

Query  869  CNWIGVTCNSRHNRV--SALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELS  696
            CN  G   N   N +  S+L L +    G +   + +L  L  L+L  N     FP  L 
Sbjct  558  CNLKGHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLKNLQQLSLGVNRISGPFPNGLC  617

Query  695  QLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGV  516
            +L  L  L+ S N   G+IP+  G L +LR +YL +NN +  +P+SL+NL  +  L+L  
Sbjct  618  ELSSLFFLKLSQNQMWGSIPTCLGDLTSLREVYLDSNNFTSSIPSSLWNLKDILKLNLSS  677

Query  515  NSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
            N   GS+P E GNL    LL+LS N  SG+                        +P  LG
Sbjct  678  NFFNGSLPLEFGNLKAAILLDLSWNQLSGN------------------------IPNTLG  713

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
              L   Q+++   N+  G IP +  K   L+ L L +NN SG +P+    L +L+   + 
Sbjct  714  TLLKVTQLYLAH-NRIEGSIPETFGKLVNLEALDLSYNNMSGVIPKSLEELKQLDSFNVS  772

Query  155  SNQLTGAIP  129
             N+L G IP
Sbjct  773  FNRLHGEIP  781



>ref|XP_009759631.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Nicotiana sylvestris]
Length=1183

 Score =   242 bits (618),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 148/304 (49%), Positives = 199/304 (65%), Gaps = 5/304 (2%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            NI+TD+ +LL+LK++I+ DP++IL+ NWS +S T C WIG+TC SRH RV+ LN+  +G 
Sbjct  45   NISTDQSSLLALKARITSDPNNILSTNWS-SSTTVCKWIGITCGSRHQRVTVLNISGLGF  103

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             G + P LGNLSFLVSL+LS N FH   P E+S L RL+ +  S N  +G IPS+ G   
Sbjct  104  NGTIPPQLGNLSFLVSLDLSHNYFHGELPSEISHLPRLRAIDLSDNYLTGQIPSFSG---  160

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ-LKLLNLSDNH  438
            ++R L L  N+ SGF+P+S+  +  LE L LG N+LEG+IP+ I    Q LKLL+   N 
Sbjct  161  DIRMLSLEINSFSGFIPSSISRIKNLEFLKLGYNNLEGNIPKGIATDLQSLKLLSFGFNK  220

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             +GS  L I N+S LE+L L  + L G LP DL   LP+L+   +  NK  G+IP ++S+
Sbjct  221  LNGSNVLSIFNISLLEDLDLEKSGLSGNLPSDLCRRLPRLRKLELNFNKLRGQIPRTISE  280

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNN  78
            CSLLQ LSL  NN  G +PRE GNL  L+ L L +N L G IP EIG L +L ++ +  N
Sbjct  281  CSLLQVLSLMENNLDGTIPRELGNLKLLQDLTLGNNTLEGTIPSEIGHLYNLKLLVMEKN  340

Query  77   KLYG  66
            KL G
Sbjct  341  KLKG  344


 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 92/265 (35%), Positives = 137/265 (52%), Gaps = 26/265 (10%)
 Frame = -1

Query  839  RHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSF  660
            R  R+  L L    L G++   +   S L  L+L +NN   + PREL  L+ L+ L    
Sbjct  256  RLPRLRKLELNFNKLRGQIPRTISECSLLQVLSLMENNLDGTIPRELGNLKLLQDLTLGN  315

Query  659  NDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIG  480
            N   G IPS  G L NL+ L +  N + G +P ++FN+S LE L++  N LEG +PR+IG
Sbjct  316  NTLEGTIPSEIGHLYNLKLLVMEKNKLKGPIPLTIFNISSLEFLYMSGNMLEGPLPRDIG  375

Query  479  NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMR  300
            NL  L  L+L +NH +G                         +P +LGN L +L    + 
Sbjct  376  NLTMLTALDLGNNHLTGV------------------------IPDELGN-LQELVDLSLY  410

Query  299  SNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGN-LTKLEKLFLRSNQLTGAIPRE  123
             N FSG IP  +   S L+++SL  N+FSG++P   G+ L  +E +FL  N + G +P  
Sbjct  411  LNNFSGSIPIGIFNISTLESISLSDNHFSGNLPSTIGHGLPNIEGIFLGENNINGILPSS  470

Query  122  IGALSSLLIVDLSNNKLYGTFIQNL  48
            I  LS L  ++L  N+L G+  ++L
Sbjct  471  ISNLSKLTALELGGNELTGSIPKSL  495


 Score =   126 bits (316),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 105/262 (40%), Positives = 146/262 (56%), Gaps = 11/262 (4%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            ++AL+L N  L G +  +LGNL  LV L+L  NNF  S P  +  +  L+ +  S N FS
Sbjct  380  LTALDLGNNHLTGVIPDELGNLQELVDLSLYLNNFSGSIPIGIFNISTLESISLSDNHFS  439

Query  647  GNIPSWFGL-LQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLF  471
            GN+PS  G  L N+  ++LG NNI+G LP+S+ NLSKL  L LG N L GSIP+ + NL 
Sbjct  440  GNLPSTIGHGLPNIEGIFLGENNINGILPSSISNLSKLTALELGGNELTGSIPKSLVNLR  499

Query  470  QLKLLNLSDNHFSG-----SFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
             L++L+L  N F G     SF   I  L  L +L LS N L   LP  +GN    LQ F 
Sbjct  500  LLEVLHLQSNSFIGETSTLSF---ITPLINLVDLRLSFNPLNALLPKSIGNL--SLQWFS  554

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
                   G IP+ +     L +L L  N+F+G VP    +L  L++L L  N+++G  P 
Sbjct  555  AIGCNLKGHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLKNLQQLSLGVNRISGPFPN  614

Query  125  EIGALSSLLIVDLSNNKLYGTF  60
             +  LSSL  + LS N+++G+ 
Sbjct  615  GLCELSSLFFLKLSQNQMWGSI  636


 Score =   107 bits (268),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 115/221 (52%), Gaps = 1/221 (0%)
 Frame = -1

Query  728  NFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN  549
            N     P E+  L  L  L+   NDF+G +P+    L+NL+ L LG N ISG  P  L  
Sbjct  559  NLKGHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLKNLQQLSLGVNRISGPFPNGLCE  618

Query  548  LSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvn  369
            LS L  L L  N + GSIP  +G+L  L+ + L  N+F+ S P  + NL  +  L+LS N
Sbjct  619  LSSLFFLKLSQNQMWGSIPTCLGDLTSLREVYLDSNNFTSSIPSSLWNLKDILKLNLSSN  678

Query  368  sLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG  189
               G LPL+ GN L    +  +  N+ SG IP++L     +  L L  N   G +P  FG
Sbjct  679  FFNGSLPLEFGN-LKAAILLDLSWNQLSGNIPNTLGTLLKVTQLYLAHNRIEGSIPETFG  737

Query  188  NLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             L  LE L L  N ++G IP+ +  L  L   ++S N+L+G
Sbjct  738  KLVNLEALDLSYNNMSGVIPKSLEELKQLDSFNVSFNRLHG  778


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 117/249 (47%), Gaps = 27/249 (11%)
 Frame = -1

Query  869  CNWIGVTCNSRHNRV--SALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELS  696
            CN  G   N   N +  S+L L +    G +   + +L  L  L+L  N     FP  L 
Sbjct  558  CNLKGHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLKNLQQLSLGVNRISGPFPNGLC  617

Query  695  QLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGV  516
            +L  L  L+ S N   G+IP+  G L +LR +YL +NN +  +P+SL+NL  +  L+L  
Sbjct  618  ELSSLFFLKLSQNQMWGSIPTCLGDLTSLREVYLDSNNFTSSIPSSLWNLKDILKLNLSS  677

Query  515  NSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLG  336
            N   GS+P E GNL    LL+LS N  SG+                        +P  LG
Sbjct  678  NFFNGSLPLEFGNLKAAILLDLSWNQLSGN------------------------IPNTLG  713

Query  335  NHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLR  156
              L   Q+++   N+  G IP +  K   L+ L L +NN SG +P+    L +L+   + 
Sbjct  714  TLLKVTQLYLAH-NRIEGSIPETFGKLVNLEALDLSYNNMSGVIPKSLEELKQLDSFNVS  772

Query  155  SNQLTGAIP  129
             N+L G IP
Sbjct  773  FNRLHGEIP  781



>ref|XP_009623595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Nicotiana tomentosiformis]
Length=1178

 Score =   242 bits (618),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 209/322 (65%), Gaps = 6/322 (2%)
 Frame = -1

Query  1025  IFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITP-CNWIGVT  849
             + FFH ++  L + +HTNITTD+ ALLSLKS+I  DP  +L ++WS    TP  +WIGVT
Sbjct  9     LLFFHLVVASLAM-SHTNITTDQLALLSLKSQIIADPFHLLYESWS--PATPISDWIGVT  65

Query  848   CNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ  669
             C  RH+RV +LN+ NM L G + P+ GNL+FLVSL+L  NNF+ + P+E+++L RL+ ++
Sbjct  66    CGPRHHRVKSLNISNMALTGRIPPNFGNLTFLVSLDLGSNNFYGNLPQEMARLHRLRFVR  125

Query  668   CSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR  489
               FN+FSG +PSWFG+L  L+ L L NN+ SG +P+   N+S L+ L L  NSLEG IP 
Sbjct  126   LGFNNFSGEVPSWFGVLHQLQVLTLRNNSFSGSIPSLFSNISTLQTLDLTCNSLEGHIPE  185

Query  488   EIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIF  309
             EIGN+  L+ L+L  N F+GS PL + N S L  L LS N L G +P ++G  L  L+I 
Sbjct  186   EIGNIENLRFLSLGGNKFTGSIPLSLSNASMLMTLELSQNFLEGNIPEEIG-RLQTLKIL  244

Query  308   VMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGN-LTKLEKLFLRSNQLTGAI  132
              + SN+ +G IP S+   S ++ ++   N  SG++P    + +  LEKL+L  N+L G +
Sbjct  245   SIESNQLTGSIPFSIFNISGIEVIAFTKNTLSGNLPAAMCDYIPMLEKLYLSKNELRGHM  304

Query  131   PREIGALSSLLIVDLSNNKLYG  66
             P  +   S+L ++ LS NK  G
Sbjct  305   PLSLPNCSNLQLLSLSYNKFDG  326


 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/229 (39%), Positives = 128/229 (56%), Gaps = 22/229 (10%)
 Frame = -1

Query  764  LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNN  585
            +  L  L LS+N      P  L     L++L  S+N F G I S  G+L NL  L L  N
Sbjct  287  IPMLEKLYLSKNELRGHMPLSLPNCSNLQLLSLSYNKFDGPIHSEIGILNNLVILGLETN  346

Query  584  NISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD-------------  444
            +ISG +P S FN+S L+VL L  N+L GS PRE+GNL +L++L+L+D             
Sbjct  347  HISGQIPVSTFNISSLQVLVLAHNNLIGSFPREVGNLTKLQILDLADNMLTGEIPKEVSN  406

Query  443  ---------NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNK  291
                     N F+GS P++I N+S + ++ L  N+L G LPLD+G+ LP +++  + +  
Sbjct  407  LIELFDMSFNKFTGSLPMEIFNISGMRSIQLIFNNLTGTLPLDIGSTLPNIEVLHLSNLN  466

Query  290  FSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQL  144
             SG IP SLS CS L +L L FN  +G +P   G LT+++ L L  N L
Sbjct  467  LSGTIPHSLSNCSKLTSLDLSFNRLTGLIPNSLGLLTRIQSLGLDVNNL  515


 Score = 95.9 bits (237),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 101/203 (50%), Gaps = 30/203 (15%)
 Frame = -1

Query  641  IPSWFGLL-----QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN  477
            I  W G+        ++ L + N  ++G +P +  NL+ L  L LG N+  G++P+E+  
Sbjct  58   ISDWIGVTCGPRHHRVKSLNISNMALTGRIPPNFGNLTFLVSLDLGSNNFYGNLPQEMAR  117

Query  476  LFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRS  297
            L +L+ + L  N+FSG  P                 S FG L         +LQ+  +R+
Sbjct  118  LHRLRFVRLGFNNFSGEVP-----------------SWFGVLH--------QLQVLTLRN  152

Query  296  NKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIG  117
            N FSG IPS  S  S LQTL L  N+  GH+P E GN+  L  L L  N+ TG+IP  + 
Sbjct  153  NSFSGSIPSLFSNISTLQTLDLTCNSLEGHIPEEIGNIENLRFLSLGGNKFTGSIPLSLS  212

Query  116  ALSSLLIVDLSNNKLYGTFIQNL  48
              S L+ ++LS N L G   + +
Sbjct  213  NASMLMTLELSQNFLEGNIPEEI  235


 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 102/263 (39%), Positives = 131/263 (50%), Gaps = 13/263 (5%)
 Frame = -1

Query  797  LVGELTPDLGN-LSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGL  621
            L G L  D+G+ L  +  L+LS  N   + P  LS   +L  L  SFN  +G IP+  GL
Sbjct  442  LTGTLPLDIGSTLPNIEVLHLSNLNLSGTIPHSLSNCSKLTSLDLSFNRLTGLIPNSLGL  501

Query  620  LQNLRFLYLGNNNISG-----FLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLL  456
            L  ++ L L  NN+       FL TSL N   L+ L +  N L G +P  +GNL    LL
Sbjct  502  LTRIQSLGLDVNNLMSDTRLSFL-TSLSNCRDLKFLFVSSNPLYGVLPASLGNLSVTSLL  560

Query  455  NL--SDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
                +D    G  P  I NLS L  L LS N L G +P  + N L  LQ   +  NK SG
Sbjct  561  RFRATDCRIKGEIPKGIGNLSSLLELDLSENGLTGSIPTTISN-LRSLQSCKLSHNKLSG  619

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSL  102
                 L K   L  L L  N  SG +P   GNLT L+++FL SN+    IP  IG L +L
Sbjct  620  FTQIDLCKLQNLGYLHLTQNQLSGSLPNCIGNLTSLQEIFLGSNKYRSDIPASIGNLINL  679

Query  101  LIVDLSNNKLYGTF---IQNLDT  42
            L +DLS+N L G+    I+NL  
Sbjct  680  LKLDLSSNNLGGSLPPEIRNLKA  702


 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 113/242 (47%), Gaps = 25/242 (10%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            GE+   +GNLS L+ L+LS+N    S P  +S LR L+  + S N  SG        LQN
Sbjct  571  GEIPKGIGNLSSLLELDLSENGLTGSIPTTISNLRSLQSCKLSHNKLSGFTQIDLCKLQN  630

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFS  432
            L +L+L  N +SG LP  + NL+ L+ + LG N     IP  IGNL  L  L+LS N+  
Sbjct  631  LGYLHLTQNQLSGSLPNCIGNLTSLQEIFLGSNKYRSDIPASIGNLINLLKLDLSSNNLG  690

Query  431  GSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCS  252
            GS P +I                          +L  +    +  N  S  IP  +    
Sbjct  691  GSLPPEI-------------------------RNLKAVIYIDLSMNTLSNGIPGGIGSLQ  725

Query  251  LLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKL  72
             L  LSL  N   G +P    +++ LE L L  N ++G IP+ +  L +L   D+S NKL
Sbjct  726  NLIHLSLRDNKLQGSIPDSMSSMSALEFLDLSHNNVSGLIPKSLEKLQNLKYFDVSFNKL  785

Query  71   YG  66
             G
Sbjct  786  VG  787


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 96/292 (33%), Positives = 135/292 (46%), Gaps = 31/292 (11%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            +  L+L N+ L G +   L N S L SL+LS N      P  L  L R++ L    N+  
Sbjct  457  IEVLHLSNLNLSGTIPHSLSNCSKLTSLDLSFNRLTGLIPNSLGLLTRIQSLGLDVNNLM  516

Query  647  GNIP-SWFGLLQN---LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGV------------  516
             +   S+   L N   L+FL++ +N + G LP SL NLS   +L                
Sbjct  517  SDTRLSFLTSLSNCRDLKFLFVSSNPLYGVLPASLGNLSVTSLLRFRATDCRIKGEIPKG  576

Query  515  --------------NSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlsl  378
                          N L GSIP  I NL  L+   LS N  SG   +D+  L  L  L L
Sbjct  577  IGNLSSLLELDLSENGLTGSIPTTISNLRSLQSCKLSHNKLSGFTQIDLCKLQNLGYLHL  636

Query  377  svnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPR  198
            + N L G LP  +GN L  LQ   + SNK+  +IP+S+     L  L L  NN  G +P 
Sbjct  637  TQNQLSGSLPNCIGN-LTSLQEIFLGSNKYRSDIPASIGNLINLLKLDLSSNNLGGSLPP  695

Query  197  EFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
            E  NL  +  + L  N L+  IP  IG+L +L+ + L +NKL G+   ++ +
Sbjct  696  EIRNLKAVIYIDLSMNTLSNGIPGGIGSLQNLIHLSLRDNKLQGSIPDSMSS  747


 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 90/272 (33%), Positives = 135/272 (50%), Gaps = 32/272 (12%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQN  612
            G++     N+S L  L L+ NN   SFPRE+  L +L+IL  + N  +G IP     L  
Sbjct  350  GQIPVSTFNISSLQVLVLAHNNLIGSFPREVGNLTKLQILDLADNMLTGEIPKEVSNL--  407

Query  611  LRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN-LFQLKLLNLSDNHF  435
            +    +  N  +G LP  +FN+S +  + L  N+L G++P +IG+ L  +++L+LS+ + 
Sbjct  408  IELFDMSFNKFTGSLPMEIFNISGMRSIQLIFNNLTGTLPLDIGSTLPNIEVLHLSNLNL  467

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELP-------------LDLGNHLP----------  324
            SG+ P  + N SKL +L LS N L G +P             LD+ N +           
Sbjct  468  SGTIPHSLSNCSKLTSLDLSFNRLTGLIPNSLGLLTRIQSLGLDVNNLMSDTRLSFLTSL  527

Query  323  ----KLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNN--FSGHVPREFGNLTKLEKLF  162
                 L+   + SN   G +P+SL   S+   L     +    G +P+  GNL+ L +L 
Sbjct  528  SNCRDLKFLFVSSNPLYGVLPASLGNLSVTSLLRFRATDCRIKGEIPKGIGNLSSLLELD  587

Query  161  LRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            L  N LTG+IP  I  L SL    LS+NKL G
Sbjct  588  LSENGLTGSIPTTISNLRSLQSCKLSHNKLSG  619


 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 66/123 (54%), Gaps = 0/123 (0%)
 Frame = -1

Query  788  ELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNL  609
            ++   +GNL  L+ L+LS NN   S P E+  L+ +  +  S N  S  IP   G LQNL
Sbjct  668  DIPASIGNLINLLKLDLSSNNLGGSLPPEIRNLKAVIYIDLSMNTLSNGIPGGIGSLQNL  727

Query  608  RFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSG  429
              L L +N + G +P S+ ++S LE L L  N++ G IP+ +  L  LK  ++S N   G
Sbjct  728  IHLSLRDNKLQGSIPDSMSSMSALEFLDLSHNNVSGLIPKSLEKLQNLKYFDVSFNKLVG  787

Query  428  SFP  420
              P
Sbjct  788  EIP  790



>ref|XP_006448720.1| hypothetical protein CICLE_v10017727mg [Citrus clementina]
 gb|ESR61960.1| hypothetical protein CICLE_v10017727mg [Citrus clementina]
Length=1190

 Score =   241 bits (616),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 148/335 (44%), Positives = 198/335 (59%), Gaps = 25/335 (7%)
 Frame = -1

Query  983  AHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFN  804
            A TN+TTD+ ALL+LK  I  DP ++LA+NWS  S + C+WIGV C  R+ RV+ALN+  
Sbjct  3    AVTNVTTDQFALLALKEHIKHDPSNLLANNWSTTS-SVCSWIGVACGVRNRRVTALNISY  61

Query  803  MGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
             GL G + P LGNLSFL  L +  N+F  S P ELS LRRLK     FN+F   IPSWF 
Sbjct  62   FGLTGTIPPQLGNLSFLAELAIRNNSFFGSLPEELSHLRRLKYFDFRFNNFHIEIPSWFV  121

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
             L  L+ L L +N+  G +P ++  LS L+ L L  N L G+IP  I N+  L++L+ S 
Sbjct  122  SLPRLQHLLLKHNSFVGKIPETIGYLSLLQELDLSDNQLSGTIPSSIFNISSLEILDFSG  181

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N  SGSFP    N+  L  + LS N L G LP ++ N+LP L+   +  N   GEIPS+L
Sbjct  182  NQLSGSFPSIAFNMPSLFVIDLSDNGLSGGLPSNIFNYLPSLKFLFLSGNMLDGEIPSTL  241

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGA----------  114
            SKC  +++LSL  NNF+G +PRE GNLT+LE ++L  N+L G IP E+G           
Sbjct  242  SKCQQMESLSLSLNNFTGAIPREIGNLTELESMYLGHNKLEGKIPEELGNLPKLELLLLP  301

Query  113  --------------LSSLLIVDLSNNKLYGTFIQN  51
                          +SSL  +DL+ N+L G+   N
Sbjct  302  NNVLTGSIPSQIFNISSLTNLDLTYNRLVGSLPDN  336


 Score =   132 bits (333),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 147/276 (53%), Gaps = 25/276 (9%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNI  639
            L+L +  L G +   + N+S L  L+ S N    SFP     +  L ++  S N  SG +
Sbjct  153  LDLSDNQLSGTIPSSIFNISSLEILDFSGNQLSGSFPSIAFNMPSLFVIDLSDNGLSGGL  212

Query  638  PS-WFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            PS  F  L +L+FL+L  N + G +P++L    ++E L L +N+  G+IPREIGNL +L+
Sbjct  213  PSNIFNYLPSLKFLFLSGNMLDGEIPSTLSKCQQMESLSLSLNNFTGAIPREIGNLTELE  272

Query  461  LLNLSDNHF------------------------SGSFPLDIlnlsklenlslsvnsLFGE  354
             + L  N                          +GS P  I N+S L NL L+ N L G 
Sbjct  273  SMYLGHNKLEGKIPEELGNLPKLELLLLPNNVLTGSIPSQIFNISSLTNLDLTYNRLVGS  332

Query  353  LPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKL  174
            LP +   +LP L+   +  N+ +G IP++L KC  L  +SL FN F G +PR+ GNLT +
Sbjct  333  LPDNTCQNLPVLEGLFISYNQLTGPIPTNLWKCRELHVVSLAFNKFQGGIPRDIGNLTSV  392

Query  173  EKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             KLFL +N L G IP EIG L +L ++ + ++ L G
Sbjct  393  RKLFLGNNSLIGEIPNEIGNLRNLEVLGVQSSNLAG  428


 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 96/252 (38%), Positives = 125/252 (50%), Gaps = 34/252 (13%)
 Frame = -1

Query  797  LVGELTPD--LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFG  624
            LVG L PD    NL  L  L +S N      P  L + R L ++  +FN F G IP   G
Sbjct  329  LVGSL-PDNTCQNLPVLEGLFISYNQLTGPIPTNLWKCRELHVVSLAFNKFQGGIPRDIG  387

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
             L ++R L+LGNN++ G +P  + NL  LEVL +  ++L G IP  I N+  LK L ++D
Sbjct  388  NLTSVRKLFLGNNSLIGEIPNEIGNLRNLEVLGVQSSNLAGLIPASIFNISTLKELAVTD  447

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N   GS P  I                      DLG  LP L+   +  N FSG IPSSL
Sbjct  448  NDLLGSLPSSI----------------------DLG--LPNLERLFLGENNFSGTIPSSL  483

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLL-----  99
            +  S L  +   FN+FSG +P  FGNL  L+ L L  N LT   P ++  LSSL      
Sbjct  484  TNISELSVIDFGFNSFSGFIPTTFGNLRSLKLLSLAGNVLTSPTP-DLSFLSSLTSCRNL  542

Query  98   -IVDLSNNKLYG  66
             I+ LS N + G
Sbjct  543  EIIYLSENPING  554


 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 134/246 (54%), Gaps = 8/246 (3%)
 Frame = -1

Query  791  GELTPDLGNLSF-LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            G L   +GN S  + SL++   N   + P+EL  +  L +++   N+ +G IP   G LQ
Sbjct  554  GILPSSIGNFSISMKSLSMESCNISGAIPKELGNINNLTVIRLGNNELTGTIPVTLGRLQ  613

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             L+ LYL NN + G +P  L +L +L  L+LG N L G +P  +GNL  L+ L+L  N  
Sbjct  614  KLQGLYLQNNKLEGSIPEDLCHLYRLANLYLGDNKLSGRLPACLGNLTSLRDLSLGSNAL  673

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV---MRSNKFSGEIPSSL  264
            +   P  + NL  +  L+LS NSL G L  D+GN    L++ +   +  N  SG IP ++
Sbjct  674  TSIIPSTLWNLKDILRLNLSSNSLNGSLLPDIGN----LKVVIEMDLSLNALSGVIPVTV  729

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
                 +Q LSL +N   G +P  FG L  L  + + +N L+G IP+ + ALS L  ++LS
Sbjct  730  GALQSVQLLSLRYNRLQGPIPESFGGLKSLNFVDMSNNNLSGTIPKSMEALSYLKYLNLS  789

Query  83   NNKLYG  66
             N+L G
Sbjct  790  FNQLEG  795


 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 134/249 (54%), Gaps = 8/249 (3%)
 Frame = -1

Query  776  DLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLY  597
            DLG L  L  L L +NNF  + P  L+ +  L ++   FN FSG IP+ FG L++L+ L 
Sbjct  459  DLG-LPNLERLFLGENNFSGTIPSSLTNISELSVIDFGFNSFSGFIPTTFGNLRSLKLLS  517

Query  596  LGNNNISGFLP-----TSLFNLSKLEVLHLGVNSLEGSIPREIGNL-FQLKLLNLSDNHF  435
            L  N ++   P     +SL +   LE+++L  N + G +P  IGN    +K L++   + 
Sbjct  518  LAGNVLTSPTPDLSFLSSLTSCRNLEIIYLSENPINGILPSSIGNFSISMKSLSMESCNI  577

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            SG+ P ++ N++ L  + L  N L G +P+ LG  L KLQ   +++NK  G IP  L   
Sbjct  578  SGAIPKELGNINNLTVIRLGNNELTGTIPVTLG-RLQKLQGLYLQNNKLEGSIPEDLCHL  636

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              L  L L  N  SG +P   GNLT L  L L SN LT  IP  +  L  +L ++LS+N 
Sbjct  637  YRLANLYLGDNKLSGRLPACLGNLTSLRDLSLGSNALTSIIPSTLWNLKDILRLNLSSNS  696

Query  74   LYGTFIQNL  48
            L G+ + ++
Sbjct  697  LNGSLLPDI  705


 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 95/264 (36%), Positives = 136/264 (52%), Gaps = 10/264 (4%)
 Frame = -1

Query  782  TPDLGNLSFLVS------LNLSQNNFHNSFPRELSQLR-RLKILQCSFNDFSGNIPSWFG  624
            TPDL  LS L S      + LS+N  +   P  +      +K L     + SG IP   G
Sbjct  527  TPDLSFLSSLTSCRNLEIIYLSENPINGILPSSIGNFSISMKSLSMESCNISGAIPKELG  586

Query  623  LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSD  444
             + NL  + LGNN ++G +P +L  L KL+ L+L  N LEGSIP ++ +L++L  L L D
Sbjct  587  NINNLTVIRLGNNELTGTIPVTLGRLQKLQGLYLQNNKLEGSIPEDLCHLYRLANLYLGD  646

Query  443  NHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSL  264
            N  SG  P  + NL+ L +LSL  N+L   +P  L N L  +    + SN  +G +   +
Sbjct  647  NKLSGRLPACLGNLTSLRDLSLGSNALTSIIPSTLWN-LKDILRLNLSSNSLNGSLLPDI  705

Query  263  SKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLS  84
                ++  + L  N  SG +P   G L  ++ L LR N+L G IP   G L SL  VD+S
Sbjct  706  GNLKVVIEMDLSLNALSGVIPVTVGALQSVQLLSLRYNRLQGPIPESFGGLKSLNFVDMS  765

Query  83   NNKLYGTFIQNLDTP*LK*LSYYN  12
            NN L GT  ++++   L  L Y N
Sbjct  766  NNNLSGTIPKSMEA--LSYLKYLN  787


 Score =   108 bits (269),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 83/233 (36%), Positives = 124/233 (53%), Gaps = 1/233 (0%)
 Frame = -1

Query  827  VSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFS  648
            + +L++ +  + G +  +LGN++ L  + L  N    + P  L +L++L+ L    N   
Sbjct  567  MKSLSMESCNISGAIPKELGNINNLTVIRLGNNELTGTIPVTLGRLQKLQGLYLQNNKLE  626

Query  647  GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
            G+IP     L  L  LYLG+N +SG LP  L NL+ L  L LG N+L   IP  + NL  
Sbjct  627  GSIPEDLCHLYRLANLYLGDNKLSGRLPACLGNLTSLRDLSLGSNALTSIIPSTLWNLKD  686

Query  467  LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
            +  LNLS N  +GS   DI NL  +  + LS+N+L G +P+ +G  L  +Q+  +R N+ 
Sbjct  687  ILRLNLSSNSLNGSLLPDIGNLKVVIEMDLSLNALSGVIPVTVG-ALQSVQLLSLRYNRL  745

Query  287  SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
             G IP S      L  + +  NN SG +P+    L+ L+ L L  NQL G IP
Sbjct  746  QGPIPESFGGLKSLNFVDMSNNNLSGTIPKSMEALSYLKYLNLSFNQLEGEIP  798


 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 96/206 (47%), Gaps = 30/206 (15%)
 Frame = -1

Query  650  SGNIPSWFGLLQNLRFLYLGNNNIS-----GFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            + ++ SW G+   +R   +   NIS     G +P  L NLS L  L +  NS  GS+P E
Sbjct  36   TSSVCSWIGVACGVRNRRVTALNISYFGLTGTIPPQLGNLSFLAELAIRNNSFFGSLPEE  95

Query  485  IGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
            + +L +LK  +   N+F    P   +                          LP+LQ  +
Sbjct  96   LSHLRRLKYFDFRFNNFHIEIPSWFV-------------------------SLPRLQHLL  130

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
            ++ N F G+IP ++   SLLQ L L  N  SG +P    N++ LE L    NQL+G+ P 
Sbjct  131  LKHNSFVGKIPETIGYLSLLQELDLSDNQLSGTIPSSIFNISSLEILDFSGNQLSGSFPS  190

Query  125  EIGALSSLLIVDLSNNKLYGTFIQNL  48
                + SL ++DLS+N L G    N+
Sbjct  191  IAFNMPSLFVIDLSDNGLSGGLPSNI  216



>emb|CDP16051.1| unnamed protein product [Coffea canephora]
Length=843

 Score =   239 bits (610),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 146/341 (43%), Positives = 199/341 (58%), Gaps = 32/341 (9%)
 Frame = -1

Query  1058  MEITRHYFCLSIFF---FHSLMLCLTINAHTNITTDKHALLSLKSKISF-DPHSILADNW  891
             ME   ++F   +FF   + S  L +T    TNITTD+HALL+L++ I+  DPH IL +NW
Sbjct  1     MEKLSYHFLQGLFFLLYYVSASLAMTT---TNITTDQHALLALRAHITVQDPHQILLENW  57

Query  890   SVNSITPCNWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSF  711
             S +S   C W GVTC SRH RV+AL+L NM L G + P LGN+SFLVSLN+S+NNF+   
Sbjct  58    SASSPV-CQWAGVTCGSRHLRVTALDLSNMNLSGIIPPQLGNMSFLVSLNMSKNNFYGEL  116

Query  710   PRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEV  531
             P E ++LRRL++L    N+  G  P WFG    LR L L NN+ +GF+  SL N+SKLE 
Sbjct  117   PHEFARLRRLRVLDLDANNLGGEFPDWFGSFHQLRLLSLSNNSFTGFISPSLANVSKLET  176

Query  530   LHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGEL  351
             L L  N L+G+IP EI  +  L+L+    N  SGS                        +
Sbjct  177   LSLSFNYLQGNIPTEIFKISSLELIFFQGNSLSGS------------------------V  212

Query  350   PLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLE  171
             P D+  HL +L+   +  NK +G+IPSS+  CS LQ L L +N F+G +P+E G L  LE
Sbjct  213   PDDMCRHLQRLKWIDLSRNKLNGQIPSSIYNCSQLQVLHLSWNYFTGFIPKEIGTLKALE  272

Query  170   KLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNL  48
             +L+L  N L G IP+E+G L+ L  +    N + G   Q +
Sbjct  273   RLYLTYNSLQGEIPKEMGNLTVLKTLGFGVNHITGAIPQEI  313


 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 122/201 (61%), Gaps = 0/201 (0%)
 Frame = -1

Query  746  LNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFL  567
            ++LS+N  +   P  +    +L++L  S+N F+G IP   G L+ L  LYL  N++ G +
Sbjct  226  IDLSRNKLNGQIPSSIYNCSQLQVLHLSWNYFTGFIPKEIGTLKALERLYLTYNSLQGEI  285

Query  566  PTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklen  387
            P  + NL+ L+ L  GVN + G+IP+EI  L  L+ L L+ N+ +G  P+ + NLS++  
Sbjct  286  PKEMGNLTVLKTLGFGVNHITGAIPQEISKLCYLEQLYLASNNITGFIPMQVFNLSQIRT  345

Query  386  lslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGH  207
            +SL+ N L G LP  +GN LP L+  ++  N F G IP S+S CS L+ ++L +NNF+G 
Sbjct  346  VSLTENQLSGNLPSRVGNGLPNLEELLLNHNNFGGSIPDSISNCSKLKMITLAYNNFTGS  405

Query  206  VPREFGNLTKLEKLFLRSNQL  144
            +P  FG+L  LE L L  N L
Sbjct  406  IPNSFGDLRLLEVLALNGNNL  426


 Score =   107 bits (267),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 90/254 (35%), Positives = 135/254 (53%), Gaps = 12/254 (5%)
 Frame = -1

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
             G +  ++G L  L  L L+ N+     P+E+  L  LK L    N  +G IP     L 
Sbjct  258  TGFIPKEIGTLKALERLYLTYNSLQGEIPKEMGNLTVLKTLGFGVNHITGAIPQEISKLC  317

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN-LFQLKLLNLSDNH  438
             L  LYL +NNI+GF+P  +FNLS++  + L  N L G++P  +GN L  L+ L L+ N+
Sbjct  318  YLEQLYLASNNITGFIPMQVFNLSQIRTVSLTENQLSGNLPSRVGNGLPNLEELLLNHNN  377

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPS----  270
            F GS P  I N SKL+ ++L+ N+  G +P   G+ L  L++  +  N    +  S    
Sbjct  378  FGGSIPDSISNCSKLKMITLAYNNFTGSIPNSFGD-LRLLEVLALNGNNLMSDYSSSNSE  436

Query  269  -----SLSKCSLLQTLSLPFNNFSGHVPREFGNL-TKLEKLFLRSNQLTGAIPREIGALS  108
                 SL+ C  L+ L +  N  +G +P   GNL T LE ++  +  + G IP EIG LS
Sbjct  437  LSWFNSLANCKHLRLLVVSDNPLNGILPNSIGNLSTSLEDMYAINCNIRGRIPDEIGNLS  496

Query  107  SLLIVDLSNNKLYG  66
            SL I+ + +N+L G
Sbjct  497  SLTILSMYSNQLSG  510


 Score = 91.7 bits (226),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 105/314 (33%), Positives = 146/314 (46%), Gaps = 6/314 (2%)
 Frame = -1

Query  1004  MLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRV  825
             M+ L  N  T    +    L L   ++ + +++++D  S NS    +W     N +H R+
Sbjct  394   MITLAYNNFTGSIPNSFGDLRLLEVLALNGNNLMSDYSSSNS--ELSWFNSLANCKHLRL  451

Query  824   SALNLFNMGLVGELTPDLGNLSFLVSLNLSQN-NFHNSFPRELSQLRRLKILQCSFNDFS  648
               L + +  L G L   +GNLS  +    + N N     P E+  L  L IL    N  S
Sbjct  452   --LVVSDNPLNGILPNSIGNLSTSLEDMYAINCNIRGRIPDEIGNLSSLTILSMYSNQLS  509

Query  647   GNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQ  468
             G +P     L+ L+ + L +N +S      L  L  L VL+LG N + GS+P  IGN+  
Sbjct  510   GMLPITMKNLEKLQGIDLQDNKLSKTSLDYLCVLQNLAVLYLGANQISGSLPECIGNVTS  569

Query  467   LKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKF  288
             L+ L L  N  + S P  I NL  L  L LS NSL G LP  + N L    +  +  N+ 
Sbjct  570   LRYLYLGSNLLNSSLPTTIWNLKDLLELDLSSNSLSGSLPPKIRN-LKAAILIDLSINEI  628

Query  287   SGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALS  108
             SG IPSS+     LQ LSL  N   G +P   G    LE L L  N  TG IP  +  L 
Sbjct  629   SGGIPSSIGDMVSLQNLSLAHNRLQGSIPTSIGTTLSLEWLDLSRNYHTGTIPISLENLR  688

Query  107   SLLIVDLSNNKLYG  66
              L+  ++S N L G
Sbjct  689   YLVYFNVSFNNLRG  702


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 110/237 (46%), Gaps = 41/237 (17%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPS------W  630
            G +   + N S L  + L+ NNF  S P     LR L++L  + N+   +  S      W
Sbjct  380  GSIPDSISNCSKLKMITLAYNNFTGSIPNSFGDLRLLEVLALNGNNLMSDYSSSNSELSW  439

Query  629  FGLLQN---LRFLYLGNNNISGFLPTSLFNLS-KLEVLHLGVNSLEGSIPREIGNLFQLK  462
            F  L N   LR L + +N ++G LP S+ NLS  LE ++    ++ G IP EIGNL  L 
Sbjct  440  FNSLANCKHLRLLVVSDNPLNGILPNSIGNLSTSLEDMYAINCNIRGRIPDEIGNLSSLT  499

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
            +L++  N  SG  P+ +                          +L KLQ   ++ NK S 
Sbjct  500  ILSMYSNQLSGMLPITM-------------------------KNLEKLQGIDLQDNKLS-  533

Query  281  EIPSSLSKCSLLQTLSLPF---NNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREI  120
               +SL    +LQ L++ +   N  SG +P   GN+T L  L+L SN L  ++P  I
Sbjct  534  --KTSLDYLCVLQNLAVLYLGANQISGSLPECIGNVTSLRYLYLGSNLLNSSLPTTI  588


 Score = 80.9 bits (198),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 132/262 (50%), Gaps = 8/262 (3%)
 Frame = -1

Query  905  LADNWSVNSITPCNWIGVTCNSRHN--RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQ  732
            L D +++N    CN  G   +   N   ++ L++++  L G L   + NL  L  ++L  
Sbjct  474  LEDMYAIN----CNIRGRIPDEIGNLSSLTILSMYSNQLSGMLPITMKNLEKLQGIDLQD  529

Query  731  NNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLF  552
            N    +    L  L+ L +L    N  SG++P   G + +LR+LYLG+N ++  LPT+++
Sbjct  530  NKLSKTSLDYLCVLQNLAVLYLGANQISGSLPECIGNVTSLRYLYLGSNLLNSSLPTTIW  589

Query  551  NLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsv  372
            NL  L  L L  NSL GS+P +I NL    L++LS N  SG  P  I ++  L+NLSL+ 
Sbjct  590  NLKDLLELDLSSNSLSGSLPPKIRNLKAAILIDLSINEISGGIPSSIGDMVSLQNLSLAH  649

Query  371  nsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREF  192
            N L G +P  +G  L  L+   +  N  +G IP SL     L   ++ FNN  G +P + 
Sbjct  650  NRLQGSIPTSIGTTL-SLEWLDLSRNYHTGTIPISLENLRYLVYFNVSFNNLRGEIPSK-  707

Query  191  GNLTKLEKLFLRSNQLTGAIPR  126
            G  T        SN+     PR
Sbjct  708  GPFTNFSGESFISNEALCGAPR  729



>emb|CDP09585.1| unnamed protein product [Coffea canephora]
Length=1101

 Score =   241 bits (614),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 190/305 (62%), Gaps = 4/305 (1%)
 Frame = -1

Query  1043  HYFCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSK-ISFDPHSILADNWSVNSITPC  867
             HY  L  F   SL +    N  +N+TTD+ ALL L+ + I+ +P  ILA NWS+ S + C
Sbjct  6     HYLFLISFSLVSLAMMAAGN--SNVTTDQLALLVLRDRMINSEPREILAKNWSITS-SVC  62

Query  866   NWIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLR  687
             +WIGVTC  RH+RV+ALN+ NM L G L P LGNLSFLVSLN+S+NNFH   P EL  LR
Sbjct  63    DWIGVTCGFRHHRVTALNISNMNLTGTLPPQLGNLSFLVSLNISRNNFHGELPGELVHLR  122

Query  686   RLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSL  507
             RL+ L    N+  G +PSWFG L  L+FL LGNN+  G +P S+ N+S LE L L  N +
Sbjct  123   RLRYLDFGINNLGGELPSWFGFLYKLQFLSLGNNSFMGSIPPSISNMSNLETLLLSFNFI  182

Query  506   EGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHL  327
             EG++P E  NL  LK L +  N  SG  PL + NLS L+ +S   NSL G LP D    L
Sbjct  183   EGTVPIEFQNLHNLKNLLIEYNQLSGPLPLHVFNLSSLQIISFMSNSLSGILPDDACQRL  242

Query  326   PKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQ  147
              KL    +  N   G IPS++S+CSLL+ L+   N  SG +P    NLT LE+L+L SN 
Sbjct  243   QKLTWLSLEYNNLIGRIPSTVSQCSLLRYLASSENRLSGPIPMGIANLTMLEELYLESNN  302

Query  146   LTGAI  132
             LTG I
Sbjct  303   LTGKI  307


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 120/290 (41%), Gaps = 67/290 (23%)
 Frame = -1

Query  830  RVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDF  651
            R+  L L+N  L G +   + N+S L  + L QN F  + P  +S   +L  L+  F + 
Sbjct  466  RLEELYLYNNALSGSIPAAIFNISSLQHIGLDQNKFSGTIPLTVSN-NKLSNLESLFLER  524

Query  650  SGNIPSWFGLLQNLRFLYL-----------------------------GNNNISGFLPTS  558
            S +IP+    L+NL++LYL                             GNN ++GFLP S
Sbjct  525  S-SIPTSLASLRNLKYLYLDYNRLSSESSELSFFTFLTSSRSLTYLVLGNNPLNGFLPAS  583

Query  557  LFNLS-KLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenls  381
              N S  LEV+      ++G+IP  I NL  L  L  S N   GS P  I          
Sbjct  584  FSNYSTSLEVITAKSCRIKGNIPDGISNLSSLVELEFSGNELIGSVPRTIH---------  634

Query  380  lsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVP  201
                                       SN+ +  IP++L     LQ L+L  N  SG +P
Sbjct  635  --------------------------NSNRLTSMIPTNLLSMKDLQILNLSSNFLSGSLP  668

Query  200  REFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQN  51
             E GNL     L +  NQL+  IP  IG L +L  + L+NN L G    N
Sbjct  669  LEIGNLKAAYSLDISFNQLSDKIPTTIGELQALQSLSLANNNLQGQLFMN  718


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 106/223 (48%), Gaps = 39/223 (17%)
 Frame = -1

Query  719  NSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRF-----LYLGNNNISGFLPTSL  555
            NS PRE        IL  +++  + ++  W G+    R      L + N N++G LP  L
Sbjct  44   NSEPRE--------ILAKNWS-ITSSVCDWIGVTCGFRHHRVTALNISNMNLTGTLPPQL  94

Query  554  FNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlsls  375
             NLS L  L++  N+  G +P E+ +L +L+ L+   N+  G  P               
Sbjct  95   GNLSFLVSLNISRNNFHGELPGELVHLRRLRYLDFGINNLGGELP---------------  139

Query  374  vnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPRE  195
              S FG         L KLQ   + +N F G IP S+S  S L+TL L FN   G VP E
Sbjct  140  --SWFG--------FLYKLQFLSLGNNSFMGSIPPSISNMSNLETLLLSFNFIEGTVPIE  189

Query  194  FGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            F NL  L+ L +  NQL+G +P  +  LSSL I+   +N L G
Sbjct  190  FQNLHNLKNLLIEYNQLSGPLPLHVFNLSSLQIISFMSNSLSG  232


 Score = 83.2 bits (204),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 111/228 (49%), Gaps = 9/228 (4%)
 Frame = -1

Query  728  NFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN  549
            NF  + P E+  L  L IL    N  +G IP+  G L  L  L   NN ++G +P  + N
Sbjct  404  NFVGAIPNEIGNLTMLTILYFYDNKLTGVIPAEIGNLAMLMDLDFSNNKLTGGIPEKIGN  463

Query  548  LSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvn  369
            L +LE L+L  N+L GSIP  I N+  L+ + L  N FSG+ PL + N       SL + 
Sbjct  464  LHRLEELYLYNNALSGSIPAAIFNISSLQHIGLDQNKFSGTIPLTVSNNKLSNLESLFLE  523

Query  368  sLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPF-----NNFSGHV  204
                 +P  L + L  L+   +  N+ S E         L  + SL +     N  +G +
Sbjct  524  R--SSIPTSLAS-LRNLKYLYLDYNRLSSESSELSFFTFLTSSRSLTYLVLGNNPLNGFL  580

Query  203  PREFGNL-TKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGT  63
            P  F N  T LE +  +S ++ G IP  I  LSSL+ ++ S N+L G+
Sbjct  581  PASFSNYSTSLEVITAKSCRIKGNIPDGISNLSSLVELEFSGNELIGS  628



>emb|CDP05658.1| unnamed protein product [Coffea canephora]
Length=1041

 Score =   240 bits (613),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 150/327 (46%), Positives = 212/327 (65%), Gaps = 25/327 (8%)
 Frame = -1

Query  974  NITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSRHNRVSALNLFNMGL  795
            +ITTD+ ALL+L+S+I+ +P+ +L +NWSV+S + C W+GVTC+SRH+RV ALN+ NMGL
Sbjct  25   DITTDQSALLALRSQITSEPYQMLVNNWSVSS-SVCQWMGVTCSSRHHRVIALNISNMGL  83

Query  794  VGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            +G + P +GNLSFL+S++LS+NNFH   P  LS L RL++L  + N+ SG +PSW G  Q
Sbjct  84   IGTIHPQVGNLSFLISMDLSRNNFHGELPEGLSHLGRLRVLNLTINNLSGKVPSWLGSFQ  143

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
            NL++L L NN+ +G +P ++ NLS L+ L L  NSL G +P EIGNL  LK L++  N+ 
Sbjct  144  NLQYLSLANNSFTGVIPPAICNLSTLKSLSLSFNSLSGKLPIEIGNLQSLKKLSIEYNYL  203

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            SGS P  I N+S LE LS   N L G LP+D+ +   +++   +  NK SG+IPS+   C
Sbjct  204  SGSVPSGIFNISSLEILSFLSNGLSGSLPVDMCSRPRRIKWLNLSVNKLSGQIPSTWFHC  263

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN------------------------Q  147
            S LQ LSL  N F+G +P E GNLT LE L+L  N                         
Sbjct  264  SQLQMLSLSINQFTGTIPNEIGNLTALEVLYLGPNNFRATIPEQFCNLHRLKQLWINEAS  323

Query  146  LTGAIPREIGALSSLLIVDLSNNKLYG  66
            LTG+IP ++  +S+LL++ L++N L G
Sbjct  324  LTGSIPAQLFNISTLLLLVLNDNILSG  350


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 106/227 (47%), Gaps = 25/227 (11%)
 Frame = -1

Query  818  LNLFNMGLVGELTPDLGNLSFLVS-LNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGN  642
            L+  + GL G L  D+ +    +  LNLS N      P       +L++L  S N F+G 
Sbjct  220  LSFLSNGLSGSLPVDMCSRPRRIKWLNLSVNKLSGQIPSTWFHCSQLQMLSLSINQFTGT  279

Query  641  IPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLK  462
            IP+  G L  L  LYLG NN    +P    NL +L+ L +   SL GSIP ++ N+  L 
Sbjct  280  IPNEIGNLTALEVLYLGPNNFRATIPEQFCNLHRLKQLWINEASLTGSIPAQLFNISTLL  339

Query  461  LLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSG  282
            LL L+DN  SG+                        LPL     LP L++   R N+  G
Sbjct  340  LLVLNDNILSGN------------------------LPLSNRQRLPNLEVLSARGNELHG  375

Query  281  EIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
             IP+S+S  S L  L+L  N F+G +P   G+L  LE L L  N  T
Sbjct  376  VIPASISNASNLYYLNLARNKFNGPIPDSLGDLRLLEHLNLGQNYFT  422


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 93/269 (35%), Positives = 141/269 (52%), Gaps = 10/269 (4%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCS  663
            SR  R+  LNL    L G++     + S L  L+LS N F  + P E+  L  L++L   
Sbjct  237  SRPRRIKWLNLSVNKLSGQIPSTWFHCSQLQMLSLSINQFTGTIPNEIGNLTALEVLYLG  296

Query  662  FNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIP-RE  486
             N+F   IP  F  L  L+ L++   +++G +P  LFN+S L +L L  N L G++P   
Sbjct  297  PNNFRATIPEQFCNLHRLKQLWINEASLTGSIPAQLFNISTLLLLVLNDNILSGNLPLSN  356

Query  485  IGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
               L  L++L+   N   G  P  I N S L  L+L+ N   G +P  LG+ L  L+   
Sbjct  357  RQRLPNLEVLSARGNELHGVIPASISNASNLYYLNLARNKFNGPIPDSLGD-LRLLEHLN  415

Query  305  MRSNKFSGE-------IPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLT-KLEKLFLRSN  150
            +  N F+ E         SSL+KC  L+ L +  N+F+G +P+  GNL+  +EK+F   +
Sbjct  416  LGQNYFTCEPSILELSFISSLTKCKYLEFLGMNDNSFNGSIPKSIGNLSHSIEKIFAYES  475

Query  149  QLTGAIPREIGALSSLLIVDLSNNKLYGT  63
            +L G+IP   G LS+LL++ L  N L G+
Sbjct  476  ELKGSIPDCFGNLSNLLLLSLDGNHLTGS  504


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 124/243 (51%), Gaps = 2/243 (1%)
 Frame = -1

Query  791  GELTPDLGNLSFLVSLNLS-QNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQ  615
            G +   +GNLS  +    + ++    S P     L  L +L    N  +G++PS F  LQ
Sbjct  454  GSIPKSIGNLSHSIEKIFAYESELKGSIPDCFGNLSNLLLLSLDGNHLTGSVPSTFKSLQ  513

Query  614  NLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHF  435
             L+ L L NN +SG LP    ++S L ++ +G N + GSIP  +GN+  L  L +  N  
Sbjct  514  KLQALSLENNLLSGPLPHHFCDMSSLYIVAIGQNQISGSIPSCLGNVTSLGYLLIDQNLL  573

Query  434  SGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKC  255
            + S P ++ NLS L  L LS NSL G LP ++ N L       +  N  SG IPSS+   
Sbjct  574  NSSIPANLWNLSDLLELDLSSNSLSGSLPEEMQN-LKAATRLNLSENDISGNIPSSIGGL  632

Query  254  SLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNK  75
              L  LS   N   G +P   GN+  L+ L L  N L+G IP+ + ALS L  ++LS N 
Sbjct  633  QNLLNLSFAQNKIEGSIPNSVGNMLSLQCLDLSHNDLSGVIPKSMEALSYLSYINLSFNN  692

Query  74   LYG  66
            L G
Sbjct  693  LNG  695


 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 97/330 (29%), Positives = 143/330 (43%), Gaps = 41/330 (12%)
 Frame = -1

Query  944  SLKSKISFDPHSILADNWSVNSIT---PCNWIGVTCNSRHNRVSALNLFNMGLVGELTPD  774
            SL   +   P  I   N SVN ++   P  W    C+       ++N F     G +  +
Sbjct  230  SLPVDMCSRPRRIKWLNLSVNKLSGQIPSTWF--HCSQLQMLSLSINQF----TGTIPNE  283

Query  773  LGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWF-----------  627
            +GNL+ L  L L  NNF  + P +   L RLK L  +    +G+IP+             
Sbjct  284  IGNLTALEVLYLGPNNFRATIPEQFCNLHRLKQLWINEASLTGSIPAQLFNISTLLLLVL  343

Query  626  --------------GLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR  489
                            L NL  L    N + G +P S+ N S L  L+L  N   G IP 
Sbjct  344  NDNILSGNLPLSNRQRLPNLEVLSARGNELHGVIPASISNASNLYYLNLARNKFNGPIPD  403

Query  488  EIGNLFQLKLLNLSDNHFSG-------SFPLDIlnlsklenlslsvnsLFGELPLDLGNH  330
             +G+L  L+ LNL  N+F+        SF   +     LE L ++ NS  G +P  +GN 
Sbjct  404  SLGDLRLLEHLNLGQNYFTCEPSILELSFISSLTKCKYLEFLGMNDNSFNGSIPKSIGNL  463

Query  329  LPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN  150
               ++      ++  G IP      S L  LSL  N+ +G VP  F +L KL+ L L +N
Sbjct  464  SHSIEKIFAYESELKGSIPDCFGNLSNLLLLSLDGNHLTGSVPSTFKSLQKLQALSLENN  523

Query  149  QLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             L+G +P     +SSL IV +  N++ G+ 
Sbjct  524  LLSGPLPHHFCDMSSLYIVAIGQNQISGSI  553


 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 115/226 (51%), Gaps = 6/226 (3%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +     +L  L +L+L  N      P     +  L I+    N  SG+IPS  G +
Sbjct  501  LTGSVPSTFKSLQKLQALSLENNLLSGPLPHHFCDMSSLYIVAIGQNQISGSIPSCLGNV  560

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
             +L +L +  N ++  +P +L+NLS L  L L  NSL GS+P E+ NL     LNLS+N 
Sbjct  561  TSLGYLLIDQNLLNSSIPANLWNLSDLLELDLSSNSLSGSLPEEMQNLKAATRLNLSEND  620

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
             SG+ P  I  L  L NLS + N + G +P  +GN L  LQ   +  N  SG IP S+  
Sbjct  621  ISGNIPSSIGGLQNLLNLSFAQNKIEGSIPNSVGNML-SLQCLDLSHNDLSGVIPKSMEA  679

Query  257  CSLLQTLSLPFNNFSGHVPR--EFGNLTKLEKLFLRSNQLTGAIPR  126
             S L  ++L FNN +G +P    F N T   + F+ +  L GA PR
Sbjct  680  LSYLSYINLSFNNLNGEIPSGGPFKNFTS--QSFMSNAALCGA-PR  722


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 78/255 (31%), Positives = 129/255 (51%), Gaps = 4/255 (2%)
 Frame = -1

Query  773  LGNLSFLVSLNLSQNNFHNSFPRELSQLRR-LKILQCSFNDFSGNIPSWFGLLQNLRFLY  597
            L    +L  L ++ N+F+ S P+ +  L   ++ +    ++  G+IP  FG L NL  L 
Sbjct  436  LTKCKYLEFLGMNDNSFNGSIPKSIGNLSHSIEKIFAYESELKGSIPDCFGNLSNLLLLS  495

Query  596  LGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPL  417
            L  N+++G +P++  +L KL+ L L  N L G +P    ++  L ++ +  N  SGS P 
Sbjct  496  LDGNHLTGSVPSTFKSLQKLQALSLENNLLSGPLPHHFCDMSSLYIVAIGQNQISGSIPS  555

Query  416  DIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTL  237
             + N++ L  L +  N L   +P +L N    L    + SN  SG +P  +        L
Sbjct  556  CLGNVTSLGYLLIDQNLLNSSIPANLWNLS-DLLELDLSSNSLSGSLPEEMQNLKAATRL  614

Query  236  SLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFI  57
            +L  N+ SG++P   G L  L  L    N++ G+IP  +G + SL  +DLS+N L G   
Sbjct  615  NLSENDISGNIPSSIGGLQNLLNLSFAQNKIEGSIPNSVGNMLSLQCLDLSHNDLSGVIP  674

Query  56   QNLDTP*LK*LSYYN  12
            ++++   L  LSY N
Sbjct  675  KSMEA--LSYLSYIN  687


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 93/150 (62%), Gaps = 1/150 (1%)
 Frame = -1

Query  509  LEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNH  330
            L G+I  ++GNL  L  ++LS N+F G  P  + +L +L  L+L++N+L G++P  LG+ 
Sbjct  83   LIGTIHPQVGNLSFLISMDLSRNNFHGELPEGLSHLGRLRVLNLTINNLSGKVPSWLGS-  141

Query  329  LPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSN  150
               LQ   + +N F+G IP ++   S L++LSL FN+ SG +P E GNL  L+KL +  N
Sbjct  142  FQNLQYLSLANNSFTGVIPPAICNLSTLKSLSLSFNSLSGKLPIEIGNLQSLKKLSIEYN  201

Query  149  QLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
             L+G++P  I  +SSL I+   +N L G+ 
Sbjct  202  YLSGSVPSGIFNISSLEILSFLSNGLSGSL  231



>emb|CDP00840.1| unnamed protein product [Coffea canephora]
Length=1092

 Score =   241 bits (614),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 199/318 (63%), Gaps = 4/318 (1%)
 Frame = -1

Query  1016  FHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWIGVTCNSR  837
             F    +C+ + +  N T D  ALL+LK+ + FDP  IL  NWS +S + C WIG+TCN+R
Sbjct  26    FAPTSVCVQVFSAGN-TRDLDALLALKATV-FDPERILPTNWS-SSASVCGWIGITCNTR  82

Query  836   HNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFN  657
             H RV+A++L NMGL+G + P LGNLSFLV LNL  N+FH   P +LS LRRL+ +  + N
Sbjct  83    HQRVAAIDLPNMGLIGTIPPQLGNLSFLVRLNLPNNSFHGRPPPDLSNLRRLRYISLAGN  142

Query  656   DFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGN  477
              F G +PSW G L  L++L LG N   G L   LFN +KL+ + L  NS+ G IP E  +
Sbjct  143   SFGGRLPSWLGALSELQYLSLGYNKFYGSLSGVLFNATKLQTILLPNNSITGHIPDEFSS  202

Query  476   LFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL-GNHLPKLQIFVMR  300
             L  L  LNL  N  +GS P  + NLS L+ L +S NSL G LP D+   H+ +LQ   + 
Sbjct  203   LENLIGLNLDFNQLTGSLPKSLFNLSSLQKLGVSSNSLSGSLPRDICKKHVSQLQGLYLS  262

Query  299   SNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREI  120
              N+  GEIPS + +CS LQ LSL +N F+G +P+EF NLT LE++ L +  L G +P+ I
Sbjct  263   YNQLQGEIPSGIGECSRLQNLSLSYNKFNGSLPKEFWNLTALERIRLGNTYLEGLLPQAI  322

Query  119   GALSSLLIVDLSNNKLYG  66
             G L+ L ++ L  NK  G
Sbjct  323   GYLTKLEVLVLDGNKFTG  340


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 91/272 (33%), Positives = 134/272 (49%), Gaps = 10/272 (4%)
 Frame = -1

Query  848  CNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQ  669
            C    +++  L L    L GE+   +G  S L +L+LS N F+ S P+E   L  L+ ++
Sbjct  249  CKKHVSQLQGLYLSYNQLQGEIPSGIGECSRLQNLSLSYNKFNGSLPKEFWNLTALERIR  308

Query  668  CSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPR  489
                   G +P   G L  L  L L  N  +G +P  LFN+S L++L +  N+L G++P 
Sbjct  309  LGNTYLEGLLPQAIGYLTKLEVLVLDGNKFTGPIPVRLFNISSLQILSMVQNNLWGNLPS  368

Query  488  EIGNLF-QLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQI  312
             +G +   L+ L +  N  SG     I N S L  L +  N   G +P  LG  L  L++
Sbjct  369  TLGVMLPNLEDLFIGGNRLSGMILTSISNASSLVGLDVGSNQFTGPIPHSLGG-LRFLEV  427

Query  311  FVMRSNKFSGEIPSS-------LSKCSLLQTLSLPFNNFSGHVPREFGNLTK-LEKLFLR  156
              +  N FS E  S        LS C  L+ L L  N  +G +P   GNL+  LE  +L 
Sbjct  428  LALGDNSFSYESHSGELSFLTFLSNCRYLKQLWLSLNPLNGFLPISIGNLSSTLESFYLD  487

Query  155  SNQLTGAIPREIGALSSLLIVDLSNNKLYGTF  60
            ++ + G IP  IG LS+L+ ++LS N L GT 
Sbjct  488  NSGIIGHIPSSIGNLSNLVDLNLSGNALEGTI  519


 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 82/276 (30%), Positives = 135/276 (49%), Gaps = 32/276 (12%)
 Frame = -1

Query  881  SITPCN-WIGVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPR  705
            S+ P N ++ ++  +  + + +  L N G++G +   +GNLS LV LNLS N    + PR
Sbjct  462  SLNPLNGFLPISIGNLSSTLESFYLDNSGIIGHIPSSIGNLSNLVDLNLSGNALEGTIPR  521

Query  704  ELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLH  525
             +  L  L+ ++  +N   G  P  F  L NL  L L +N +SG LP+ + N++ L  L+
Sbjct  522  TIGGLLNLQRVELGYNKIEGPFPRQFCHLFNLGHLSLKSNMVSGMLPSCIENMTSLRYLY  581

Query  524  LGVNSLEGSIPR---EIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGE  354
            L  N+L   +P     +G++ +L L   S +    S                        
Sbjct  582  LDSNNLTSIVPSSLWRVGDILELNLSKNSFSSSLSS------------------------  617

Query  353  LPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKL  174
               ++GN L +L +  +  N F G+IP+++     LQTLSL  N   G +P    N+ +L
Sbjct  618  ---EIGN-LKELIMMDLSVNDFYGDIPTAIGALEKLQTLSLKHNRIQGFIPDSMKNMLEL  673

Query  173  EKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
            + L    N L G IP+ + ALS+L+  ++S N+L G
Sbjct  674  QYLDFSFNNLAGEIPKSLEALSNLVYFNVSFNRLRG  709


 Score = 96.3 bits (238),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 101/313 (32%), Positives = 144/313 (46%), Gaps = 35/313 (11%)
 Frame = -1

Query  854  VTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHN-------SFPRELS  696
            +T  S  + +  L++ +    G +   LG L FL  L L  N+F         SF   LS
Sbjct  392  LTSISNASSLVGLDVGSNQFTGPIPHSLGGLRFLEVLALGDNSFSYESHSGELSFLTFLS  451

Query  695  QLRRLKILQCSFNDFSGNIPSWFG-LLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLG  519
              R LK L  S N  +G +P   G L   L   YL N+ I G +P+S+ NLS L  L+L 
Sbjct  452  NCRYLKQLWLSLNPLNGFLPISIGNLSSTLESFYLDNSGIIGHIPSSIGNLSNLVDLNLS  511

Query  518  VNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDL  339
             N+LEG+IPR IG L  L+ + L  N   G FP    +L  L +LSL  N + G LP  +
Sbjct  512  GNALEGTIPRTIGGLLNLQRVELGYNKIEGPFPRQFCHLFNLGHLSLKSNMVSGMLPSCI  571

Query  338  GNHLPKLQIFVMRSNKFSGEIPSSLSKC------------------------SLLQTLSL  231
             N +  L+   + SN  +  +PSSL +                           L  + L
Sbjct  572  EN-MTSLRYLYLDSNNLTSIVPSSLWRVGDILELNLSKNSFSSSLSSEIGNLKELIMMDL  630

Query  230  PFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQN  51
              N+F G +P   G L KL+ L L+ N++ G IP  +  +  L  +D S N L G   ++
Sbjct  631  SVNDFYGDIPTAIGALEKLQTLSLKHNRIQGFIPDSMKNMLELQYLDFSFNNLAGEIPKS  690

Query  50   LDTP*LK*LSYYN  12
            L+   L  L Y+N
Sbjct  691  LEA--LSNLVYFN  701


 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 102/206 (50%), Gaps = 30/206 (15%)
 Frame = -1

Query  650  SGNIPSWFGLLQNLRF-----LYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPRE  486
            S ++  W G+  N R      + L N  + G +P  L NLS L  L+L  NS  G  P +
Sbjct  68   SASVCGWIGITCNTRHQRVAAIDLPNMGLIGTIPPQLGNLSFLVRLNLPNNSFHGRPPPD  127

Query  485  IGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFV  306
            + NL +L+ ++L+ N F G                         LP  LG  L +LQ   
Sbjct  128  LSNLRRLRYISLAGNSFGG------------------------RLPSWLG-ALSELQYLS  162

Query  305  MRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIPR  126
            +  NKF G +   L   + LQT+ LP N+ +GH+P EF +L  L  L L  NQLTG++P+
Sbjct  163  LGYNKFYGSLSGVLFNATKLQTILLPNNSITGHIPDEFSSLENLIGLNLDFNQLTGSLPK  222

Query  125  EIGALSSLLIVDLSNNKLYGTFIQNL  48
             +  LSSL  + +S+N L G+  +++
Sbjct  223  SLFNLSSLQKLGVSSNSLSGSLPRDI  248



>ref|XP_009609323.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Nicotiana tomentosiformis]
Length=1158

 Score =   241 bits (615),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 150/327 (46%), Positives = 205/327 (63%), Gaps = 9/327 (3%)
 Frame = -1

Query  1037  FCLSIFFFHSLMLCLTINAHTNITTDKHALLSLKSKISFDPHSILADNWSVNSITPCNWI  858
               L +     +  CL +N    I+TD+ +LL+LK++I+ DP+ IL+ NWS +S T C WI
Sbjct  15    LALLVISLRVITTCLAMN----ISTDQSSLLALKARITSDPNHILSTNWS-SSTTVCKWI  69

Query  857   GVTCNSRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLK  678
             G+TC SRH RV+ LN+  +G  G + P LGNLSFLVSL+LS N+FH   P E+S L RL+
Sbjct  70    GITCGSRHQRVTVLNISGLGFNGTIPPQLGNLSFLVSLDLSHNDFHGELPPEISHLPRLR  129

Query  677   ILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGS  498
              +  S N  +G IPS+ G   ++R L L  N+ SGF+P+S+  +  L  L LG N+LEG+
Sbjct  130   AIDLSNNYLTGQIPSFSG---DIRMLSLEMNSFSGFIPSSISRMKNLGFLKLGYNNLEGN  186

Query  497   IPREIG-NLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPK  321
             IPR I  NL  LKLL+   N  +GS  L + N+S LE+L L  + L G LP DL   LP+
Sbjct  187   IPRGIATNLHSLKLLSFGFNKLNGSNVLSVFNISLLEDLDLEKSGLTGNLPSDLCRRLPR  246

Query  320   LQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLT  141
             L+   +  NK  G+IP ++S+CS LQ LSL  NN  G +PRE GNL  L+ L L +N L 
Sbjct  247   LRKLELNFNKLRGQIPRTISECSQLQVLSLMENNLDGIIPRELGNLQLLQDLTLGNNTLE  306

Query  140   GAIPREIGALSSLLIVDLSNNKLYGTF  60
             G IP EIG L +L ++ +  NKL G+ 
Sbjct  307   GTIPYEIGHLYNLKLLVMEKNKLKGSI  333


 Score =   127 bits (320),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 141/265 (53%), Gaps = 25/265 (9%)
 Frame = -1

Query  767  NLSFLVSLNLSQNNFHNSFPREL-SQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLG  591
            N+S L  L+L ++    + P +L  +L RL+ L+ +FN   G IP        L+ L L 
Sbjct  218  NISLLEDLDLEKSGLTGNLPSDLCRRLPRLRKLELNFNKLRGQIPRTISECSQLQVLSLM  277

Query  590  NNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDI  411
             NN+ G +P  L NL  L+ L LG N+LEG+IP EIG+L+ LKLL +  N   GS PL I
Sbjct  278  ENNLDGIIPRELGNLQLLQDLTLGNNTLEGTIPYEIGHLYNLKLLVMEKNKLKGSIPLTI  337

Query  410  lnlsklenlslsvnsLFGELPLDLGN--------------------HLPKLQIFVMRS--  297
             N+S LE L +S N L G LP D+GN                     L  LQ  V  S  
Sbjct  338  FNISSLEFLFMSGNMLEGPLPRDVGNLTMLTTLDLGNNFLTGVIPDELGNLQELVDLSLY  397

Query  296  -NKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGN-LTKLEKLFLRSNQLTGAIPRE  123
             N FSG IP  +   S L ++SL  N+FSGH+P   G+ L  +E +FL  N + G +P  
Sbjct  398  LNNFSGSIPIGIFNISTLVSISLSDNHFSGHLPSTIGHGLPNIEGIFLGENNINGILPSS  457

Query  122  IGALSSLLIVDLSNNKLYGTFIQNL  48
            I  LS L +++L  N+L G+  ++L
Sbjct  458  ISNLSKLTVLELGGNELTGSIPKSL  482


 Score =   120 bits (300),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 127/235 (54%), Gaps = 0/235 (0%)
 Frame = -1

Query  842  SRHNRVSALNLFNMGLVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCS  663
            S  +++  L+L    L G +  +LGNL  L  L L  N    + P E+  L  LK+L   
Sbjct  266  SECSQLQVLSLMENNLDGIIPRELGNLQLLQDLTLGNNTLEGTIPYEIGHLYNLKLLVME  325

Query  662  FNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREI  483
             N   G+IP     + +L FL++  N + G LP  + NL+ L  L LG N L G IP E+
Sbjct  326  KNKLKGSIPLTIFNISSLEFLFMSGNMLEGPLPRDVGNLTMLTTLDLGNNFLTGVIPDEL  385

Query  482  GNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVM  303
            GNL +L  L+L  N+FSGS P+ I N+S L ++SLS N   G LP  +G+ LP ++   +
Sbjct  386  GNLQELVDLSLYLNNFSGSIPIGIFNISTLVSISLSDNHFSGHLPSTIGHGLPNIEGIFL  445

Query  302  RSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTG  138
              N  +G +PSS+S  S L  L L  N  +G +P+   NL  LE L L+SN   G
Sbjct  446  GENNINGILPSSISNLSKLTVLELGGNELTGSIPKSLVNLRLLEVLHLQSNSFIG  500


 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 113/221 (51%), Gaps = 1/221 (0%)
 Frame = -1

Query  728  NFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNISGFLPTSLFN  549
            N     P E+  L  L  L+   NDF+G +P+    L NL+ L LG N ISG  P  L  
Sbjct  546  NLKGHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLTNLQQLSLGVNRISGPFPNGLCE  605

Query  548  LSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsklenlslsvn  369
            LS L  L L  N + GSIP  +G+L  L+ + L  N+ + + PL + NL  +  L+LS N
Sbjct  606  LSSLFFLKLSQNQMRGSIPTCLGDLTSLREVYLDSNNLTANIPLSLWNLKDILKLNLSSN  665

Query  368  sLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNFSGHVPREFG  189
               G LP   GN L    +  +  N+ SG IP++L     +  LSL  N   G +P  F 
Sbjct  666  FFNGSLPPQFGN-LKAAILLDLSWNQLSGNIPNTLGSLLKVTQLSLAHNRIEGSIPETFR  724

Query  188  NLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYG  66
             L  LE L L  N ++G IP+ + AL  L   ++S N+L+G
Sbjct  725  KLVSLEALDLSYNNMSGVIPKSLEALQQLHSFNVSFNRLHG  765


 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 113/223 (51%), Gaps = 1/223 (0%)
 Frame = -1

Query  797  LVGELTPDLGNLSFLVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLL  618
            L G +  ++GNL  L SL L  N+F    P  +S L  L+ L    N  SG  P+    L
Sbjct  547  LKGHIPNEIGNLINLSSLELEDNDFTGIVPTTISSLTNLQQLSLGVNRISGPFPNGLCEL  606

Query  617  QNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNH  438
             +L FL L  N + G +PT L +L+ L  ++L  N+L  +IP  + NL  +  LNLS N 
Sbjct  607  SSLFFLKLSQNQMRGSIPTCLGDLTSLREVYLDSNNLTANIPLSLWNLKDILKLNLSSNF  666

Query  437  FSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSK  258
            F+GS P    NL     L LS N L G +P  LG+ L K+    +  N+  G IP +  K
Sbjct  667  FNGSLPPQFGNLKAAILLDLSWNQLSGNIPNTLGSLL-KVTQLSLAHNRIEGSIPETFRK  725

Query  257  CSLLQTLSLPFNNFSGHVPREFGNLTKLEKLFLRSNQLTGAIP  129
               L+ L L +NN SG +P+    L +L    +  N+L G IP
Sbjct  726  LVSLEALDLSYNNMSGVIPKSLEALQQLHSFNVSFNRLHGEIP  768


 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 121/238 (51%), Gaps = 2/238 (1%)
 Frame = -1

Query  755  LVSLNLSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIPSWFGLLQNLRFLYLGNNNIS  576
            LV L LS N  +   P+ +  L  L+       +  G+IP+  G L NL  L L +N+ +
Sbjct  514  LVDLRLSFNPLNAVLPKSIGNLS-LQWFSAIGCNLKGHIPNEIGNLINLSSLELEDNDFT  572

Query  575  GFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKLLNLSDNHFSGSFPLDIlnlsk  396
            G +PT++ +L+ L+ L LGVN + G  P  +  L  L  L LS N   GS P  + +L+ 
Sbjct  573  GIVPTTISSLTNLQQLSLGVNRISGPFPNGLCELSSLFFLKLSQNQMRGSIPTCLGDLTS  632

Query  395  lenlslsvnsLFGELPLDLGNHLPKLQIFVMRSNKFSGEIPSSLSKCSLLQTLSLPFNNF  216
            L  + L  N+L   +PL L N L  +    + SN F+G +P           L L +N  
Sbjct  633  LREVYLDSNNLTANIPLSLWN-LKDILKLNLSSNFFNGSLPPQFGNLKAAILLDLSWNQL  691

Query  215  SGHVPREFGNLTKLEKLFLRSNQLTGAIPREIGALSSLLIVDLSNNKLYGTFIQNLDT  42
            SG++P   G+L K+ +L L  N++ G+IP     L SL  +DLS N + G   ++L+ 
Sbjct  692  SGNIPNTLGSLLKVTQLSLAHNRIEGSIPETFRKLVSLEALDLSYNNMSGVIPKSLEA  749


 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 122/251 (49%), Gaps = 28/251 (11%)
 Frame = -1

Query  740  LSQNNFHNSFPRELSQLRRLKILQCSFNDFSGNIP-------------------------  636
            L +NN +   P  +S L +L +L+   N+ +G+IP                         
Sbjct  445  LGENNINGILPSSISNLSKLTVLELGGNELTGSIPKSLVNLRLLEVLHLQSNSFIGETST  504

Query  635  -SWFGLLQNLRFLYLGNNNISGFLPTSLFNLSKLEVLHLGVNSLEGSIPREIGNLFQLKL  459
             S+   L NL  L L  N ++  LP S+ NLS      +G N L+G IP EIGNL  L  
Sbjct  505  LSFITPLINLVDLRLSFNPLNAVLPKSIGNLSLQWFSAIGCN-LKGHIPNEIGNLINLSS  563

Query  458  LNLSDNHFSGSFPLDIlnlsklenlslsvnsLFGELPLDLGNHLP