BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21091_g1_i1 len=1887 path=[1:0-638 3838:639-645 640:646-900
3572:901-922 3947:923-923 3595:924-1123 @896@!:1124-1584
1357:1585-1886]

Length=1887
                                                                      Score     E

ref|XP_007039796.1|  Phosphatidylserine decarboxylase 1                 357   8e-148   
ref|XP_006477161.1|  PREDICTED: phosphatidylserine decarboxylase ...    326   2e-140   
ref|XP_009758386.1|  PREDICTED: phosphatidylserine decarboxylase ...    314   2e-97    
ref|XP_009615919.1|  PREDICTED: phosphatidylserine decarboxylase ...    316   4e-97    
emb|CDP09984.1|  unnamed protein product                                315   1e-96    
ref|NP_001234166.1|  phosphatidylserine decarboxylase                   314   3e-96    
ref|XP_011081318.1|  PREDICTED: phosphatidylserine decarboxylase ...    313   6e-96    
ref|XP_010646535.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    299   2e-90    
ref|XP_008238454.1|  PREDICTED: phosphatidylserine decarboxylase ...    298   5e-90    
ref|XP_007209142.1|  hypothetical protein PRUPE_ppa005808mg             295   4e-89    
gb|KFK23090.1|  hypothetical protein AALP_AAs51321U000300               296   4e-89    
ref|XP_007209141.1|  hypothetical protein PRUPE_ppa005808mg             295   5e-89    
ref|XP_006477162.1|  PREDICTED: phosphatidylserine decarboxylase ...    295   5e-89    
gb|KHN42684.1|  Phosphatidylserine decarboxylase proenzyme              295   8e-89    
ref|NP_193403.2|  phosphatidylserine decarboxylase 1                    294   2e-88    Arabidopsis thaliana [mouse-ear cress]
gb|KDO61396.1|  hypothetical protein CISIN_1g013143mg                   293   3e-88    
ref|XP_010055481.1|  PREDICTED: phosphatidylserine decarboxylase ...    293   3e-88    
ref|NP_001240209.1|  uncharacterized protein LOC100811372               291   1e-87    
ref|XP_008437062.1|  PREDICTED: phosphatidylserine decarboxylase ...    292   1e-87    
ref|XP_004152398.1|  PREDICTED: phosphatidylserine decarboxylase ...    291   1e-87    
ref|XP_006440281.1|  hypothetical protein CICLE_v10020120mg             291   2e-87    
ref|XP_006591531.1|  PREDICTED: phosphatidylserine decarboxylase ...    281   3e-87    
emb|CDY54745.1|  BnaAnng13400D                                          288   2e-86    
ref|XP_009145596.1|  PREDICTED: phosphatidylserine decarboxylase ...    288   2e-86    
emb|CDY40507.1|  BnaC01g20050D                                          287   5e-86    
ref|XP_004299425.1|  PREDICTED: phosphatidylserine decarboxylase ...    287   6e-86    
ref|XP_010677069.1|  PREDICTED: phosphatidylserine decarboxylase ...    287   7e-86    
ref|XP_010434784.1|  PREDICTED: phosphatidylserine decarboxylase ...    287   7e-86    
ref|XP_010264359.1|  PREDICTED: phosphatidylserine decarboxylase ...    287   8e-86    
ref|XP_010919616.1|  PREDICTED: phosphatidylserine decarboxylase ...    287   8e-86    
gb|KHG14927.1|  Phosphatidylserine decarboxylase proenzyme 1, mit...    285   3e-85    
ref|XP_010449727.1|  PREDICTED: phosphatidylserine decarboxylase ...    285   4e-85    
gb|KDP39887.1|  hypothetical protein JCGZ_03418                         284   1e-84    
ref|XP_002868107.1|  predicted protein                                  284   1e-84    
ref|XP_006286156.1|  hypothetical protein CARUB_v10007715mg             284   1e-84    
gb|AES94292.2|  phosphatidylserine decarboxylase                        283   1e-84    
ref|XP_004511705.1|  PREDICTED: phosphatidylserine decarboxylase ...    283   2e-84    
ref|XP_008342942.1|  PREDICTED: phosphatidylserine decarboxylase ...    283   2e-84    
ref|XP_010440113.1|  PREDICTED: phosphatidylserine decarboxylase ...    283   3e-84    
ref|XP_004511703.1|  PREDICTED: phosphatidylserine decarboxylase ...    283   6e-84    
ref|XP_008802785.1|  PREDICTED: phosphatidylserine decarboxylase ...    280   3e-83    
ref|XP_003611334.1|  Phosphatidylserine decarboxylase proenzyme         283   4e-83    
emb|CBI37364.3|  unnamed protein product                                279   4e-83    
ref|XP_009398118.1|  PREDICTED: phosphatidylserine decarboxylase ...    271   5e-80    
ref|XP_011031905.1|  PREDICTED: phosphatidylserine decarboxylase ...    271   8e-80    
ref|XP_002304284.1|  hypothetical protein POPTR_0003s07600g             270   1e-79    Populus trichocarpa [western balsam poplar]
ref|XP_010104885.1|  Phosphatidylserine decarboxylase proenzyme 1       204   6e-78    
dbj|BAJ99307.1|  predicted protein                                      263   1e-77    
gb|AAS58475.1|  phosphatidylserine decarboxylase                        262   1e-76    Hordeum vulgare subsp. vulgare [barley]
gb|AAS58480.1|  phosphatidylserine decarboxylase                        262   1e-76    Triticum monococcum [einkorn wheat]
ref|XP_002530657.1|  phosphatidylserine decarboxylase, putative         200   2e-76    Ricinus communis
ref|XP_006649225.1|  PREDICTED: phosphatidylserine decarboxylase ...    260   6e-76    
ref|NP_001048658.1|  Os03g0101900                                       259   3e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010542213.1|  PREDICTED: phosphatidylserine decarboxylase ...    255   1e-74    
ref|XP_004986096.1|  PREDICTED: phosphatidylserine decarboxylase ...    259   1e-74    
ref|XP_004986097.1|  PREDICTED: phosphatidylserine decarboxylase ...    259   1e-74    
ref|XP_003559037.1|  PREDICTED: phosphatidylserine decarboxylase ...    256   2e-74    
ref|XP_010542211.1|  PREDICTED: phosphatidylserine decarboxylase ...    255   6e-74    
ref|XP_010542212.1|  PREDICTED: phosphatidylserine decarboxylase ...    255   7e-74    
ref|XP_010542210.1|  PREDICTED: phosphatidylserine decarboxylase ...    255   1e-73    
ref|XP_007157277.1|  hypothetical protein PHAVU_002G0572001g            187   2e-72    
ref|XP_006838214.1|  hypothetical protein AMTR_s00106p00153400          251   5e-72    
gb|KEH27465.1|  phosphatidylserine decarboxylase                        194   2e-71    
gb|EMS47322.1|  Cell number regulator 6                                 263   3e-71    
gb|ABK25027.1|  unknown                                                 247   9e-71    Picea sitchensis
gb|EYU19316.1|  hypothetical protein MIMGU_mgv1a0064762mg               200   6e-70    
ref|XP_006440282.1|  hypothetical protein CICLE_v10020120mg             204   1e-69    
gb|KDO36165.1|  hypothetical protein CISIN_1g024609mg                   204   4e-69    
gb|EMT02980.1|  Phosphatidylserine decarboxylase proenzyme              243   1e-68    
ref|XP_006414314.1|  hypothetical protein EUTSA_v10025592mg             190   9e-67    
emb|CAB10445.1|  decarboxylase like protein                             179   8e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001767589.1|  predicted protein                                  218   5e-60    
ref|XP_007157276.1|  hypothetical protein PHAVU_002G0572001g            134   3e-56    
ref|XP_002983160.1|  hypothetical protein SELMODRAFT_117633             192   2e-51    
ref|XP_002965919.1|  hypothetical protein SELMODRAFT_23058              190   1e-50    
ref|XP_007266134.1|  phosphatidylserine decarboxylase                   158   9e-49    
ref|XP_453424.1|  hypothetical protein                                  162   3e-47    Kluyveromyces lactis NRRL Y-1140
ref|XP_007157278.1|  hypothetical protein PHAVU_002G0572000g            172   4e-47    
dbj|BAO39209.1|  phosphatidylserine decarboxylase proenzyme 1           158   4e-47    
dbj|BAP70725.1|  phosphatidylserine decarboxylase proenzyme 1           158   5e-47    
ref|XP_001943709.2|  PREDICTED: phosphatidylserine decarboxylase ...    158   1e-46    Acyrthosiphon pisum
emb|CDO93645.1|  unnamed protein product                                163   2e-46    
gb|EJT98898.1|  phosphatidylserine decarboxylase                        160   2e-46    
ref|XP_002174664.1|  phosphatidylserine decarboxylase Psd1              166   2e-46    Schizosaccharomyces japonicus yFS275
ref|XP_003245397.1|  PREDICTED: phosphatidylserine decarboxylase ...    158   2e-46    
ref|XP_003245396.1|  PREDICTED: phosphatidylserine decarboxylase ...    158   2e-46    
gb|KHN34922.1|  Phosphatidylserine decarboxylase proenzyme              170   2e-46    
gb|EGA77195.1|  Psd1p                                                   163   3e-45    
ref|XP_007541783.1|  PREDICTED: phosphatidylserine decarboxylase ...    175   3e-45    
emb|CDX95403.1|  BnaC04g27550D                                          170   3e-45    
ref|XP_007541784.1|  PREDICTED: phosphatidylserine decarboxylase ...    175   4e-45    
ref|XP_503119.1|  YALI0D21604p                                          156   6e-45    Yarrowia lipolytica CLIB122
ref|XP_009263733.1|  hypothetical protein FPSE_12341                    158   9e-45    
ref|XP_007368499.1|  phosphatidylserine decarboxylase                   149   1e-44    
emb|CDR42342.1|  CYFA0S09e01552g1_1                                     158   1e-44    
ref|XP_447977.1|  hypothetical protein                                  165   2e-44    Candida glabrata CBS 138
gb|ESU07229.1|  phosphatidylserine decarboxylase proenzyme 1            158   2e-44    
ref|NP_595799.2|  phosphatidylserine decarboxylase Psd1                 159   2e-44    Schizosaccharomyces pombe
ref|XP_005750631.1|  PREDICTED: phosphatidylserine decarboxylase ...    167   4e-44    
ref|XP_002996948.1|  phosphatidylserine decarboxylase, putative         171   4e-44    
ref|XP_002996945.1|  phosphatidylserine decarboxylase, putative         170   4e-44    
ref|XP_002611852.1|  hypothetical protein BRAFLDRAFT_83124              171   5e-44    Branchiostoma floridae
gb|KDN70229.1|  putative phosphatidylserine decarboxylase               164   6e-44    
emb|CDY18315.1|  BnaC09g30650D                                          167   6e-44    
ref|XP_382041.1|  hypothetical protein FG01865.1                        158   8e-44    Fusarium graminearum PH-1
gb|EQK97863.1|  phosphatidylserine decarboxylase proenzyme 1            160   9e-44    
gb|EFQ26098.1|  phosphatidylserine decarboxylase                        165   1e-43    
ref|XP_006967649.1|  hypothetical protein TRIREDRAFT_110040             159   2e-43    
gb|ETM50170.1|  phosphatidylserine decarboxylase                        171   2e-43    
ref|XP_008400809.1|  PREDICTED: phosphatidylserine decarboxylase ...    170   2e-43    
gb|ETI50565.1|  phosphatidylserine decarboxylase                        171   2e-43    
gb|ETK90438.1|  phosphatidylserine decarboxylase                        171   2e-43    
ref|XP_008400810.1|  PREDICTED: phosphatidylserine decarboxylase ...    170   2e-43    
ref|XP_007601707.1|  phosphatidylserine decarboxylase                   164   2e-43    
emb|CCK70803.1|  hypothetical protein KNAG_0F01350                      166   3e-43    
ref|XP_008891339.1|  phosphatidylserine decarboxylase                   170   3e-43    
gb|ETO79304.1|  phosphatidylserine decarboxylase                        169   5e-43    
ref|XP_010718675.1|  PREDICTED: phosphatidylserine decarboxylase ...    165   5e-43    
ref|XP_001482776.1|  hypothetical protein PGUG_04731                    155   5e-43    Meyerozyma guilliermondii ATCC 6260
gb|EDK40633.2|  hypothetical protein PGUG_04731                         154   5e-43    Meyerozyma guilliermondii
ref|XP_003677438.1|  hypothetical protein NCAS_0G01980                  158   6e-43    
gb|KFQ29147.1|  Phosphatidylserine decarboxylase proenzyme              166   6e-43    
ref|XP_003704936.1|  PREDICTED: phosphatidylserine decarboxylase ...    168   7e-43    
gb|EGW00415.1|  Phosphatidylserine decarboxylase proenzyme              164   8e-43    
gb|KFZ59708.1|  Phosphatidylserine decarboxylase proenzyme              166   9e-43    
gb|KFP44632.1|  Phosphatidylserine decarboxylase proenzyme              166   9e-43    
ref|XP_002611862.1|  hypothetical protein BRAFLDRAFT_83114              171   1e-42    Branchiostoma floridae
emb|CCE32678.1|  related to phosphatidylserine decarboxylase            162   1e-42    
ref|XP_004084615.1|  PREDICTED: phosphatidylserine decarboxylase ...    168   1e-42    
gb|ERE87874.1|  phosphatidylserine decarboxylase proenzyme isoform 1    164   1e-42    
ref|XP_006905001.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   3e-42    
ref|XP_009537413.1|  hypothetical protein PHYSODRAFT_529613             163   4e-42    
ref|XP_009789652.1|  PREDICTED: phosphatidylserine decarboxylase ...    159   4e-42    
gb|KFZ67201.1|  Phosphatidylserine decarboxylase proenzyme              164   4e-42    
gb|KFA64705.1|  hypothetical protein S40285_05269                       159   4e-42    
ref|XP_008170258.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   4e-42    
gb|EAW59990.1|  phosphatidylserine decarboxylase, isoform CRA_d         162   4e-42    
ref|XP_005612476.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   4e-42    
gb|KFO85108.1|  Phosphatidylserine decarboxylase proenzyme              164   4e-42    
ref|XP_009810684.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   4e-42    
ref|XP_008324402.1|  PREDICTED: phosphatidylserine decarboxylase ...    167   4e-42    
ref|XP_005458406.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   4e-42    
gb|KFQ56775.1|  Phosphatidylserine decarboxylase proenzyme              164   5e-42    
ref|XP_008324404.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   5e-42    
ref|XP_004934423.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   5e-42    
gb|KFO13184.1|  Phosphatidylserine decarboxylase proenzyme              164   5e-42    
gb|KFQ21053.1|  Phosphatidylserine decarboxylase proenzyme              164   5e-42    
ref|XP_009300123.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   6e-42    
ref|XP_008324405.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   6e-42    
ref|XP_004178447.1|  hypothetical protein TBLA_0B00850                  160   6e-42    
emb|CEG65911.1|  Putative Phosphatidylserine decarboxylase              168   6e-42    
ref|XP_010192663.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   7e-42    
gb|KFW09431.1|  Phosphatidylserine decarboxylase proenzyme              164   7e-42    
ref|XP_002611397.1|  hypothetical protein BRAFLDRAFT_166706             163   7e-42    Branchiostoma floridae
ref|XP_006782282.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   8e-42    
ref|XP_003688556.1|  hypothetical protein TPHA_0O01550                  167   8e-42    
ref|XP_010167823.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   8e-42    
ref|XP_006905000.1|  PREDICTED: phosphatidylserine decarboxylase ...    165   8e-42    
gb|ACF22770.1|  phosphatidylserine decarboxylase                        119   8e-42    Brachypodium distachyon [annual false brome]
ref|XP_009300122.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   9e-42    
gb|KGL74589.1|  Phosphatidylserine decarboxylase proenzyme              165   9e-42    
ref|XP_005815031.1|  PREDICTED: phosphatidylserine decarboxylase ...    168   9e-42    
gb|KFV92215.1|  Phosphatidylserine decarboxylase proenzyme              163   1e-41    
gb|KFQ57578.1|  Phosphatidylserine decarboxylase proenzyme              163   1e-41    
gb|KFP54178.1|  Phosphatidylserine decarboxylase proenzyme              163   1e-41    
gb|KFW73940.1|  Phosphatidylserine decarboxylase proenzyme              163   1e-41    
gb|KFQ88013.1|  Phosphatidylserine decarboxylase proenzyme              163   1e-41    
gb|KGK39684.1|  hypothetical protein JL09_g1210                         162   1e-41    
gb|KFV19714.1|  Phosphatidylserine decarboxylase proenzyme              163   1e-41    
ref|XP_010124270.1|  PREDICTED: phosphatidylserine decarboxylase ...    165   1e-41    
gb|KFV52855.1|  Phosphatidylserine decarboxylase proenzyme              163   1e-41    
ref|XP_005458405.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   1e-41    
ref|XP_006894871.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   1e-41    
ref|XP_005869845.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   1e-41    
gb|KFP69151.1|  Phosphatidylserine decarboxylase proenzyme              163   1e-41    
ref|NP_001072442.1|  phosphatidylserine decarboxylase proenzyme         166   1e-41    Xenopus tropicalis [western clawed frog]
gb|KFP98015.1|  Phosphatidylserine decarboxylase proenzyme              163   1e-41    
ref|XP_006105607.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   1e-41    
gb|KFO57891.1|  Phosphatidylserine decarboxylase proenzyme              164   1e-41    
gb|KFV02595.1|  Phosphatidylserine decarboxylase proenzyme              163   1e-41    
ref|NP_001073170.1|  phosphatidylserine decarboxylase proenzyme         166   1e-41    Danio rerio [leopard danio]
gb|KFQ15196.1|  Phosphatidylserine decarboxylase proenzyme              163   1e-41    
gb|KFP92700.1|  Phosphatidylserine decarboxylase proenzyme              163   1e-41    
gb|ENH82841.1|  phosphatidylserine decarboxylase proenzyme              159   1e-41    
ref|XP_004615636.1|  PREDICTED: phosphatidylserine decarboxylase ...    165   1e-41    
ref|XP_005421556.1|  PREDICTED: phosphatidylserine decarboxylase ...    165   1e-41    
gb|KHO00934.1|  phosphatidylserine decarboxylase proenzyme 1            157   1e-41    
ref|XP_001515601.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   1e-41    Ornithorhynchus anatinus [duck-billed platypus]
gb|KFV87759.1|  Phosphatidylserine decarboxylase proenzyme              164   1e-41    
ref|XP_008973193.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-41    
ref|XP_007170712.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   2e-41    
emb|CCA24217.1|  unnamed protein product                                162   2e-41    
ref|XP_005612474.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   2e-41    
ref|XP_008324401.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   2e-41    
gb|KFW82493.1|  Phosphatidylserine decarboxylase proenzyme              164   2e-41    
gb|EPX74525.1|  phosphatidylserine decarboxylase Psd1                   148   2e-41    
ref|XP_009090517.1|  PREDICTED: phosphatidylserine decarboxylase ...    165   2e-41    
ref|XP_007642838.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   2e-41    
gb|KFW71923.1|  Phosphatidylserine decarboxylase proenzyme              164   2e-41    
ref|XP_010192662.1|  PREDICTED: phosphatidylserine decarboxylase ...    165   2e-41    
ref|XP_004556234.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   2e-41    
ref|XP_010167822.1|  PREDICTED: phosphatidylserine decarboxylase ...    165   2e-41    
ref|XP_008875662.1|  phosphatidylserine decarboxylase                   163   2e-41    
ref|XP_010396399.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   2e-41    
ref|XP_010226969.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   2e-41    
gb|KEY65935.1|  hypothetical protein S7711_07740                        156   2e-41    
gb|ETE67104.1|  Phosphatidylserine decarboxylase proenzyme              166   2e-41    
gb|KFQ95915.1|  Phosphatidylserine decarboxylase proenzyme              164   2e-41    
ref|XP_004449819.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   2e-41    
gb|KFR12428.1|  Phosphatidylserine decarboxylase proenzyme              164   2e-41    
gb|KFM08023.1|  Phosphatidylserine decarboxylase proenzyme              164   2e-41    
ref|XP_009928635.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   2e-41    
ref|XP_005942619.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   3e-41    
ref|XP_005869843.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   3e-41    
ref|XP_006105605.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   3e-41    
gb|KFO71478.1|  Phosphatidylserine decarboxylase proenzyme              164   3e-41    
ref|XP_009082342.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   3e-41    
ref|XP_005869842.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   3e-41    
ref|XP_006148020.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   3e-41    
ref|XP_009685751.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   3e-41    
ref|XP_010947187.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   3e-41    
ref|XP_008170257.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   3e-41    
ref|XP_006105604.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   3e-41    
gb|EHK15186.1|  hypothetical protein TRIVIDRAFT_196625                  153   3e-41    
ref|XP_008924004.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   3e-41    
ref|NP_001162202.1|  phosphatidylserine decarboxylase proenzyme         164   3e-41    Papio anubis [baboon]
ref|XP_007128781.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-41    
gb|KFP07816.1|  Phosphatidylserine decarboxylase proenzyme              163   3e-41    
gb|KFV63296.1|  Phosphatidylserine decarboxylase proenzyme              163   3e-41    
ref|XP_006782281.1|  PREDICTED: phosphatidylserine decarboxylase ...    166   4e-41    
gb|KFP33719.1|  Phosphatidylserine decarboxylase proenzyme              161   4e-41    
ref|NP_001172059.1|  phosphatidylserine decarboxylase proenzyme         164   4e-41    
ref|XP_007170710.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   4e-41    
dbj|BAE39619.1|  unnamed protein product                                160   4e-41    Mus musculus [mouse]
ref|XP_006019917.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   4e-41    
ref|XP_008140615.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   4e-41    
ref|XP_010140256.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   4e-41    
ref|XP_009329076.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   4e-41    
gb|AAA37015.1|  phosphatidylserine decarboxylase                        163   4e-41    Cricetulus griseus [Chinese hamsters]
ref|XP_004429802.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   4e-41    
ref|XP_001494498.3|  PREDICTED: phosphatidylserine decarboxylase ...    163   4e-41    Equus caballus [domestic horse]
gb|KFU95054.1|  Phosphatidylserine decarboxylase proenzyme              163   4e-41    
ref|XP_004890655.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   4e-41    
ref|XP_010124269.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   4e-41    
gb|ACC68877.1|  hypothetical protein                                    162   4e-41    Rhinolophus ferrumequinum
ref|XP_009278280.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   4e-41    
ref|XP_004429801.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   4e-41    
ref|XP_008299636.1|  PREDICTED: phosphatidylserine decarboxylase ...    165   4e-41    
ref|XP_415253.3|  PREDICTED: phosphatidylserine decarboxylase pro...    163   4e-41    Gallus gallus [bantam]
gb|KFP19305.1|  Phosphatidylserine decarboxylase proenzyme              163   4e-41    
ref|XP_009090516.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   4e-41    
ref|XP_006148019.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   4e-41    
ref|XP_009569605.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   4e-41    
ref|XP_006762156.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   4e-41    
ref|XP_009935020.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   5e-41    
ref|XP_010020626.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   5e-41    
gb|KGL96181.1|  Phosphatidylserine decarboxylase proenzyme              163   5e-41    
ref|XP_009685750.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   5e-41    
ref|XP_009090515.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   5e-41    
ref|XP_008270374.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   5e-41    
ref|XP_005147855.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   5e-41    
ref|XP_010347400.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   5e-41    
ref|XP_007432336.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   5e-41    
ref|XP_005612472.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   5e-41    
ref|XP_005421555.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   5e-41    
ref|XP_010573242.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   5e-41    
ref|XP_010305451.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   5e-41    
ref|XP_009652577.1|  phosphatidylserine decarboxylase proenzyme         150   5e-41    
ref|XP_007453226.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   5e-41    
ref|XP_007973673.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   5e-41    
gb|EOA96298.1|  Phosphatidylserine decarboxylase proenzyme              162   5e-41    
gb|KFQ72659.1|  Phosphatidylserine decarboxylase proenzyme              161   5e-41    
ref|XP_008059722.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   5e-41    
ref|XP_007170709.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   5e-41    
ref|XP_008945575.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   5e-41    
gb|KDO32457.1|  hypothetical protein SPRG_02934                         165   5e-41    
ref|XP_005493409.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   5e-41    
ref|XP_005218200.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   5e-41    
ref|XP_007170708.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   5e-41    
ref|XP_009007769.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   6e-41    
ref|XP_005261519.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   6e-41    
ref|XP_004766435.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   6e-41    
ref|XP_007128780.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   6e-41    
ref|XP_005524513.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   6e-41    
ref|XP_003504169.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   6e-41    
ref|XP_010396398.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   6e-41    
ref|XP_004332523.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    163   6e-41    
gb|EFB25696.1|  hypothetical protein PANDA_003600                       162   6e-41    
ref|XP_008630298.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   6e-41    
ref|XP_006184842.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   6e-41    
ref|XP_009909265.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   6e-41    
gb|ACB21195.1|  phosphatidylserine decarboxylase (predicted)            163   6e-41    
ref|XP_005691719.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   7e-41    
ref|XP_001642154.1|  hypothetical protein Kpol_139p1                    160   7e-41    
ref|XP_004429800.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   7e-41    
ref|XP_004449815.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   7e-41    
ref|XP_007490505.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   7e-41    
ref|XP_004449816.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   7e-41    
ref|XP_003938462.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   7e-41    
ref|NP_001087912.1|  phosphatidylserine decarboxylase                   164   7e-41    
ref|XP_009641111.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   7e-41    
ref|XP_004379029.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   7e-41    
ref|XP_007453225.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   7e-41    
gb|EMP34149.1|  Phosphatidylserine decarboxylase proenzyme              162   7e-41    
ref|XP_004716795.1|  PREDICTED: phosphatidylserine decarboxylase ...    165   7e-41    
ref|XP_005026740.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   8e-41    
ref|XP_010003115.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   8e-41    
ref|XP_009886878.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   8e-41    
ref|XP_004934422.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   8e-41    
ref|XP_010226967.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   8e-41    
ref|XP_010154468.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   8e-41    
ref|XP_003504168.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   8e-41    
gb|EPQ09942.1|  Phosphatidylserine decarboxylase proenzyme              163   9e-41    
ref|XP_006218091.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   9e-41    
ref|XP_009082341.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   9e-41    
ref|XP_004843560.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   9e-41    
ref|XP_005612470.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   9e-41    
ref|XP_009966572.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   9e-41    
ref|XP_009575940.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   9e-41    
ref|XP_007642835.1|  PREDICTED: phosphatidylserine decarboxylase ...    164   9e-41    
ref|XP_004283731.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_009987409.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_009487122.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_009232551.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_008875668.1|  phosphatidylserine decarboxylase                   164   1e-40    
ref|XP_009513736.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_005054876.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_005524512.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_006869342.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_004449814.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_005233298.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_003478341.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_009706873.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_010084271.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_009955769.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_010140247.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_009875649.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_006148018.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_008059721.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_009685748.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_005396380.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   1e-40    
ref|XP_007490504.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_002719749.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_005503964.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_005567598.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_006972970.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_005218199.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_004890654.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_866442.2|  PREDICTED: phosphatidylserine decarboxylase pro...    162   1e-40    
ref|XP_010827105.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_010602133.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_010347399.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_006051077.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_004592066.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_007973663.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_009935019.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_007973665.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_010358989.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_006972969.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_004283730.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_006640159.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_008708810.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    162   1e-40    
ref|XP_009329075.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_009461981.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_009278278.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_004379028.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_010305450.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   1e-40    
ref|XP_006938667.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_004766431.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   1e-40    
ref|XP_005218201.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_004400065.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_005147854.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   2e-40    
ref|XP_001150563.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|NP_055153.1|  phosphatidylserine decarboxylase proenzyme            162   2e-40    
ref|XP_002743744.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_008604464.1|  hypothetical protein SDRG_00751                    163   2e-40    
ref|XP_005567597.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_002196581.2|  PREDICTED: phosphatidylserine decarboxylase ...    163   2e-40    
ref|XP_010876326.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   2e-40    
ref|XP_007973664.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_006724262.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_007973662.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_004934421.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   2e-40    
ref|XP_010358988.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_007128778.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
gb|AFK37828.1|  unknown                                                 155   2e-40    
gb|EDM00146.1|  rCG36021, isoform CRA_h                                 158   2e-40    
ref|XP_007082636.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   2e-40    
ref|XP_007128777.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_007490503.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   2e-40    
ref|XP_010751101.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   2e-40    
ref|XP_004664148.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   2e-40    
ref|XP_005567596.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_006000944.1|  PREDICTED: phosphatidylserine decarboxylase ...    157   2e-40    
ref|XP_008059720.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|NP_001126113.1|  phosphatidylserine decarboxylase proenzyme         162   2e-40    
gb|EPY81079.1|  phosphatidylserine decarboxylase proenzyme-like p...    164   2e-40    
ref|XP_004843558.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_007231484.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   2e-40    
ref|XP_004890653.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_006733549.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_005636534.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_005026735.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_010827104.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_010602132.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_005218198.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_010003114.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_009928632.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_003821527.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_005339926.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   2e-40    
ref|XP_010573225.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-40    
ref|XP_009886877.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
ref|XP_008501022.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
ref|XP_009436470.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
ref|XP_007952141.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
ref|XP_010205123.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   3e-40    
ref|XP_005366144.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   3e-40    
ref|XP_007061627.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   3e-40    
dbj|BAC28786.1|  unnamed protein product                                162   3e-40    
ref|XP_006051076.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
ref|XP_007909093.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   3e-40    
ref|XP_005396377.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   3e-40    
ref|XP_005261512.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
gb|ACK44251.1|  phosphatidylserine decarboxylase (predicted)            162   3e-40    
ref|XP_007490502.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   3e-40    
ref|XP_007231483.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   3e-40    
emb|CAB43678.2|  hypothetical protein                                   162   3e-40    
ref|XP_010751100.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   3e-40    
ref|XP_009987408.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
ref|XP_009575939.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
ref|XP_004890650.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
ref|XP_003797498.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   3e-40    
ref|XP_007128776.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
ref|XP_009513728.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
ref|XP_009928631.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
ref|XP_009487114.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
ref|XP_010876324.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   3e-40    
ref|XP_010876325.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   3e-40    
ref|XP_009955768.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
ref|XP_009706872.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   3e-40    
gb|ELK31543.1|  Phosphatidylserine decarboxylase proenzyme              163   3e-40    
ref|XP_007912342.1|  putative phosphatidylserine decarboxylase pr...    160   3e-40    
ref|XP_009966571.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   4e-40    
ref|XP_007973660.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   4e-40    
ref|XP_010084270.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   4e-40    
ref|XP_007909094.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   4e-40    
ref|XP_006139707.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    162   4e-40    
ref|XP_006504065.1|  PREDICTED: phosphatidylserine decarboxylase ...    159   4e-40    
ref|XP_005503963.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   4e-40    
ref|XP_005233297.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   4e-40    
ref|XP_005908568.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   4e-40    
ref|XP_007973661.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   4e-40    
ref|XP_003797499.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   4e-40    
ref|XP_004843556.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   4e-40    
ref|XP_005445318.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   4e-40    
emb|CDQ60770.1|  unnamed protein product                                160   4e-40    
ref|XP_010827103.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   4e-40    
ref|XP_005396376.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   4e-40    
gb|ESZ97621.1|  hypothetical protein SBOR_2022                          149   4e-40    
ref|XP_003258055.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   4e-40    
gb|EHH65774.1|  hypothetical protein EGM_02608                          161   4e-40    
ref|NP_001019646.1|  phosphatidylserine decarboxylase proenzyme         161   4e-40    
ref|XP_010812467.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   5e-40    
ref|XP_009875648.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   5e-40    
ref|XP_008059719.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   5e-40    
ref|XP_005987197.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   5e-40    
ref|XP_004645612.1|  PREDICTED: phosphatidylserine decarboxylase ...    163   5e-40    
ref|XP_010282995.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   5e-40    
ref|XP_009436469.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   5e-40    
ref|XP_010876323.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   5e-40    
ref|XP_005636533.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   6e-40    
ref|XP_009007764.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   6e-40    
ref|XP_004766430.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   6e-40    
ref|XP_008973184.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   7e-40    
ref|XP_010751099.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   7e-40    
ref|XP_008564649.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   7e-40    
ref|XP_007231482.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   7e-40    
ref|XP_010876321.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   7e-40    
ref|XP_009829264.1|  phosphatidylserine decarboxylase                   161   7e-40    
ref|XP_009158047.1|  phosphatidylserine decarboxylase                   150   8e-40    
ref|XP_005396375.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   8e-40    
ref|XP_008564648.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   8e-40    
ref|XP_006051075.1|  PREDICTED: phosphatidylserine decarboxylase ...    161   9e-40    
ref|NP_001167077.1|  phosphatidylserine decarboxylase proenzyme         160   1e-39    
emb|CDQ77218.1|  unnamed protein product                                161   1e-39    
ref|XP_010812469.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   1e-39    
ref|XP_006504062.1|  PREDICTED: phosphatidylserine decarboxylase ...    159   1e-39    
ref|NP_594463.1|  phosphatidylserine decarboxylase Psd2                 162   1e-39    
ref|XP_007909092.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   1e-39    
gb|EHJ75757.1|  phosphatidylserine decarboxylase                        157   1e-39    
ref|XP_008839228.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    160   1e-39    
ref|NP_796272.2|  phosphatidylserine decarboxylase proenzyme            159   1e-39    
dbj|BAE37044.1|  unnamed protein product                                159   1e-39    
gb|EMC88630.1|  Phosphatidylserine decarboxylase proenzyme              162   2e-39    
ref|XP_002915640.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-39    
ref|XP_010282994.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   2e-39    
ref|XP_005961245.1|  PREDICTED: phosphatidylserine decarboxylase ...    160   2e-39    
ref|XP_006762154.1|  PREDICTED: phosphatidylserine decarboxylase ...    162   2e-39    
ref|XP_006221879.1|  PREDICTED: phosphatidylserine decarboxylase ...    157   2e-39    
gb|EPY51422.1|  phosphatidylserine decarboxylase Psd2                   161   2e-39    



>ref|XP_007039796.1| Phosphatidylserine decarboxylase 1 [Theobroma cacao]
 gb|EOY24297.1| Phosphatidylserine decarboxylase 1 [Theobroma cacao]
Length=462

 Score =   357 bits (916),  Expect(2) = 8e-148, Method: Compositional matrix adjust.
 Identities = 203/339 (60%), Positives = 238/339 (70%), Gaps = 64/339 (19%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNS--EKE  820
             LVSPVDGTILRFGELK AG MIEQVKGFSYSV  LLGA+S L + AE  ++  +S  E+E
Sbjct  180   LVSPVDGTILRFGELKGAGAMIEQVKGFSYSVSSLLGASSLLPIIAEGHTQDDSSTIEQE  239

Query  821   SSDTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCG  1000
             SS  + +KKSWWR+SLASPKVR                ET+SA     C Y         
Sbjct  240   SSQREKSKKSWWRISLASPKVR----------------ETVSA----CCVYS------SN  273

Query  1001  FINNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYH  1180
              ++ W                   T+Q    D  F       PMKGL+YCVIYLKPGDYH
Sbjct  274   SLDCW-------------------TIQ----DILF-------PMKGLYYCVIYLKPGDYH  303

Query  1181  RIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGAT  1360
             RIHSP DWNVL+RRHF+G LFP+NERATRTIRNLYVENERVVLEG WQ+G+MA+AAIGAT
Sbjct  304   RIHSPVDWNVLVRRHFAGHLFPLNERATRTIRNLYVENERVVLEGLWQQGYMAVAAIGAT  363

Query  1361  NIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLV  1540
             NIGSIELFIEP LRTN+P+K  LH  PPEE VY+P+G G+ +KKG+E+AAFNMGSTVVLV
Sbjct  364   NIGSIELFIEPELRTNRPRKKLLHSGPPEECVYKPEGVGVMLKKGEEVAAFNMGSTVVLV  423

Query  1541  FQAPI------SSPSDFRFCIKKGERIRMGEALGRWHDS  1639
             FQAP       S+ S+FRF I++G+RIR+GEA+GRWHDS
Sbjct  424   FQAPTLKSPKNSNASEFRFSIRRGDRIRVGEAMGRWHDS  462


 Score =   196 bits (499),  Expect(2) = 8e-148, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 139/182 (76%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearassng--gssshgksFFLP  282
            MKFR +  VP+F   +   H+   R  F+ + ++  ++    +S     S S G +F LP
Sbjct  1    MKFRLSQHVPMFPPYSHAGHVHIHRRFFSWYAKQFPTTSQARASVSGGNSDSQGNAFLLP  60

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GATVAT++MLGALHARRLYDD K+E AREKG+E EF PDVKA+F+ MLPLRSISR WGFL
Sbjct  61   GATVATLLMLGALHARRLYDDKKVEDAREKGVEFEFQPDVKAAFLRMLPLRSISRVWGFL  120

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T VE PVWLRP+VYRAWARAFHSNLEEAALPL+EYASLRDFFVRTL+EG RP+D DP  L
Sbjct  121  TNVEIPVWLRPHVYRAWARAFHSNLEEAALPLDEYASLRDFFVRTLREGCRPIDPDPYSL  180

Query  643  VT  648
            V+
Sbjct  181  VS  182



>ref|XP_006477161.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial-like 
isoform X1 [Citrus sinensis]
Length=465

 Score =   326 bits (835),  Expect(2) = 2e-140, Method: Compositional matrix adjust.
 Identities = 185/337 (55%), Positives = 219/337 (65%), Gaps = 64/337 (19%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             LVSPVDG +LR GELK  G  IEQVKGFSYSV  LLG++SFL M  E D  +++ E+ES+
Sbjct  180   LVSPVDGIVLRVGELKGVGAKIEQVKGFSYSVSSLLGSSSFLPMIEEGDMHEQSGEQEST  239

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
              T+  KKSWW +SLASP+VRD A       ++ +F                  A  C  +
Sbjct  240   PTEKTKKSWWSISLASPRVRDTATTRDSSFSIFLF------------------AYLCFGL  281

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRI  1186
              N    ++L   T                                        PGDYHRI
Sbjct  282   QNMMIHVLLSAST----------------------------------------PGDYHRI  301

Query  1187  HSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNI  1366
             HSP DWNVL+RRHFSGRLFP+NERATRT+RNLYVENERVVLEG WQEG++AMAA+GATNI
Sbjct  302   HSPVDWNVLVRRHFSGRLFPLNERATRTVRNLYVENERVVLEGMWQEGYLAMAAVGATNI  361

Query  1367  GSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQ  1546
             GSIEL IEP LRTN+P+K  LH EPPEERVYEP G G+ +KKGDE+ AFNMGSTVVLVFQ
Sbjct  362   GSIELVIEPELRTNQPRKKLLHSEPPEERVYEPQGVGMMLKKGDEVGAFNMGSTVVLVFQ  421

Query  1547  AP-ISSP-----SDFRFCIKKGERIRMGEALGRWHDS  1639
             AP I SP     S+FRFCIK+G++IR+GE LGRW +S
Sbjct  422   APTIKSPKRGDNSNFRFCIKRGDKIRVGEGLGRWQES  458


 Score =   203 bits (516),  Expect(2) = 2e-140, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 146/182 (80%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearass--nggssshgksFFLP  282
            MKFR +++V +F    R  +    R   TSFLRK+Q++    +S   G ++S G +F LP
Sbjct  1    MKFRFSNKVSVFPHYLRLEYDHHCRQFSTSFLRKLQTNPQVRASFSGGSNNSQGNTFLLP  60

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GAT+AT++MLGALHARR+YDD K+E AREKGIE+EF PD KASF+ +LPLRSISR WGF+
Sbjct  61   GATLATLLMLGALHARRMYDDRKVEEAREKGIEIEFKPDAKASFLRLLPLRSISRIWGFM  120

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T VE+PVW+RPYVY+AWARAFHSNLEEAALPL EYASLR+FFVRTLK+GSRP+D DP CL
Sbjct  121  TSVEYPVWMRPYVYKAWARAFHSNLEEAALPLGEYASLREFFVRTLKQGSRPIDHDPHCL  180

Query  643  VT  648
            V+
Sbjct  181  VS  182



>ref|XP_009758386.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial-like 
[Nicotiana sylvestris]
Length=335

 Score =   314 bits (804),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 161/177 (91%), Gaps = 7/177 (4%)
 Frame = +2

Query  1127  PMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVV  1306
             P+KGLFYCVIYL+PGDYHRIHSP DWNVL RRHFSGRLFP+NERATRTIRNLYVENER+V
Sbjct  158   PLKGLFYCVIYLRPGDYHRIHSPVDWNVLGRRHFSGRLFPMNERATRTIRNLYVENERIV  217

Query  1307  LEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRM  1486
             LEG+WQEGFMAMAAIGATNIGSIELFIEPTLRTN+P K  LH EPPEE+VYEP GTG+ +
Sbjct  218   LEGKWQEGFMAMAAIGATNIGSIELFIEPTLRTNRPWKKMLHPEPPEEQVYEPKGTGVFL  277

Query  1487  KKGDELAAFNMGSTVVLVFQAPISSPS-------DFRFCIKKGERIRMGEALGRWHD  1636
             KKGDELAAFNMGSTVVLVFQAPIS PS       +FRFCIKKG+R+RMGEALGRWHD
Sbjct  278   KKGDELAAFNMGSTVVLVFQAPISEPSADKSMSAEFRFCIKKGDRVRMGEALGRWHD  334


 Score =   108 bits (269),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+L+FGELK+AG MIEQVKGFSYS   LLGA+S L M   DD++ ++  +E S
Sbjct  72   LVSPVDGTVLQFGELKKAGAMIEQVKGFSYSASSLLGASSLLPMAVVDDNKNEDGGQEGS  131

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              DAN+KSWWRVSLASPKVRDPAPA
Sbjct  132  TDDANQKSWWRVSLASPKVRDPAPA  156


 Score = 42.7 bits (99),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +1

Query  580  DFFVRTLKEGSRPVDSDPCCLVT  648
            +FFVR LKEG+RP+D +PCCLV+
Sbjct  52   EFFVRRLKEGTRPIDCNPCCLVS  74



>ref|XP_009615919.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
[Nicotiana tomentosiformis]
Length=439

 Score =   316 bits (810),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +2

Query  1127  PMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVV  1306
             PMKGLFYCVIYL+PGDYHRIHSP DW VL RRHFSGRLFP+NERATRTIRNLYVENER+V
Sbjct  269   PMKGLFYCVIYLRPGDYHRIHSPVDWKVLGRRHFSGRLFPMNERATRTIRNLYVENERIV  328

Query  1307  LEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRM  1486
             LEG+WQEGFMAMAAIGATNIGSIELFIEPTLRTN+P K  LH EPPEE+VYEP GTG+ +
Sbjct  329   LEGKWQEGFMAMAAIGATNIGSIELFIEPTLRTNRPWKKMLHPEPPEEQVYEPKGTGVFL  388

Query  1487  KKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGRWHD  1636
             KKGDELAAFNMGSTVVLVFQAPIS  ++FRFCIKKG+R+RMGEALGRWHD
Sbjct  389   KKGDELAAFNMGSTVVLVFQAPISMSAEFRFCIKKGDRVRMGEALGRWHD  438


 Score =   207 bits (528),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 146/186 (78%), Gaps = 7/186 (4%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearassnggssshgksF-----  273
            MKFR   R+P FT   R +HL+ +R HFT+FLRK+Q++EARAS N G SS   S      
Sbjct  1    MKFRGCQRIPCFTYNGRLNHLNAQRFHFTTFLRKVQATEARASLNSGGSSSSNSSSQGSN  60

Query  274  -FLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
              LPGATVATIVMLG LHARRLYDD K+E AREKG  LEF PD KA+FM +LPLRSISRF
Sbjct  61   LLLPGATVATIVMLGLLHARRLYDDQKVEEAREKGA-LEFRPDAKATFMRLLPLRSISRF  119

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG LT VE P+WLRPY Y+ WARAFHSNLEE ALPLEEYASLR+FFVR LKEG+RP+D +
Sbjct  120  WGTLTSVELPMWLRPYAYKGWARAFHSNLEEVALPLEEYASLREFFVRRLKEGTRPIDCN  179

Query  631  PCCLVT  648
            PCCLV+
Sbjct  180  PCCLVS  185


 Score =   108 bits (269),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+L+FGELK+AG MIEQVKGF+YS   LLGA+S L M   DD++ ++  +E S
Sbjct  183  LVSPVDGTVLQFGELKKAGAMIEQVKGFTYSASSLLGASSLLPMAVVDDNKNEDGGQEGS  242

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              DAN+KSWWRVSLASPKVRDPAPA
Sbjct  243  TDDANQKSWWRVSLASPKVRDPAPA  267



>emb|CDP09984.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   315 bits (808),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 5/177 (3%)
 Frame = +2

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             SPMKGLFYCVIYLKPGDYHRIHSP DWNVL+RRHFSGRL+P+NERA RTIRNLYVENERV
Sbjct  271   SPMKGLFYCVIYLKPGDYHRIHSPVDWNVLVRRHFSGRLYPLNERAMRTIRNLYVENERV  330

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIR  1483
             VLEG+WQEG+MAMAAIGATNIGSIELF+EPTL TN+P+K  LH EPPEERVYEP+G GI 
Sbjct  331   VLEGQWQEGYMAMAAIGATNIGSIELFVEPTLHTNRPRKKLLHSEPPEERVYEPEGNGIM  390

Query  1484  MKKGDELAAFNMGSTVVLVFQAPISS-----PSDFRFCIKKGERIRMGEALGRWHDS  1639
             +KKGDE+ AFNMGSTVVLVFQAP+SS     PSDF+FCI++G RIRMGEALGRWHD+
Sbjct  391   LKKGDEVGAFNMGSTVVLVFQAPVSSANERMPSDFKFCIERGVRIRMGEALGRWHDA  447


 Score =   211 bits (538),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 152/188 (81%), Gaps = 8/188 (4%)
 Frame = +1

Query  109  MKFRA-THRVPLFTRCTRFS-HLSQRRLHFTSFLRKIQssearassnggssshg------  264
            MKFRA T R+ LF +  R + +  Q+  HF++F RK+QSS ARAS NGG    G      
Sbjct  1    MKFRAATQRLLLFAQAARHARNFHQQPRHFSTFFRKVQSSAARASINGGGGGGGGGGGRG  60

Query  265  ksFFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSIS  444
             SFF+PGATV T++MLGALHARRLYDD KIE AREKGIELEFHPDVKA+F+  LPLR+IS
Sbjct  61   NSFFVPGATVGTVLMLGALHARRLYDDKKIEEAREKGIELEFHPDVKATFLSFLPLRTIS  120

Query  445  RFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVD  624
            RFWGFLT VE+P+WLRP+VY AWARAFHSNLEEAALPLEEYASLR FFVRTLKEG RP+D
Sbjct  121  RFWGFLTSVEYPIWLRPHVYNAWARAFHSNLEEAALPLEEYASLRHFFVRTLKEGCRPID  180

Query  625  SDPCCLVT  648
             DPCCL++
Sbjct  181  LDPCCLIS  188


 Score =   117 bits (293),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            L+SPVDGT+LRFGELKEAG MIEQVKGFSYSV  LLGA SFL MTA ++ +Q++  ++ S
Sbjct  186  LISPVDGTVLRFGELKEAGAMIEQVKGFSYSVSSLLGAKSFLPMTACENIQQESGGEDKS  245

Query  827  DTDANKKSWWRVSLASPKVRDPAP  898
              D  +KSWWRVSLASPKVR  +P
Sbjct  246  MGDETQKSWWRVSLASPKVRAISP  269



>ref|NP_001234166.1| phosphatidylserine decarboxylase [Solanum lycopersicum]
 gb|AAM11886.1| phosphatidylserine decarboxylase [Solanum lycopersicum]
Length=445

 Score =   314 bits (804),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 160/178 (90%), Gaps = 7/178 (4%)
 Frame = +2

Query  1127  PMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVV  1306
             PMKGLFYCVIYL PGDYHRIHSPADWNVL RRHFSGRLFP+NERATRTIRNLYVENERVV
Sbjct  268   PMKGLFYCVIYLSPGDYHRIHSPADWNVLGRRHFSGRLFPMNERATRTIRNLYVENERVV  327

Query  1307  LEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRM  1486
             LEG+WQEGFMAMAA+GATNIGSIELFIEPTLRTN+P K  LH EPPEE+VYEP GTG+ +
Sbjct  328   LEGKWQEGFMAMAAVGATNIGSIELFIEPTLRTNRPWKKLLHPEPPEEQVYEPRGTGVLL  387

Query  1487  KKGDELAAFNMGSTVVLVFQAPISSPS-------DFRFCIKKGERIRMGEALGRWHDS  1639
             KKGDELAAFNMGSTVVLVFQAPIS PS       +F FCIKK +R+RMGEALGRWHDS
Sbjct  388   KKGDELAAFNMGSTVVLVFQAPISQPSADKSTSAEFSFCIKKRDRVRMGEALGRWHDS  445


 Score =   219 bits (558),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 152/185 (82%), Gaps = 6/185 (3%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearas-----snggssshgksF  273
            MKFRA+ R+P FT   RFSHL  +R HFT+FLRK+Q++EARAS     S+  SSS G + 
Sbjct  1    MKFRASQRIPCFTYNGRFSHLHAQRFHFTTFLRKVQATEARASLNRGGSSSNSSSQGNTL  60

Query  274  FLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFW  453
             LPGATVATIVMLG LHARRLYDD KIE AREKGI LEF PDVKA+FM +LPLRSISRFW
Sbjct  61   LLPGATVATIVMLGLLHARRLYDDQKIEDAREKGI-LEFQPDVKATFMRLLPLRSISRFW  119

Query  454  GFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDP  633
            G LT VE P+WLRP VY+ WARAFHSNLEE ALPLEEYASLR+FFVR LKEG+RP+D DP
Sbjct  120  GTLTNVELPMWLRPSVYKGWARAFHSNLEEVALPLEEYASLREFFVRRLKEGTRPIDPDP  179

Query  634  CCLVT  648
            CCL++
Sbjct  180  CCLIS  184


 Score =   107 bits (266),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            L+SPVDGT+L+FGELKE G MIEQVKGFSYSV  LLGA+S L M   DD+  ++  +E S
Sbjct  182  LISPVDGTVLQFGELKEVGAMIEQVKGFSYSVSSLLGASSLLPMNVVDDNTNQDGGQEGS  241

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              D N+KSWWRVSLASPKVRDPAPA
Sbjct  242  MDDTNQKSWWRVSLASPKVRDPAPA  266



>ref|XP_011081318.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
[Sesamum indicum]
Length=440

 Score =   313 bits (802),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 162/181 (90%), Gaps = 7/181 (4%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             S  P+KGLFYCVIYLKPGDYHRIHSP DW+VLLRRHF+G LFP+NERATRTIRNLYVENE
Sbjct  260   SSRPLKGLFYCVIYLKPGDYHRIHSPVDWSVLLRRHFTGHLFPMNERATRTIRNLYVENE  319

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
             RVVLEG+WQEG+MAMAAIGATNIGSIELFIEPTLRTN PQK  L  EPPEERVYEP+GTG
Sbjct  320   RVVLEGQWQEGYMAMAAIGATNIGSIELFIEPTLRTNNPQKKLLQSEPPEERVYEPEGTG  379

Query  1478  IRMKKGDELAAFNMGSTVVLVFQAPIS-------SPSDFRFCIKKGERIRMGEALGRWHD  1636
             + +KKGDE+AAFNMGSTVVLVFQAPIS       S S+FRFCIK+G+RIRMGEALGRW D
Sbjct  380   VLLKKGDEIAAFNMGSTVVLVFQAPISESSAHQGSSSEFRFCIKRGDRIRMGEALGRWKD  439

Query  1637  S  1639
             S
Sbjct  440   S  440


 Score =   204 bits (518),  Expect(2) = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 146/182 (80%), Gaps = 5/182 (3%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQsse--arassnggssshgksFFLP  282
            MK+R    VP+     RF H  QRR HFT+ LRK Q ++  A A+ + GSSS G SF +P
Sbjct  1    MKWRGGRSVPVLN-YNRFYH--QRRFHFTTLLRKGQRAQPRASAAGSNGSSSQGNSFLVP  57

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GATVATI+MLGALHARRLYDD KIE AR KG+E EFHPDVKA F+ +LPLRSISRFWG +
Sbjct  58   GATVATILMLGALHARRLYDDKKIEEARTKGVEFEFHPDVKARFLRLLPLRSISRFWGSM  117

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            TG+E PVWLRP+VY+AWARAFHSNLEEA LPLEEYASLRDFFVR LKEG RP++SD CCL
Sbjct  118  TGMELPVWLRPHVYKAWARAFHSNLEEAQLPLEEYASLRDFFVRRLKEGLRPIESDSCCL  177

Query  643  VT  648
            V+
Sbjct  178  VS  179


 Score =   106 bits (265),  Expect(2) = 9e-75, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT++RFGEL+  G MIEQVKG SYS   LLGA SFL M A  ++ ++   +E++
Sbjct  177  LVSPVDGTVMRFGELRGPGAMIEQVKGCSYSASSLLGANSFLPMIAAGEANEERGGEENT  236

Query  827  DTDANKKSWWRVSLASPKVRD  889
             TDA +KSWWR+S ASPKVRD
Sbjct  237  VTDATQKSWWRISFASPKVRD  257



>ref|XP_010646535.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylserine decarboxylase 
proenzyme 1, mitochondrial [Vitis vinifera]
Length=436

 Score =   299 bits (765),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 160/181 (88%), Gaps = 6/181 (3%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             ++ SPMKGLFYCVIYLKPGDYHRIHSP DWNVL+RRHFSGRLFPVNERATRTIRNLY+EN
Sbjct  256   VASSPMKGLFYCVIYLKPGDYHRIHSPIDWNVLVRRHFSGRLFPVNERATRTIRNLYLEN  315

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG+WQEGFM +AAIGAT   +++LFIEP LRTN+P+K   H EPPEER+YEP+G 
Sbjct  316   ERVVLEGQWQEGFMXIAAIGATXXXTLQLFIEPELRTNRPRKKFFHSEPPEERIYEPEGV  375

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPIS-SP-----SDFRFCIKKGERIRMGEALGRWHD  1636
             G+ +KKGDE+AAFNMGSTVVLVFQAP+S SP     S+F FC +KG+RIR+GEALGRWHD
Sbjct  376   GVMLKKGDEMAAFNMGSTVVLVFQAPVSRSPKNQGSSEFSFCTRKGDRIRVGEALGRWHD  435

Query  1637  S  1639
             S
Sbjct  436   S  436


 Score =   214 bits (545),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 143/180 (79%), Gaps = 4/180 (2%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearassnggssshgksFFLPGA  288
            MKFR + + P+F      +H   R LH  SF+RK+Q+S A  +    SS     F +PGA
Sbjct  1    MKFRVSQKFPMFIHQATLNH---RHLHLISFVRKLQTSRASVNGGSSSSQGNS-FLVPGA  56

Query  289  TVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTG  468
            TVATI+MLGALHARRLYDD K+E AREKG+E EFHPDVKA+F+ +LPLRSISR+WG LT 
Sbjct  57   TVATILMLGALHARRLYDDKKVEDAREKGLEFEFHPDVKATFLQLLPLRSISRYWGLLTS  116

Query  469  VEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCLVT  648
            VE PVWLRPYVYRAWARAFHSNLEEAA+PL+EYA+LRDFFVR+LKEGSRP+D DP CLV+
Sbjct  117  VEIPVWLRPYVYRAWARAFHSNLEEAAMPLDEYATLRDFFVRSLKEGSRPIDPDPRCLVS  176


 Score =   114 bits (286),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG ILRFGELK AG MIEQVKGFSYSV  LLGA S L M  E+++  ++SE E++
Sbjct  174  LVSPVDGIILRFGELKAAGAMIEQVKGFSYSVSSLLGANSLLPMITEENTHAESSELENT  233

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
              D + KSWWRVSLASPKV DP 
Sbjct  234  PKDQSNKSWWRVSLASPKVWDPV  256



>ref|XP_008238454.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 2, mitochondrial 
[Prunus mume]
Length=443

 Score =   298 bits (763),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 158/181 (87%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S  PMKGLFYCVIYLKPGDYHRIH+PADWNVL+RRHFSGRL PVNERATRTIRNLYVEN
Sbjct  262   VSACPMKGLFYCVIYLKPGDYHRIHAPADWNVLVRRHFSGRLLPVNERATRTIRNLYVEN  321

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG W+EGFMA+AA+GATNIGSIEL IEP LRTN+ +K  LH EPPEER+YEPDG 
Sbjct  322   ERVVLEGLWKEGFMALAAVGATNIGSIELSIEPELRTNQARKKLLHSEPPEERIYEPDGI  381

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPIS-------SPSDFRFCIKKGERIRMGEALGRWH  1633
             G  +KKGDE+AAFNMGSTVVLVFQAPIS       S S+FRF +++G+R+R+GEALGRW 
Sbjct  382   GRTLKKGDEVAAFNMGSTVVLVFQAPISLSQENGDSSSEFRFSVQRGDRVRVGEALGRWQ  441

Query  1634  D  1636
             D
Sbjct  442   D  442


 Score =   201 bits (511),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 141/182 (77%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssear--assnggssshgksFFLP  282
            MKFRA+H V +F+  TR + L  +R  F SFL+K+         S+ GG  S G SF LP
Sbjct  1    MKFRASHGVLIFSHSTRLNSLHNQRRCFASFLKKLHKPTQARSFSNGGGGGSKGDSFLLP  60

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GATVAT++MLGALH RR+YDD K+E AREKG E EF PDVK++F+ +LPLRSISRFWG L
Sbjct  61   GATVATLLMLGALHVRRMYDDRKVEEAREKGTEFEFQPDVKSTFLRLLPLRSISRFWGLL  120

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T VE PV LRPYVY AWA+AFHSNLEEAALPL+EY SLR+FFVRTLKEGSRP+D DP CL
Sbjct  121  TSVEIPVSLRPYVYGAWAQAFHSNLEEAALPLDEYTSLREFFVRTLKEGSRPIDPDPRCL  180

Query  643  VT  648
            V+
Sbjct  181  VS  182


 Score =   112 bits (279),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGEL+ AG MIEQVKGFSYSV  LLGA+SFL + A+ D  +++SE E++
Sbjct  180  LVSPVDGTVLRFGELRGAGAMIEQVKGFSYSVFSLLGASSFLPLIAKGDVHEESSEPENA  239

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              + +KKSW RVSLASPKV DP  A
Sbjct  240  SREKSKKSWLRVSLASPKVWDPVSA  264



>ref|XP_007209142.1| hypothetical protein PRUPE_ppa005808mg [Prunus persica]
 gb|EMJ10341.1| hypothetical protein PRUPE_ppa005808mg [Prunus persica]
Length=443

 Score =   295 bits (756),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 158/181 (87%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S  P+KGLFYCVIYLKPGDYHRIH+PADWNVL+RRHFSGRL PVNERATRTIRNLYVEN
Sbjct  262   VSTCPIKGLFYCVIYLKPGDYHRIHAPADWNVLVRRHFSGRLLPVNERATRTIRNLYVEN  321

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG W+EGFMA+AA+GATNIGSIEL IEP LRTN+ +K  LH EPPEER+YEPDG 
Sbjct  322   ERVVLEGLWKEGFMALAAVGATNIGSIELSIEPELRTNQARKKLLHSEPPEERIYEPDGI  381

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPIS-------SPSDFRFCIKKGERIRMGEALGRWH  1633
             G  +KKGDE+AAFNMGSTVVLVFQAPIS       S S+FRF +++G+R+R+GEALGRW 
Sbjct  382   GRTLKKGDEVAAFNMGSTVVLVFQAPISLSQENGDSASEFRFSVQRGDRVRVGEALGRWR  441

Query  1634  D  1636
             D
Sbjct  442   D  442


 Score =   197 bits (500),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssear--assnggssshgksFFLP  282
            MKFRA+HRV +F+  T  + L  +R  F SFL+K+  +      S+ GG  S G SF LP
Sbjct  1    MKFRASHRVCIFSHSTHLNSLHNQRRCFASFLKKLHKTPQARSFSNGGGGGSKGDSFLLP  60

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GATVAT++MLGALH RR+YDD K+E A EKG E EF PDVK++F+ +LPLRSISR WG L
Sbjct  61   GATVATLLMLGALHVRRMYDDRKVEEALEKGTEFEFQPDVKSTFLRLLPLRSISRCWGLL  120

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T VE PV LRPYVY AWARAFHSNLEEAALPL+EY SLR+FFVRTLKEGSRP+D DP CL
Sbjct  121  TSVEIPVSLRPYVYGAWARAFHSNLEEAALPLDEYTSLREFFVRTLKEGSRPIDPDPRCL  180

Query  643  VT  648
            V+
Sbjct  181  VS  182


 Score =   110 bits (276),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGEL+ AG MIEQVKGFSYSV  LLGA+SFL + A+ D  +++SE E++
Sbjct  180  LVSPVDGTVLRFGELRGAGAMIEQVKGFSYSVFSLLGASSFLPLIAKGDVHEESSEPENA  239

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
              + +KKSW RVSLASPKV DP 
Sbjct  240  SREKSKKSWLRVSLASPKVWDPV  262



>gb|KFK23090.1| hypothetical protein AALP_AAs51321U000300 [Arabis alpina]
Length=449

 Score =   296 bits (757),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 158/181 (87%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S SPMKGL+YCVIYLKPGDYHRIHSPADWN L+RRHF+GRLFPVNERATRTIRNLYVEN
Sbjct  268   ISASPMKGLYYCVIYLKPGDYHRIHSPADWNALVRRHFAGRLFPVNERATRTIRNLYVEN  327

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG W+EGFMA+AA+GATNIGSIELFIEP LRTNKP+K     EPPEERVY+P+G 
Sbjct  328   ERVVLEGVWKEGFMALAAVGATNIGSIELFIEPELRTNKPKKKLFPTEPPEERVYDPEGH  387

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPI-------SSPSDFRFCIKKGERIRMGEALGRWH  1633
             G++++KG ++ AFNMGSTVVLVFQAP        SS SDFRFC+K G+R+R+GEALGRW 
Sbjct  388   GVKLEKGKQVGAFNMGSTVVLVFQAPTANTPEGSSSSSDFRFCVKHGDRVRVGEALGRWK  447

Query  1634  D  1636
             +
Sbjct  448   E  448


 Score =   184 bits (467),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGAT+ATI+MLGALHARRLY+D KIE  RE+GIELEF PDVKASF+G+LPLRSISR 
Sbjct  67   FLLPGATMATILMLGALHARRLYEDKKIEEKRERGIELEFKPDVKASFLGILPLRSISRA  126

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG LT VE PVW+RPYVY+AW+RAFHSNLEE ALPLEEYASL++FFVR+LKEG RP+D D
Sbjct  127  WGSLTSVEIPVWMRPYVYKAWSRAFHSNLEEPALPLEEYASLQEFFVRSLKEGCRPIDPD  186

Query  631  PCCLVT  648
            P CLV+
Sbjct  187  PRCLVS  192


 Score = 92.4 bits (228),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT++RFGELK + GMIEQVKG SYSV  LLG    L M  E     K SE E +
Sbjct  190  LVSPVDGTVVRFGELKGSRGMIEQVKGHSYSVSALLGNNCLLPMAPEG----KESEDEEA  245

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              + N KSWW VSLASPK+R+   A
Sbjct  246  IGENNDKSWWTVSLASPKLRESISA  270



>ref|XP_007209141.1| hypothetical protein PRUPE_ppa005808mg [Prunus persica]
 gb|EMJ10340.1| hypothetical protein PRUPE_ppa005808mg [Prunus persica]
Length=443

 Score =   295 bits (756),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 158/181 (87%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S  P+KGLFYCVIYLKPGDYHRIH+PADWNVL+RRHFSGRL PVNERATRTIRNLYVEN
Sbjct  262   VSTCPIKGLFYCVIYLKPGDYHRIHAPADWNVLVRRHFSGRLLPVNERATRTIRNLYVEN  321

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG W+EGFMA+AA+GATNIGSIEL IEP LRTN+ +K  LH EPPEER+YEPDG 
Sbjct  322   ERVVLEGLWKEGFMALAAVGATNIGSIELSIEPELRTNQARKKLLHSEPPEERIYEPDGI  381

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPIS-------SPSDFRFCIKKGERIRMGEALGRWH  1633
             G  +KKGDE+AAFNMGSTVVLVFQAPIS       S S+FRF +++G+R+R+GEALGRW 
Sbjct  382   GRTLKKGDEVAAFNMGSTVVLVFQAPISLSQENGDSASEFRFSVQRGDRVRVGEALGRWR  441

Query  1634  D  1636
             D
Sbjct  442   D  442


 Score =   194 bits (492),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 139/182 (76%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssear--assnggssshgksFFLP  282
            MKFRA+HRV +F+  T  + L  +R  F SFL+K+  +      S+ GG  S G SF LP
Sbjct  1    MKFRASHRVCIFSHSTHLNSLHNQRRCFASFLKKLHKTPQARSFSNGGGGGSKGDSFLLP  60

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GATVAT++MLGALH RR+YDD K+  A EKG E EF PDVK++F+ +LPLRSISR WG L
Sbjct  61   GATVATLLMLGALHVRRMYDDRKVYEALEKGTEFEFQPDVKSTFLRLLPLRSISRCWGLL  120

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T VE PV LRPYVY AWARAFHSNLEEAALPL+EY SLR+FFVRTLKEGSRP+D DP CL
Sbjct  121  TSVEIPVSLRPYVYGAWARAFHSNLEEAALPLDEYTSLREFFVRTLKEGSRPIDPDPRCL  180

Query  643  VT  648
            V+
Sbjct  181  VS  182


 Score =   110 bits (276),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGEL+ AG MIEQVKGFSYSV  LLGA+SFL + A+ D  +++SE E++
Sbjct  180  LVSPVDGTVLRFGELRGAGAMIEQVKGFSYSVFSLLGASSFLPLIAKGDVHEESSEPENA  239

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
              + +KKSW RVSLASPKV DP 
Sbjct  240  SREKSKKSWLRVSLASPKVWDPV  262



>ref|XP_006477162.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=449

 Score =   295 bits (756),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 158/180 (88%), Gaps = 6/180 (3%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             +  P+KGL+YCVIYLKPGDYHRIHSP DWNVL+RRHFSGRLFP+NERATRT+RNLYVENE
Sbjct  263   TTRPVKGLYYCVIYLKPGDYHRIHSPVDWNVLVRRHFSGRLFPLNERATRTVRNLYVENE  322

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
             RVVLEG WQEG++AMAA+GATNIGSIEL IEP LRTN+P+K  LH EPPEERVYEP G G
Sbjct  323   RVVLEGMWQEGYLAMAAVGATNIGSIELVIEPELRTNQPRKKLLHSEPPEERVYEPQGVG  382

Query  1478  IRMKKGDELAAFNMGSTVVLVFQAP-ISSP-----SDFRFCIKKGERIRMGEALGRWHDS  1639
             + +KKGDE+ AFNMGSTVVLVFQAP I SP     S+FRFCIK+G++IR+GE LGRW +S
Sbjct  383   MMLKKGDEVGAFNMGSTVVLVFQAPTIKSPKRGDNSNFRFCIKRGDKIRVGEGLGRWQES  442


 Score =   203 bits (516),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 146/182 (80%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearass--nggssshgksFFLP  282
            MKFR +++V +F    R  +    R   TSFLRK+Q++    +S   G ++S G +F LP
Sbjct  1    MKFRFSNKVSVFPHYLRLEYDHHCRQFSTSFLRKLQTNPQVRASFSGGSNNSQGNTFLLP  60

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GAT+AT++MLGALHARR+YDD K+E AREKGIE+EF PD KASF+ +LPLRSISR WGF+
Sbjct  61   GATLATLLMLGALHARRMYDDRKVEEAREKGIEIEFKPDAKASFLRLLPLRSISRIWGFM  120

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T VE+PVW+RPYVY+AWARAFHSNLEEAALPL EYASLR+FFVRTLK+GSRP+D DP CL
Sbjct  121  TSVEYPVWMRPYVYKAWARAFHSNLEEAALPLGEYASLREFFVRTLKQGSRPIDHDPHCL  180

Query  643  VT  648
            V+
Sbjct  181  VS  182


 Score = 85.5 bits (210),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR GELK  G  IEQVKGFSYSV  LLG++SFL M  E D  +++ E+ES+
Sbjct  180  LVSPVDGIVLRVGELKGVGAKIEQVKGFSYSVSSLLGSSSFLPMIEEGDMHEQSGEQEST  239

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
             T+  KKSWW +SLASP+VRD A
Sbjct  240  PTEKTKKSWWSISLASPRVRDTA  262



>gb|KHN42684.1| Phosphatidylserine decarboxylase proenzyme [Glycine soja]
Length=435

 Score =   295 bits (754),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 155/180 (86%), Gaps = 6/180 (3%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             S  P KGLFYCV+YLKPGDYHRIHSPADWN+L RRHFSGRL+P+NERATRTIRNLY+ENE
Sbjct  256   SSRPKKGLFYCVVYLKPGDYHRIHSPADWNILARRHFSGRLYPLNERATRTIRNLYIENE  315

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
             RV+LEG WQEGFMA+AAIGATNIGSIELFIEP L TN+P+K  LH EPPEER+YE +G G
Sbjct  316   RVILEGLWQEGFMALAAIGATNIGSIELFIEPELHTNRPRKKFLHSEPPEERIYECEGVG  375

Query  1478  IRMKKGDELAAFNMGSTVVLVFQAPIS------SPSDFRFCIKKGERIRMGEALGRWHDS  1639
               +KKGDEL AFNMGSTVVLVFQAPIS      S  +FRFC+ +G+RIR+GEALGRWH S
Sbjct  376   RMLKKGDELGAFNMGSTVVLVFQAPISKLPEGDSSQEFRFCVGRGDRIRVGEALGRWHSS  435


 Score =   195 bits (496),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 145/183 (79%), Gaps = 7/183 (4%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTR-FSHLSQRRLHFTSFLRKIQsse--arassnggssshgksFFL  279
            MK+R +H+ P+  R TR F+H      +FTSF +K Q+ +  A  ++ G  +S G SF +
Sbjct  1    MKYRVSHKFPVLPRHTRPFNHTR----YFTSFAKKFQTPQPRASINAGGSGNSQGNSFVV  56

Query  280  PGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGF  459
            PGATVATI+MLG LHARRLY+D K E  +EKGIE+EF PD KA+F+ +LPLRSISR WG+
Sbjct  57   PGATVATILMLGVLHARRLYEDKKTEQMKEKGIEIEFQPDAKATFLRLLPLRSISRCWGY  116

Query  460  LTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCC  639
            LT +E PVWLRP++Y+AWARAFHSNLEEAALPL++YASLRDFFVRTLKEGSRP+D DP C
Sbjct  117  LTSMEIPVWLRPHIYKAWARAFHSNLEEAALPLDKYASLRDFFVRTLKEGSRPIDVDPQC  176

Query  640  LVT  648
            LV+
Sbjct  177  LVS  179


 Score =   101 bits (251),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 65/83 (78%), Gaps = 4/83 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK AG MIEQ+KGFSYSV  LLGA+ FL  T   D ++++SE  ++
Sbjct  177  LVSPVDGTVLRFGELKGAGAMIEQIKGFSYSVFSLLGASPFLPTT---DVQEEHSESITT  233

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
             T  +KKSWWRVSLASPKV +P 
Sbjct  234  -TVKSKKSWWRVSLASPKVWNPT  255



>ref|NP_193403.2| phosphatidylserine decarboxylase 1 [Arabidopsis thaliana]
 sp|Q84V22.1|PSD1_ARATH RecName: Full=Phosphatidylserine decarboxylase proenzyme 1, mitochondrial; 
Contains: RecName: Full=Phosphatidylserine decarboxylase 
1 beta chain; Contains: RecName: Full=Phosphatidylserine 
decarboxylase 1 alpha chain; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAO38842.1| phosphatidylserine decarboxylase [Arabidopsis thaliana]
 gb|ABG48491.1| At4g16700 [Arabidopsis thaliana]
 gb|AEE83788.1| phosphatidylserine decarboxylase [Arabidopsis thaliana]
Length=453

 Score =   294 bits (753),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 158/181 (87%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S SPMKGL+YCVIYLKPGDYHRIHSPADWN  +RRHF+GRLFPVNERATRTIRNLYVEN
Sbjct  272   VSASPMKGLYYCVIYLKPGDYHRIHSPADWNATVRRHFAGRLFPVNERATRTIRNLYVEN  331

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG W+EGFMA+AA+GATNIGSIELFIEP LRTNKP+K     EPPEERVY+P+G 
Sbjct  332   ERVVLEGIWKEGFMALAAVGATNIGSIELFIEPELRTNKPKKKLFPTEPPEERVYDPEGL  391

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPI-------SSPSDFRFCIKKGERIRMGEALGRWH  1633
             G+R++KG E+A FNMGSTVVL+FQAP        SS SD+RFC+K+G+R+R+G+ALGRW 
Sbjct  392   GLRLEKGKEVAVFNMGSTVVLIFQAPTANTPEGSSSSSDYRFCVKQGDRVRVGQALGRWK  451

Query  1634  D  1636
             +
Sbjct  452   E  452


 Score =   189 bits (479),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F +PGAT+ATI+MLGALHARRLY+D KIE  REKGIELEFHPD+KASF+G+LPLRSISR 
Sbjct  71   FLVPGATMATILMLGALHARRLYEDKKIEEKREKGIELEFHPDIKASFLGVLPLRSISRA  130

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG    +E PVW+RPY Y+AWARAFHSNLEEAALPLEEY SL+DFFVR+LKEG RP+D D
Sbjct  131  WGSFMSLEIPVWMRPYAYKAWARAFHSNLEEAALPLEEYTSLQDFFVRSLKEGCRPIDPD  190

Query  631  PCCLVT  648
            PCCLV+
Sbjct  191  PCCLVS  196


 Score = 95.9 bits (237),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK   GMIEQVKG SYSVP LLG  S L M    + E KN  KE +
Sbjct  194  LVSPVDGTVLRFGELKGNRGMIEQVKGHSYSVPALLGNNSLLPM----EPEGKNESKEEA  249

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              D + KSW RVSLASPK+R+   A
Sbjct  250  VGDKSDKSWLRVSLASPKLRENVSA  274



>gb|KDO61396.1| hypothetical protein CISIN_1g013143mg [Citrus sinensis]
Length=449

 Score =   293 bits (751),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 157/180 (87%), Gaps = 6/180 (3%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             +  P+KGL+YCVIYLKPGDYHRIHSP DWNVL+RRHFSGRLFP+NERATRTIRNLY ENE
Sbjct  263   TTRPVKGLYYCVIYLKPGDYHRIHSPVDWNVLVRRHFSGRLFPLNERATRTIRNLYFENE  322

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
             RVVLEG WQEG++AMAA+GATNIGSIEL IEP LRTN+P+K  LH EPPEERVYEP G G
Sbjct  323   RVVLEGMWQEGYLAMAAVGATNIGSIELVIEPELRTNQPRKKLLHSEPPEERVYEPQGVG  382

Query  1478  IRMKKGDELAAFNMGSTVVLVFQAP-ISSP-----SDFRFCIKKGERIRMGEALGRWHDS  1639
             + +KKGDE+ AFNMGSTVVLVFQAP I SP     S+FRFCIK+G++IR+GE LGRW +S
Sbjct  383   MMLKKGDEVGAFNMGSTVVLVFQAPTIKSPNRGDNSNFRFCIKRGDKIRVGEGLGRWQES  442


 Score =   203 bits (516),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 146/182 (80%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearass--nggssshgksFFLP  282
            MKFR +++V +F    R  +    R   TSFLRK+Q++    +S   G ++S G +F LP
Sbjct  1    MKFRFSNKVSVFPHYLRLEYDHHCRQFSTSFLRKLQTNPQVRASFSGGSNNSQGNTFLLP  60

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GAT+AT++MLGALHARR+YDD K+E AREKGIE+EF PD KASF+ +LPLRSISR WGF+
Sbjct  61   GATLATLLMLGALHARRMYDDRKVEEAREKGIEIEFKPDAKASFLRLLPLRSISRIWGFM  120

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T VE+PVW+RPYVY+AWARAFHSNLEEAALPL EYASLR+FFVRTLK+GSRP+D DP CL
Sbjct  121  TSVEYPVWMRPYVYKAWARAFHSNLEEAALPLGEYASLREFFVRTLKQGSRPIDHDPHCL  180

Query  643  VT  648
            V+
Sbjct  181  VS  182


 Score = 85.1 bits (209),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR GELK  G  IEQVKGFSYSV  LLG++SFL M  E D  +++ E+ES+
Sbjct  180  LVSPVDGIVLRVGELKGVGAKIEQVKGFSYSVSSLLGSSSFLPMIEEGDMHEQSGEQEST  239

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
             T+  KKSWW +SLASP+VRD A
Sbjct  240  PTEKTKKSWWSISLASPRVRDTA  262



>ref|XP_010055481.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
[Eucalyptus grandis]
 gb|KCW71955.1| hypothetical protein EUGRSUZ_E00410 [Eucalyptus grandis]
Length=446

 Score =   293 bits (751),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 156/180 (87%), Gaps = 6/180 (3%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S  PMKGLFYCVIYL+PGDYHR+HSPA+WNVL RRHFSGRLFP+NERATRTIRNLYVEN
Sbjct  263   VSACPMKGLFYCVIYLRPGDYHRVHSPANWNVLSRRHFSGRLFPLNERATRTIRNLYVEN  322

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG WQEGFMA+AAIGATNIGSIEL+IEP LRTN+P+K  L  E PEER YEP+G 
Sbjct  323   ERVVLEGLWQEGFMALAAIGATNIGSIELYIEPELRTNRPKKKLLQSETPEERFYEPEGV  382

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPIS------SPSDFRFCIKKGERIRMGEALGRWHD  1636
             GI  KKGDE+A FNMGSTVVL+FQAP++       PS FRFCIK+G+RIR+G+ALGRW +
Sbjct  383   GIMSKKGDEMAVFNMGSTVVLIFQAPMTESHEDDDPSGFRFCIKQGDRIRVGQALGRWKE  442


 Score =   200 bits (508),  Expect(2) = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 141/183 (77%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKI---QssearassnggssshgksFFL  279
            M+FR++HR+PLF        L Q R    SF  K     +    +S  G + S G S+ +
Sbjct  1    MRFRSSHRLPLFPHQKPLRCLHQHRRFLASFFAKKLSGSAQARASSDGGAAGSEGSSYLV  60

Query  280  PGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGF  459
            PGATVAT++MLGALHARRLYDD K+E AREKGIE+EF PDVKA+F+ +LPLRSISRFWGF
Sbjct  61   PGATVATLLMLGALHARRLYDDKKVEEAREKGIEIEFQPDVKATFLRLLPLRSISRFWGF  120

Query  460  LTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCC  639
            LT VE PVW+RPY+ RAWARAFHSNLEEAALPLEEY+SL++FFVR LKEGSRP+D DP C
Sbjct  121  LTNVEVPVWMRPYLCRAWARAFHSNLEEAALPLEEYSSLQEFFVRALKEGSRPIDPDPKC  180

Query  640  LVT  648
            LV+
Sbjct  181  LVS  183


 Score =   114 bits (285),  Expect(2) = 7e-76, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGTILR GELK AG MIEQVKG SYSV  LLGA+SFL M A   + +   EKES 
Sbjct  181  LVSPVDGTILRCGELKAAGAMIEQVKGLSYSVYALLGASSFLPMVAGGKTNEDEVEKESV  240

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              +  KKSWWRVSLASPK+RDP  A
Sbjct  241  TEEERKKSWWRVSLASPKIRDPVSA  265



>ref|NP_001240209.1| uncharacterized protein LOC100811372 [Glycine max]
 gb|ACU22799.1| unknown [Glycine max]
Length=435

 Score =   291 bits (746),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 154/180 (86%), Gaps = 6/180 (3%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             S  P KGLFYCV+YLKPGDYHRIHSPADWN+L RRHFSGRL+P+NERATRTIRNLY+ENE
Sbjct  256   SSRPKKGLFYCVVYLKPGDYHRIHSPADWNILARRHFSGRLYPLNERATRTIRNLYIENE  315

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
             RV+LEG WQEGFMA+AAIGATNIGSIELFIEP L TN+P+K  LH EPPEER+Y  +G G
Sbjct  316   RVILEGLWQEGFMALAAIGATNIGSIELFIEPELHTNRPRKKFLHSEPPEERIYGCEGVG  375

Query  1478  IRMKKGDELAAFNMGSTVVLVFQAPIS------SPSDFRFCIKKGERIRMGEALGRWHDS  1639
               +KKGDEL AFNMGSTVVLVFQAPIS      S  +FRFC+ +G+RIR+GEALGRWH S
Sbjct  376   RMLKKGDELGAFNMGSTVVLVFQAPISKLPEGDSSQEFRFCVGRGDRIRVGEALGRWHSS  435


 Score =   195 bits (496),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 145/183 (79%), Gaps = 7/183 (4%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTR-FSHLSQRRLHFTSFLRKIQsse--arassnggssshgksFFL  279
            MK+R +H+ P+  R TR F+H      +FTSF +K Q+ +  A  ++ G  +S G SF +
Sbjct  1    MKYRVSHKFPVLPRHTRPFNHTR----YFTSFAKKFQTPQPRASINAGGSGNSQGNSFVV  56

Query  280  PGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGF  459
            PGATVATI+MLG LHARRLY+D K E  +EKGIE+EF PD KA+F+ +LPLRSISR WG+
Sbjct  57   PGATVATILMLGVLHARRLYEDKKTEQMKEKGIEIEFQPDAKATFLRLLPLRSISRCWGY  116

Query  460  LTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCC  639
            LT +E PVWLRP++Y+AWARAFHSNLEEAALPL++YASLRDFFVRTLKEGSRP+D DP C
Sbjct  117  LTSMEIPVWLRPHIYKAWARAFHSNLEEAALPLDKYASLRDFFVRTLKEGSRPIDVDPQC  176

Query  640  LVT  648
            LV+
Sbjct  177  LVS  179


 Score =   101 bits (251),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 65/83 (78%), Gaps = 4/83 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK AG MIEQ+KGFSYSV  LLGA+ FL  T   D ++++SE  ++
Sbjct  177  LVSPVDGTVLRFGELKGAGAMIEQIKGFSYSVFSLLGASPFLPTT---DVQEEHSESITT  233

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
             T  +KKSWWRVSLASPKV +P 
Sbjct  234  -TVKSKKSWWRVSLASPKVWNPT  255



>ref|XP_008437062.1| PREDICTED: phosphatidylserine decarboxylase proenzyme [Cucumis 
melo]
Length=445

 Score =   292 bits (747),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 157/180 (87%), Gaps = 8/180 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S  P+KGLFYCVIYLKPGDYHRIHSP DW VL+RRHFSG LFPVNERA RTIRNLYVEN
Sbjct  265   VSTCPVKGLFYCVIYLKPGDYHRIHSPVDWQVLVRRHFSGHLFPVNERAVRTIRNLYVEN  324

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK-LHLEPPEERVYEPDG  1471
             ERVVLEG WQEGFMA+AAIGATNIGSIE+FIEP LRTNKP++ K LH +PPEERVYEP+G
Sbjct  325   ERVVLEGLWQEGFMAIAAIGATNIGSIEVFIEPELRTNKPKRRKSLHSDPPEERVYEPEG  384

Query  1472  TGIRMKKGDELAAFNMGSTVVLVFQAPIS-------SPSDFRFCIKKGERIRMGEALGRW  1630
              GI +KKGDE+AAFNMGSTVVL+FQAP+S       S S+F+F IK+G+R+R GEALGRW
Sbjct  385   VGIMLKKGDEMAAFNMGSTVVLIFQAPVSNLHENVASRSEFKFSIKRGDRVRAGEALGRW  444


 Score =   171 bits (432),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 132/185 (71%), Gaps = 5/185 (3%)
 Frame = +1

Query  109  MKFRATHRVPLF--TRCTRFSHLSQRRLHFTSFLRKIQssearassnggssshgks---F  273
            MKFRA   + +   T C   S L      F S  R+ Q+S    +S GG +        +
Sbjct  1    MKFRAPKTIFILPSTSCHLNSSLRNHNRSFASVFRRFQTSLQARASVGGGNGSSSQGDSY  60

Query  274  FLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFW  453
             +PGATVAT++MLGALHARRLYDD K+E ARE+GIE EF  D+KA+F+ ++PLR +SR W
Sbjct  61   LVPGATVATLLMLGALHARRLYDDKKVEEARERGIEPEFKSDIKATFLRLIPLRLVSRCW  120

Query  454  GFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDP  633
            G +T VE P+WLRPYV+RAWARAFHSNLEE ALPL+EYASLR+FFVR+LK+G RP+D D 
Sbjct  121  GHITNVELPIWLRPYVHRAWARAFHSNLEEVALPLDEYASLREFFVRSLKDGCRPIDPDL  180

Query  634  CCLVT  648
             CLV+
Sbjct  181  QCLVS  185


 Score =   111 bits (277),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK AG MIEQVKGFSYSV  LLG  S L M A  D  ++ S +E+S
Sbjct  183  LVSPVDGTVLRFGELKGAGAMIEQVKGFSYSVAALLGTGSLLPMMAAGDGNEEGSGQENS  242

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
              D+ K+SWW++SLA PKV DP 
Sbjct  243  SADSGKRSWWKISLAYPKVLDPV  265



>ref|XP_004152398.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like [Cucumis 
sativus]
 ref|XP_004158135.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like [Cucumis 
sativus]
 gb|KGN50263.1| hypothetical protein Csa_5G162610 [Cucumis sativus]
Length=442

 Score =   291 bits (745),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 157/177 (89%), Gaps = 5/177 (3%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S  P+KGLFYCVIYLKPGDYHRIHSP DW VL+RRHFSG LFPVNERA RTIRNLYVEN
Sbjct  265   VSTCPVKGLFYCVIYLKPGDYHRIHSPVDWQVLVRRHFSGHLFPVNERAVRTIRNLYVEN  324

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK-LHLEPPEERVYEPDG  1471
             ERVVLEG WQEG+MA+AAIGATNIGS+E+FIEP LRTNKP++ K LH +PPEERVYEP+G
Sbjct  325   ERVVLEGLWQEGYMAIAAIGATNIGSVEVFIEPELRTNKPKRRKSLHSDPPEERVYEPEG  384

Query  1472  TGIRMKKGDELAAFNMGSTVVLVFQAPIS----SPSDFRFCIKKGERIRMGEALGRW  1630
              GI +KKGDE+AAFNMGSTVVL+FQAP+S    S S+F+F IK+G+R+R GEALGRW
Sbjct  385   VGIMLKKGDEMAAFNMGSTVVLIFQAPVSNLHDSRSEFKFSIKRGDRVRAGEALGRW  441


 Score =   173 bits (438),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 134/185 (72%), Gaps = 5/185 (3%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRF--SHLSQRRLHFTSFLRKIQssearassnggssshgks---F  273
            MKFRA +R+ +    + +  S L      F S  R+ Q+S    +S GG +        +
Sbjct  1    MKFRAPNRIFILPSTSSYFNSSLRNHNRSFASVFRRFQTSLQARASVGGGNGSSSQGDSY  60

Query  274  FLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFW  453
             +PGATVAT++MLGALHARRLYDD K+E ARE+GIE EF  D+KA+F+ ++PLR +SR W
Sbjct  61   LVPGATVATLLMLGALHARRLYDDKKVEEARERGIEPEFKSDIKATFLRLIPLRLVSRCW  120

Query  454  GFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDP  633
            G +T VE P+WLRPYV+RAWARAFHSNLEE ALPL+EYASLR+FFVR+LKEG RP+D D 
Sbjct  121  GHITNVELPIWLRPYVHRAWARAFHSNLEEVALPLDEYASLREFFVRSLKEGCRPIDPDL  180

Query  634  CCLVT  648
             CLV+
Sbjct  181  QCLVS  185


 Score =   112 bits (281),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK AG MIEQVKGFSYSV  LLG  S L M A  D  ++ S +E+S
Sbjct  183  LVSPVDGTVLRFGELKGAGAMIEQVKGFSYSVAALLGTGSLLPMMAAGDGNEEGSGQENS  242

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
             TD+ K+SWW++SLA PKV DP 
Sbjct  243  STDSGKRSWWKISLAYPKVLDPV  265



>ref|XP_006440281.1| hypothetical protein CICLE_v10020120mg [Citrus clementina]
 gb|ESR53521.1| hypothetical protein CICLE_v10020120mg [Citrus clementina]
Length=449

 Score =   291 bits (745),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 156/177 (88%), Gaps = 6/177 (3%)
 Frame = +2

Query  1127  PMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVV  1306
             P+KGL+YCVIYLKPG+YHRIHSP DWNVL+RRHFSGRLFP+NERATRTIRNLY ENERVV
Sbjct  266   PVKGLYYCVIYLKPGNYHRIHSPVDWNVLVRRHFSGRLFPLNERATRTIRNLYFENERVV  325

Query  1307  LEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRM  1486
             LEG WQEG++AMAA+GATNIGSIEL IEP LRTN+P+K  LH EPPEERVYEP G G+ +
Sbjct  326   LEGMWQEGYLAMAAVGATNIGSIELVIEPELRTNRPRKKLLHSEPPEERVYEPQGVGMML  385

Query  1487  KKGDELAAFNMGSTVVLVFQAP-ISSP-----SDFRFCIKKGERIRMGEALGRWHDS  1639
             KKGDE+ AFNMGSTVVLVFQAP I SP     S+FRFCIK+G++IR+GE LGRW +S
Sbjct  386   KKGDEVGAFNMGSTVVLVFQAPTIKSPNRGDNSNFRFCIKRGDKIRVGEGLGRWQES  442


 Score =   204 bits (520),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 146/182 (80%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearass--nggssshgksFFLP  282
            MKFR +++V +F    R  +    R   TSFLRK+Q++    +S   G ++S G +F LP
Sbjct  1    MKFRFSNKVSVFPHYLRLEYDHHCRQFSTSFLRKLQTNPQVRASFSGGSNNSQGNTFLLP  60

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GAT AT++MLGALHARR+YDD K+E AREKGIE+EF PD KASF+ +LPLRSISRFWGFL
Sbjct  61   GATFATLLMLGALHARRMYDDRKVEEAREKGIEIEFKPDAKASFLRLLPLRSISRFWGFL  120

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T VE+PVW+RPYVY+AWARAFHSNLEEAALPL EYASLR+FFVRTLK+GSRP+D DP CL
Sbjct  121  TSVEYPVWMRPYVYKAWARAFHSNLEEAALPLGEYASLREFFVRTLKQGSRPIDPDPHCL  180

Query  643  VT  648
            V+
Sbjct  181  VS  182


 Score = 87.8 bits (216),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR GELK  G MIEQVKGFSYSV  LLG++SFL M  E D  ++  E+ESS
Sbjct  180  LVSPVDGIVLRVGELKGVGAMIEQVKGFSYSVSSLLGSSSFLPMIEEGDMHEQCGEQESS  239

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
             T+  KKSWW +SLASP+VRD A
Sbjct  240  PTEKTKKSWWSISLASPRVRDTA  262



>ref|XP_006591531.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like [Glycine 
max]
Length=190

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 152/178 (85%), Gaps = 6/178 (3%)
 Frame = +2

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             SP KGLFYCV+YL PGDYHRIHSPADWN+L+RRHFSGRL+P+NERA RTIRNLY+ENERV
Sbjct  13    SPKKGLFYCVVYLNPGDYHRIHSPADWNILVRRHFSGRLYPLNERAIRTIRNLYIENERV  72

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIR  1483
             +LEG W EGFMA+AAIG TNIGSIELFIEP L TN+P+K  LH EPPEER+YE +G G  
Sbjct  73    ILEGLWLEGFMALAAIGDTNIGSIELFIEPELHTNRPRKKFLHSEPPEERIYECEGLGRM  132

Query  1484  MKKGDELAAFNMGSTVVLVFQAPIS------SPSDFRFCIKKGERIRMGEALGRWHDS  1639
             +KKGDEL AFNMGSTVVLVFQAPIS      S  +FRFC+ +G+RIR+GEALGRWH S
Sbjct  133   LKKGDELGAFNMGSTVVLVFQAPISKLHEGDSFQEFRFCVGRGDRIRVGEALGRWHSS  190



>emb|CDY54745.1| BnaAnng13400D [Brassica napus]
Length=445

 Score =   288 bits (738),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 157/181 (87%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S SPMKGL+YCVIYLKPGDYHRIHSPADWN L+RRHF+GRLFPVNERATRTI+NLYVEN
Sbjct  264   ISASPMKGLYYCVIYLKPGDYHRIHSPADWNALVRRHFAGRLFPVNERATRTIKNLYVEN  323

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG W++GFMA+AA+GATNIGSIELFIEP LRTNKP+K     EPPEERVY+P G 
Sbjct  324   ERVVLEGVWKQGFMALAAVGATNIGSIELFIEPELRTNKPKKKLFPTEPPEERVYDPQGH  383

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPIS-SPS------DFRFCIKKGERIRMGEALGRWH  1633
             G++++KG E+  FNMGSTVVLVFQAP + SP       D+RFC+K+GER+R+G+ALGRW 
Sbjct  384   GVKLEKGKEVGVFNMGSTVVLVFQAPTANSPDGSSSSSDYRFCVKQGERVRVGQALGRWK  443

Query  1634  D  1636
             +
Sbjct  444   E  444


 Score =   184 bits (468),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGATVATI+MLGALH RRLY+D KIE  RE+GIELEFH DVKASF+G+LPLRSISR 
Sbjct  63   FLLPGATVATILMLGALHGRRLYEDKKIEEKRERGIELEFHQDVKASFLGILPLRSISRA  122

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG LT VE PVW+RP+VY+AW+RAFHSNLEEAALPLEEYASLRDFFVR+LK+G RP+D D
Sbjct  123  WGSLTSVEIPVWMRPFVYKAWSRAFHSNLEEAALPLEEYASLRDFFVRSLKQGCRPIDPD  182

Query  631  PCCLVT  648
            P CLV+
Sbjct  183  PRCLVS  188


 Score = 96.3 bits (238),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELKE+ GMIEQVKG SYSVP LLG  S L M  +     K+  +E +
Sbjct  186  LVSPVDGTVLRFGELKESRGMIEQVKGHSYSVPALLGTNSLLPMVPQG----KDESEEEA  241

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              D   KSW RVSLASPK+R+   A
Sbjct  242  AGDKGDKSWLRVSLASPKLRESISA  266



>ref|XP_009145596.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
[Brassica rapa]
Length=445

 Score =   288 bits (738),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 157/181 (87%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S SPMKGL+YCVIYLKPGDYHRIHSPADWN L+RRHF+GRLFPVNERATRTI+NLYVEN
Sbjct  264   ISASPMKGLYYCVIYLKPGDYHRIHSPADWNALVRRHFAGRLFPVNERATRTIKNLYVEN  323

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG W++GFMA+AA+GATNIGSIELFIEP LRTNKP+K     EPPEERVY+P G 
Sbjct  324   ERVVLEGVWKQGFMALAAVGATNIGSIELFIEPELRTNKPKKKLFPTEPPEERVYDPQGH  383

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPIS-SPS------DFRFCIKKGERIRMGEALGRWH  1633
             G++++KG E+  FNMGSTVVLVFQAP + SP       D+RFC+K+GER+R+G+ALGRW 
Sbjct  384   GVKLEKGKEVGVFNMGSTVVLVFQAPTANSPDGSSSSSDYRFCVKQGERVRVGQALGRWK  443

Query  1634  D  1636
             +
Sbjct  444   E  444


 Score =   185 bits (469),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 138/188 (73%), Gaps = 8/188 (4%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCT---RFSHLSQRRL-----HFTSFLRKIQssearassnggssshg  264
            MK R    + LF R +   RF   S+R L     H  S  R   S+   +   G   S+G
Sbjct  1    MKPRFPQNIFLFGRYSYVRRFHQSSRRNLSSFINHIRSNRRTFSSTGGGSGGGGTGDSNG  60

Query  265  ksFFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSIS  444
             +F LPGATVATI+MLGALH RRLY+D KIE  RE+GIELEFH DVKASF+G+LPLRSIS
Sbjct  61   NAFLLPGATVATILMLGALHGRRLYEDKKIEEKRERGIELEFHQDVKASFLGILPLRSIS  120

Query  445  RFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVD  624
            R WG LT VE PVW+RP+VY+AW+RAFHSNLEEAALPLEEYASLRDFFVR+LK+G RP+D
Sbjct  121  RAWGSLTSVEIPVWMRPFVYKAWSRAFHSNLEEAALPLEEYASLRDFFVRSLKQGCRPID  180

Query  625  SDPCCLVT  648
             DP CLV+
Sbjct  181  PDPRCLVS  188


 Score = 96.3 bits (238),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELKE+ GMIEQVKG SYSVP LLG  S L M  +     K+  +E +
Sbjct  186  LVSPVDGTVLRFGELKESRGMIEQVKGHSYSVPALLGTNSLLPMVPQG----KDESEEEA  241

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              D   KSW RVSLASPK+R+   A
Sbjct  242  AGDKGDKSWLRVSLASPKLRESISA  266



>emb|CDY40507.1| BnaC01g20050D [Brassica napus]
Length=445

 Score =   287 bits (735),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 157/181 (87%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S SPMKGL+YCVIYLKPGDYHRIHSPADWN L+RRHF+GRLFPVNERATRTI+NLYVEN
Sbjct  264   ISASPMKGLYYCVIYLKPGDYHRIHSPADWNALVRRHFAGRLFPVNERATRTIKNLYVEN  323

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG W++GFMA+AA+GATNIGSIELFIEP LRTNKP+K     EPPEERVY+P G 
Sbjct  324   ERVVLEGVWKQGFMALAAVGATNIGSIELFIEPELRTNKPKKKLFPTEPPEERVYDPQGH  383

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPIS-SPS------DFRFCIKKGERIRMGEALGRWH  1633
             G++++KG E+  FNMGSTVVLVFQAP + SP       D+RFC+K+G+R+R+G+ALGRW 
Sbjct  384   GVKLEKGKEVGVFNMGSTVVLVFQAPTANSPDGSSSSSDYRFCVKQGDRVRVGQALGRWK  443

Query  1634  D  1636
             +
Sbjct  444   E  444


 Score =   187 bits (474),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGATVATI+MLGALH RRLY+D KIE  RE+GIELEFH DVKASF+G+LPLRSISR 
Sbjct  63   FLLPGATVATILMLGALHGRRLYEDKKIEEKRERGIELEFHQDVKASFLGILPLRSISRA  122

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG LT VE PVW+RP+VY+AW+RAFHSNLEEAALPLEEYASLRDFFVR+LKEG RP+D+D
Sbjct  123  WGSLTSVEIPVWMRPFVYKAWSRAFHSNLEEAALPLEEYASLRDFFVRSLKEGCRPIDTD  182

Query  631  PCCLVT  648
            P CLV+
Sbjct  183  PRCLVS  188


 Score = 95.9 bits (237),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELKE+ GMIEQVKG SYSVP LLG  S L M  +     K+  +E +
Sbjct  186  LVSPVDGTVLRFGELKESRGMIEQVKGHSYSVPALLGTNSLLPMVPQG----KDESEEEA  241

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              D   KSW RVSLASPK+R+   A
Sbjct  242  VGDKGDKSWLRVSLASPKLRESISA  266



>ref|XP_004299425.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=445

 Score =   287 bits (735),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 154/180 (86%), Gaps = 7/180 (4%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             S  PMKGLFYCVIYLKPGDYHR+H+PADWN+L RRHFSGRL+PVNERATRTIRNLYVENE
Sbjct  265   SSRPMKGLFYCVIYLKPGDYHRVHAPADWNILARRHFSGRLYPVNERATRTIRNLYVENE  324

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
             RVVLEG WQEGFMA+AA+GATNIGSIEL IEP LRTN+ +K  LH E PEER+YEPDG G
Sbjct  325   RVVLEGLWQEGFMALAAVGATNIGSIELSIEPELRTNQAKKKFLHSERPEERLYEPDGVG  384

Query  1478  IRMKKGDELAAFNMGSTVVLVFQAPIS-------SPSDFRFCIKKGERIRMGEALGRWHD  1636
               +KKGDE+AAFNMGSTVVLVFQAP+S       S SDF+F +++G+R+R GEALGR  D
Sbjct  385   RTLKKGDEVAAFNMGSTVVLVFQAPLSRSPENGESSSDFKFLVQRGDRVRAGEALGRCQD  444


 Score =   192 bits (489),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 136/184 (74%), Gaps = 4/184 (2%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearassnggssshgks----FF  276
            MKFRA H VP+F+  T  +HL  +R  FTS L+K+Q +    +S   +S   K     F 
Sbjct  1    MKFRAVHGVPIFSPSTHLNHLHNQRRCFTSLLKKLQKTTQVRASLNSASGSSKGNGDWFL  60

Query  277  LPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWG  456
            LPGATVAT++MLG LH RR+Y+D K+  A EKGIE EF PD K++F+ +LPLRSISR WG
Sbjct  61   LPGATVATLLMLGVLHGRRMYEDMKVGEAHEKGIEFEFQPDAKSAFLRLLPLRSISRCWG  120

Query  457  FLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPC  636
             LT VE PV LR  VY AWARAFHSNLEEAALPLEEYA+L+DFFVRTLKEGSRP+D DP 
Sbjct  121  VLTSVEIPVSLRSRVYGAWARAFHSNLEEAALPLEEYATLQDFFVRTLKEGSRPIDPDPQ  180

Query  637  CLVT  648
            CLV+
Sbjct  181  CLVS  184


 Score =   107 bits (267),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGE+K AG MIEQVKGFSYSV  LLGATSFL   A+ D + ++SE E+ 
Sbjct  182  LVSPVDGTVLRFGEIKGAGAMIEQVKGFSYSVFSLLGATSFLPTIAKGDMQDESSEPENV  241

Query  827  DTDANKKSWWRVSLASPKVRDP  892
              + ++KSWW +S ASPKV +P
Sbjct  242  SGEKSRKSWWSISFASPKVWNP  263



>ref|XP_010677069.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=446

 Score =   287 bits (735),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 155/181 (86%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +  SPMKGLFYCV+YL PGDYHR+HSP DWNVL+RRHFSGRLFPVNERAT+TIRNLY EN
Sbjct  266   IPASPMKGLFYCVLYLSPGDYHRVHSPVDWNVLVRRHFSGRLFPVNERATKTIRNLYTEN  325

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ER+VLEG+WQ+G++A+AAIGATNIGSIEL+IEP LRTN+P K  L  EPPEERVYE +G 
Sbjct  326   ERIVLEGQWQQGYLALAAIGATNIGSIELYIEPELRTNRPSKKFLQFEPPEERVYEREGV  385

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPI-------SSPSDFRFCIKKGERIRMGEALGRWH  1633
             G  +KKG+E+AAFNMGSTVVLVFQAP+       +S +DFRF I +G+RIR+GEALGRW 
Sbjct  386   GFMVKKGEEVAAFNMGSTVVLVFQAPVAKSSKDKASSTDFRFNINRGDRIRVGEALGRWK  445

Query  1634  D  1636
             D
Sbjct  446   D  446


 Score =   183 bits (464),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 137/186 (74%), Gaps = 6/186 (3%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLH--FTSFLRKIQssearassng----gssshgks  270
            MKFR   R P F    RFS+L+  + H    SFL+K+ +S +  +S       SSS+G +
Sbjct  1    MKFRVHRRFPAFNHLHRFSNLNVFQSHRINPSFLKKLHTSFSTKASLNDGHNSSSSNGNT  60

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGATVATI+M GALHARRLYDD K+E A+E+GIE  F PD KASF+ +LPLR+ISR 
Sbjct  61   FLLPGATVATILMFGALHARRLYDDRKVEEAKERGIEPGFQPDAKASFLNILPLRTISRI  120

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG L  VE PV +RPYVY+AWARAFHSNLEE ALPLEEY S+RDFF R L+EG RP+D+D
Sbjct  121  WGSLMSVELPVQMRPYVYKAWARAFHSNLEEVALPLEEYPSMRDFFSRGLREGCRPIDND  180

Query  631  PCCLVT  648
            P CL++
Sbjct  181  PQCLIS  186


 Score =   118 bits (296),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            L+SPVDG ++RFGELKE G MIEQVKGFSYSV  LLG  SFL M +  D  QKN E E S
Sbjct  184  LISPVDGIVVRFGELKEPGAMIEQVKGFSYSVSTLLGLNSFLPMVSGKDVVQKNGEVEDS  243

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              D  KKSWWRVSL+SPK++DP PA
Sbjct  244  HKDQIKKSWWRVSLSSPKIQDPIPA  268



>ref|XP_010434784.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial-like 
[Camelina sativa]
Length=448

 Score =   287 bits (735),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 157/179 (88%), Gaps = 7/179 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S SPMKGL+YCVIYLKPGDYHRIHSP DWNV++RRHF+GRLFPVNERATRTIRNLYVEN
Sbjct  267   ISASPMKGLYYCVIYLKPGDYHRIHSPVDWNVMVRRHFAGRLFPVNERATRTIRNLYVEN  326

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG+W+EGFMA+AA+GATNIGSIELFIEP LRTNKP+K     EPPEERVY+P+G 
Sbjct  327   ERVVLEGKWKEGFMALAAVGATNIGSIELFIEPDLRTNKPKKKLFPTEPPEERVYDPEGH  386

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPISSPSD-------FRFCIKKGERIRMGEALGRW  1630
             G++++KG E+  FNMGSTVVLVFQAP ++  +       +RFC+K+G+R+R+G+ALGRW
Sbjct  387   GLKLEKGKEVGVFNMGSTVVLVFQAPTANSPEDSSSSSDYRFCVKQGDRVRVGQALGRW  445


 Score =   188 bits (477),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 139/193 (72%), Gaps = 15/193 (8%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCT---RFSHLSQRRLHFTSFLRKIQsse----------arassngg  249
            M+ R TH V L  R T   RF H  +R   F+SFL  I+S+           + +   G 
Sbjct  1    MRPRFTHNVYLLARYTHLRRFHHTHRRT--FSSFLNNIRSNNFGARATPLGGSSSGGGGT  58

Query  250  ssshgksFFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLP  429
              S G +F +PGAT+ATI+MLGALHARRLY+D KIE  REKGIELEFH DVKASF+G+LP
Sbjct  59   GDSKGNAFLVPGATMATILMLGALHARRLYEDKKIEEKREKGIELEFHQDVKASFLGILP  118

Query  430  LRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEG  609
            LRSISR WG    +E PVW+RP+ Y+AWARAFHSNLEEAA PLEEY SL+DFFVR+LKEG
Sbjct  119  LRSISRAWGSFMSLEIPVWMRPHAYKAWARAFHSNLEEAARPLEEYVSLQDFFVRSLKEG  178

Query  610  SRPVDSDPCCLVT  648
             RP+D DPCCLV+
Sbjct  179  CRPIDPDPCCLVS  191


 Score = 94.0 bits (232),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 58/81 (72%), Gaps = 4/81 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK + GMIEQVKG SYSVP LLG  S L M    + E KN  +E +
Sbjct  189  LVSPVDGTVLRFGELKGSRGMIEQVKGHSYSVPALLGNNSLLPM----EPEGKNESEEEA  244

Query  827  DTDANKKSWWRVSLASPKVRD  889
              D +  SW RVSLASPK+R+
Sbjct  245  VGDKSDNSWLRVSLASPKLRE  265



>ref|XP_010264359.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
[Nelumbo nucifera]
Length=440

 Score =   287 bits (734),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 155/178 (87%), Gaps = 8/178 (4%)
 Frame = +2

Query  1127  PMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVV  1306
             PMKGLFYCVIYLKPGDYHR+HSP DW+V +RRHFSG LFP+NERATRTIRNLYVENERVV
Sbjct  262   PMKGLFYCVIYLKPGDYHRVHSPVDWHVFIRRHFSGHLFPLNERATRTIRNLYVENERVV  321

Query  1307  LEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRM  1486
             LEG+W +GFMA+AAIGATN GSIEL IEP LRTN+P+K  LH +PP+ERVYEP+G G+ +
Sbjct  322   LEGQWAQGFMAIAAIGATNTGSIELVIEPDLRTNRPRKKFLHSDPPDERVYEPEGVGVML  381

Query  1487  KKGDELAAFNMGSTVVLVFQAPIS--------SPSDFRFCIKKGERIRMGEALGRWHD  1636
             KKG+E+AAFNMGSTVVLVFQAP+S        S S+F+FC+ +G++IRMGEALGRW +
Sbjct  382   KKGEEMAAFNMGSTVVLVFQAPVSKSLQNDDTSSSEFKFCVSRGDKIRMGEALGRWSE  439


 Score =   184 bits (467),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearassnggssshgksFFLPGA  288
            M+FR +    +F +  +  HL   RL+  SF R +Q   A  +   G S     F +PGA
Sbjct  1    MRFRVSPIWSVFPKRLQHYHLRSHRLYLYSFARNLQIGRASINGGTGRSDGNS-FLVPGA  59

Query  289  TVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTG  468
            TVAT++MLG LHARRLYDD K+E ARE+GIE EF PDVKA F+ +LPLRSISRFWGF+T 
Sbjct  60   TVATLLMLGILHARRLYDDKKVEEAREQGIEFEFSPDVKARFLSLLPLRSISRFWGFITS  119

Query  469  VEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCLVT  648
            VE PV LRP +Y+ WARAFHSNLEEAALPL+EYASL+DFFVRTLK G RP+D DP CLV+
Sbjct  120  VEIPVPLRPLIYKGWARAFHSNLEEAALPLDEYASLQDFFVRTLKAGCRPIDPDPHCLVS  179


 Score =   111 bits (277),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 66/85 (78%), Gaps = 1/85 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGTILR GELKE G MIEQVKGFSYSV  LLG ++FL M  ++D+    S K+ +
Sbjct  177  LVSPVDGTILRLGELKELGAMIEQVKGFSYSVSSLLGESTFLPMNVQEDT-HGESNKQKN  235

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              +A+KKSWWR+SLASP+ R+P PA
Sbjct  236  TKEASKKSWWRISLASPRRRNPEPA  260



>ref|XP_010919616.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
[Elaeis guineensis]
Length=445

 Score =   287 bits (734),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 160/179 (89%), Gaps = 7/179 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S SP KGLFYCVIYLKPGDYHR+HSP DW+VL+RRHFSGRLFP+NERATRTIRNL+VEN
Sbjct  264   VSVSPKKGLFYCVIYLKPGDYHRVHSPIDWHVLIRRHFSGRLFPLNERATRTIRNLHVEN  323

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEGRW+EGF+AMAAIGATN+GSI+LFIEP L+TN+P+K  LH EPP+ERVYEP+G 
Sbjct  324   ERVVLEGRWEEGFIAMAAIGATNVGSIKLFIEPELKTNRPRKRLLHSEPPDERVYEPEGV  383

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPIS-SP------SDFRFCIKKGERIRMGEALGRW  1630
             G+ +KKG+ELAAFNMGSTVVLVFQA +S SP      S+F+FC+K G++I++GE +G+W
Sbjct  384   GVMVKKGEELAAFNMGSTVVLVFQASVSESPGKDDHSSEFKFCVKSGDKIKVGEVIGKW  442


 Score =   175 bits (443),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
              +PGAT+ATI+MLG LHARRLYDD K+E  +EKGIELEF PDVKASF+ +LPLRS+SR 
Sbjct  60   LLVPGATMATILMLGILHARRLYDDKKVEDMKEKGIELEFSPDVKASFLRLLPLRSMSRC  119

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WGFL  VE PV LRP++Y+AWARAFHSNL+EAALPLE Y SL++FF+RTLKEGSRP+D D
Sbjct  120  WGFLMSVEIPVRLRPFIYKAWARAFHSNLDEAALPLENYVSLQEFFIRTLKEGSRPIDPD  179

Query  631  PCCLVT  648
            P CLV+
Sbjct  180  PNCLVS  185


 Score = 94.0 bits (232),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG ILR GEL+ +G MIEQVKGFSYS   LLGA S L    ++++ +++SE +S 
Sbjct  183  LVSPVDGKILRLGELRGSGAMIEQVKGFSYSAASLLGANSLLHDAVDEETCKEHSE-QSI  241

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
               +++KSWWR+S ASPK+R P 
Sbjct  242  TEHSSRKSWWRISFASPKLRGPV  264



>gb|KHG14927.1| Phosphatidylserine decarboxylase proenzyme 1, mitochondrial [Gossypium 
arboreum]
Length=447

 Score =   285 bits (730),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 155/177 (88%), Gaps = 7/177 (4%)
 Frame = +2

Query  1121  CSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENER  1300
             CS MKGL+YCVIYLKPGDYHRIHSP DWNVL+RRHFSGRLFPVNERATRTIRNLYVENER
Sbjct  271   CS-MKGLYYCVIYLKPGDYHRIHSPVDWNVLVRRHFSGRLFPVNERATRTIRNLYVENER  329

Query  1301  VVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGI  1480
             VVLEG WQ+GFMA+AA+GATNIGSIELFIEP LRTN+P+K  +  EPPEE +YEP G G+
Sbjct  330   VVLEGLWQQGFMAIAAVGATNIGSIELFIEPELRTNRPRKKLIPSEPPEEHLYEPKGVGV  389

Query  1481  RMKKGDELAAFNMGSTVVLVFQAPIS-SP-----SDFRFCIKKGERIRMGEALGRWH  1633
              +KKGDE+AAFNMGSTVVLVFQAP S SP     S+F F I++G++IR+GEALG WH
Sbjct  390   MLKKGDEVAAFNMGSTVVLVFQAPTSKSPKNNDASEFEFSIRRGDKIRVGEALGVWH  446


 Score =   177 bits (448),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 139/186 (75%), Gaps = 6/186 (3%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearass-----nggssshgksF  273
            M FR +  V +F     F+++  RR  F+ +++  +++    +S        S+S G +F
Sbjct  1    MNFRFSRNVAVFPPYLHFANVHNRRRLFSWYVKHFRTTSQARASLSGGGGSSSNSQGNAF  60

Query  274  FLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVK-ASFMGMLPLRSISRF  450
             +PGATVAT++MLG LHARRLYDD K+E AREKGIE EF PDVK A+F+ +LPLRSISR 
Sbjct  61   LVPGATVATLLMLGVLHARRLYDDKKVEEAREKGIEFEFRPDVKVATFLRILPLRSISRA  120

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WGFL  V+ PVWLRP+VYRAWARAFHSNLEEAALPLEEYASLRDFFVRTLKEG RP++ +
Sbjct  121  WGFLMSVDIPVWLRPHVYRAWARAFHSNLEEAALPLEEYASLRDFFVRTLKEGCRPINPN  180

Query  631  PCCLVT  648
            P  LV+
Sbjct  181  PYSLVS  186


 Score =   112 bits (279),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 2/83 (2%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNS--EKE  820
            LVSPVDGTILRFG+L  AG MI+QVKGFSYSV  LLGA+  LSM AE +SE  +S  E+E
Sbjct  184  LVSPVDGTILRFGKLNGAGAMIDQVKGFSYSVSSLLGASPLLSMLAEKNSEDDSSTIEQE  243

Query  821  SSDTDANKKSWWRVSLASPKVRD  889
            S+  + +KKSWWRVSLASPKVR+
Sbjct  244  STQREQSKKSWWRVSLASPKVRE  266



>ref|XP_010449727.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
[Camelina sativa]
Length=444

 Score =   285 bits (729),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 155/178 (87%), Gaps = 7/178 (4%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             S SPMKGL+YCVIYLKPGDYHRIHSP DWN ++RRHF+GRLFPVNERATRTIRNLYVENE
Sbjct  264   SASPMKGLYYCVIYLKPGDYHRIHSPVDWNAMVRRHFAGRLFPVNERATRTIRNLYVENE  323

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
             RVVLEG+W+EGFMA+AA+GATNIGSIELFIEP LRTNKP+K     EPPEERVY+P+G G
Sbjct  324   RVVLEGQWKEGFMALAAVGATNIGSIELFIEPELRTNKPKKKLFPTEPPEERVYDPEGHG  383

Query  1478  IRMKKGDELAAFNMGSTVVLVFQAPISSPSD-------FRFCIKKGERIRMGEALGRW  1630
             ++++KG E+  FNMGSTVVLVFQAP ++  +       +RFC+K+G+R+R+G+ALGRW
Sbjct  384   LKLEKGKEVGVFNMGSTVVLVFQAPTANSPEDSSSSSDYRFCVKQGDRVRVGQALGRW  441


 Score =   189 bits (480),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 140/189 (74%), Gaps = 11/189 (6%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCT---RFSHLSQRRLHFTSFLRKIQssearassn------ggsssh  261
            M+ R +H V L  R T   RF H  +R   F+SFL  I+S+   A +       GG  S 
Sbjct  1    MRPRFSHNVYLLARYTHLRRFHHTHRRT--FSSFLNNIRSNNFGARATPLGGSSGGGDSK  58

Query  262  gksFFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSI  441
            G +F +PGAT+ATI+MLGALHARRLY+D KIE  RE+GIELEFH DVKASF+G+LPLRSI
Sbjct  59   GNAFLVPGATMATILMLGALHARRLYEDKKIEEKRERGIELEFHQDVKASFLGILPLRSI  118

Query  442  SRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPV  621
            SR WG    +E PVW+RPY Y+AWARAFHSNLEEAA PLEEY SL+DFFVR+LKEG RP+
Sbjct  119  SRAWGSFMSLEIPVWMRPYAYKAWARAFHSNLEEAARPLEEYVSLQDFFVRSLKEGCRPI  178

Query  622  DSDPCCLVT  648
            D DPCCLV+
Sbjct  179  DPDPCCLVS  187


 Score = 94.0 bits (232),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK   GMIEQVKG SYSVP LLG  S L M    + E KN  +E +
Sbjct  185  LVSPVDGTVLRFGELKGNRGMIEQVKGHSYSVPALLGNNSLLPM----EPEGKNESEEEA  240

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              D +  SW RVSLASPK+R+ + A
Sbjct  241  VGDKSDNSWLRVSLASPKLRENSSA  265



>gb|KDP39887.1| hypothetical protein JCGZ_03418 [Jatropha curcas]
Length=444

 Score =   284 bits (726),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 155/181 (86%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S  P KGL+YCVIYL+PGDYHRIHSP +WNVL+RRHF+G LFP+NERATRTIRNLYVEN
Sbjct  263   VSACPKKGLYYCVIYLRPGDYHRIHSPVEWNVLVRRHFTGNLFPMNERATRTIRNLYVEN  322

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG WQEGFMA+AAIGATNIGSIELFIEP L TN P+K  L+ +PPEERVYEP+G 
Sbjct  323   ERVVLEGLWQEGFMAIAAIGATNIGSIELFIEPELCTNLPRKKLLNSQPPEERVYEPEGI  382

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPI-------SSPSDFRFCIKKGERIRMGEALGRWH  1633
             G  +KKG+E+AAFNMGSTVVLVFQAP         S S+FRF IK+G+R+R+GEALGRWH
Sbjct  383   GKMLKKGEEVAAFNMGSTVVLVFQAPTLKLLKNRDSSSEFRFNIKRGDRVRVGEALGRWH  442

Query  1634  D  1636
             D
Sbjct  443   D  443


 Score =   207 bits (526),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 143/183 (78%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssear---assnggssshgksFFL  279
            MKFR + +VP+F    R +H    R  F SF +K Q++       + N  S+S G SF +
Sbjct  1    MKFRFSRKVPIFPHNLRINHRYHERQFFNSFFKKSQTAPQARGSFNGNSSSNSQGNSFLV  60

Query  280  PGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGF  459
            PGATVAT++MLGALHARRLYDD K E AREKGIE+EF PDVKASF+ MLPLRSISR WG 
Sbjct  61   PGATVATLLMLGALHARRLYDDKKNEEAREKGIEIEFQPDVKASFLQMLPLRSISRVWGS  120

Query  460  LTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCC  639
            LTG+E P+WLRPYVY+AWARAFHSNLEEAALPLE+YASL+DFFVR L+EG RP+D DPCC
Sbjct  121  LTGIELPIWLRPYVYKAWARAFHSNLEEAALPLEKYASLKDFFVRALEEGCRPIDPDPCC  180

Query  640  LVT  648
            LV+
Sbjct  181  LVS  183


 Score =   117 bits (292),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGTILRFGELK +G MIEQVKGFSYSV  LLG++SFL + AE D + ++SE++S+
Sbjct  181  LVSPVDGTILRFGELKGSGAMIEQVKGFSYSVFSLLGSSSFLPLIAEGDVQDESSEQQSN  240

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              + +KKSWWR+SLASPKVRD   A
Sbjct  241  LKENSKKSWWRISLASPKVRDTVSA  265



>ref|XP_002868107.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44366.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=451

 Score =   284 bits (726),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 158/181 (87%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S SPMKGL+YCVIYL+PGDYHRIHSP DWN ++RRHF+GRLFPVNERATRTIRNLYVEN
Sbjct  270   ISASPMKGLYYCVIYLRPGDYHRIHSPVDWNAMVRRHFAGRLFPVNERATRTIRNLYVEN  329

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG W+EGFMA+AA+GAT+IGSIELFIEP LRTNKP+K     EPPEERVY+P+G 
Sbjct  330   ERVVLEGIWKEGFMALAAVGATSIGSIELFIEPELRTNKPKKKLFPTEPPEERVYDPEGL  389

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPIS-SPS------DFRFCIKKGERIRMGEALGRWH  1633
             G++++KG E+  FNMGSTVVLVFQAP + SP       D+RFC+K+G+R+R+G+ALGRW+
Sbjct  390   GLKLEKGKEVGVFNMGSTVVLVFQAPTANSPEGSSSSSDYRFCVKQGDRVRVGQALGRWN  449

Query  1634  D  1636
             +
Sbjct  450   E  450


 Score =   189 bits (481),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGAT+ATI+MLGALHARRLY+D KIE  RE+GIELEFHPDVKASF+G+LPLRSISR 
Sbjct  69   FLLPGATMATILMLGALHARRLYEDKKIEEKRERGIELEFHPDVKASFLGILPLRSISRA  128

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG +  +E PVW+RPY Y+AWARAFHSNLEEAALPL+EYASL+DFFVR+LKEG RP+D D
Sbjct  129  WGSIMSLEIPVWMRPYAYKAWARAFHSNLEEAALPLKEYASLQDFFVRSLKEGCRPIDPD  188

Query  631  PCCLVT  648
            PCCLV+
Sbjct  189  PCCLVS  194


 Score = 94.7 bits (234),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 59/81 (73%), Gaps = 4/81 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGTILRFGELK + GMIEQVKG SYSVP LLG  S L M    + E K+  +E +
Sbjct  192  LVSPVDGTILRFGELKGSRGMIEQVKGHSYSVPALLGNNSLLPM----EPEGKDESEEEA  247

Query  827  DTDANKKSWWRVSLASPKVRD  889
              D + KSW RVSLASPK+R+
Sbjct  248  VGDKSHKSWLRVSLASPKLRE  268



>ref|XP_006286156.1| hypothetical protein CARUB_v10007715mg [Capsella rubella]
 gb|EOA19054.1| hypothetical protein CARUB_v10007715mg [Capsella rubella]
Length=449

 Score =   284 bits (726),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 156/179 (87%), Gaps = 7/179 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S SPMKGL+YCVIYLKPGDYHRIHSPADWN ++RRHF+GRLFPVNERATRTIRNLYVEN
Sbjct  268   ISASPMKGLYYCVIYLKPGDYHRIHSPADWNAMVRRHFAGRLFPVNERATRTIRNLYVEN  327

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG W+EGFMA+AA+GATNIGSIELFIEP LRTNKP+K     EPPEERVY+P G 
Sbjct  328   ERVVLEGLWKEGFMAVAAVGATNIGSIELFIEPELRTNKPKKKLFPTEPPEERVYDPKGH  387

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPISS-------PSDFRFCIKKGERIRMGEALGRW  1630
             G++++KG E+  FNMGSTVVLVFQAP ++        SD+RFC+K+G+R+R+G+ALGRW
Sbjct  388   GLKLEKGKEVGVFNMGSTVVLVFQAPTANSPDDSSSSSDYRFCVKQGDRVRVGQALGRW  446


 Score =   189 bits (480),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGAT+ATI+MLGALHARRLY+D KIE  RE+GIELEFH DVKASF+G+LPLRSISR 
Sbjct  67   FLLPGATMATILMLGALHARRLYEDKKIEEKRERGIELEFHQDVKASFLGILPLRSISRA  126

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG L  +E PVW+RPY Y+AWARAFHSNLEEAALPL+EYASLRDFFVR+LKEG RPVD D
Sbjct  127  WGSLMSLEIPVWMRPYAYKAWARAFHSNLEEAALPLKEYASLRDFFVRSLKEGCRPVDPD  186

Query  631  PCCLVT  648
            PCCLV+
Sbjct  187  PCCLVS  192


 Score = 92.8 bits (229),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK + GMIEQVKG SYSVP LLG  S L M    + E K+  +E +
Sbjct  190  LVSPVDGTVLRFGELKGSRGMIEQVKGHSYSVPALLGNNSLLPM----EPEGKDKSEEEA  245

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              D +  SW RVSLASPK+R+   A
Sbjct  246  VGDKSDNSWLRVSLASPKLREDISA  270



>gb|AES94292.2| phosphatidylserine decarboxylase [Medicago truncatula]
Length=440

 Score =   283 bits (725),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 153/181 (85%), Gaps = 7/181 (4%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             S  P KGLFYCVIYLKPGDY+RIHSPADWN+L+RRHFSG L+PVNERATRTIRNLY+ENE
Sbjct  260   SSCPKKGLFYCVIYLKPGDYNRIHSPADWNILVRRHFSGHLYPVNERATRTIRNLYIENE  319

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
             RVVLEG WQEGFMA+AA+GATNIGSIELFIEP L+TNKP K  L+ EPPEERVY+ +G G
Sbjct  320   RVVLEGVWQEGFMALAAVGATNIGSIELFIEPELQTNKPIKKSLNSEPPEERVYDCEGVG  379

Query  1478  IRMKKGDELAAFNMGSTVVLVFQAPIS-------SPSDFRFCIKKGERIRMGEALGRWHD  1636
               +KKGDEL AFNMGSTVVLVFQAPIS       S  +F F +K G+RI++GEALGRWH 
Sbjct  380   KVLKKGDELGAFNMGSTVVLVFQAPISKLLHEGDSSQEFNFNVKCGDRIKVGEALGRWHS  439

Query  1637  S  1639
             S
Sbjct  440   S  440


 Score =   194 bits (493),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 4/182 (2%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQsse--arassnggssshgksFFLP  282
            MK R  HR P+ +  TRF + + +   FTSF++     +  +  +   G+S    S+ LP
Sbjct  1    MKPRVPHRFPILSYHTRFHNHTHKS--FTSFIKNFPKPQPPSSVNGANGNSKGDSSYLLP  58

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GATVATI+MLGALHARR+YDD KIE  +EKGIE+EF PDVKASFM  LPLRSISR WG L
Sbjct  59   GATVATILMLGALHARRMYDDKKIEKRQEKGIEVEFQPDVKASFMSFLPLRSISRCWGQL  118

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T +E P WLRP+VY+AWARAFHSNLEEAALPL++Y SLR+FFVR LKEGSRP+D+DP CL
Sbjct  119  TSMEIPAWLRPHVYKAWARAFHSNLEEAALPLDKYTSLREFFVRALKEGSRPIDTDPQCL  178

Query  643  VT  648
            V+
Sbjct  179  VS  180


 Score =   104 bits (259),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG ILRFGELK AG MIEQVKGFSY V  LLGA+S L  TA  + +++ SE    
Sbjct  178  LVSPVDGKILRFGELKGAGAMIEQVKGFSYPVFSLLGASSLLPTTAHGNVQEETSE-SIK  236

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
             T+ +KKSWWRVSLASPKV DP 
Sbjct  237  PTEKSKKSWWRVSLASPKVWDPT  259



>ref|XP_004511705.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like isoform 
X3 [Cicer arietinum]
Length=438

 Score =   283 bits (724),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 152/181 (84%), Gaps = 7/181 (4%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             S  P KGLFYCVIYLKPGDYHRIHSP DWN+L+RRHFSG L+PVNERATRTIRNLY+ENE
Sbjct  258   SSCPKKGLFYCVIYLKPGDYHRIHSPTDWNILVRRHFSGNLYPVNERATRTIRNLYIENE  317

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
             RV+LEG WQEGFMA+AA+GATNIGSIELFIEP L+TNKP+K  LH EPPEERVY+ +G G
Sbjct  318   RVILEGVWQEGFMALAAVGATNIGSIELFIEPELQTNKPRKKSLHSEPPEERVYDCEGVG  377

Query  1478  IRMKKGDELAAFNMGSTVVLVFQAPIS-------SPSDFRFCIKKGERIRMGEALGRWHD  1636
               +KKGDEL AFNMGSTVVLVF+APIS       S  +F F +K G+RIR+GEALGR H 
Sbjct  378   RALKKGDELGAFNMGSTVVLVFEAPISKLLHEGNSSQEFNFSVKCGDRIRVGEALGRRHS  437

Query  1637  S  1639
             S
Sbjct  438   S  438


 Score =   186 bits (471),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 134/182 (74%), Gaps = 5/182 (3%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKI--QssearassnggssshgksFFLP  282
            MK R +HR  +     RF  L+  +  FTSF +K     +    +   G+S    SF LP
Sbjct  1    MKPRVSHRFLILRYQIRF--LTHTK-PFTSFAKKFLAPQARPSINGGNGNSQGDSSFLLP  57

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GATVATI+MLGALHARR+YDD K E  REKGIELEF PDVKASF  +LPLRSISR WG L
Sbjct  58   GATVATILMLGALHARRMYDDKKTEDMREKGIELEFQPDVKASFFRLLPLRSISRCWGHL  117

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T +E PVWLRP+VYRAWARAFHSNLEEAALPL++Y SLR+FF R LKEGSRP+D+DP CL
Sbjct  118  TSMEIPVWLRPHVYRAWARAFHSNLEEAALPLDKYTSLREFFARALKEGSRPIDADPQCL  177

Query  643  VT  648
            V+
Sbjct  178  VS  179


 Score =   105 bits (262),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 2/83 (2%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGTILRFGELK AG MIEQVKGFSY V  LLGA+SFL  TA+ + ++++SE   +
Sbjct  177  LVSPVDGTILRFGELKGAGAMIEQVKGFSYPVFSLLGASSFLP-TADSNVQEEHSES-IT  234

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
             T+ +KKSWWRVSLASPKV DP 
Sbjct  235  ITEKSKKSWWRVSLASPKVWDPT  257



>ref|XP_008342942.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
[Malus domestica]
Length=442

 Score =   283 bits (724),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 156/181 (86%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S  PM GLFYCVIYLKPGDYHRIH+P DWNVL+RRHFSGRLFPVNERATRTIRNLYVEN
Sbjct  261   VSERPMNGLFYCVIYLKPGDYHRIHAPXDWNVLVRRHFSGRLFPVNERATRTIRNLYVEN  320

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG W+EGFMA+AAIGATNIGSIEL IEP L+TN+ +K  L   PPEE++YEPDG 
Sbjct  321   ERVVLEGLWKEGFMALAAIGATNIGSIELSIEPELQTNQARKKLLPSGPPEEQLYEPDGI  380

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPIS-------SPSDFRFCIKKGERIRMGEALGRWH  1633
             G  +KKGDE+AAFNMGSTVVLVFQAPIS       S S+F+F +++G+R+R+GEALGRW+
Sbjct  381   GRMLKKGDEVAAFNMGSTVVLVFQAPISLSQEKRDSSSEFKFLVQRGDRVRVGEALGRWY  440

Query  1634  D  1636
             D
Sbjct  441   D  441


 Score =   181 bits (460),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearas--snggssshgksFFLP  282
            M+FR +H +P+F+  +  ++L  +R  F+S L+K+  +    +  + GG  S G SF LP
Sbjct  1    MEFRVSHGIPMFSGSSHLAYLHNQRHCFSS-LKKLHKTAQARAFVNGGGGGSKGDSFLLP  59

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GATVAT++MLG LH RR+Y+D K E ARE G ELEF PDVK+ F+ +LPLRSISR WG L
Sbjct  60   GATVATLLMLGVLHGRRMYEDRKAEEARENGAELEFQPDVKSKFLRLLPLRSISRCWGLL  119

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T VE PV LR +VY AWARAFHSNLEEAALPL+EYASLR+FFVRTLKEGSRP+D DP CL
Sbjct  120  TSVEIPVSLRXHVYGAWARAFHSNLEEAALPLDEYASLREFFVRTLKEGSRPIDPDPRCL  179

Query  643  VT  648
            V+
Sbjct  180  VS  181


 Score =   116 bits (290),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGEL+EAG MIEQVKGFSYSV  LLGA SFL M A+ D  +++SE E++
Sbjct  179  LVSPVDGTVLRFGELREAGAMIEQVKGFSYSVFSLLGANSFLPMIAKGDMHEESSEPENT  238

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
              + NKKSW RVSLASPKV DP 
Sbjct  239  SREKNKKSWLRVSLASPKVWDPV  261



>ref|XP_010440113.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial-like 
[Camelina sativa]
Length=451

 Score =   283 bits (723),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 156/180 (87%), Gaps = 8/180 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S SPMKGL+YCVIYLKPGDYHRIHSPADWN  +RRHF+GRLFPVNERATRTIRNLYVEN
Sbjct  269   ISASPMKGLYYCVIYLKPGDYHRIHSPADWNARVRRHFAGRLFPVNERATRTIRNLYVEN  328

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG+W+EGFMA+AA+GATNIGSIELFIEP LRTNKP+K     EPPEERVY+P G 
Sbjct  329   ERVVLEGQWKEGFMALAAVGATNIGSIELFIEPELRTNKPKKKLFPTEPPEERVYDPKGH  388

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPISS--------PSDFRFCIKKGERIRMGEALGRW  1630
             G++++KG E+  FNMGSTVVLVFQAP ++         SD+RFC+K+G+R+R+G+ALGRW
Sbjct  389   GLKLEKGKEVGVFNMGSTVVLVFQAPTANSPEEDSSSSSDYRFCVKQGDRVRVGQALGRW  448


 Score =   186 bits (472),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 138/195 (71%), Gaps = 17/195 (9%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCT---RFSHLSQRRLHFTSFLRKIQssearassn------------  243
            M+ R TH V L  R T   RF H  +R   F+SFL  I+S+   A +             
Sbjct  1    MRPRFTHNVYLLARYTHLRRFHHTHRRT--FSSFLNNIRSNNFGARATPLGGGGGGGGGV  58

Query  244  ggssshgksFFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGM  423
            G   S G +F LPGAT+ATI+MLGALHARRLY+D KIE  RE GIELEFH DVKASF+G+
Sbjct  59   GTGDSKGNAFLLPGATMATILMLGALHARRLYEDKKIEEKREMGIELEFHQDVKASFLGI  118

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLK  603
            LP+RSISR WG    +E PVW+RPY Y++WARAFHSNLEEAA PLEEY SL+DFFVR+LK
Sbjct  119  LPMRSISRAWGSFMSLEIPVWMRPYAYKSWARAFHSNLEEAARPLEEYLSLQDFFVRSLK  178

Query  604  EGSRPVDSDPCCLVT  648
            EG RP+D DPCCLV+
Sbjct  179  EGCRPIDPDPCCLVS  193


 Score = 92.4 bits (228),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 4/81 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK + GMIEQVKG SYSVP LLG  S L M    + E KN  +E +
Sbjct  191  LVSPVDGTVLRFGELKGSRGMIEQVKGHSYSVPALLGNNSLLPM----EPEGKNESEEEA  246

Query  827  DTDANKKSWWRVSLASPKVRD  889
              D +   W RVSLASPK+R+
Sbjct  247  VGDKSDNCWLRVSLASPKLRE  267



>ref|XP_004511703.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511704.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like isoform 
X2 [Cicer arietinum]
Length=491

 Score =   283 bits (725),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 152/181 (84%), Gaps = 7/181 (4%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             S  P KGLFYCVIYLKPGDYHRIHSP DWN+L+RRHFSG L+PVNERATRTIRNLY+ENE
Sbjct  311   SSCPKKGLFYCVIYLKPGDYHRIHSPTDWNILVRRHFSGNLYPVNERATRTIRNLYIENE  370

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
             RV+LEG WQEGFMA+AA+GATNIGSIELFIEP L+TNKP+K  LH EPPEERVY+ +G G
Sbjct  371   RVILEGVWQEGFMALAAVGATNIGSIELFIEPELQTNKPRKKSLHSEPPEERVYDCEGVG  430

Query  1478  IRMKKGDELAAFNMGSTVVLVFQAPIS-------SPSDFRFCIKKGERIRMGEALGRWHD  1636
               +KKGDEL AFNMGSTVVLVF+APIS       S  +F F +K G+RIR+GEALGR H 
Sbjct  431   RALKKGDELGAFNMGSTVVLVFEAPISKLLHEGNSSQEFNFSVKCGDRIRVGEALGRRHS  490

Query  1637  S  1639
             S
Sbjct  491   S  491


 Score =   149 bits (377),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGATVATI+MLGALHARR+YDD K E  REKGIELEF PDVKASF  +LPLRSISR 
Sbjct  54   FLLPGATVATILMLGALHARRMYDDKKTEDMREKGIELEFQPDVKASFFRLLPLRSISRC  113

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSN  534
            WG LT +E PVWLRP+VYRAWARAFHS+
Sbjct  114  WGHLTSMEIPVWLRPHVYRAWARAFHSS  141


 Score =   106 bits (264),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 2/83 (2%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGTILRFGELK AG MIEQVKGFSY V  LLGA+SFL  TA+ + ++++SE   +
Sbjct  230  LVSPVDGTILRFGELKGAGAMIEQVKGFSYPVFSLLGASSFLP-TADSNVQEEHSE-SIT  287

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
             T+ +KKSWWRVSLASPKV DP 
Sbjct  288  ITEKSKKSWWRVSLASPKVWDPT  310


 Score = 43.9 bits (102),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  577  RDFFVRTLKEGSRPVDSDPCCLVT  648
            R+FF R LKEGSRP+D+DP CLV+
Sbjct  209  REFFARALKEGSRPIDADPQCLVS  232



>ref|XP_008802785.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
[Phoenix dactylifera]
Length=447

 Score =   280 bits (716),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 159/182 (87%), Gaps = 7/182 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S SP KGLFYCVIYLKPGDYHR+HSP DW+VL+RRHFSG LFP+NERATRTIRNL+VEN
Sbjct  266   VSVSPKKGLFYCVIYLKPGDYHRVHSPIDWHVLIRRHFSGCLFPLNERATRTIRNLHVEN  325

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG+W+EGF+AMAAIGATN+GSI+LFIEP L+TN+P++  LH + P+ERVYEP+G 
Sbjct  326   ERVVLEGQWEEGFIAMAAIGATNVGSIKLFIEPELKTNRPRQRLLHSDHPDERVYEPEGI  385

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPISS-------PSDFRFCIKKGERIRMGEALGRWH  1633
             G+ +KKG+ELAAFNMGSTVVLVFQAP+S         S+F+FC+K G++I++GEA+G+W 
Sbjct  386   GVMVKKGEELAAFNMGSTVVLVFQAPVSELPGKDDHSSEFKFCVKSGDKIKVGEAIGKWS  445

Query  1634  DS  1639
              S
Sbjct  446   RS  447


 Score =   174 bits (442),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
              +PGAT+ATI+MLG LHARRLYDD K+E  +EKGIELEF PDVKASF+ +LPLRS+SR 
Sbjct  62   LLIPGATMATILMLGILHARRLYDDKKVEEMKEKGIELEFSPDVKASFLRLLPLRSMSRC  121

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WGFL  VE PV LRP++Y AWARAFHSNL+EAALPLE Y SL++FFVRTLKEGSRP+D D
Sbjct  122  WGFLMSVEIPVRLRPFIYNAWARAFHSNLDEAALPLENYVSLQEFFVRTLKEGSRPIDPD  181

Query  631  PCCLVT  648
            P CLV+
Sbjct  182  PNCLVS  187


 Score = 91.7 bits (226),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG ILR GEL+  G MIEQVKGFSYS   LLGA S L      ++ +++SE +S 
Sbjct  185  LVSPVDGKILRLGELRGLGAMIEQVKGFSYSAASLLGANSLLHDAVNVETCKEHSE-QSI  243

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
              D + KSWWR+S ASPK+R P 
Sbjct  244  TEDLSAKSWWRISFASPKLRGPV  266



>ref|XP_003611334.1| Phosphatidylserine decarboxylase proenzyme [Medicago truncatula]
Length=545

 Score =   283 bits (723),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 153/181 (85%), Gaps = 7/181 (4%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             S  P KGLFYCVIYLKPGDY+RIHSPADWN+L+RRHFSG L+PVNERATRTIRNLY+ENE
Sbjct  365   SSCPKKGLFYCVIYLKPGDYNRIHSPADWNILVRRHFSGHLYPVNERATRTIRNLYIENE  424

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
             RVVLEG WQEGFMA+AA+GATNIGSIELFIEP L+TNKP K  L+ EPPEERVY+ +G G
Sbjct  425   RVVLEGVWQEGFMALAAVGATNIGSIELFIEPELQTNKPIKKSLNSEPPEERVYDCEGVG  484

Query  1478  IRMKKGDELAAFNMGSTVVLVFQAPIS-------SPSDFRFCIKKGERIRMGEALGRWHD  1636
               +KKGDEL AFNMGSTVVLVFQAPIS       S  +F F +K G+RI++GEALGRWH 
Sbjct  485   KVLKKGDELGAFNMGSTVVLVFQAPISKLLHEGDSSQEFNFNVKCGDRIKVGEALGRWHS  544

Query  1637  S  1639
             S
Sbjct  545   S  545


 Score =   160 bits (404),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/240 (47%), Positives = 138/240 (58%), Gaps = 58/240 (24%)
 Frame = +1

Query  97   RKKKMKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQsse--arassnggssshgks  270
            R  KMK R  HR P+ +  TRF + + +   FTSF++     +  +  +   G+S    S
Sbjct  48   RIAKMKPRVPHRFPILSYHTRFHNHTHKS--FTSFIKNFPKPQPPSSVNGANGNSKGDSS  105

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            + LPGATVATI+MLGALHARR+YDD KIE  +EKGIE+EF PDVKASFM  LPLRSISR 
Sbjct  106  YLLPGATVATILMLGALHARRMYDDKKIEKRQEKGIEVEFQPDVKASFMSFLPLRSISRC  165

Query  451  WGFLTGVEFPV--WLR--------------------------------------------  492
            WG LT +   +  W R                                            
Sbjct  166  WGQLTSMRMDIGRWRRRVSDRESAVEGGDGGLCAGEGWGRRRRTSMLRRRRNNIWEKEEE  225

Query  493  --------PYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCLVT  648
                    P+VY+AWARAFHSNLEEAALPL++Y SLR+FFVR LKEGSRP+D+DP CLV+
Sbjct  226  REIPAWLRPHVYKAWARAFHSNLEEAALPLDKYTSLREFFVRALKEGSRPIDTDPQCLVS  285


 Score =   103 bits (257),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG ILRFGELK AG MIEQVKGFSY V  LLGA+S L  TA  + +++ SE    
Sbjct  283  LVSPVDGKILRFGELKGAGAMIEQVKGFSYPVFSLLGASSLLPTTAHGNVQEETSE-SIK  341

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
             T+ +KKSWWRVSLASPKV DP 
Sbjct  342  PTEKSKKSWWRVSLASPKVWDPT  364



>emb|CBI37364.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   279 bits (714),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 152/181 (84%), Gaps = 15/181 (8%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             ++ SPMKGLFYCVIYLKPGDYHRIHSP DWNVL+RRHFSGRLFPVNERATRTIRNLY+EN
Sbjct  256   VASSPMKGLFYCVIYLKPGDYHRIHSPIDWNVLVRRHFSGRLFPVNERATRTIRNLYLEN  315

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG+WQEGFM +  +         LFIEP LRTN+P+K   H EPPEER+YEP+G 
Sbjct  316   ERVVLEGQWQEGFMELLQL---------LFIEPELRTNRPRKKFFHSEPPEERIYEPEGV  366

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPIS-SP-----SDFRFCIKKGERIRMGEALGRWHD  1636
             G+ +KKGDE+AAFNMGSTVVLVFQAP+S SP     S+F FC +KG+RIR+GEALGRWHD
Sbjct  367   GVMLKKGDEMAAFNMGSTVVLVFQAPVSRSPKNQGSSEFSFCTRKGDRIRVGEALGRWHD  426

Query  1637  S  1639
             S
Sbjct  427   S  427


 Score =   214 bits (545),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 143/180 (79%), Gaps = 4/180 (2%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearassnggssshgksFFLPGA  288
            MKFR + + P+F      +H   R LH  SF+RK+Q+S A  +    SS     F +PGA
Sbjct  1    MKFRVSQKFPMFIHQATLNH---RHLHLISFVRKLQTSRASVNGGSSSSQGNS-FLVPGA  56

Query  289  TVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTG  468
            TVATI+MLGALHARRLYDD K+E AREKG+E EFHPDVKA+F+ +LPLRSISR+WG LT 
Sbjct  57   TVATILMLGALHARRLYDDKKVEDAREKGLEFEFHPDVKATFLQLLPLRSISRYWGLLTS  116

Query  469  VEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCLVT  648
            VE PVWLRPYVYRAWARAFHSNLEEAA+PL+EYA+LRDFFVR+LKEGSRP+D DP CLV+
Sbjct  117  VEIPVWLRPYVYRAWARAFHSNLEEAAMPLDEYATLRDFFVRSLKEGSRPIDPDPRCLVS  176


 Score =   114 bits (286),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG ILRFGELK AG MIEQVKGFSYSV  LLGA S L M  E+++  ++SE E++
Sbjct  174  LVSPVDGIILRFGELKAAGAMIEQVKGFSYSVSSLLGANSLLPMITEENTHAESSELENT  233

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              D + KSWWRVSLASPKV DP  +
Sbjct  234  PKDQSNKSWWRVSLASPKVWDPVAS  258



>ref|XP_009398118.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=447

 Score =   271 bits (694),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 165/217 (76%), Gaps = 13/217 (6%)
 Frame = +2

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRI  1186
             NN Y    L E ++R+      +  H +F        +  P KG+FYCVIYLKPGDYHRI
Sbjct  236   NNQYPEQSLTEDSSRK------SWWHISFASPKVRNPATCPKKGIFYCVIYLKPGDYHRI  289

Query  1187  HSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNI  1366
             HSP DW VLLRRHF+GRL+P NERA RTIRNLY+ENERVVLEG+W+EGF+A+AAIGATN+
Sbjct  290   HSPVDWQVLLRRHFAGRLYPTNERAARTIRNLYIENERVVLEGQWKEGFLAVAAIGATNV  349

Query  1367  GSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQ  1546
             GS++L IEP L+TN+P K  L    P+ERVYEP+G G+ +KKG+E+AAFNMGSTVVLVFQ
Sbjct  350   GSVKLLIEPELKTNRPLKKLLPSGTPDERVYEPEGVGLMIKKGEEVAAFNMGSTVVLVFQ  409

Query  1547  APIS-SPS------DFRFCIKKGERIRMGEALGRWHD  1636
             APIS SP       +F+FC++ G+RIR+GEA+GRW D
Sbjct  410   APISESPEKIKAGPEFKFCVRNGDRIRVGEAIGRWGD  446


 Score =   144 bits (364),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
              LPGAT+ATI+MLG LHARR+YDD K+E  + KG+E EF PD KA+F+  +PLRS+SR 
Sbjct  63   LLLPGATMATILMLGFLHARRMYDDKKVEDLKVKGMEQEFSPDAKAAFLRFVPLRSVSRL  122

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
             G+L  V+ PV LRP++Y+AW+RAFHS+L+E ALPLE Y SL++FF R+LKEGSRPVD D
Sbjct  123  LGYLMSVDIPVPLRPFIYKAWSRAFHSDLDEVALPLENYGSLQEFFARSLKEGSRPVDLD  182

Query  631  PCCLVT  648
               LV+
Sbjct  183  QKSLVS  188


 Score = 95.5 bits (236),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 1/83 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG ILR GELK +  MIEQVKGFSYS   LLGA S L   A +D   +  E +S 
Sbjct  186  LVSPVDGKILRLGELKGSNAMIEQVKGFSYSASSLLGANSSLHEAANEDRNNQYPE-QSL  244

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
              D+++KSWW +S ASPKVR+PA
Sbjct  245  TEDSSRKSWWHISFASPKVRNPA  267



>ref|XP_011031905.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
[Populus euphratica]
Length=444

 Score =   271 bits (693),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 151/181 (83%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S  P KGL+YCVIYL PGDYH IHSPADWNVL+RRHFSG LFPVNERATRTIRNLYV+N
Sbjct  263   VSACPAKGLYYCVIYLSPGDYHLIHSPADWNVLVRRHFSGHLFPVNERATRTIRNLYVQN  322

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG W+ GFMA+AAIGATNIGSI+LFIEP L+TN+ ++  L+ EPP+ERVY  +G 
Sbjct  323   ERVVLEGLWEGGFMAIAAIGATNIGSIKLFIEPELQTNQRRQKILNSEPPDERVYALEGV  382

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPI-------SSPSDFRFCIKKGERIRMGEALGRWH  1633
             G  +KKG E+AAFN+GSTVVLVFQAP         S S+FRF I++G+R+R+GEALGRWH
Sbjct  383   GKSLKKGAEVAAFNLGSTVVLVFQAPTLKMLQNRDSSSEFRFSIRRGDRVRVGEALGRWH  442

Query  1634  D  1636
             D
Sbjct  443   D  443


 Score =   205 bits (521),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLS-QRRLHFTSFLRKIQssearassnggsssh--gksFFL  279
            MKFR ++++P+F    R SH   QRR  FTS L+++Q++    +S  GSS +  G  F +
Sbjct  1    MKFRYSNKLPIFAHSLRLSHQHHQRRQFFTSLLKRVQTASQVRASFNGSSENPRGNIFLV  60

Query  280  PGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGF  459
            PGATVAT++MLGALHARRLYDD K+E AREKGIE EF PD KASF+ MLPLRSISR +G 
Sbjct  61   PGATVATLLMLGALHARRLYDDKKVEEAREKGIEFEFQPDHKASFLRMLPLRSISRLFGS  120

Query  460  LTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCC  639
            LT VE PVW+RP+V+RAWARAFHSNLEE ALPLE YASLR+FFVRTLKEGSRP+D DP C
Sbjct  121  LTSVELPVWMRPHVHRAWARAFHSNLEEVALPLENYASLREFFVRTLKEGSRPIDPDPHC  180

Query  640  LVT  648
            LV+
Sbjct  181  LVS  183


 Score =   111 bits (278),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK +G MIEQVKGFSYSV  LLGA++ L +  E D  +++SE++ +
Sbjct  181  LVSPVDGTVLRFGELKGSGTMIEQVKGFSYSVSSLLGASNLLPVITEGDMHKESSEQQGN  240

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              + NKKSWWR SLASPK+RD   A
Sbjct  241  LKEKNKKSWWRFSLASPKIRDTVSA  265



>ref|XP_002304284.1| hypothetical protein POPTR_0003s07600g [Populus trichocarpa]
 gb|EEE79263.1| hypothetical protein POPTR_0003s07600g [Populus trichocarpa]
Length=444

 Score =   270 bits (691),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 151/181 (83%), Gaps = 7/181 (4%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S  P KGL+YCVIYL PGDYH IHSPADWNVL+RRHFSG LFPVNERATRTIRNLYV+N
Sbjct  263   VSACPAKGLYYCVIYLSPGDYHLIHSPADWNVLVRRHFSGHLFPVNERATRTIRNLYVQN  322

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG W+ GFMA+AAIGATNIGSI+LFIEP L+TN+ ++  L+ EPP+ERVY  +G 
Sbjct  323   ERVVLEGLWEGGFMAIAAIGATNIGSIKLFIEPELQTNQRRQKILNSEPPDERVYALEGV  382

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPI-------SSPSDFRFCIKKGERIRMGEALGRWH  1633
             G  +KKG E+AAFN+GSTVVLVFQAP         S S+FRF I++G+R+R+GEALGRWH
Sbjct  383   GKSLKKGAEVAAFNLGSTVVLVFQAPTLKMLQNRDSSSEFRFSIRRGDRVRVGEALGRWH  442

Query  1634  D  1636
             D
Sbjct  443   D  443


 Score =   206 bits (524),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLS-QRRLHFTSFLRKIQssearassnggsssh--gksFFL  279
            MKFR ++++P+F    R SH   QRR  FTS L+++Q++    +S  GSS +  G  F +
Sbjct  1    MKFRYSNKLPIFAHSLRLSHQHHQRRQFFTSLLKRVQTASQVRASFNGSSGNPRGNIFLV  60

Query  280  PGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGF  459
            PGATVAT++MLGALHARRLYDD K+E AREKGIE EF PD KASF+ MLPLRSISR +G 
Sbjct  61   PGATVATLLMLGALHARRLYDDKKVEEAREKGIEFEFQPDHKASFLRMLPLRSISRLFGS  120

Query  460  LTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCC  639
            LT VE PVW+RP+VYRAWARAFHSNLEE ALPLE YASLR+FFVRTLKEGSRP+D DP C
Sbjct  121  LTSVELPVWMRPHVYRAWARAFHSNLEEVALPLENYASLREFFVRTLKEGSRPIDPDPHC  180

Query  640  LVT  648
            LV+
Sbjct  181  LVS  183


 Score = 94.4 bits (233),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK +G MIEQVKGFSYSV  LLGA+S L +  E D  +++SE++ +
Sbjct  181  LVSPVDGTVLRFGELKGSGTMIEQVKGFSYSVSSLLGASSLLPVITEGDMHKESSEQQGN  240

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              + NKKSWWR SLASPK+RD   A
Sbjct  241  LKEKNKKSWWRFSLASPKIRDTVSA  265



>ref|XP_010104885.1| Phosphatidylserine decarboxylase proenzyme 1 [Morus notabilis]
 gb|EXC02121.1| Phosphatidylserine decarboxylase proenzyme 1 [Morus notabilis]
Length=495

 Score =   204 bits (519),  Expect(2) = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 142/182 (78%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearass--nggssshgksFFLP  282
            M FR +HRVP+   C R ++L  +R  F+SF++K+Q++    +S   G  SS G SF +P
Sbjct  58   MNFRVSHRVPVLPYCARANYLHNQRRSFSSFIKKLQTATQARASFNGGSGSSRGDSFLVP  117

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GATVAT++MLG LHARR+YDD K+E ARE+GIE EF PD KAS + +LPLRSISR WG+L
Sbjct  118  GATVATLLMLGVLHARRMYDDKKVEEARERGIESEFQPDFKASVLRLLPLRSISRCWGYL  177

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T VE PVWLRPYVYRAWARAFHS LEEAALPL +YA+LR+FFVR LKEG RP+D DP CL
Sbjct  178  TSVEMPVWLRPYVYRAWARAFHSKLEEAALPLNKYANLREFFVRALKEGCRPIDPDPQCL  237

Query  643  VT  648
            V+
Sbjct  238  VS  239


 Score =   116 bits (291),  Expect(2) = 6e-78, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGTILRFGELK  G MIEQVKGFSYSV  LLGA+SFL M AE D ++   E E++
Sbjct  237  LVSPVDGTILRFGELKGPGVMIEQVKGFSYSVASLLGASSFLPMVAEGDMDEDGDEAENT  296

Query  827  DTDANKKSWWRVSLASPKVRD  889
              D  KKSWWR+SL+SPKVRD
Sbjct  297  PMDKRKKSWWRISLSSPKVRD  317


 Score =   246 bits (628),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 149/177 (84%), Gaps = 4/177 (2%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S  P+KGLFYCVIYLKPGDYH IHSP DW + +RRHFSG L+PVNERATRTIRNLY+EN
Sbjct  319   VSSRPVKGLFYCVIYLKPGDYHHIHSPVDWKIFIRRHFSGNLYPVNERATRTIRNLYIEN  378

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG WQEGFMA+AAIGA NIGSIEL IEP  R+N P+K  LH E  EER+YEP G 
Sbjct  379   ERVVLEGLWQEGFMAIAAIGAINIGSIELPIEPEFRSNLPRKKLLHPETAEERLYEP-GI  437

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPI---SSPSDFRFCIKKGERIRMGEALGRWHD  1636
             G+ ++KGDE+AAFNMGSTVV+VFQAP+    S S+F+F IK+G++IR+GEALGRW +
Sbjct  438   GMTLRKGDEIAAFNMGSTVVMVFQAPVIIGDSSSEFKFSIKRGDKIRVGEALGRWRE  494



>dbj|BAJ99307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=362

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 145/176 (82%), Gaps = 7/176 (4%)
 Frame = +2

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             SP +G+FYCV+YL PGDYHR+HSP DWN+  RRHFSG LFP NERA RTIRNLYVENERV
Sbjct  184   SPKRGIFYCVLYLHPGDYHRVHSPVDWNIFKRRHFSGNLFPTNERAVRTIRNLYVENERV  243

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIR  1483
             VLEG+W+EGF+A+AA+GATN+GSI+L IEP LRTN P    LH +P +ERVYEP+G+G+ 
Sbjct  244   VLEGQWKEGFVAIAAVGATNVGSIKLLIEPELRTNGPGSMMLHSQPYDERVYEPEGSGMM  303

Query  1484  MKKGDELAAFNMGSTVVLVFQAPISSPS-------DFRFCIKKGERIRMGEALGRW  1630
             +KKG E+A FNMGSTVV+VF+AP+S  S       DF FC+K G+RIR+GEA+GRW
Sbjct  304   VKKGQEVAGFNMGSTVVIVFEAPLSKASGNGTFSPDFGFCVKAGDRIRVGEAIGRW  359


 Score = 98.6 bits (244),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +1

Query  400  VKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslR  579
            ++ASF+ +LPLRS+SR WG L  VE PV++RP +Y+AWARAFHSNL+E ALPLEEY SL+
Sbjct  20   IQASFLRLLPLRSMSRVWGSLMEVEVPVFMRPAIYKAWARAFHSNLQEPALPLEEYPSLQ  79

Query  580  DFFVRTLKEGSRPVDSDPCCLVT  648
             FF+R+LK+GSRP+D DP CLV+
Sbjct  80   AFFIRSLKQGSRPIDPDPNCLVS  102


 Score = 96.3 bits (238),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR G+L+  G MIEQVKGFSY V  LLGATS L  TAE D   + +E+  S
Sbjct  100  LVSPVDGKVLRLGQLRGPGTMIEQVKGFSYPVSSLLGATSSLHDTAEKDISGEQTEQNVS  159

Query  827  DTDANKKSWWRVSLASPKVRD  889
            ++ ++ KSWWRVS+ASPK+RD
Sbjct  160  ES-SSAKSWWRVSVASPKLRD  179



>gb|AAS58475.1| phosphatidylserine decarboxylase [Hordeum vulgare subsp. vulgare]
Length=426

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 145/177 (82%), Gaps = 7/177 (4%)
 Frame = +2

Query  1121  CSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENER  1300
              SP +G+FYCV+YL PGDYHR+HSP DWN+  RRHFSG LFP NERA RTIRNLYVENER
Sbjct  247   LSPKRGIFYCVLYLHPGDYHRVHSPVDWNIFKRRHFSGNLFPTNERAVRTIRNLYVENER  306

Query  1301  VVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGI  1480
             VVLEG+W+EGF+A+AA+GATN+GSI+L IEP LRTN P    LH +P +ERVYEP+G+G+
Sbjct  307   VVLEGQWKEGFVAIAAVGATNVGSIKLLIEPELRTNGPGSMMLHSQPYDERVYEPEGSGM  366

Query  1481  RMKKGDELAAFNMGSTVVLVFQAPISSPS-------DFRFCIKKGERIRMGEALGRW  1630
              +KKG E+A FNMGSTVV+VF+AP+S  S       DF FC+K G+RIR+GEA+GRW
Sbjct  367   MVKKGQEVAGFNMGSTVVIVFEAPLSKASGNGTFSPDFGFCVKAGDRIRVGEAIGRW  423


 Score =   153 bits (387),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGA+ A ++MLG LHA+R+YDD ++   +E+GIE EF PD+KASF+ +LPLRS+SR 
Sbjct  41   FLLPGASAAVLLMLGVLHAKRMYDDKQLVERKEQGIEPEFSPDLKASFLRLLPLRSMSRV  100

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG L  VE PV++RP +Y+AWARAFHSNL+E ALPLEEY SL+ FF+R+LK+GSRP+D D
Sbjct  101  WGSLMEVEVPVFMRPAIYKAWARAFHSNLQEPALPLEEYPSLQAFFIRSLKQGSRPIDPD  160

Query  631  PCCLVT  648
            P CLV+
Sbjct  161  PNCLVS  166


 Score = 96.3 bits (238),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR G+L+  G MIEQVKGFSY V  LLGATS L  TAE D   + +E+  S
Sbjct  164  LVSPVDGKVLRLGQLRGPGTMIEQVKGFSYPVSSLLGATSSLHDTAEKDISGEQTEQNVS  223

Query  827  DTDANKKSWWRVSLASPKVRD  889
            + +++ KSWWRVS+ASPK+RD
Sbjct  224  E-NSSAKSWWRVSVASPKLRD  243



>gb|AAS58480.1| phosphatidylserine decarboxylase [Triticum monococcum]
Length=424

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 146/179 (82%), Gaps = 7/179 (4%)
 Frame = +2

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             SP +G+FYCV+YL PGDYHR+HSP DWN+  RRHFSG LFP NERA RTIRNLY+ENERV
Sbjct  246   SPKRGIFYCVLYLHPGDYHRVHSPVDWNIFKRRHFSGNLFPTNERAVRTIRNLYIENERV  305

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIR  1483
             VLEG+W+EGF+A+AA+GATN+GSI+L IEP LRTN P    LH +P +ERVYEP+GTG+ 
Sbjct  306   VLEGQWKEGFVAIAAVGATNVGSIKLLIEPELRTNSPGSMTLHSQPYDERVYEPEGTGMM  365

Query  1484  MKKGDELAAFNMGSTVVLVFQAPISSP-------SDFRFCIKKGERIRMGEALGRWHDS  1639
             +KKG E+A F+MGSTVV+VF+AP+S         SDF FC+K G+RIR+GEA+GRW  S
Sbjct  366   VKKGQEVAGFHMGSTVVVVFEAPLSKAREDGTVSSDFGFCVKAGDRIRVGEAIGRWSQS  424


 Score =   156 bits (395),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGA+ A ++MLG LHA+R+YDD ++   +E+GIE EF PD+KASF+ +LPLRS+SR 
Sbjct  39   FLLPGASAAVLLMLGVLHAKRMYDDKQLVERKEQGIEPEFSPDLKASFLRLLPLRSMSRV  98

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG+L  VE PV++RP +Y+AWARAFHSNL+E ALPLEEY SL+ FF+R+LKEGSRP+D D
Sbjct  99   WGYLMEVEVPVFMRPAIYKAWARAFHSNLQEPALPLEEYPSLQAFFIRSLKEGSRPIDPD  158

Query  631  PCCLVT  648
            P CLV+
Sbjct  159  PNCLVS  164


 Score = 78.6 bits (192),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR G+L+  G MIEQVKGFSY V  LLGA+S L    E D   + +E+   
Sbjct  162  LVSPVDGKVLRLGQLRGPGTMIEQVKGFSYPVSSLLGASSSLHDATEKDISGEQTEQNVP  221

Query  827  DTDANKKSWWRVSLASPKVRD  889
            ++ +N KSWWRVS+ASPK+RD
Sbjct  222  ES-SNAKSWWRVSVASPKLRD  241



>ref|XP_002530657.1| phosphatidylserine decarboxylase, putative [Ricinus communis]
 gb|EEF31726.1| phosphatidylserine decarboxylase, putative [Ricinus communis]
Length=420

 Score =   200 bits (508),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 143/186 (77%), Gaps = 7/186 (4%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSH--LSQRRLHFTSFLRKIQssearassnggssshgks----  270
            MKFR + +VP+     R +H    QR+L FTSFL+K+Q++    +S  GS S   S    
Sbjct  1    MKFRFSQKVPIIPHNLRLNHHQYHQRQL-FTSFLKKVQTASQARASFNGSGSSNNSQGSH  59

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
              LPGATVATI+MLGALHARRLY+D K E AREKGIE+EF PD KA+F+ MLPLRSISRF
Sbjct  60   LLLPGATVATILMLGALHARRLYEDKKTEEAREKGIEIEFQPDFKATFLRMLPLRSISRF  119

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG LT VE P W+RPYVYR+WARAFHSNLEEAALPL+ YASLR+FFVR LKEGSRP+D D
Sbjct  120  WGTLTNVELPPWVRPYVYRSWARAFHSNLEEAALPLDRYASLREFFVRGLKEGSRPIDPD  179

Query  631  PCCLVT  648
            P CLV+
Sbjct  180  PHCLVS  185


 Score =   115 bits (289),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGTILRFGELK +G MIEQVKG SYSV  LLGA+SFL M AE D  ++ SE++S+
Sbjct  183  LVSPVDGTILRFGELKGSGAMIEQVKGHSYSVSTLLGASSFLPMIAEGDICEERSEQQSN  242

Query  827  DTDANKKSWWRVSLASPKVRDPAPA  901
              + NKKSWWR+SLA PKVR+  PA
Sbjct  243  LEENNKKSWWRISLAFPKVRENVPA  267


 Score =   223 bits (569),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 128/181 (71%), Gaps = 33/181 (18%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +   P KGL+YCVIYL+PGDYHRIHSP  WNVL+RRHF+G LFP+NERATRTIRNLY EN
Sbjct  265   VPACPTKGLYYCVIYLRPGDYHRIHSPVQWNVLVRRHFAGHLFPMNERATRTIRNLYTEN  324

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ER                          LFIEP LRTN P+K  L+ EPPEERVY+P+G 
Sbjct  325   ER--------------------------LFIEPELRTNLPRKKLLNTEPPEERVYDPEGI  358

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPISSP-------SDFRFCIKKGERIRMGEALGRWH  1633
             G  +KKGDE+AAFNMGSTVVLVFQAP   P       SDFRF I++G+R+R+GEALGRWH
Sbjct  359   GKVLKKGDEVAAFNMGSTVVLVFQAPTLKPVKDGVPSSDFRFNIRRGDRVRVGEALGRWH  418

Query  1634  D  1636
             D
Sbjct  419   D  419



>ref|XP_006649225.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 2, mitochondrial-like 
[Oryza brachyantha]
Length=431

 Score =   260 bits (665),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 146/177 (82%), Gaps = 8/177 (5%)
 Frame = +2

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             SP KG+FYCVIYL PGDYHRIHSP DWN++ RRHFSG LFP N+RA +TIRNLYVENERV
Sbjct  253   SPKKGIFYCVIYLHPGDYHRIHSPIDWNIVKRRHFSGHLFPQNDRAVQTIRNLYVENERV  312

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIR  1483
             VLEG W+EGF+A+AA+GATN+GSI++F+EP LRTN+     L  + P+E VYEP+GTG+ 
Sbjct  313   VLEGHWKEGFVAIAAVGATNVGSIKVFVEPELRTNRAGSKILKFQAPDECVYEPEGTGVM  372

Query  1484  MKKGDELAAFNMGSTVVLVFQAPISS--------PSDFRFCIKKGERIRMGEALGRW  1630
             +KKG+E+A FNMGSTVV+VF+AP+SS         SDF FCIK G+RIR+GEA+GRW
Sbjct  373   VKKGEEVAGFNMGSTVVMVFEAPVSSKAREKGRVASDFDFCIKAGDRIRVGEAIGRW  429


 Score =   156 bits (394),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGAT ATIVM G LHARR+Y+D K+   +EKGI+ EF PD  ASF+ +LPLRSISR 
Sbjct  46   FILPGATAATIVMFGILHARRMYEDQKVVERKEKGIQPEFSPDFMASFLRLLPLRSISRL  105

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG L  VE PV++RP +Y+AWARAFHS+L+EAALPLEEY SL+ FF+R+LKEGSRP+D+D
Sbjct  106  WGSLMEVELPVFMRPAIYKAWARAFHSDLQEAALPLEEYPSLQAFFIRSLKEGSRPIDAD  165

Query  631  PCCLVT  648
            P CLV+
Sbjct  166  PNCLVS  171


 Score =   105 bits (261),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LRFGEL+  G MIEQVKGFSYS   LLGA+SFL   AE+D  ++++E ++ 
Sbjct  169  LVSPVDGKVLRFGELRGPGTMIEQVKGFSYSAASLLGASSFLHGAAEEDLPREHTE-QNM  227

Query  827  DTDANKKSWWRVSLASPKVRD  889
              DAN KSWWRVS+ASPK+RD
Sbjct  228  PADANAKSWWRVSVASPKLRD  248



>ref|NP_001048658.1| Os03g0101900 [Oryza sativa Japonica Group]
 sp|Q10T43.1|PSD1_ORYSJ RecName: Full=Phosphatidylserine decarboxylase proenzyme 1, mitochondrial; 
Contains: RecName: Full=Phosphatidylserine decarboxylase 
1 beta chain; Contains: RecName: Full=Phosphatidylserine 
decarboxylase 1 alpha chain; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|ABF93486.1| phosphatidylserine decarboxylase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10572.1| Os03g0101900 [Oryza sativa Japonica Group]
 dbj|BAG92859.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74331.1| hypothetical protein OsI_09619 [Oryza sativa Indica Group]
Length=438

 Score =   259 bits (661),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 147/183 (80%), Gaps = 14/183 (8%)
 Frame = +2

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             SP KG+FYCVIYL PGDYHR+HSP DWN++ RRHFSG LFP NERA RTIRNLYVENERV
Sbjct  252   SPKKGIFYCVIYLHPGDYHRVHSPVDWNIIKRRHFSGHLFPQNERAVRTIRNLYVENERV  311

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHL--EPPEERVYEPDGTG  1477
             VLEG+W+EGF+A+AAIGATN+GSI+L+IEP LRTN+     L+   EPP++RVYEP GTG
Sbjct  312   VLEGQWKEGFVAIAAIGATNVGSIKLYIEPELRTNRAGSKILNSQPEPPDDRVYEPVGTG  371

Query  1478  IRMKKGDELAAFNMGSTVVLVFQAPISS------------PSDFRFCIKKGERIRMGEAL  1621
             + +KKG+E+A F MGSTVV+VF+AP+ S             SDF FCIK G+RIR+GEA+
Sbjct  372   VMVKKGEEIAGFKMGSTVVMVFEAPVVSKARWREDGSGTVTSDFDFCIKAGDRIRVGEAI  431

Query  1622  GRW  1630
             GRW
Sbjct  432   GRW  434


 Score =   160 bits (404),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGAT AT+VM G LHARR+Y+D K+   +EKGIE EF PD KASF+ +LPLRS+SR 
Sbjct  45   FILPGATAATLVMFGILHARRMYEDQKVVERKEKGIEPEFSPDFKASFLRLLPLRSMSRL  104

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG L  VE PV++RP +Y+AWARAFHSNL+EAA+PLEEY SL+ FF+R+LKEGSRP+D+D
Sbjct  105  WGSLMEVELPVFMRPAIYKAWARAFHSNLQEAAMPLEEYPSLQAFFIRSLKEGSRPIDAD  164

Query  631  PCCLVT  648
            P CLV+
Sbjct  165  PNCLVS  170


 Score = 94.0 bits (232),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR GEL+  G MIEQVKGFSYS   LLGA+S L    E+D  ++++E +S+
Sbjct  168  LVSPVDGKVLRLGELRGPGTMIEQVKGFSYSAASLLGASSSLHGAEEEDFSREHTE-QSN  226

Query  827  DTDANKKSWWRVSLASPKVRD  889
              D+N KSWWRVS+A PK+ D
Sbjct  227  PADSNAKSWWRVSVAKPKLWD  247



>ref|XP_010542213.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
isoform X4 [Tarenaya hassleriana]
Length=360

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 142/175 (81%), Gaps = 4/175 (2%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
                 +S  PM GL+YCVIYL+PGDYHRIHSPADW  ++RRHF+GRLFPVNERATRTIRNL
Sbjct  186   LQETISVRPMSGLYYCVIYLRPGDYHRIHSPADWKAMVRRHFAGRLFPVNERATRTIRNL  245

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             YVENERVVLEG WQEG+MA+AAIGATNIGSIE+FIE  LRTN+P+K     EPPEERVY 
Sbjct  246   YVENERVVLEGLWQEGYMALAAIGATNIGSIEIFIERELRTNEPRKKLFPAEPPEERVYN  305

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
             P+  GI +K+G+E+  F MGSTVV+VFQA     S F FC+ +G+R+R+G+ LGR
Sbjct  306   PERGGIVLKRGEEVGGFGMGSTVVVVFQA----SSQFGFCVGRGDRVRVGQPLGR  356


 Score =   155 bits (391),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +1

Query  307  MLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVW  486
            MLGALHARRLY+D KIE  R KGIELEF PDVKASF+ +LPLR+ISR WG  T VE PVW
Sbjct  1    MLGALHARRLYEDKKIEEKRGKGIELEFQPDVKASFLRILPLRTISRMWGSFTRVEIPVW  60

Query  487  LRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCLVT  648
            +RPYVY+AWARAFHSNL+E ALPLEEY SL DFF+R+LK G RP+D DP CL++
Sbjct  61   MRPYVYKAWARAFHSNLDEVALPLEEYPSLWDFFIRSLKGGCRPIDQDPHCLIS  114


 Score = 93.2 bits (230),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 6/82 (7%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAE-DDSEQKNSEKES  823
            L+SPVDGTILRFGELK  G MIEQVKG SYS+  LLGA+S L + +E  D  Q+ +  E 
Sbjct  112  LISPVDGTILRFGELKGDGAMIEQVKGHSYSLTALLGASSLLPLASECRDERQEGTVGEK  171

Query  824  SDTDANKKSWWRVSLASPKVRD  889
            SD     KSWWR+SLASPK+++
Sbjct  172  SD-----KSWWRISLASPKLQE  188



>ref|XP_004986096.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like isoform 
X1 [Setaria italica]
Length=492

 Score =   259 bits (661),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 144/175 (82%), Gaps = 4/175 (2%)
 Frame = +2

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             SP KG+FYCVIYL PGDYHR+HSP DWN+L RRHFSG LFP NERA RTIRNLYVENERV
Sbjct  316   SPKKGIFYCVIYLHPGDYHRVHSPVDWNILKRRHFSGHLFPQNERAVRTIRNLYVENERV  375

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIR  1483
             VLEGRW+EGF+A+AAIGATN+GSI + +EP LRTN+     +H    EERVYEP+GTG+ 
Sbjct  376   VLEGRWKEGFVALAAIGATNVGSIRVNLEPELRTNRAVSMMVHSLAAEERVYEPEGTGVV  435

Query  1484  MKKGDELAAFNMGSTVVLVFQAP----ISSPSDFRFCIKKGERIRMGEALGRWHD  1636
             +KKG+E+A F MGSTVVLVF+AP     S+ +DF FC++ G+++R+GEA+GRW D
Sbjct  436   VKKGEEIAGFKMGSTVVLVFEAPSREVSSASADFSFCVRAGDKVRVGEAIGRWSD  490


 Score =   160 bits (405),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGAT A +VMLGALHARR+YDDNK+   +EKGIE EF PD KASF  +LPLRS+SRF
Sbjct  109  FLLPGATAAVLVMLGALHARRMYDDNKVVQRKEKGIEPEFSPDFKASFFRLLPLRSMSRF  168

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG L  V+ PV++RP +Y+ WARAFHS+L+E ALPLEEY SL+ FF+R+LKEG+RPVD D
Sbjct  169  WGSLMEVDVPVFMRPTIYKTWARAFHSDLQEVALPLEEYPSLQAFFIRSLKEGARPVDPD  228

Query  631  PCCLVT  648
            P CLV+
Sbjct  229  PNCLVS  234


 Score = 79.3 bits (194),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR GEL+  G MIEQVKGFSYSV  LLG +S L   AE++  ++  E +S+
Sbjct  232  LVSPVDGKVLRLGELRGPGTMIEQVKGFSYSVSSLLGTSSSLHDAAEEELSRERIE-QST  290

Query  827  DTDANKKSWWRVSLASPKVRD  889
              ++N KSWWRVS+ASPK+RD
Sbjct  291  PENSNAKSWWRVSVASPKLRD  311



>ref|XP_004986097.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like isoform 
X2 [Setaria italica]
Length=489

 Score =   259 bits (661),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 144/175 (82%), Gaps = 4/175 (2%)
 Frame = +2

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             SP KG+FYCVIYL PGDYHR+HSP DWN+L RRHFSG LFP NERA RTIRNLYVENERV
Sbjct  313   SPKKGIFYCVIYLHPGDYHRVHSPVDWNILKRRHFSGHLFPQNERAVRTIRNLYVENERV  372

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIR  1483
             VLEGRW+EGF+A+AAIGATN+GSI + +EP LRTN+     +H    EERVYEP+GTG+ 
Sbjct  373   VLEGRWKEGFVALAAIGATNVGSIRVNLEPELRTNRAVSMMVHSLAAEERVYEPEGTGVV  432

Query  1484  MKKGDELAAFNMGSTVVLVFQAP----ISSPSDFRFCIKKGERIRMGEALGRWHD  1636
             +KKG+E+A F MGSTVVLVF+AP     S+ +DF FC++ G+++R+GEA+GRW D
Sbjct  433   VKKGEEIAGFKMGSTVVLVFEAPSREVSSASADFSFCVRAGDKVRVGEAIGRWSD  487


 Score =   155 bits (392),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 103/126 (82%), Gaps = 3/126 (2%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGAT A +VMLGALHARR+YDDNK    +EKGIE EF PD KASF  +LPLRS+SRF
Sbjct  109  FLLPGATAAVLVMLGALHARRMYDDNK---RKEKGIEPEFSPDFKASFFRLLPLRSMSRF  165

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG L  V+ PV++RP +Y+ WARAFHS+L+E ALPLEEY SL+ FF+R+LKEG+RPVD D
Sbjct  166  WGSLMEVDVPVFMRPTIYKTWARAFHSDLQEVALPLEEYPSLQAFFIRSLKEGARPVDPD  225

Query  631  PCCLVT  648
            P CLV+
Sbjct  226  PNCLVS  231


 Score = 79.3 bits (194),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR GEL+  G MIEQVKGFSYSV  LLG +S L   AE++  ++  E +S+
Sbjct  229  LVSPVDGKVLRLGELRGPGTMIEQVKGFSYSVSSLLGTSSSLHDAAEEELSRERIE-QST  287

Query  827  DTDANKKSWWRVSLASPKVRD  889
              ++N KSWWRVS+ASPK+RD
Sbjct  288  PENSNAKSWWRVSVASPKLRD  308



>ref|XP_003559037.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
[Brachypodium distachyon]
Length=426

 Score =   256 bits (654),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 144/178 (81%), Gaps = 9/178 (5%)
 Frame = +2

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             SP +G+FYCV+YL PGDYHR+HSP DW++  RRHFSG LFP NERA RTIRNLYVENERV
Sbjct  248   SPKRGIFYCVLYLHPGDYHRVHSPVDWSISKRRHFSGNLFPTNERAVRTIRNLYVENERV  307

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTN-KPQKNKLHLEPPEERVYEPDGTGI  1480
             VLEG+W+EGF+A+AA+GATN+GSI+LFIEP LRTN  P    L  +PP+ER Y P+GTG+
Sbjct  308   VLEGQWKEGFVAVAAVGATNVGSIKLFIEPELRTNSSPGSRILQSQPPDERFYGPEGTGV  367

Query  1481  RMKKGDELAAFNMGSTVVLVFQAPISS--------PSDFRFCIKKGERIRMGEALGRW  1630
              +KKG E+A FNMGSTVVLVF+AP+S          SDF FC+K G+RIR+GEA+GRW
Sbjct  368   MVKKGQEIAGFNMGSTVVLVFEAPLSKKAMEDGMPTSDFGFCVKAGDRIRVGEAIGRW  425


 Score =   157 bits (396),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGA+ A ++MLG LHA+R+YDD K+   +EKGIE EF PD+KASF  +LPLRS+SR 
Sbjct  41   FLLPGASAAALLMLGVLHAKRMYDDKKLVERKEKGIEPEFSPDLKASFFRLLPLRSMSRL  100

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG L  VE PV++RP +Y+AWARAFHSNL+E+ALPLEEY SL+ FF+R+LKEGSRP+D D
Sbjct  101  WGSLMEVEVPVFMRPVIYKAWARAFHSNLQESALPLEEYPSLQAFFIRSLKEGSRPIDPD  160

Query  631  PCCLVT  648
            P CLV+
Sbjct  161  PNCLVS  166


 Score = 81.6 bits (200),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR G+L+  G MIEQVKGFSY V  LLGA+S L  T E D  ++ +E+  S
Sbjct  164  LVSPVDGKVLRLGQLRGPGTMIEQVKGFSYPVSSLLGASSSLHDTTEKDFSEEQTEENVS  223

Query  827  DTDANKKSWWRVSLASPKVRD  889
            +  +N KSWWRVS+ASPK+RD
Sbjct  224  E-GSNAKSWWRVSVASPKLRD  243



>ref|XP_010542211.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
isoform X2 [Tarenaya hassleriana]
Length=434

 Score =   255 bits (652),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 142/171 (83%), Gaps = 4/171 (2%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S  PM GL+YCVIYL+PGDYHRIHSPADW  ++RRHF+GRLFPVNERATRTIRNLYVEN
Sbjct  264   ISVRPMSGLYYCVIYLRPGDYHRIHSPADWKAMVRRHFAGRLFPVNERATRTIRNLYVEN  323

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG WQEG+MA+AAIGATNIGSIE+FIE  LRTN+P+K     EPPEERVY P+  
Sbjct  324   ERVVLEGLWQEGYMALAAIGATNIGSIEIFIERELRTNEPRKKLFPAEPPEERVYNPERG  383

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
             GI +K+G+E+  F MGSTVV+VFQA     S F FC+ +G+R+R+G+ LGR
Sbjct  384   GIVLKRGEEVGGFGMGSTVVVVFQA----SSQFGFCVGRGDRVRVGQPLGR  430


 Score =   191 bits (486),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 134/188 (71%), Gaps = 8/188 (4%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearassnggssshgk-------  267
            MK R    VP+F+ C+RF H    R  FTSFL+ I S+    +S+    S          
Sbjct  1    MKSRFPQNVPMFSHCSRFFHPRTHRRAFTSFLKNIHSNSQLRASSITGGSGENGGGGSKG  60

Query  268  -sFFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSIS  444
             +  LPGATVATI+MLGALHARRLY+D KIE  R KGIELEF PDVKASF+ +LPLR+IS
Sbjct  61   NALLLPGATVATILMLGALHARRLYEDKKIEEKRGKGIELEFQPDVKASFLRILPLRTIS  120

Query  445  RFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVD  624
            R WG  T VE PVW+RPYVY+AWARAFHSNL+E ALPLEEY SL DFF+R+LK G RP+D
Sbjct  121  RMWGSFTRVEIPVWMRPYVYKAWARAFHSNLDEVALPLEEYPSLWDFFIRSLKGGCRPID  180

Query  625  SDPCCLVT  648
             DP CL++
Sbjct  181  QDPHCLIS  188


 Score = 93.6 bits (231),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 6/82 (7%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAE-DDSEQKNSEKES  823
            L+SPVDGTILRFGELK  G MIEQVKG SYS+  LLGA+S L + +E  D  Q+ +  E 
Sbjct  186  LISPVDGTILRFGELKGDGAMIEQVKGHSYSLTALLGASSLLPLASECRDERQEGTVGEK  245

Query  824  SDTDANKKSWWRVSLASPKVRD  889
            SD     KSWWR+SLASPK+++
Sbjct  246  SD-----KSWWRISLASPKLQE  262



>ref|XP_010542212.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
isoform X3 [Tarenaya hassleriana]
Length=431

 Score =   255 bits (651),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 142/175 (81%), Gaps = 4/175 (2%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
                 +S  PM GL+YCVIYL+PGDYHRIHSPADW  ++RRHF+GRLFPVNERATRTIRNL
Sbjct  257   LQETISVRPMSGLYYCVIYLRPGDYHRIHSPADWKAMVRRHFAGRLFPVNERATRTIRNL  316

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             YVENERVVLEG WQEG+MA+AAIGATNIGSIE+FIE  LRTN+P+K     EPPEERVY 
Sbjct  317   YVENERVVLEGLWQEGYMALAAIGATNIGSIEIFIERELRTNEPRKKLFPAEPPEERVYN  376

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
             P+  GI +K+G+E+  F MGSTVV+VFQA     S F FC+ +G+R+R+G+ LGR
Sbjct  377   PERGGIVLKRGEEVGGFGMGSTVVVVFQA----SSQFGFCVGRGDRVRVGQPLGR  427


 Score = 93.2 bits (230),  Expect(3) = 2e-36, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 6/82 (7%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAE-DDSEQKNSEKES  823
            L+SPVDGTILRFGELK  G MIEQVKG SYS+  LLGA+S L + +E  D  Q+ +  E 
Sbjct  183  LISPVDGTILRFGELKGDGAMIEQVKGHSYSLTALLGASSLLPLASECRDERQEGTVGEK  242

Query  824  SDTDANKKSWWRVSLASPKVRD  889
            SD     KSWWR+SLASPK+++
Sbjct  243  SD-----KSWWRISLASPKLQE  259


 Score = 75.1 bits (183),  Expect(3) = 2e-36, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  472  EFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCLVT  648
            E PVW+RPYVY+AWARAFHSNL+E ALPLEEY SL DFF+R+LK G RP+D DP CL++
Sbjct  127  EIPVWMRPYVYKAWARAFHSNLDEVALPLEEYPSLWDFFIRSLKGGCRPIDQDPHCLIS  185


 Score = 34.3 bits (77),  Expect(3) = 2e-36, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 42/110 (38%), Gaps = 10/110 (9%)
 Frame = +2

Query  137  LSSLAARASVISPSVVSTSLASFGRYN--PPKLELPPMAEAALTVKVS-------FCLVR  289
            L SL  R S I P ++   L    R +   P   L P  EAA    V        FC  +
Sbjct  3    LCSLTVRVSSI-PVLIDEPLPPSLRTSIPTPNFALLPSPEAAGKTAVVVLRGMHFFCPEQ  61

Query  290  PWQP**C*ALFMLAVSMMITRLKEQERKELSWNSTLM*KHHLWECYRCAP  439
             W P  C  L M        RLK  E KEL+ +S    K H    Y C P
Sbjct  62   LWPPSLCWGLSMPVAYTRTRRLKRNEEKELNLSSNQTLKPHSSGSYLCEP  111



>ref|XP_010542210.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial 
isoform X1 [Tarenaya hassleriana]
Length=446

 Score =   255 bits (651),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 142/171 (83%), Gaps = 4/171 (2%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
             +S  PM GL+YCVIYL+PGDYHRIHSPADW  ++RRHF+GRLFPVNERATRTIRNLYVEN
Sbjct  276   ISVRPMSGLYYCVIYLRPGDYHRIHSPADWKAMVRRHFAGRLFPVNERATRTIRNLYVEN  335

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
             ERVVLEG WQEG+MA+AAIGATNIGSIE+FIE  LRTN+P+K     EPPEERVY P+  
Sbjct  336   ERVVLEGLWQEGYMALAAIGATNIGSIEIFIERELRTNEPRKKLFPAEPPEERVYNPERG  395

Query  1475  GIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
             GI +K+G+E+  F MGSTVV+VFQA     S F FC+ +G+R+R+G+ LGR
Sbjct  396   GIVLKRGEEVGGFGMGSTVVVVFQA----SSQFGFCVGRGDRVRVGQPLGR  442


 Score = 93.6 bits (231),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 6/82 (7%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAE-DDSEQKNSEKES  823
            L+SPVDGTILRFGELK  G MIEQVKG SYS+  LLGA+S L + +E  D  Q+ +  E 
Sbjct  198  LISPVDGTILRFGELKGDGAMIEQVKGHSYSLTALLGASSLLPLASECRDERQEGTVGEK  257

Query  824  SDTDANKKSWWRVSLASPKVRD  889
            SD     KSWWR+SLASPK+++
Sbjct  258  SD-----KSWWRISLASPKLQE  274


 Score = 86.3 bits (212),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 97/200 (49%), Gaps = 20/200 (10%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearassnggss-----------  255
            MK R    VP+F+ C+RF H    R  FTSFL+ I S+    +S+               
Sbjct  1    MKSRFPQNVPMFSHCSRFFHPRTHRRAFTSFLKNIHSNSQLRASSITGGSGENGGGGSKG  60

Query  256  -----shgksFFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELE----FHPDVKA  408
                 + G  FF P       +  G           +++   EK + L       P    
Sbjct  61   SFSVITEGMHFFCPEQLWPPSLCWGLSMPVAYTRTRRLKRNEEKELNLSSNQTLKPHSSG  120

Query  409  SFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFF  588
            S++        +      +  E PVW+RPYVY+AWARAFHSNL+E ALPLEEY SL DFF
Sbjct  121  SYLCEPSQECGAPLQECRSSQEIPVWMRPYVYKAWARAFHSNLDEVALPLEEYPSLWDFF  180

Query  589  VRTLKEGSRPVDSDPCCLVT  648
            +R+LK G RP+D DP CL++
Sbjct  181  IRSLKGGCRPIDQDPHCLIS  200



>ref|XP_007157277.1| hypothetical protein PHAVU_002G0572001g, partial [Phaseolus vulgaris]
 gb|ESW29271.1| hypothetical protein PHAVU_002G0572001g, partial [Phaseolus vulgaris]
Length=318

 Score =   187 bits (476),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 137/181 (76%), Gaps = 4/181 (2%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRK-IQssearassnggssshgksFFLPG  285
            MK+R +H++ +    T   H      + TSF RK I      + + G  +S G SF +PG
Sbjct  1    MKYRVSHKLLVLPHRT---HPFNSARYITSFARKFITRPPRASINGGSGNSQGDSFIVPG  57

Query  286  ATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLT  465
            ATVATI+MLG LHARRLYDD K EG +EKGIE+EF PD+KA+F+ +LPLRSISR WG++T
Sbjct  58   ATVATILMLGVLHARRLYDDKKTEGMKEKGIEVEFQPDIKATFLRLLPLRSISRCWGYMT  117

Query  466  GVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCLV  645
             +E PVWLRP +Y+AWARAFHSNLEEA LPL++YA+L+DFFVRTLKEGSRP+D DP CLV
Sbjct  118  SMEIPVWLRPVIYKAWARAFHSNLEEAGLPLDKYATLKDFFVRTLKEGSRPIDVDPQCLV  177

Query  646  T  648
            +
Sbjct  178  S  178


 Score =   115 bits (287),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK AG MIEQVKGFSYSV  LLGA+ FL  TA+ D ++K +E  ++
Sbjct  176  LVSPVDGTVLRFGELKGAGAMIEQVKGFSYSVFSLLGASPFLPTTADGDVQEKLNE-STT  234

Query  827  DTDANKKSWWRVSLASPKVRDP  892
            +T+ NKKSWWRVSLASPKV DP
Sbjct  235  NTEKNKKSWWRVSLASPKVWDP  256


 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 1/66 (2%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             +  K SC P +GLFYCV+YLKPGDYHRIHSPADWN+L+RRHFSGRL+P+NERATRTIRNL
Sbjct  254   WDPKSSC-PKRGLFYCVVYLKPGDYHRIHSPADWNILVRRHFSGRLYPLNERATRTIRNL  312

Query  1283  YVENER  1300
             Y+ENER
Sbjct  313   YIENER  318



>ref|XP_006838214.1| hypothetical protein AMTR_s00106p00153400 [Amborella trichopoda]
 gb|ERN00783.1| hypothetical protein AMTR_s00106p00153400 [Amborella trichopoda]
Length=470

 Score =   251 bits (641),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 147/206 (71%), Gaps = 36/206 (17%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             S  PMKG FYCVIYL PGDYHR+HSP DW+V  RRHFSGRLFP NERATRTIRNLYVENE
Sbjct  262   SLRPMKGTFYCVIYLCPGDYHRVHSPVDWHVSHRRHFSGRLFPTNERATRTIRNLYVENE  321

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
             RVVLEGRW EG+MAMAA+GATN+GSI+L IEP L+TN+P+K+ +H EP  ER YEP+GTG
Sbjct  322   RVVLEGRWLEGYMAMAAVGATNVGSIQLSIEPELKTNRPRKSLMHSEPQNEREYEPEGTG  381

Query  1478  IRMKKGDE-----------------------------LAAFNMGSTVVLVFQAPISS---  1561
             + +KKG+E                             +AAF MGSTVVLVFQAP+ +   
Sbjct  382   VLIKKGEEVTNLKLNISLVALPCNMKFAFEGINELKQVAAFKMGSTVVLVFQAPVGTSDV  441

Query  1562  ----PSDFRFCIKKGERIRMGEALGR  1627
                  S F FCIK+G +I++GEALGR
Sbjct  442   NNGDASGFEFCIKRGSKIKVGEALGR  467


 Score =   183 bits (464),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 131/183 (72%), Gaps = 5/183 (3%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCT---RFSHLSQRRLHFTSFLRKIQssearassnggssshgksFFL  279
            M FR++ R PLF       RFS +      FTSF R  +   A  +       +   FF+
Sbjct  1    MGFRSSSRWPLFPHPLHHRRFSRVFPAHRFFTSFRRSFRIGGASINGGTNVEDNP--FFI  58

Query  280  PGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGF  459
            PGAT+AT+VMLG LHAR LY+D K+E AR+KGIELEF PD KA+F+ +LPLRSISR WGF
Sbjct  59   PGATLATLVMLGLLHARHLYEDKKMEEARQKGIELEFQPDAKAAFLRLLPLRSISRAWGF  118

Query  460  LTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCC  639
            +T VE PVWLRPYVYR WARAFHSNLEE ALPL+EYASL+DFFVRTLKEG RP+D DP  
Sbjct  119  ITSVEIPVWLRPYVYRGWARAFHSNLEEVALPLDEYASLQDFFVRTLKEGYRPIDPDPYS  178

Query  640  LVT  648
            L +
Sbjct  179  LAS  181


 Score = 94.4 bits (233),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            L SPVDG +LRFGEL + G MIEQVKGFSYSV  LLG  S   + A +D  +K  E+   
Sbjct  179  LASPVDGIVLRFGELNKPGAMIEQVKGFSYSVSSLLGENSLFPLVALEDVNKKQREQSQM  238

Query  827  DTDANKKSWWRVSLASPKVRDP  892
              + +K+SWW +S +SPKVR P
Sbjct  239  RIEESKRSWWTISWSSPKVRIP  260



>gb|KEH27465.1| phosphatidylserine decarboxylase [Medicago truncatula]
Length=392

 Score =   194 bits (494),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 4/182 (2%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQsse--arassnggssshgksFFLP  282
            MK R  HR P+ +  TRF + + +   FTSF++     +  +  +   G+S    S+ LP
Sbjct  1    MKPRVPHRFPILSYHTRFHNHTHKS--FTSFIKNFPKPQPPSSVNGANGNSKGDSSYLLP  58

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GATVATI+MLGALHARR+YDD KIE  +EKGIE+EF PDVKASFM  LPLRSISR WG L
Sbjct  59   GATVATILMLGALHARRMYDDKKIEKRQEKGIEVEFQPDVKASFMSFLPLRSISRCWGQL  118

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T +E P WLRP+VY+AWARAFHSNLEEAALPL++Y SLR+FFVR LKEGSRP+D+DP CL
Sbjct  119  TSMEIPAWLRPHVYKAWARAFHSNLEEAALPLDKYTSLREFFVRALKEGSRPIDTDPQCL  178

Query  643  VT  648
            V+
Sbjct  179  VS  180


 Score =   104 bits (260),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG ILRFGELK AG MIEQVKGFSY V  LLGA+S L  TA  + +++ SE    
Sbjct  178  LVSPVDGKILRFGELKGAGAMIEQVKGFSYPVFSLLGASSLLPTTAHGNVQEETSE-SIK  236

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
             T+ +KKSWWRVSLASPKV DP 
Sbjct  237  PTEKSKKSWWRVSLASPKVWDPT  259


 Score =   222 bits (565),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             S  P KGLFYCVIYLKPGDY+RIHSPADWN+L+RRHFSG L+PVNERATRTIRNLY+ENE
Sbjct  260   SSCPKKGLFYCVIYLKPGDYNRIHSPADWNILVRRHFSGHLYPVNERATRTIRNLYIENE  319

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
             RVVLEG WQEGFMA+AA+GATNIGSIELFIEP L+TNKP K  L+ EPPEERVY+ +G G
Sbjct  320   RVVLEGVWQEGFMALAAVGATNIGSIELFIEPELQTNKPIKKSLNSEPPEERVYDCEGVG  379

Query  1478  IRMKKGDEL  1504
               +KKGDE+
Sbjct  380   KVLKKGDEV  388



>gb|EMS47322.1| Cell number regulator 6 [Triticum urartu]
Length=2207

 Score =   263 bits (673),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 146/179 (82%), Gaps = 7/179 (4%)
 Frame = +2

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             SP +G+FYCV+YL PGDYHR+HSP DWN+  RRHFSG LFP NERA +TIRNLY+ENERV
Sbjct  2029  SPKRGIFYCVLYLHPGDYHRVHSPVDWNIFKRRHFSGNLFPTNERAVQTIRNLYIENERV  2088

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIR  1483
             VLEG+W+EGF+A+AA+GATN+GSI+L IEP LRTN P    LH +P +ERVYEP+GTG+ 
Sbjct  2089  VLEGQWKEGFVAIAAVGATNVGSIKLLIEPELRTNSPGSMTLHSQPYDERVYEPEGTGMM  2148

Query  1484  MKKGDELAAFNMGSTVVLVFQAPISSP-------SDFRFCIKKGERIRMGEALGRWHDS  1639
             +KKG E+A F+MGSTVV+VF+AP+S         SDF FC+K G+RIR+GEA+GRW  S
Sbjct  2149  VKKGQEVAGFHMGSTVVVVFEAPLSKAREDGTVSSDFGFCVKAGDRIRVGEAIGRWSQS  2207


 Score =   125 bits (315),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 91/126 (72%), Gaps = 18/126 (14%)
 Frame = +1

Query  271   FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
             F LPGA+ A ++MLG LHA+R+YD  +                  ASF+ +LPLRS+SR 
Sbjct  1840  FLLPGASAAVLLMLGVLHAKRMYDGKQ------------------ASFLRLLPLRSMSRV  1881

Query  451   WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
             WG+L  VE PV++RP +Y+AWARAFHSNL+E ALPLEEY SL+ FF+R+LKEGSRP+D D
Sbjct  1882  WGYLMEVEVPVFMRPAIYKAWARAFHSNLQEPALPLEEYPSLQAFFIRSLKEGSRPIDPD  1941

Query  631   PCCLVT  648
             P CLV+
Sbjct  1942  PNCLVS  1947


 Score = 78.2 bits (191),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             LVSPVDG +LR G+L+  G MIEQVKGFSY V  LLGA+S L    E D   + +E+   
Sbjct  1945  LVSPVDGKVLRLGQLRGPGTMIEQVKGFSYPVSSLLGASSSLHDATEKDISGEQTEQNVP  2004

Query  827   DTDANKKSWWRVSLASPKVRD  889
             ++ +N KSWWRVS+ASPK+RD
Sbjct  2005  ES-SNAKSWWRVSVASPKLRD  2024



>gb|ABK25027.1| unknown [Picea sitchensis]
Length=458

 Score =   247 bits (631),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 140/185 (76%), Gaps = 15/185 (8%)
 Frame = +2

Query  1121  CSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENER  1300
              +P+ GLFYCV+YL PG+YHR+HSP DW V+ RRHFSGRL PVNERA RTIRNL+VENER
Sbjct  274   AAPIMGLFYCVLYLGPGEYHRVHSPVDWQVMHRRHFSGRLLPVNERAARTIRNLHVENER  333

Query  1301  VVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGI  1480
             VVLEG+W EGF+A+AA+GATN+GSIEL IEP L+TN+P+ +  H EPP ER+Y     G+
Sbjct  334   VVLEGKWSEGFLAIAAVGATNVGSIELPIEPELKTNRPKLSLFHTEPPNERMYGNKDAGL  393

Query  1481  RMKKGDELAAFNMGSTVVLVFQAPI---------------SSPSDFRFCIKKGERIRMGE  1615
              +KKG E+A FNMGSTVVLVFQAP                SS   FRF IK G+R+RMG+
Sbjct  394   MIKKGQEVAVFNMGSTVVLVFQAPSANAFQYDDVNSELEQSSSPGFRFLIKNGDRVRMGQ  453

Query  1616  ALGRW  1630
             A+GRW
Sbjct  454   AIGRW  458


 Score =   186 bits (473),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F +PGAT+ATIVMLG LHARRLY+D K+E AREKGIELEF PD+KA+F+ M+PLRSISR 
Sbjct  67   FLIPGATIATIVMLGVLHARRLYEDKKMEEAREKGIELEFLPDMKATFLKMVPLRSISRA  126

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG +T VE PVWLRP++YR+WARAFHSN+ EAA PLEEYASLR+FFVRTLKEGSRP+D D
Sbjct  127  WGLVTAVELPVWLRPFIYRSWARAFHSNISEAAQPLEEYASLREFFVRTLKEGSRPLDQD  186

Query  631  PCCLVT  648
            P CLV+
Sbjct  187  PKCLVS  192


 Score = 85.5 bits (210),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG ILR G+LK  G MIEQVKGFSYS   LLG+ S L ++   +   +  E++  
Sbjct  190  LVSPVDGIILRVGQLKGPGAMIEQVKGFSYSALSLLGSRSVLPISDSQEVLAEQYEQKQV  249

Query  827  DTDANKKSWWRVSLASPKVR  886
              + N++SWWRVS  +PKVR
Sbjct  250  RRNLNQRSWWRVSWIAPKVR  269



>gb|EYU19316.1| hypothetical protein MIMGU_mgv1a0064762mg, partial [Erythranthe 
guttata]
Length=356

 Score =   200 bits (508),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 140/189 (74%), Gaps = 11/189 (6%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQss---------earassnggsssh  261
            MK+R     P+      + H  +RR HFT+FLRK+Q +          A  S+   S S 
Sbjct  1    MKWRGFRSPPILNYNRIYHH--RRRFHFTTFLRKVQPAPPRSFLGGAAAAGSNGSNSQSQ  58

Query  262  gksFFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSI  441
            G SF +PGAT+ATI MLGALHARRLYDDNKIE AR KG+ELEF PDVKA F+ +LPLRSI
Sbjct  59   GNSFLVPGATLATIFMLGALHARRLYDDNKIEEARSKGVELEFQPDVKARFLRLLPLRSI  118

Query  442  SRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPV  621
            SR WG +TGVE PVWLRPYVYRAWARAFHSNLEEA LPLEEYASLR+FFVR LKEGSRP+
Sbjct  119  SRLWGSVTGVELPVWLRPYVYRAWARAFHSNLEEAQLPLEEYASLREFFVRKLKEGSRPI  178

Query  622  DSDPCCLVT  648
            D DP CL +
Sbjct  179  DYDPYCLAS  187


 Score = 94.4 bits (233),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 60/83 (72%), Gaps = 2/83 (2%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            L SPVDGT+LRFGEL+  G MI+QVKG +YS   LLGA S+L M A  D+ ++ +  E +
Sbjct  185  LASPVDGTVLRFGELRGPGAMIDQVKGCTYSASSLLGANSYLPMIAAGDANEEENIGEEN  244

Query  827  DT--DANKKSWWRVSLASPKVRD  889
             T   A +KSWWR+SLASPKVRD
Sbjct  245  TTMKSATQKSWWRISLASPKVRD  267


 Score =   171 bits (434),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             S SP+KGLFYCVIYLKPGDYHRIHSP DWN+L+RRHF+G LFPVNERATRTIR+LYVENE
Sbjct  270   SSSPLKGLFYCVIYLKPGDYHRIHSPGDWNILIRRHFTGNLFPVNERATRTIRSLYVENE  329

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIE  1378
             RVVLEG+WQEG+MAMAA+GATNIGSIE
Sbjct  330   RVVLEGQWQEGYMAMAAVGATNIGSIE  356



>ref|XP_006440282.1| hypothetical protein CICLE_v10020120mg [Citrus clementina]
 gb|ESR53522.1| hypothetical protein CICLE_v10020120mg [Citrus clementina]
Length=413

 Score =   204 bits (519),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 146/182 (80%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearass--nggssshgksFFLP  282
            MKFR +++V +F    R  +    R   TSFLRK+Q++    +S   G ++S G +F LP
Sbjct  1    MKFRFSNKVSVFPHYLRLEYDHHCRQFSTSFLRKLQTNPQVRASFSGGSNNSQGNTFLLP  60

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GAT AT++MLGALHARR+YDD K+E AREKGIE+EF PD KASF+ +LPLRSISRFWGFL
Sbjct  61   GATFATLLMLGALHARRMYDDRKVEEAREKGIEIEFKPDAKASFLRLLPLRSISRFWGFL  120

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T VE+PVW+RPYVY+AWARAFHSNLEEAALPL EYASLR+FFVRTLK+GSRP+D DP CL
Sbjct  121  TSVEYPVWMRPYVYKAWARAFHSNLEEAALPLGEYASLREFFVRTLKQGSRPIDPDPHCL  180

Query  643  VT  648
            V+
Sbjct  181  VS  182


 Score = 89.0 bits (219),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR GELK  G MIEQVKGFSYSV  LLG++SFL M  E D  ++  E+ESS
Sbjct  180  LVSPVDGIVLRVGELKGVGAMIEQVKGFSYSVSSLLGSSSFLPMIEEGDMHEQCGEQESS  239

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
             T+  KKSWW +SLASP+VRD A
Sbjct  240  PTEKTKKSWWSISLASPRVRDTA  262


 Score =   230 bits (587),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 122/146 (84%), Gaps = 6/146 (4%)
 Frame = +2

Query  1127  PMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVV  1306
             P+KGL+YCVIYLKPG+YHRIHSP DWNVL+RRHFSGRLFP+NERATRTIRNLY ENERVV
Sbjct  266   PVKGLYYCVIYLKPGNYHRIHSPVDWNVLVRRHFSGRLFPLNERATRTIRNLYFENERVV  325

Query  1307  LEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRM  1486
             LEG WQEG++AMAA+GATNIGSIEL IEP LRTN+P+K  LH EPPEERVYEP G G+ +
Sbjct  326   LEGMWQEGYLAMAAVGATNIGSIELVIEPELRTNRPRKKLLHSEPPEERVYEPQGVGMML  385

Query  1487  KKGDE------LAAFNMGSTVVLVFQ  1546
             KKGDE      L    +G   +++FQ
Sbjct  386   KKGDEVRDMHKLCLLELGCLTIILFQ  411



>gb|KDO36165.1| hypothetical protein CISIN_1g024609mg [Citrus sinensis]
Length=265

 Score =   204 bits (520),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 145/182 (80%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTSFLRKIQssearassng--gssshgksFFLP  282
            MKFR +++V +F    R  +    R   TSFLRK+Q++    +S     ++S G +F LP
Sbjct  1    MKFRFSNKVSVFPHYLRLEYDHHCRQFSTSFLRKLQTNPQVRASFSGGSNNSQGNTFLLP  60

Query  283  GATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFL  462
            GAT AT++MLGALHARR+YDD K+E AREKGIE+EF PD KASF+ +LPLRSISRFWGFL
Sbjct  61   GATFATLLMLGALHARRMYDDRKVEEAREKGIEIEFKPDAKASFLRLLPLRSISRFWGFL  120

Query  463  TGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPCCL  642
            T VE+PVW+RPYVY+AWARAFHSNLEEAALPL EYASLR+FFVRTLK+GSRP+D DP CL
Sbjct  121  TSVEYPVWMRPYVYKAWARAFHSNLEEAALPLGEYASLREFFVRTLKQGSRPIDPDPHCL  180

Query  643  VT  648
            V+
Sbjct  181  VS  182


 Score = 87.0 bits (214),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR GELK  G MIEQVKGFSYSV  LLG++SFL M  E D  ++  E+ESS
Sbjct  180  LVSPVDGIVLRVGELKGVGAMIEQVKGFSYSVSSLLGSSSFLPMIEEGDMHEQCGEQESS  239

Query  827  DTDANKKSWWRVSLASPKVRDPA  895
             T+  KKSWW +SLASP+VRD A
Sbjct  240  PTEKTKKSWWSISLASPRVRDTA  262



>gb|EMT02980.1| Phosphatidylserine decarboxylase proenzyme [Aegilops tauschii]
Length=503

 Score =   243 bits (619),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 135/168 (80%), Gaps = 7/168 (4%)
 Frame = +2

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             SP +G+FYCV+YL PGDYHR+HSP DW++  RRHFSG LFP NERA RTIRNLYVENERV
Sbjct  251   SPKRGIFYCVLYLHPGDYHRVHSPVDWSIFKRRHFSGNLFPTNERAVRTIRNLYVENERV  310

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIR  1483
             VLEG+W+EGF+A+AA+GATN+GSI+L IEP LRTN P    LH +  +ERVYEP+GTG+ 
Sbjct  311   VLEGQWKEGFVAIAAVGATNVGSIKLLIEPELRTNNPGSMALHSQSYDERVYEPEGTGMM  370

Query  1484  MKKGDELAAFNMGSTVVLVFQAPISSP-------SDFRFCIKKGERIR  1606
             +KKG E+A F MGSTVV+VF+AP+S         SDF FC+K G+RIR
Sbjct  371   VKKGQEIAGFKMGSTVVVVFEAPLSKARGDGTVSSDFGFCVKAGDRIR  418


 Score =   155 bits (393),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGA+ A ++MLG LHA+R+YDD ++   +E+GIE EF PD+KASF+ +LPLRS+SR 
Sbjct  44   FLLPGASAAVLLMLGVLHAKRMYDDKQLVERKERGIEPEFSPDLKASFLRLLPLRSMSRV  103

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            WG L  VE PV++RP VY+AWARAFHSNL+E ALPLEEY SL+ FF+R+LKEGSRP+D D
Sbjct  104  WGSLMEVEVPVFMRPAVYKAWARAFHSNLQEPALPLEEYPSLQAFFIRSLKEGSRPIDPD  163

Query  631  PCCLVT  648
            P CLV+
Sbjct  164  PNCLVS  169


 Score = 94.4 bits (233),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR G+L+  G MIEQVKGFSY V  LLGATS L    E+D   + +E+   
Sbjct  167  LVSPVDGKVLRLGQLRGPGTMIEQVKGFSYPVSSLLGATSSLHDATEEDISGEQTEQNVP  226

Query  827  DTDANKKSWWRVSLASPKVRD  889
            ++ +N KSWWRVS+ASPK+RD
Sbjct  227  ES-SNAKSWWRVSVASPKLRD  246



>ref|XP_006414314.1| hypothetical protein EUTSA_v10025592mg [Eutrema salsugineum]
 gb|ESQ55767.1| hypothetical protein EUTSA_v10025592mg [Eutrema salsugineum]
Length=351

 Score =   190 bits (483),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 143/192 (74%), Gaps = 14/192 (7%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCT---RFSHLSQRRLHFTSFLRKIQssearassng---------gs  252
            MK R +  V L  R +   RF H  +R   F+SFL  I+S+   A ++            
Sbjct  1    MKPRFSQNVYLLGRYSFVRRFHHTHRRT--FSSFLNNIRSNHFGARASSIGGGGGGGGTG  58

Query  253  sshgksFFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPL  432
            +S G +F LPGAT+ATI+MLGALHARRLY+D KIE  RE+GIELEFH DVKASF+G+LPL
Sbjct  59   NSKGNAFLLPGATMATILMLGALHARRLYEDKKIEEKRERGIELEFHQDVKASFLGILPL  118

Query  433  RSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGS  612
            RSISR WG LT +E PVW+RPYVY+AWARAFHSNLEEAALPLEEYASLRDFFVR+LKEG 
Sbjct  119  RSISRAWGSLTSLEIPVWMRPYVYKAWARAFHSNLEEAALPLEEYASLRDFFVRSLKEGC  178

Query  613  RPVDSDPCCLVT  648
            R +D DPCCLV+
Sbjct  179  RSIDPDPCCLVS  190


 Score = 93.2 bits (230),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK   GMIEQVKG SYSVP LLG  S L M  E     K+  +E +
Sbjct  188  LVSPVDGTVLRFGELKGNRGMIEQVKGHSYSVPALLGTNSLLPMVPEG----KDESEEEA  243

Query  827  DTDANKKSWWRVSLASPKVRD  889
              D   KSW RVSLASPK+R+
Sbjct  244  VGDKGDKSWLRVSLASPKLRE  264


 Score =   126 bits (316),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
             S SPMKGL+YCVIYL+PGDYHRIHSPADW  L+RRHF+GRLFPVNERATRTIRNLYVENE
Sbjct  267   SASPMKGLYYCVIYLRPGDYHRIHSPADWKALVRRHFAGRLFPVNERATRTIRNLYVENE  326

Query  1298  RV  1303
             RV
Sbjct  327   RV  328



>emb|CAB10445.1| decarboxylase like protein [Arabidopsis thaliana]
 emb|CAB78712.1| decarboxylase like protein [Arabidopsis thaliana]
Length=434

 Score =   179 bits (453),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 110/133 (83%), Gaps = 9/133 (7%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNK---------IEGAREKGIELEFHPDVKASFMGM  423
            F +PGAT+ATI+MLGALHARRLY+D K         IE  REKGIELEFHPD+KASF+G+
Sbjct  71   FLVPGATMATILMLGALHARRLYEDKKHRFLLADTQIEEKREKGIELEFHPDIKASFLGV  130

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLK  603
            LPLRSISR WG    +E PVW+RPY Y+AWARAFHSNLEEAALPLEEY SL+DFFVR+LK
Sbjct  131  LPLRSISRAWGSFMSLEIPVWMRPYAYKAWARAFHSNLEEAALPLEEYTSLQDFFVRSLK  190

Query  604  EGSRPVDSDPCCL  642
            EG RP+D DPCCL
Sbjct  191  EGCRPIDPDPCCL  203


 Score = 95.1 bits (235),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 57/80 (71%), Gaps = 4/80 (5%)
 Frame = +2

Query  650  VSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESSD  829
            VSPVDGT+LRFGELK   GMIEQVKG SYSVP LLG  S L M    + E KN  KE + 
Sbjct  214  VSPVDGTVLRFGELKGNRGMIEQVKGHSYSVPALLGNNSLLPM----EPEGKNESKEEAV  269

Query  830  TDANKKSWWRVSLASPKVRD  889
             D + KSW RVSLASPK+R+
Sbjct  270  GDKSDKSWLRVSLASPKLRE  289


 Score =   179 bits (455),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 104/132 (79%), Gaps = 2/132 (2%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL--YV  1288
             +S SPMKGL+YCVIYLKPGDYHRIHSPADWN  +RRHF+G ++  N        N+   +
Sbjct  291   VSASPMKGLYYCVIYLKPGDYHRIHSPADWNATVRRHFAGLVYQPNMSGILLSPNIDHQL  350

Query  1289  ENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPD  1468
               ++VVLEG W+EGFMA+AA+GATNIGSIELFIEP LRTNKP+K     EPPEERVY+P+
Sbjct  351   LIQQVVLEGIWKEGFMALAAVGATNIGSIELFIEPELRTNKPKKKLFPTEPPEERVYDPE  410

Query  1469  GTGIRMKKGDEL  1504
             G G+R++KG E+
Sbjct  411   GLGLRLEKGKEV  422



>ref|XP_001767589.1| predicted protein [Physcomitrella patens]
 gb|EDQ67548.1| predicted protein [Physcomitrella patens]
Length=435

 Score =   218 bits (555),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 128/174 (74%), Gaps = 8/174 (5%)
 Frame = +2

Query  1127  PMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVV  1306
             P KGLFYCV+YL PGDYHRIHSP+DW + LRRHF+G+LFPVN+RA RT+RNLYV NERVV
Sbjct  249   PSKGLFYCVLYLGPGDYHRIHSPSDWKIRLRRHFAGKLFPVNDRAVRTVRNLYVVNERVV  308

Query  1307  LEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRM  1486
             LEG W +G MAMAA+GATN+GSIE+  EP L+TN P   +        + Y  DG G+ +
Sbjct  309   LEGEWSQGLMAMAAVGATNVGSIEISFEPELKTNLPLLGQQAPSVVTAQKYGVDGEGLDV  368

Query  1487  KKGDELAAFNMGSTVVLVFQAPIS--------SPSDFRFCIKKGERIRMGEALG  1624
             K GDE+A FN+GSTVVLVF+A +             F+F ++KG+R++MG+A+G
Sbjct  369   KAGDEVAVFNLGSTVVLVFEASVGGEGLNVGLQQGQFKFLLRKGQRVKMGQAIG  422


 Score =   137 bits (346),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +1

Query  274  FLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFW  453
             LPGAT+AT++MLG LHARRLY+D+K++  R +G E+EF  D KA+F+  LPLR ISR W
Sbjct  45   LLPGATLATLLMLGTLHARRLYEDSKLQQQRVQGAEIEFAADWKATFLQFLPLRFISRRW  104

Query  454  GFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDP  633
            G  T VE P+WLRPYVY  WARAFH+NLEEA+ P+EEY SLR FF+R LK+G+RP++   
Sbjct  105  GEFTSVELPLWLRPYVYHGWARAFHANLEEASWPVEEYPSLRAFFIRKLKDGARPLEISS  164

Query  634  CCLVT  648
              L++
Sbjct  165  TNLIS  169


 Score = 52.8 bits (125),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQ-VKGFSYSVPKLLGATSFLS  775
            L+SPVDG ++ +G++K  G MIEQ VKGFSYS+P LLGA   LS
Sbjct  167  LISPVDGVVVGYGQVKGPGTMIEQVVKGFSYSLPALLGAPLQLS  210



>ref|XP_007157276.1| hypothetical protein PHAVU_002G0572001g, partial [Phaseolus vulgaris]
 gb|ESW29270.1| hypothetical protein PHAVU_002G0572001g, partial [Phaseolus vulgaris]
Length=236

 Score =   134 bits (336),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  364  REKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNlee  543
            +EKGIE+EF PD+KA+F+ +LPLRSISR WG++T +E PVWLRP +Y+AWARAFHSNLEE
Sbjct  2    KEKGIEVEFQPDIKATFLRLLPLRSISRCWGYMTSMEIPVWLRPVIYKAWARAFHSNLEE  61

Query  544  aalpleeyaslRDFFVRTLKEGSRPVDSDPCCLVT  648
            A LPL++YA+L+DFFVRTLKEGSRP+D DP CLV+
Sbjct  62   AGLPLDKYATLKDFFVRTLKEGSRPIDVDPQCLVS  96


 Score =   114 bits (286),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDGT+LRFGELK AG MIEQVKGFSYSV  LLGA+ FL  TA+ D ++K +E  ++
Sbjct  94   LVSPVDGTVLRFGELKGAGAMIEQVKGFSYSVFSLLGASPFLPTTADGDVQEKLNE-STT  152

Query  827  DTDANKKSWWRVSLASPKVRDP  892
            +T+ NKKSWWRVSLASPKV DP
Sbjct  153  NTEKNKKSWWRVSLASPKVWDP  174


 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 1/66 (2%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             +  K SC P +GLFYCV+YLKPGDYHRIHSPADWN+L+RRHFSGRL+P+NERATRTIRNL
Sbjct  172   WDPKSSC-PKRGLFYCVVYLKPGDYHRIHSPADWNILVRRHFSGRLYPLNERATRTIRNL  230

Query  1283  YVENER  1300
             Y+ENER
Sbjct  231   YIENER  236



>ref|XP_002983160.1| hypothetical protein SELMODRAFT_117633 [Selaginella moellendorffii]
 gb|EFJ15969.1| hypothetical protein SELMODRAFT_117633 [Selaginella moellendorffii]
Length=377

 Score =   192 bits (489),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 124/179 (69%), Gaps = 21/179 (12%)
 Frame = +2

Query  1127  PMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSG-RLFPVNERATRTIRNLYVENERV  1303
             P + LFYCV+YL PGDYHR+HSP++W +  RRHFSG  L+PVN RA RTI+NLYV NER+
Sbjct  209   PPRALFYCVLYLGPGDYHRVHSPSNWCIENRRHFSGTNLYPVNARAARTIKNLYVVNERI  268

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIR  1483
             VLEG WQEG M+MA +GATN GSIEL  EP L+TN P+         E  + E  G  IR
Sbjct  269   VLEGEWQEGLMSMALVGATNCGSIELKFEPDLKTNIPKA--------ESSIKENCGYCIR  320

Query  1484  MKKGDELAAFNMGSTVVLVFQAP---------ISSP-SDFRFCIKKGERIRMGEALGRW  1630
               KGDE   FN+GSTVV+VF+AP         + +P   F F ++KG+RI+MG+ALG+W
Sbjct  321   --KGDEATTFNLGSTVVMVFEAPGEVEDLFKVLDNPYQGFNFTVEKGQRIKMGQALGQW  377


 Score =   135 bits (339),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +1

Query  274  FLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFW  453
            FLPGATVAT+ M+  L  +R+Y++ ++E A + GIE EF PD KASF+ +LPLR ISR W
Sbjct  12   FLPGATVATLAMVAVLQGKRIYEEKQMELAIQNGIEPEFSPDTKASFLRLLPLRFISRVW  71

Query  454  GFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDP  633
            G ++ +  P W RPYVY+ WARAFH++L+E  L LEEY+SLR+FF R LK G+RP+D+  
Sbjct  72   GSISSINLPTWSRPYVYKGWARAFHTDLDEVPLSLEEYSSLREFFARGLKAGARPIDTRE  131

Query  634  CCLVT  648
             C+++
Sbjct  132  NCMLS  136


 Score = 50.1 bits (118),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNS  811
            ++SPVDG + R+G + + G  +EQVKGF+YS+  LLG       TA    E+K+S
Sbjct  134  MLSPVDGIVTRYGRVAQPGAKVEQVKGFTYSLSALLGFEPNPIKTAAAPEEKKSS  188



>ref|XP_002965919.1| hypothetical protein SELMODRAFT_23058, partial [Selaginella moellendorffii]
 gb|EFJ33339.1| hypothetical protein SELMODRAFT_23058, partial [Selaginella moellendorffii]
Length=365

 Score =   190 bits (483),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 123/179 (69%), Gaps = 21/179 (12%)
 Frame = +2

Query  1127  PMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSG-RLFPVNERATRTIRNLYVENERV  1303
             P + LFYCV+YL PGDYHR+HSP++W +  RRHFSG  L+PVN RA RTI+NLYV NER+
Sbjct  197   PPRALFYCVLYLGPGDYHRVHSPSNWCIENRRHFSGTNLYPVNARAARTIKNLYVVNERI  256

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIR  1483
             VLEG WQEG M+MA +GATN GSIEL  EP L+TN  +         E  + E  G  IR
Sbjct  257   VLEGEWQEGLMSMALVGATNCGSIELKFEPDLKTNTTKA--------ESSIKENCGYCIR  308

Query  1484  MKKGDELAAFNMGSTVVLVFQAP---------ISSP-SDFRFCIKKGERIRMGEALGRW  1630
               KGDE   FN+GSTVV+VF+AP         + +P   F F ++KG+RI+MG+ALG+W
Sbjct  309   --KGDEATTFNLGSTVVMVFEAPGEVEDLFKVLDNPYQGFNFTVEKGQRIKMGQALGQW  365


 Score =   134 bits (338),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +1

Query  277  LPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWG  456
            LPGATVAT+ M+  L  +R+Y++ ++E A +KGIE EF PD KASF+ +LPLR ISR WG
Sbjct  1    LPGATVATLAMVAVLQGKRIYEEKQMELAIQKGIEPEFSPDTKASFLRLLPLRFISRVWG  60

Query  457  FLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSDPC  636
             ++ +  P W RPYVY+ WARAFH++L+E  L LEEY+SLR+FF R LK G+RP+D+   
Sbjct  61   SISSINLPTWSRPYVYKGWARAFHTDLDEVPLSLEEYSSLREFFARGLKAGARPIDTREN  120

Query  637  CLVT  648
            C+++
Sbjct  121  CMLS  124


 Score = 50.1 bits (118),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNS  811
            ++SPVDG + R+G + + G  +EQVKGF+YS+  LLG       TA    E+K+S
Sbjct  122  MLSPVDGIVTRYGRVAQPGAKVEQVKGFTYSLSALLGFEPNPIKTAAAPEEKKSS  176



>ref|XP_007266134.1| phosphatidylserine decarboxylase [Fomitiporia mediterranea MF3/22]
 gb|EJD04533.1| phosphatidylserine decarboxylase [Fomitiporia mediterranea MF3/22]
Length=525

 Score =   158 bits (400),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 118/354 (33%), Positives = 176/354 (50%), Gaps = 68/354 (19%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAED-DSEQKNSE---  814
             LVSP DG IL FG ++  G  +EQVKG +YS+  LLG ++  + T++  D   ++ E   
Sbjct  203   LVSPADGKILHFGTVE--GSRVEQVKGLTYSLNALLGKSTPSTPTSKKVDFTNRDHEVIM  260

Query  815   -KESSDTDANKKSWWRV--SLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**  985
              +E +D +  + S  ++  S  +PKV++P       +     P+                
Sbjct  261   DREFADINGIEYSLEQLLGSSDAPKVKEPDEK---DNEASELPD----------------  301

Query  986   AKFCGFINNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSC--------------  1123
                 G +N      +L +    +   +P +   +N  +  S  L+               
Sbjct  302   ----GELN------VLRQMGEAKDVSVPPSGSESNLAHDASVALAVGRPPLTRTHSEHQR  351

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             +P   L++ VIYL PGDYHR HSPA W V  RRHF G LF V+    R + NL+V NERV
Sbjct  352   NPQNRLYFTVIYLAPGDYHRFHSPAAWVVEQRRHFVGELFSVSPYIARRLPNLFVLNERV  411

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPE----ERVYEPDG  1471
              L GRW  GF +M  +GATN+GSI L  +  LRTN   +      PP     E VY    
Sbjct  412   ALLGRWAHGFFSMTPVGATNVGSILLNFDRELRTNVRGR-----RPPPGTFMEAVYSNAS  466

Query  1472  TGIR---MKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
               +R   ++ G+E+  F +GST+VLVF+A    P DF F +  G+++++G+ LG
Sbjct  467   KILRGKPLRPGEEMGGFCLGSTIVLVFEA----PKDFVFDLHAGQKVKVGQRLG  516


 Score = 65.1 bits (157),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +1

Query  382  LEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalple  561
            +  H     + +G LPLR++SR WG+L  VE PVW RP  +  +++ F  NLEE    L 
Sbjct  119  IRLHGPFHVNVLGALPLRNLSRLWGYLNSVELPVWFRPTGFTIYSKIFGVNLEEVEHDLP  178

Query  562  eyaslRDFFVRTLKEGSRPVDS  627
             Y SL +FF R LKEG RP+D 
Sbjct  179  YYKSLGEFFYRRLKEGVRPIDD  200



>ref|XP_453424.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAH00520.1| KLLA0D08096p [Kluyveromyces lactis]
Length=492

 Score =   162 bits (410),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 116/332 (35%), Positives = 170/332 (51%), Gaps = 40/332 (12%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             +V P DGT+L+FG +    G IEQVKG +YSV + LG T    +     SE+K  +   +
Sbjct  193   VVCPSDGTVLQFGIIDPHLGHIEQVKGMTYSVKEFLG-THGHPLLQRTPSEEKLGQDTKT  251

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
             D D   + + R++     + D       H+     P + S   L   +Y +   +     
Sbjct  252   DND--HREFARINDIPYSLNDIIG----HT-----PGSQSEDHLQPFDYKMEKNQAISDQ  300

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRI  1186
             ++  +F +L       G   P+         +   KLS +  + L++ VIYL PGDYH  
Sbjct  301   DSSKTFTLL-------GELSPN---------YVKQKLSSTDTQ-LYFAVIYLAPGDYHHY  343

Query  1187  HSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNI  1366
             HSP +W   LRRHF G LF V     R   NL+V NERV L G W+ GF +M  +GATN+
Sbjct  344   HSPVNWVCKLRRHFPGELFSVAPYFQRNFPNLFVLNERVALLGHWKHGFFSMTPVGATNV  403

Query  1367  GSIELFIEPTLRTNKPQKNKLHLEPPE--ERVYEPDGT---GIRMKKGDELAAFNMGSTV  1531
             GSI+L  +  L TN  +K + H +P    E  YE       G+ + KG+E+  F +GSTV
Sbjct  404   GSIKLNFDKELITN--EKTQRHCKPHTCYEATYENASKVLGGVPLIKGEEMGGFMLGSTV  461

Query  1532  VLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
             VL F+A    P +F F I  G++++MG+ LG+
Sbjct  462   VLCFEA----PREFNFKINVGDKVKMGQPLGK  489


 Score = 55.8 bits (133),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaal-pleeyaslRDFFVRTL  600
            LPL +ISR WG +  +  P W+RP+ Y+ +A  FH+NL+E     L  Y +L  FF RT+
Sbjct  120  LPLNAISRLWGQVNSLNLPTWVRPWSYKLYATLFHANLDEMDDPDLSHYENLSQFFYRTI  179

Query  601  KEGSRPVDSDPCCLV  645
            +  +RP+D D   +V
Sbjct  180  RPETRPIDFDENVVV  194



>ref|XP_007157278.1| hypothetical protein PHAVU_002G0572000g, partial [Phaseolus vulgaris]
 ref|XP_007157279.1| hypothetical protein PHAVU_002G0572000g, partial [Phaseolus vulgaris]
 gb|ESW29272.1| hypothetical protein PHAVU_002G0572000g, partial [Phaseolus vulgaris]
 gb|ESW29273.1| hypothetical protein PHAVU_002G0572000g, partial [Phaseolus vulgaris]
Length=119

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 95/119 (80%), Gaps = 6/119 (5%)
 Frame = +2

Query  1301  VVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGI  1480
             V+LEG WQEGFMA+AAIGATNIGS ELFIEP L TN+P K  LH EPPEERVYE +G G 
Sbjct  1     VILEGLWQEGFMALAAIGATNIGSSELFIEPELHTNRPMKKFLHSEPPEERVYECEGVGR  60

Query  1481  RMKKGDELAAFNMGSTVVLVFQAPIS------SPSDFRFCIKKGERIRMGEALGRWHDS  1639
              + +GDEL AFNMGSTVVLVFQAPIS      S  +FRFC++ G+RIR+GEALGRWH S
Sbjct  61    VLTRGDELGAFNMGSTVVLVFQAPISKLNEGDSSQEFRFCVQSGDRIRVGEALGRWHSS  119



>dbj|BAO39209.1| phosphatidylserine decarboxylase proenzyme 1 [Kluyveromyces marxianus 
DMKU3-1042]
Length=517

 Score =   158 bits (399),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 113/353 (32%), Positives = 168/353 (48%), Gaps = 61/353 (17%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG------------------ATSFL  772
             +V P DG +L+FG +    G IEQVKG +YSV + LG                  +TS  
Sbjct  192   IVCPSDGKVLQFGTIDPQFGHIEQVKGLNYSVREFLGTHSHPLMQRTQSEEQLTPSTSAN  251

Query  773   SMTAEDDSEQKNSEKESSDTDANKKSWWRVSLASPKVRD---PAPAW*PHSNVLVFPETL  943
             S+ +  D+  + +  E  + D + + + R++     + D     P      ++  F    
Sbjct  252   SVESNIDTSSEKTRVEDDENDKSHREFARINNIPYSLNDIIGHTPGSQDEDHLQPFSYKR  311

Query  944   SA*QLLTCEYVI**AKFCGFINNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSC  1123
                Q +T              +N    L L       G   P+         +   K+S 
Sbjct  312   EKNQAITD-------------HNASKTLTLL------GDLSPN---------YVKQKMSS  343

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             +  + L++ VIYL PGDYH  HSP +W   LRRHF G LF V     R   NL+V NERV
Sbjct  344   TDTQ-LYFAVIYLAPGDYHHYHSPVNWVCKLRRHFPGELFSVAPYFQRNFPNLFVLNERV  402

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPE--ERVYEPDGT-  1474
              L G W+ GF +M  +GATN+GSI+L  +  L TN  +K + H +P    E  YE     
Sbjct  403   ALLGHWKHGFFSMTPVGATNVGSIKLNFDKELVTN--EKTQRHCKPHTCYEATYENASKV  460

Query  1475  --GIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
               G+ + KG+E+  F +GSTVVL F+A    P  F+F +  G++++MG+ LG+
Sbjct  461   LGGVPLIKGEEMGGFMLGSTVVLCFEA----PKGFKFNVNVGDKVKMGQPLGK  509


 Score = 59.7 bits (143),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 9/126 (7%)
 Frame = +1

Query  292  VATIVMLGALHARRL-------YDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            V + ++L   + RRL        D  + +G R+  I + F+ +        LPL +ISRF
Sbjct  69   VVSSILLNQGYFRRLEVADGEEQDGEEQDGKRKHKISI-FNNNWLFFCYSTLPLNAISRF  127

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaal-pleeyaslRDFFVRTLKEGSRPVDS  627
            WG +  +  PVW+RP+ Y+ +A  F +NLEE     L  Y +L  FF RT+K  +RP+D 
Sbjct  128  WGQVNSLNLPVWVRPWSYKLYATLFDANLEEMEDPDLTHYENLSQFFYRTIKPETRPIDY  187

Query  628  DPCCLV  645
            D   +V
Sbjct  188  DENVIV  193



>dbj|BAP70725.1| phosphatidylserine decarboxylase proenzyme 1 [Kluyveromyces marxianus]
Length=517

 Score =   158 bits (399),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 113/353 (32%), Positives = 168/353 (48%), Gaps = 61/353 (17%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG------------------ATSFL  772
             +V P DG +L+FG +    G IEQVKG +YSV + LG                  +TS  
Sbjct  192   IVCPSDGKVLQFGTIDPQFGHIEQVKGLNYSVREFLGTHSHPLMQRTQSEEQLTPSTSAN  251

Query  773   SMTAEDDSEQKNSEKESSDTDANKKSWWRVSLASPKVRD---PAPAW*PHSNVLVFPETL  943
             S+ +  D+  + +  E  + D + + + R++     + D     P      ++  F    
Sbjct  252   SVESNIDTSSEKTRVEDDENDKSHREFARINNIPYSLNDIIGHTPGSQDEDHLQPFSYKR  311

Query  944   SA*QLLTCEYVI**AKFCGFINNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSC  1123
                Q +T              +N    L L       G   P+         +   K+S 
Sbjct  312   EKNQAITD-------------HNASKTLTLL------GDLSPN---------YVKQKMSS  343

Query  1124  SPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERV  1303
             +  + L++ VIYL PGDYH  HSP +W   LRRHF G LF V     R   NL+V NERV
Sbjct  344   TDTQ-LYFAVIYLAPGDYHHYHSPVNWVCKLRRHFPGELFSVAPYFQRNFPNLFVLNERV  402

Query  1304  VLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPE--ERVYEPDGT-  1474
              L G W+ GF +M  +GATN+GSI+L  +  L TN  +K + H +P    E  YE     
Sbjct  403   ALLGHWKHGFFSMTPVGATNVGSIKLNFDKELVTN--EKTQRHCKPHTCYEATYENASKV  460

Query  1475  --GIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
               G+ + KG+E+  F +GSTVVL F+A    P  F+F +  G++++MG+ LG+
Sbjct  461   LGGVPLIKGEEMGGFMLGSTVVLCFEA----PKGFKFNVNVGDKVKMGQPLGK  509


 Score = 59.7 bits (143),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 9/126 (7%)
 Frame = +1

Query  292  VATIVMLGALHARRL-------YDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            V + ++L   + RRL        D  + +G R+  I + F+ +        LPL +ISRF
Sbjct  69   VVSSILLNQGYFRRLEVADGEEQDGEEQDGKRKHKISI-FNNNWLFFCYSTLPLNAISRF  127

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaal-pleeyaslRDFFVRTLKEGSRPVDS  627
            WG +  +  PVW+RP+ Y+ +A  F +NLEE     L  Y +L  FF RT+K  +RP+D 
Sbjct  128  WGQVNSLNLPVWVRPWSYKLYATLFDANLEEMEDPDLTHYENLSQFFYRTIKPETRPIDY  187

Query  628  DPCCLV  645
            D   +V
Sbjct  188  DENVIV  193



>ref|XP_001943709.2| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Acyrthosiphon pisum]
Length=498

 Score =   158 bits (400),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 118/350 (34%), Positives = 164/350 (47%), Gaps = 51/350 (15%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             +VSP DGTI+  G +      +EQVKG +Y++   LG     S T ++D    N E    
Sbjct  173   MVSPADGTIVSVGRVTSC--QVEQVKGVTYTIKSFLG-----SPTWQEDIATSNLESSPM  225

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
             +T A K    +   ++         W  +S  L +   L    +    ++        F+
Sbjct  226   NT-ATKSDMMKQDSSTSN----CSGWSINSTFLFYHYGLLTMHMYCINFIF------NFL  274

Query  1007  NNWYSFLILYEKT-------NRRGSFLPSTMQHAN------FDYF---FSSKLSCSPMKG  1138
             +   SF  L  K        + +   +    Q  N      FD     + SKL  +P   
Sbjct  275   SQGVSFFSLSFKKQDVALSDDTQEKTISVERQDKNDGECQPFDPHWNEYKSKLLHNPDNE  334

Query  1139  LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGR  1318
             L+  VIYL PGDYHR HSPA W V  RRHF G L  VN +  R + +L+V NER V  G 
Sbjct  335   LYQLVIYLAPGDYHRFHSPAQWTVKFRRHFQGELLSVNPKIARLLPDLFVLNERAVYVGE  394

Query  1319  WQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK---LHLEPPEERVYEPDGTGIRMK  1489
             W+ GF +M A+GATN+GSI++  +  L TNK  + K    H  P             +  
Sbjct  395   WEHGFFSMTAVGATNVGSIKVHSDKGLETNKRCRRKDFNQHDRP----------FSTQWS  444

Query  1490  KGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGRWHDS  1639
              G E+  F MGSTVVL+F+A    P  F F +  G+ I+MG+ALGR H S
Sbjct  445   IGQEVGEFRMGSTVVLLFEA----PKGFVFDVDAGQTIQMGQALGRIHVS  490


 Score = 57.8 bits (138),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 68/117 (58%), Gaps = 5/117 (4%)
 Frame = +1

Query  280  PGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGF  459
            P  T   + +L  L  RRL   NK +   E+  +  +  +++ SF   +PLR++SR WG+
Sbjct  59   PIPTGVGLTLLAVLQWRRL---NKQQPENEQ--QPIYTRNLRLSFYKAIPLRAMSRLWGY  113

Query  460  LTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            ++G   P  LR ++Y A+++ F   + E  LP+E Y SL +FF R LK+G+RP+  D
Sbjct  114  ISGCYIPRQLRYWLYTAYSKLFGVIINEIELPMESYKSLGEFFARRLKDGARPISFD  170



>emb|CDO93645.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=494

 Score =   163 bits (413),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 171/335 (51%), Gaps = 46/335 (14%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             +V P DG +L+FG +    G IEQVKG SYSV + LG T    +     SE+K  + + +
Sbjct  195   VVCPSDGKVLQFGIIDPHLGHIEQVKGLSYSVKEFLG-THLHPLLHRAPSEEKLGQDDKT  253

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHS-NVLV--FPETLSA*QLLTCEYVI**AKFC  997
             D D        +  A  ++ D      P+S N ++   P + S   +   EY I      
Sbjct  254   DND-------HIEFA--RINDI-----PYSLNDIIGHTPGSKSEDHIQPFEYKI------  293

Query  998   GFINNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDY  1177
                NN     I  + T++  + L     +     +   K+S +  K L++ VIYL PGDY
Sbjct  294   --ENNQ---AIADQDTSKSLTLLSELSPN-----YIKQKMSPTDTK-LYFAVIYLAPGDY  342

Query  1178  HRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGA  1357
             H  HSP +W   LRRHF G LF V     R   NL+V NERV L G W+ GF +M  +GA
Sbjct  343   HHYHSPVNWVCKLRRHFPGELFSVAPYFQRNFPNLFVLNERVALLGHWKHGFFSMTPVGA  402

Query  1358  TNIGSIELFIEPTLRTNKPQKNKLHLEPPE--ERVYEPDGT---GIRMKKGDELAAFNMG  1522
             TN+GSI+L  +  L TN   K   H +P    E  YE       G+ + KG+E+  F +G
Sbjct  403   TNVGSIKLNFDKELITNG--KTHRHCKPHTCYEATYENASKVLGGVPLIKGEEMGGFMLG  460

Query  1523  STVVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
             STVVL F+A    P+DF F I  G++++MG+ LG+
Sbjct  461   STVVLCFEA----PTDFNFKINVGDKVKMGQPLGK  491


 Score = 52.4 bits (124),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRD-FFVRTL  600
            LPL ++SR WG +  +  P W+RP+ YR +A  F++NL+E   P   +      FF RT+
Sbjct  122  LPLNAMSRLWGQVNSLNLPTWVRPWSYRLYAALFNANLDEMDDPDLTHYENLSRFFYRTI  181

Query  601  KEGSRPVDSDPCCLV  645
            K  +RP+D +   +V
Sbjct  182  KPETRPIDYNENVVV  196



>gb|EJT98898.1| phosphatidylserine decarboxylase [Dacryopinax sp. DJM-731 SS1]
Length=451

 Score =   160 bits (404),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/334 (34%), Positives = 161/334 (48%), Gaps = 46/334 (14%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             LVSP DGT++  GE+ +A   IEQ+KG +YS+  LLG     +         +   ++S+
Sbjct  152   LVSPSDGTVVHLGEI-QANRRIEQIKGVTYSLDALLGRGQSSTPVLSPSLPPREGTQDSA  210

Query  827   DTDANKKSWWRVSL-ASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGF  1003
               + N   +  +SL  SP  + P     P + +    +   A      E V         
Sbjct  211   FAEINGIPYSLISLMGSPSSKPPNAPHRPATPIKAQDQGDRAIHQPVGEKVH--------  262

Query  1004  INNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHR  1183
                 +S  +  E   +  + L  T++  N                LFY V+YL PGDYHR
Sbjct  263   ----HSVQVAQEMGAQAVTSLGHTVREGN---------------SLFYIVVYLGPGDYHR  303

Query  1184  IHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATN  1363
              HSPA W V  RRHFSG LF VN      + NL+V NERV L G+W+ GF +   +GATN
Sbjct  304   FHSPASWVVEKRRHFSGELFSVNPWLVSRLPNLFVLNERVALLGKWRHGFFSFIPVGATN  363

Query  1364  IGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT-------GIRMKKGDELAAFNMG  1522
             +GSI +  +  LRTN       H  PP     E   +       G    KG+E+  F +G
Sbjct  364   VGSINISFDTDLRTNA------HSAPPVGTFVEASYSSASALLGGWPAVKGEEMGGFALG  417

Query  1523  STVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
             ST+VLVF+A    P  + + +K GE++R+G+ALG
Sbjct  418   STIVLVFEA----PQRWEWSVKPGEKVRVGQALG  447


 Score = 55.5 bits (132),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +1

Query  415  MGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFV  591
            +G LPLR +SR WG+L   E P+WLRPY Y  +A  F  NLEE          SL +FF 
Sbjct  78   LGALPLRQLSRLWGWLNSHELPLWLRPYGYGFYAWLFGVNLEEMDPADLSAYRSLGEFFY  137

Query  592  RTLKEGSRPV  621
            R LK+G+RP+
Sbjct  138  RGLKDGARPI  147



>ref|XP_002174664.1| phosphatidylserine decarboxylase Psd1 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB08371.1| phosphatidylserine decarboxylase Psd1 [Schizosaccharomyces japonicus 
yFS275]
Length=433

 Score =   166 bits (420),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 119/332 (36%), Positives = 161/332 (48%), Gaps = 61/332 (18%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             +VSP DG +L FG L+  G  +EQVKG +YS+  LLG      M AE+ S+  ++ +   
Sbjct  149   MVSPSDGKVLSFGVLE--GDRMEQVKGLTYSLNALLGDDMHAKM-AEEHSDHMSALRHEK  205

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
                 N   +   SL      D      P   V   P+                       
Sbjct  206   FAVVNGIDY---SLQDIFGHDHGE---PEREVKTVPDA----------------------  237

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRI  1186
                          + R  F  S +       F S K  C     L+Y V+YL PGDYHR 
Sbjct  238   -----------SADHRDLFESSRVAVKAAPQFTSHKDDC-----LYYAVVYLSPGDYHRF  281

Query  1187  HSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNI  1366
             HSP DW V  RRHFSG LF V+    + + NL+V NERV L GR++ GFM+M  +GATN+
Sbjct  282   HSPTDWVVERRRHFSGELFSVSPYMAKRLCNLFVLNERVALLGRYKYGFMSMVPVGATNV  341

Query  1367  GSIELFIEPTLRTNKPQKNKLHLEPP---EERVYE---PDGTGIRMKKGDELAAFNMGST  1528
             GSI +  +  LRTN+  K    L PP   EE  YE   P   G+   KG+E+  F +GST
Sbjct  342   GSIVINFDKQLRTNRFSK----LGPPGTFEEATYESSSPTLDGMPFTKGEEMGRFELGST  397

Query  1529  VVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
             ++LVF+A    P +F F +  G+R+ MG++LG
Sbjct  398   IILVFEA----PKNFEFNLNVGQRVLMGQSLG  425


 Score = 49.7 bits (117),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = +1

Query  367  EKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleea  546
            +KG+++E    V    +  LPLR++SR WG L  V  P W+R   +R +A  F  NL+EA
Sbjct  60   KKGVKIEGPWQVYV--LSTLPLRTLSRVWGALNSVHLPAWIRVPWFRLYATIFGCNLDEA  117

Query  547  alple-eyaslRDFFVRTLKEGSRPVDSD  630
            A     EY +L +FF R LK G+R VD D
Sbjct  118  ACKDLREYRNLSEFFGRALKPGARQVDED  146



>ref|XP_003245397.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Acyrthosiphon pisum]
Length=487

 Score =   158 bits (399),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 118/350 (34%), Positives = 162/350 (46%), Gaps = 51/350 (15%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             +VSP DGTI+  G +      +EQVKG +Y++   LG     S T ++D    N E    
Sbjct  162   MVSPADGTIVSVGRVTSC--QVEQVKGVTYTIKSFLG-----SPTWQEDIATSNLESSPM  214

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
             +T A K       +           W  +S  L +   L    +    ++        F+
Sbjct  215   NT-ATKSD----MMKQDSSTSNCSGWSINSTFLFYHYGLLTMHMYCINFIF------NFL  263

Query  1007  NNWYSFLILYEKT-------NRRGSFLPSTMQHAN------FDYF---FSSKLSCSPMKG  1138
             +   SF  L  K        + +   +    Q  N      FD     + SKL  +P   
Sbjct  264   SQGVSFFSLSFKKQDVALSDDTQEKTISVERQDKNDGECQPFDPHWNEYKSKLLHNPDNE  323

Query  1139  LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGR  1318
             L+  VIYL PGDYHR HSPA W V  RRHF G L  VN +  R + +L+V NER V  G 
Sbjct  324   LYQLVIYLAPGDYHRFHSPAQWTVKFRRHFQGELLSVNPKIARLLPDLFVLNERAVYVGE  383

Query  1319  WQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK---LHLEPPEERVYEPDGTGIRMK  1489
             W+ GF +M A+GATN+GSI++  +  L TNK  + K    H  P             +  
Sbjct  384   WEHGFFSMTAVGATNVGSIKVHSDKGLETNKRCRRKDFNQHDRP----------FSTQWS  433

Query  1490  KGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGRWHDS  1639
              G E+  F MGSTVVL+F+A    P  F F +  G+ I+MG+ALGR H S
Sbjct  434   IGQEVGEFRMGSTVVLLFEA----PKGFVFDVDAGQTIQMGQALGRIHVS  479


 Score = 57.8 bits (138),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 68/117 (58%), Gaps = 5/117 (4%)
 Frame = +1

Query  280  PGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGF  459
            P  T   + +L  L  RRL   NK +   E+  +  +  +++ SF   +PLR++SR WG+
Sbjct  48   PIPTGVGLTLLAVLQWRRL---NKQQPENEQ--QPIYTRNLRLSFYKAIPLRAMSRLWGY  102

Query  460  LTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            ++G   P  LR ++Y A+++ F   + E  LP+E Y SL +FF R LK+G+RP+  D
Sbjct  103  ISGCYIPRQLRYWLYTAYSKLFGVIINEIELPMESYKSLGEFFARRLKDGARPISFD  159



>ref|XP_003245396.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X3 [Acyrthosiphon pisum]
Length=477

 Score =   158 bits (399),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 117/347 (34%), Positives = 166/347 (48%), Gaps = 45/347 (13%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             +VSP DGTI+  G +      +EQVKG +Y++   LG     S T ++D    N E    
Sbjct  152   MVSPADGTIVSVGRVTSC--QVEQVKGVTYTIKSFLG-----SPTWQEDIATSNLESSPM  204

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
             +T A K    +   ++         W  +S  L +   L    +    ++        F+
Sbjct  205   NT-ATKSDMMKQDSSTSN----CSGWSINSTFLFYHYGLLTMHMYCINFIF------NFL  253

Query  1007  NNWYSFLILYEKT-------NRRGSFLPSTMQHAN------FDYF---FSSKLSCSPMKG  1138
             +   SF  L  K        + +   +    Q  N      FD     + SKL  +P   
Sbjct  254   SQGVSFFSLSFKKQDVALSDDTQEKTISVERQDKNDGECQPFDPHWNEYKSKLLHNPDNE  313

Query  1139  LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGR  1318
             L+  VIYL PGDYHR HSPA W V  RRHF G L  VN +  R + +L+V NER V  G 
Sbjct  314   LYQLVIYLAPGDYHRFHSPAQWTVKFRRHFQGELLSVNPKIARLLPDLFVLNERAVYVGE  373

Query  1319  WQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRMKKGD  1498
             W+ GF +M A+GATN+GSI++  +  L TNK  + K   +   +R +       +   G 
Sbjct  374   WEHGFFSMTAVGATNVGSIKVHSDKGLETNKRCRRKDFNQ--HDRPF-----STQWSIGQ  426

Query  1499  ELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGRWHDS  1639
             E+  F MGSTVVL+F+A    P  F F +  G+ I+MG+ALGR H S
Sbjct  427   EVGEFRMGSTVVLLFEA----PKGFVFDVDAGQTIQMGQALGRIHVS  469


 Score = 57.4 bits (137),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 68/117 (58%), Gaps = 5/117 (4%)
 Frame = +1

Query  280  PGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGF  459
            P  T   + +L  L  RRL   NK +   E+  +  +  +++ SF   +PLR++SR WG+
Sbjct  38   PIPTGVGLTLLAVLQWRRL---NKQQPENEQ--QPIYTRNLRLSFYKAIPLRAMSRLWGY  92

Query  460  LTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
            ++G   P  LR ++Y A+++ F   + E  LP+E Y SL +FF R LK+G+RP+  D
Sbjct  93   ISGCYIPRQLRYWLYTAYSKLFGVIINEIELPMESYKSLGEFFARRLKDGARPISFD  149



>gb|KHN34922.1| Phosphatidylserine decarboxylase proenzyme [Glycine soja]
Length=120

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 96/119 (81%), Gaps = 6/119 (5%)
 Frame = +2

Query  1301  VVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGI  1480
             V+LEG W EGFMA+AAIG TNIGSIELFIEP L TN+P+K  LH EPPEER+YE +G G 
Sbjct  2     VILEGLWLEGFMALAAIGDTNIGSIELFIEPELHTNRPRKKFLHSEPPEERIYECEGLGR  61

Query  1481  RMKKGDELAAFNMGSTVVLVFQAPIS------SPSDFRFCIKKGERIRMGEALGRWHDS  1639
              +KKGDEL AFNMGSTVVLVFQAPIS      S  +FRFC+ +G+RIR+GEALGRWH S
Sbjct  62    MLKKGDELGAFNMGSTVVLVFQAPISKLHEGDSFQEFRFCVGRGDRIRVGEALGRWHSS  120



>gb|EGA77195.1| Psd1p [Saccharomyces cerevisiae Vin13]
Length=497

 Score =   163 bits (413),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 116/334 (35%), Positives = 162/334 (49%), Gaps = 54/334 (16%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             + SP DG IL+ G +    G IEQVKG +YS+ + LG  S   M+    S    S++E  
Sbjct  202   IASPSDGKILQVGIINSETGEIEQVKGMTYSIKEFLGTHSHPLMSKSASSLDLTSDEEKH  261

Query  827   DTDANKKSWWRVSLA-SPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGF  1003
                A      R+ LA S     P                                    F
Sbjct  262   REFARVN---RIQLAGSEDTEQP---------------------------------LLNF  285

Query  1004  INNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKG--LFYCVIYLKPGDY  1177
              N     +  ++ +  +   L S +   + +YF S+  SCS      LF+ VIYL PGDY
Sbjct  286   KNEGDQSVXEFKPSVSKNIHLLSQL---SLNYF-SNGFSCSEPHDTELFFAVIYLAPGDY  341

Query  1178  HRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGA  1357
             H  HSP DW   +RRHF G LF V     R   NL+V NERV L G W+ GF +M  +GA
Sbjct  342   HHFHSPVDWVCKVRRHFPGDLFSVAPYFQRNFPNLFVLNERVALLGSWKYGFFSMTPVGA  401

Query  1358  TNIGSIELFIEPTLRTNKPQKNKLHLEPPE--ERVYEPDGT---GIRMKKGDELAAFNMG  1522
             TN+GSI+L  +    TN   K+  HLEP    + VYE       G+ + KG+E+  F +G
Sbjct  402   TNVGSIKLNFDQEFVTN--SKSDKHLEPHTCYQAVYENASKILGGMPLVKGEEMGGFELG  459

Query  1523  STVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
             STVVL F+A    P++F+F ++ G++++MG+ LG
Sbjct  460   STVVLCFEA----PTEFKFDVRVGDKVKMGQKLG  489


 Score = 48.5 bits (114),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaal-pleeyaslRDFFVRTL  600
            LPL ++SR WG +  +  P+W+RP+ YR ++  F  NL+E     L  YA+L +FF R +
Sbjct  129  LPLNAMSRLWGQVNSLTLPIWVRPWGYRLYSFLFGVNLDEMEDPDLTHYANLSEFFYRNI  188

Query  601  KEGSRPV  621
            K G+RPV
Sbjct  189  KPGTRPV  195



>ref|XP_007541783.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Poecilia formosa]
Length=367

 Score =   175 bits (443),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 120/179 (67%), Gaps = 10/179 (6%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L  SP + LF+ V+YL PGDYH  HSPADW V LRRHF G L  VN    R ++ L
Sbjct  192   FQDRLLSSPDRALFHVVVYLAPGDYHCFHSPADWRVELRRHFPGSLMSVNPGVARWVKEL  251

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLE-----PPE  1447
             +  NERVVL G+WQ GF ++ A+GATN+GSI ++ +  LRTN P+ +K   +      P 
Sbjct  252   FCLNERVVLSGQWQHGFFSLTAVGATNVGSIRVYFDQELRTNAPRYSKGSFQDRTYVAPG  311

Query  1448  ERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
             ++V   +G G+ ++KG+ +  FN+GST+VL+F+A    P+DF F ++ G+RIRMGEALG
Sbjct  312   DQVKTGEG-GVALRKGEPVGEFNLGSTIVLLFEA----PADFTFDLQPGQRIRMGEALG  365


 Score = 40.8 bits (94),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +1

Query  427  PLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalple-eyaslRDFFVRTLK  603
            P R +SR WG L G++ P WLR  +Y  +   F  N++EAA+     Y +L +FF R LK
Sbjct  75   PTRLVSRAWGRLNGLDLPTWLRKPIYSLYIWTFGVNMQEAAVEDLHHYKNLGEFFRRRLK  134

Query  604  EGSRPVDSDPC  636
               RPV +  C
Sbjct  135  PAVRPVCAASC  145


 Score = 38.1 bits (87),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATS  766
            L SP DG IL FG ++ +   +EQVKG +YS+   LG  S
Sbjct  146  LTSPADGRILHFGRVQNS--QVEQVKGVTYSLENFLGPPS  183



>emb|CDX95403.1| BnaC04g27550D [Brassica napus]
Length=215

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 98/140 (70%), Gaps = 29/140 (21%)
 Frame = +2

Query  1118  SCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENE  1297
              C+PMKGL+YCVIYL+PGDYHRIHSPADWN L+RRHF+GRLFPVNE ATRTI+NLY    
Sbjct  83    CCTPMKGLYYCVIYLRPGDYHRIHSPADWNALVRRHFAGRLFPVNECATRTIKNLY----  138

Query  1298  RVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTG  1477
              VVLEG W++GFMA+   GATNIGSI                        E+VY+P G G
Sbjct  139   -VVLEGIWKQGFMALDVDGATNIGSI------------------------EQVYDPQGHG  173

Query  1478  IRMKKGDELAAFNMGSTVVL  1537
             ++++KG E+  FNMGSTV +
Sbjct  174   VKLEKGKEVGVFNMGSTVAV  193


 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 51/84 (61%), Gaps = 18/84 (21%)
 Frame = +2

Query  650  VSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESSD  829
            VSPVDGT+LRFGELKE+ GM EQVKG SYS P             +D+SE++        
Sbjct  14   VSPVDGTVLRFGELKESRGMNEQVKGHSYSAP------------GKDESEKEVV------  55

Query  830  TDANKKSWWRVSLASPKVRDPAPA  901
             D   KSW ++SLASPK+R+   A
Sbjct  56   ADKIDKSWLKISLASPKLRESISA  79



>ref|XP_007541784.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Poecilia formosa]
Length=366

 Score =   175 bits (443),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 120/179 (67%), Gaps = 10/179 (6%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L  SP + LF+ V+YL PGDYH  HSPADW V LRRHF G L  VN    R ++ L
Sbjct  191   FQDRLLSSPDRALFHVVVYLAPGDYHCFHSPADWRVELRRHFPGSLMSVNPGVARWVKEL  250

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLE-----PPE  1447
             +  NERVVL G+WQ GF ++ A+GATN+GSI ++ +  LRTN P+ +K   +      P 
Sbjct  251   FCLNERVVLSGQWQHGFFSLTAVGATNVGSIRVYFDQELRTNAPRYSKGSFQDRTYVAPG  310

Query  1448  ERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
             ++V   +G G+ ++KG+ +  FN+GST+VL+F+A    P+DF F ++ G+RIRMGEALG
Sbjct  311   DQVKTGEG-GVALRKGEPVGEFNLGSTIVLLFEA----PADFTFDLQPGQRIRMGEALG  364


 Score = 40.8 bits (94),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +1

Query  427  PLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalple-eyaslRDFFVRTLK  603
            P R +SR WG L G++ P WLR  +Y  +   F  N++EAA+     Y +L +FF R LK
Sbjct  74   PTRLVSRAWGRLNGLDLPTWLRKPIYSLYIWTFGVNMQEAAVEDLHHYKNLGEFFRRRLK  133

Query  604  EGSRPVDSDPC  636
               RPV +  C
Sbjct  134  PAVRPVCAASC  144


 Score = 38.5 bits (88),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATS  766
            L SP DG IL FG ++ +   +EQVKG +YS+   LG  S
Sbjct  145  LTSPADGRILHFGRVQNS--QVEQVKGVTYSLENFLGPPS  182



>ref|XP_503119.1| YALI0D21604p [Yarrowia lipolytica]
 emb|CAG81313.1| YALI0D21604p [Yarrowia lipolytica CLIB122]
Length=562

 Score =   156 bits (395),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 115/353 (33%), Positives = 170/353 (48%), Gaps = 70/353 (20%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             +V P DG +L  G +  A G +EQVKG +YS+  LLG       T   D E+ ++     
Sbjct  248   IVCPADGKVLHLGAI-NARGEVEQVKGVTYSLEALLGPP-----TPSKDGEKSHA-----  296

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*Q------LLTCEYVI**A  988
                        VSLA+P            ++ + FP+     +      +    Y +   
Sbjct  297   -----------VSLAAP------------TSEIEFPDNKEENKDREFANVNGISYTL--D  331

Query  989   KFCGFINNWYSFLILYEKTNRRGSFLPS---TMQHANFDYFFSSKLSCSPMKGLFYCVIY  1159
              F G   N  S     ++ +   +  PS   T+     D    +K + S  K LF+ VIY
Sbjct  332   DFMG--GNASSDTTFKQEGDATTTAEPSDNATVAQVGKD-LLQAKFNKSDDKELFFAVIY  388

Query  1160  LKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMA  1339
             L PGDYHR HSP +W   +RRHF G L+ V     + + NL+V NERV L G+W+ GF +
Sbjct  389   LAPGDYHRFHSPVNWVAEIRRHFVGELYSVAPYFQKKLGNLFVLNERVALLGKWKYGFFS  448

Query  1340  MAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEER-----------VYEPDG-----  1471
             M  +GATN+GSI++  +  LRTN   + K   E  E+             YE        
Sbjct  449   MTPVGATNVGSIKIHFDKDLRTNTVYEPKTESEAAEQEKIKKKRMQKNTCYEATYGKASK  508

Query  1472  --TGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
                G  + KGD++  FN+GSTVVLVF+A    P++F+F I+ G+ +R+G+ +G
Sbjct  509   LLGGYPLGKGDQMGGFNLGSTVVLVFEA----PTNFKFTIQPGQVVRVGQRIG  557


 Score = 54.3 bits (129),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 5/123 (4%)
 Frame = +1

Query  298  TIVMLGALHARR--LYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGV  471
            +IV+ G   +RR  + D+   EG   K   +        +    LPL+++SR+WG    +
Sbjct  132  SIVLWGIYQSRRNSVKDEYDEEGNLVKRAPVRPSGPWHVAVYSTLPLKALSRWWGSFNDI  191

Query  472  EFPVWLRPYVYRAWARAFHSNleeaalple-eyaslRDFFVRTLKEGSRPVDSDP--CCL  642
              PVW+R   YR ++  F +NL+E A      Y +L +FF R LKEG+RP+D D    C 
Sbjct  192  TLPVWMRDPGYRFYSFVFGANLDEVAEDDLRVYQNLGEFFYRELKEGARPIDPDADIVCP  251

Query  643  VTG  651
              G
Sbjct  252  ADG  254



>ref|XP_009263733.1| hypothetical protein FPSE_12341 [Fusarium pseudograminearum CS3096]
 gb|EKJ67476.1| hypothetical protein FPSE_12341 [Fusarium pseudograminearum CS3096]
Length=540

 Score =   158 bits (400),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 116/362 (32%), Positives = 171/362 (47%), Gaps = 77/362 (21%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             LV P DG +L++G+++  GG IEQVKG +YS+  LLG               KN+   +S
Sbjct  218   LVCPSDGKVLQYGQIQ--GGDIEQVKGMTYSIDALLG---------------KNTPP-AS  259

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
              +  +  S    SLAS  V D           LV  +                A+F    
Sbjct  260   VSGTSGTSTPATSLASTDVSD--------EEALVKQD----------------AEFAQVN  295

Query  1007  NNWYSFLILYEKTNRRGSFL--------PSTMQHANFDYFFSSK-----LSCSPMKGLFY  1147
                Y+   L   T +RG  +        P T+   + +     +     +S      L+Y
Sbjct  296   GISYTLPDLLSGTGKRGPSVKDESMPASPGTVSEVSAELALGERPWYDVVSPDKTTALYY  355

Query  1148  CVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQE  1327
              VIYL PGDYHR HSP +W V  RRHF+G L+ V+    RT+  L+  NERVVL GRW+ 
Sbjct  356   AVIYLAPGDYHRFHSPTNWVVDRRRHFAGELYSVSPYLQRTLPGLFTLNERVVLLGRWRW  415

Query  1328  GFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPP-------------EERVYE--  1462
             GF +   +GATN+GSI +  +  LRTN    +                     E  YE  
Sbjct  416   GFFSYVPVGATNVGSIVVNFDKELRTNSLLTDTAADRAAEEAANRGEVYQGFAEATYEAA  475

Query  1463  -PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSD------FRFCIKKGERIRMGEAL  1621
              P   G  +++G+E+  F +GST+VLVF+AP +   +      + + ++KG++++MG+AL
Sbjct  476   SPILRGHALRRGEEMGGFQLGSTIVLVFEAPANKVGENNQHIGWDWAVEKGQQVKMGQAL  535

Query  1622  GR  1627
             GR
Sbjct  536   GR  537


 Score = 51.6 bits (122),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 55/109 (50%), Gaps = 3/109 (3%)
 Frame = +1

Query  328  RRLYDDNKIEGAREKGIELEFHPDV--KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYV  501
             R+  ++  EG R         PD   +   M  LPL++ISR WG    +  P +LR   
Sbjct  111  ERIEMEDGQEGTRTPKKRARIRPDGPWQVQVMSTLPLKAISRLWGRFNELTIPYYLRVPG  170

Query  502  YRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCLV  645
            ++ ++  F  NL+E A P      +L  FF RTLK G+RP+D DP  LV
Sbjct  171  FKLYSWVFGVNLDEVAEPDLHVYPNLASFFYRTLKPGARPLDQDPHTLV  219



>ref|XP_007368499.1| phosphatidylserine decarboxylase [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF58850.1| phosphatidylserine decarboxylase [Dichomitus squalens LYAD-421 
SS1]
Length=526

 Score =   149 bits (376),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 114/374 (30%), Positives = 165/374 (44%), Gaps = 100/374 (27%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVK----------------------------------  724
             LVSP DG +L FG +K+  G IEQVK                                  
Sbjct  194   LVSPADGRVLHFGVIKD--GRIEQVKGSTYSLDALLGLARPGTPAVTAVEFPDQKMDEVN  251

Query  725   --------GFSYSVPKLLGA---TSFLSMTAEDDSEQKNSEKESSDTDANKKSWWRVSLA  871
                     G  YS+ +LLG    +S  + T   ++   +++  +    A KK   RV  +
Sbjct  252   HRHFADINGIEYSLHELLGTPTPSSSGTSTPTAEAPHTHTDGAAQTGTAAKKHGERVDAS  311

Query  872   SPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFINNWYSFLILYEKTNR  1051
              P+ +               PET++    +  E                  + L     R
Sbjct  312   VPRDQ-------------TLPETVAQDVSMASE------------------VGLRPTAAR  340

Query  1052  RGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFS  1231
             R SF               + +   P    F+ VIYL PGDYHR HSPA W V  RRHF 
Sbjct  341   RDSF---------------TSVRTKPGNDTFFIVIYLAPGDYHRFHSPAAWVVERRRHFV  385

Query  1232  GRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNK  1411
             G LF V+    + + NL+V NERV L GRW+ GF +M  +GATN+GSI++  +  LRTN 
Sbjct  386   GDLFSVSPWMAKRLENLFVLNERVALLGRWKYGFFSMVPVGATNVGSIKINFDQALRTNV  445

Query  1412  PQKNKLHLEPPEERVY---EPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFC  1582
               + +  +    E VY    P   G  + KG+E+  F +GST+VLVF+A    P +F F 
Sbjct  446   GSRREHPVGTFTEAVYSAASPILNGQPLVKGEEMGGFCLGSTIVLVFEA----PHNFDFF  501

Query  1583  IKKGERIRMGEALG  1624
             +  G+++++G+ LG
Sbjct  502   VSAGQKVKVGQRLG  515


 Score = 60.8 bits (146),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 59/97 (61%), Gaps = 8/97 (8%)
 Frame = +1

Query  334  LYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAW  513
            + DD+  E  R KG    +H  V    +G LPLR++SR WG+L  +E PVW RP  +R +
Sbjct  100  VVDDDGNEVIRLKG---PWHVHV----IGALPLRNMSRVWGYLNSLELPVWFRPIGFRIY  152

Query  514  ARAFHSNleeaa-lpleeyaslRDFFVRTLKEGSRPV  621
            A  F  NLEE     L +YASL +FF R LK+G+RPV
Sbjct  153  ASVFGCNLEEIDPQDLTQYASLGEFFYRKLKDGARPV  189



>emb|CDR42342.1| CYFA0S09e01552g1_1 [Cyberlindnera fabianii]
Length=539

 Score =   158 bits (399),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/343 (33%), Positives = 167/343 (49%), Gaps = 57/343 (17%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             LV P DG +L +G + +  G IEQVKG +Y++   LG  +   + A   +   + E    
Sbjct  232   LVCPSDGLVLHYGVIDD--GKIEQVKGLTYTLDAFLGDATNHKLAAPSHNVAFDHE-NPD  288

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
             D     + + +++  S  + D           ++  E  +   L                
Sbjct  289   DVQKRHEEFAQINGISYTLDD-----------IIGGEGKNVTHLKK--------------  323

Query  1007  NNWYSFLILYEKTNRRGSFLPST---MQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDY  1177
                    I+Y++   R      T   +Q AN D   S  +  +  K LF+ VIYL PGDY
Sbjct  324   -------IIYKEEGDRSHTKAGTEKVVQVAN-DLAASKVMGSAHEKELFFAVIYLAPGDY  375

Query  1178  HRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGA  1357
             HR HSP +W V LRRHF G L+ V     +T++NL+V NERV L G W+ GF +M  +GA
Sbjct  376   HRYHSPTNWVVTLRRHFIGELYSVAPYFQKTLQNLFVLNERVSLLGYWKHGFFSMTPVGA  435

Query  1358  TNIGSIELFIEPTLRTN----KPQKNKLHLEPPE-------ERVYEPDGT---GIRMKKG  1495
             TN+GSI++  +  L TN     P   +   +P +       E  YE       G  + KG
Sbjct  436   TNVGSIKVNFDKDLATNTKYESPHYKETGGQPVKVKKNTCYEATYEGASKILGGYPVTKG  495

Query  1496  DELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              E+  F +GSTVVLVF+A    P DF+F IK+G++++MG+ LG
Sbjct  496   QEVGGFMLGSTVVLVFEA----PKDFKFDIKQGQKVKMGQPLG  534


 Score = 51.6 bits (122),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSN-leeaalpleeyaslRDFFVRTL  600
            LPL +ISR WG +  ++ P W+R   Y+ +A  F +N  E     L+ Y +L +FF R L
Sbjct  160  LPLNAISRLWGRVNSMDLPEWMREPGYKFYAYCFGANLDEMKVKDLKSYKNLSEFFYREL  219

Query  601  KEGSRPVD--SDPCCLVTG  651
            ++G+RPVD  SD  C   G
Sbjct  220  EDGARPVDNESDLVCPSDG  238



>ref|XP_447977.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG60928.1| unnamed protein product [Candida glabrata]
Length=508

 Score =   165 bits (417),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 114/329 (35%), Positives = 164/329 (50%), Gaps = 36/329 (11%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             +V P DG +L+ G +    G +EQVKG +YS+ + LG  S   +  + +S    S  E  
Sbjct  208   IVCPSDGKVLQIGIINSETGEVEQVKGLTYSIKEFLGTHSH-PLLCKSESTLDLSGHEER  266

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
               +  + + ++VS +SP                     L+A +      VI       F 
Sbjct  267   HQEFARANKFKVSYSSPD--------------------LNATKDEEATDVI------KFE  300

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRI  1186
             N     +  Y   +   +    T    NF  + SS ++      L++ VIYL PGDYH  
Sbjct  301   NEGDKTVDEYNTPSISKTMKLLTEVSPNFPSYTSS-MTGPEETNLYFAVIYLAPGDYHHF  359

Query  1187  HSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNI  1366
             HSP +W   LRRHF G LF V     R   NL+V NERV L G W+ GF +M  +GATN+
Sbjct  360   HSPINWVCRLRRHFPGDLFSVAPYFQRNFPNLFVLNERVALLGYWRHGFFSMTPVGATNV  419

Query  1367  GSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT---GIRMKKGDELAAFNMGSTVVL  1537
             GSI+L  +  L+TN  ++ K+      E VYE       G+ + KG+E+  F +GSTVVL
Sbjct  420   GSIKLNFDEELKTN-AKRRKIKPHTCYEAVYEKASKVLGGLPLTKGEEMGGFMLGSTVVL  478

Query  1538  VFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              F+A    P DF+F IK GE+++MG+ LG
Sbjct  479   CFEA----PKDFQFHIKTGEKVKMGQKLG  503


 Score = 44.3 bits (103),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaal-pleeyaslRDFFVRTL  600
            LPL +ISR WG +     P+WLRP  ++ ++  F  NL+E     LE+YA+L DFF R +
Sbjct  135  LPLNAISRLWGQVNSYTLPIWLRPSGFKFYSYLFGVNLDEMENPNLEDYANLSDFFYRNI  194

Query  601  KEGSRPV  621
            +  +RPV
Sbjct  195  RPETRPV  201



>gb|ESU07229.1| phosphatidylserine decarboxylase proenzyme 1 [Fusarium graminearum 
PH-1]
 gb|EYB34361.1| hypothetical protein FG05_01865 [Fusarium graminearum]
 emb|CEF74066.1| unnamed protein product [Fusarium graminearum]
Length=540

 Score =   158 bits (399),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 116/362 (32%), Positives = 171/362 (47%), Gaps = 77/362 (21%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             LV P DG +L++G+++  GG IEQVKG +YS+  LLG               KN+   +S
Sbjct  218   LVCPSDGKVLQYGQIQ--GGDIEQVKGMTYSIDALLG---------------KNTPP-AS  259

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
              +  +  S    SLAS  V D           LV  +                A+F    
Sbjct  260   VSGTSGTSTPATSLASNDVSD--------EEALVKQD----------------AEFAQVN  295

Query  1007  NNWYSFLILYEKTNRRGSFL--------PSTMQHANFDYFFSSK-----LSCSPMKGLFY  1147
                Y+   L   T +RG  +        P T+   + +     +     +S      L+Y
Sbjct  296   GISYTLPDLLSGTGKRGPSVKDESMPASPGTVSEVSAELALGERPWYDVVSPDKTTALYY  355

Query  1148  CVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQE  1327
              VIYL PGDYHR HSP +W V  RRHF+G L+ V+    RT+  L+  NERVVL GRW+ 
Sbjct  356   AVIYLAPGDYHRFHSPTNWVVDRRRHFAGELYSVSPYLQRTLPGLFTLNERVVLLGRWRW  415

Query  1328  GFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPP-------------EERVYE--  1462
             GF +   +GATN+GSI +  +  LRTN    +                     E  YE  
Sbjct  416   GFFSYVPVGATNVGSIVVNFDKELRTNSLLTDTAADRAAEEAANRGEVYQGFAEATYEAA  475

Query  1463  -PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSD------FRFCIKKGERIRMGEAL  1621
              P   G  +++G+E+  F +GST+VLVF+AP +   +      + + ++KG++++MG+AL
Sbjct  476   SPILRGHALRRGEEMGGFQLGSTIVLVFEAPANKVGENNQHIGWDWAVEKGQQVKMGQAL  535

Query  1622  GR  1627
             GR
Sbjct  536   GR  537


 Score = 51.2 bits (121),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 55/109 (50%), Gaps = 3/109 (3%)
 Frame = +1

Query  328  RRLYDDNKIEGAREKGIELEFHPDV--KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYV  501
             R+  ++  EG R         PD   +   M  LPL++ISR WG    +  P +LR   
Sbjct  111  ERIEMEDGQEGTRTPKKRARIRPDGPWQVQVMSTLPLKAISRLWGRFNELTIPYYLRVPG  170

Query  502  YRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCLV  645
            ++ ++  F  NL+E A P      +L  FF RTLK G+RP+D DP  LV
Sbjct  171  FKLYSWIFGVNLDEVAEPDLHVYPNLASFFYRTLKPGARPLDQDPHTLV  219



>ref|NP_595799.2| phosphatidylserine decarboxylase Psd1 [Schizosaccharomyces pombe 
972h-]
 sp|O14333.4|PSD1_SCHPO RecName: Full=Phosphatidylserine decarboxylase proenzyme 1, mitochondrial; 
Contains: RecName: Full=Phosphatidylserine decarboxylase 
1 beta chain; Contains: RecName: Full=Phosphatidylserine 
decarboxylase 1 alpha chain; Flags: Precursor [Schizosaccharomyces 
pombe 972h-]
 emb|CAB16910.2| phosphatidylserine decarboxylase Psd1 [Schizosaccharomyces pombe]
Length=437

 Score =   159 bits (403),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 121/342 (35%), Positives = 165/342 (48%), Gaps = 77/342 (23%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             +V P DG IL +G ++  GG +EQVKG +YS+  LLG             E+    K S 
Sbjct  152   IVIPADGKILNYGVIE--GGQLEQVKGITYSLDALLG------------DEKLARLKRSH  197

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
                                  P+P   PH     F                  AK  G I
Sbjct  198   AI-------------------PSPDHIPHIRQEEF------------------AKLNG-I  219

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLF---------YCVIY  1159
             +     L+ ++   R      ++ QH   D   S+K++      LF         Y VIY
Sbjct  220   HYSLQDLMGHDHGERPSHVKDASAQH--IDLLSSTKVAAKSQFTLFGSRETNCLYYAVIY  277

Query  1160  LKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMA  1339
             L PGDYHR HSP DW V  RRHFSG LF V+    R + NL++ NERV L GR++ GFM+
Sbjct  278   LAPGDYHRFHSPTDWVVERRRHFSGELFSVSPFMARRLGNLFILNERVALMGRYKYGFMS  337

Query  1340  MAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPP---EERVYEPDGT---GIRMKKGDE  1501
             M  +GATN+GSI +  +  L TN+  K    L P    +E VY    +   G  + +GDE
Sbjct  338   MIPVGATNVGSIRIKFDKDLCTNQFGK----LGPVGTFDEAVYTSSSSILHGHPLLRGDE  393

Query  1502  LAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
             +  F +GSTVVLVF+A    P+DF F +K+G+++R+G  LGR
Sbjct  394   VGNFELGSTVVLVFEA----PADFEFLVKQGQKVRVGLPLGR  431


 Score = 49.7 bits (117),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaa-lpleeyaslRDFFVRTL  600
            LPLR++SR+WG++  +E P+W+R   +  +++ F  NL EA    + +Y +L +FF R L
Sbjct  80   LPLRTLSRWWGYVNRIEIPLWMRVPAFGLYSKIFGCNLTEADPDDVRQYKNLAEFFTRKL  139

Query  601  KEGSRPVDSDPCCLV  645
            K G+R +D D   ++
Sbjct  140  KPGARVIDPDAPIVI  154



>ref|XP_005750631.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like, partial 
[Pundamilia nyererei]
Length=199

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 113/178 (63%), Gaps = 8/178 (4%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   L  SP   LF+ VIYL PGDYH  HSP DW V LRRHF G L  VN    R I+ L
Sbjct  24    FRDYLLSSPDSDLFHVVIYLAPGDYHCFHSPTDWRVELRRHFPGSLMSVNPGVARWIKEL  83

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK----LHLEPPEE  1450
             +  NERVVL G+WQ+GF ++ A+GATN+GSI ++ +  L+TN P+ +K     H    ++
Sbjct  84    FCLNERVVLTGQWQQGFFSLTAVGATNVGSIRIYFDQELQTNTPRYSKGSFHDHSYIADQ  143

Query  1451  RVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              V      G+ ++KG+ +  FN+GST+VL+F+A    P DF F ++ G+RIR+GE LG
Sbjct  144   TVKFAGEGGVALQKGESVGEFNLGSTIVLLFEA----PKDFSFNLQPGQRIRVGEGLG  197



>ref|XP_002996948.1| phosphatidylserine decarboxylase, putative [Phytophthora infestans 
T30-4]
 gb|EEY70292.1| phosphatidylserine decarboxylase, putative [Phytophthora infestans 
T30-4]
Length=355

 Score =   171 bits (434),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 114/175 (65%), Gaps = 8/175 (5%)
 Frame = +2

Query  1100  FFSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRN  1279
             FF+SK S S  K +F+CV+YL PGDYHRIH+P DW V  RRHF G LFPVN+ A R I +
Sbjct  188   FFTSKTSASKGKKMFHCVLYLAPGDYHRIHAPVDWQVEERRHFPGNLFPVNKTAARLIPS  247

Query  1280  LYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVY  1459
             L+VENERV L G W+ GF ++ A+GATN+GSI +  EP  RTN   ++ L        + 
Sbjct  248   LFVENERVALLGEWEHGFFSLTAVGATNVGSIVITKEPEFRTNTALQDPLM----GHCIT  303

Query  1460  EPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
             +  G  +   +G+E+A F +GSTVVLVF+AP S    F+F IK G+++  G   G
Sbjct  304   KNYGGKVDTARGEEMAQFKLGSTVVLVFEAPES----FQFTIKPGDKVSYGSCSG  354



>ref|XP_002996945.1| phosphatidylserine decarboxylase, putative [Phytophthora infestans 
T30-4]
 gb|EEY70289.1| phosphatidylserine decarboxylase, putative [Phytophthora infestans 
T30-4]
Length=314

 Score =   170 bits (431),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 114/175 (65%), Gaps = 8/175 (5%)
 Frame = +2

Query  1100  FFSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRN  1279
             FF++K S S  K +F+CV+YL PGDYHRIH+P DW V  RRHF G LFPVN+ A R I +
Sbjct  95    FFTNKTSASKGKKMFHCVLYLAPGDYHRIHAPVDWQVEERRHFPGNLFPVNKTAARLIPS  154

Query  1280  LYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVY  1459
             L+VENERV L G W+ GF ++ A+GATN+GSI +  EP  RTN   ++ L        + 
Sbjct  155   LFVENERVALLGEWEHGFFSLTAVGATNVGSIVITKEPEFRTNTALQDPLM----GHCIT  210

Query  1460  EPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
             +  G  +   +G+E+A F +GSTVVLVF+AP S    F+F IK G+++  G   G
Sbjct  211   KNYGGKVDTARGEEMAQFKLGSTVVLVFEAPES----FQFTIKPGDKVSYGSCSG  261



>ref|XP_002611852.1| hypothetical protein BRAFLDRAFT_83124 [Branchiostoma floridae]
 gb|EEN67861.1| hypothetical protein BRAFLDRAFT_83124 [Branchiostoma floridae]
Length=330

 Score =   171 bits (432),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 117/179 (65%), Gaps = 4/179 (2%)
 Frame = +2

Query  1139  LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGR  1318
             L++C +YL PGDYHR HSPA+W VL RRHF G LF VN    R I+ L+  NERVV+ GR
Sbjct  144   LYHCTVYLAPGDYHRFHSPAEWEVLHRRHFPGELFSVNPGLVRCIQGLFNYNERVVMSGR  203

Query  1319  WQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRMKKGD  1498
             W +GF +M+A+GATN+GSI ++++  L TN P K K  L        E  GTG+ +KKG+
Sbjct  204   WDQGFFSMSAVGATNVGSIRMYMDSELHTNLPGKWKGGLFYDRVFFNETHGTGVAVKKGE  263

Query  1499  ELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGRWHDS*QPISE*ATTNS  1675
                 FN+GS++V++F+AP +    F F +K G++IR GEALG + ++ Q   E   T +
Sbjct  264   IFGEFNLGSSIVIIFEAPRT----FSFKVKAGQKIRFGEALGCFVETDQTKGEDNVTET  318



>gb|KDN70229.1| putative phosphatidylserine decarboxylase [Colletotrichum sublineola]
Length=509

 Score =   164 bits (414),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 118/360 (33%), Positives = 171/360 (48%), Gaps = 75/360 (21%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             L+SP DG +L++G+++  GG IEQVKG +YS+  LLG  +     A   S  + +EK +S
Sbjct  186   LLSPSDGRVLQYGQIQ--GGDIEQVKGMTYSIDALLGKNTPTPSIASGWSTPQEAEKTNS  243

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
              +                         P  +++   E                A+  G  
Sbjct  244   IS-------------------------PSEDLVKTDEEF--------------ARVNGIS  264

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQH--------ANFDYFFSSK-----LSCSPMKGLFY  1147
                 S L     + R+GS    T +H         + D     K     +S      L+Y
Sbjct  265   YTVPSLLSGAAMSQRKGSLKDETGEHPSASAVSEVSADLALGEKPWYDLISPENKTSLYY  324

Query  1148  CVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQE  1327
              VIYL PGDYHR HSPA+W V  RRHF+G LF V+    RT+  L+  NERVVL GRW+ 
Sbjct  325   AVIYLAPGDYHRFHSPANWVVERRRHFAGELFSVSPYLQRTLPGLFTLNERVVLLGRWRY  384

Query  1328  GFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHL----------EPP---EERVY---  1459
             GF +   +GATN+GSI++  +  LRTN    +              EP     E  Y   
Sbjct  385   GFFSYVPVGATNVGSIKINFDRELRTNSLTTDTAADRAAEEAANRGEPYTGFSEATYASA  444

Query  1460  EPDGTGIRMKKGDELAAFNMGSTVVLVFQAPIS--SPSD---FRFCIKKGERIRMGEALG  1624
              P   G  +++G+E+  F +GST+VLVF+AP     P D   +R+ ++KG+ ++MG+ALG
Sbjct  445   SPVLGGHALRRGEEMGGFQLGSTIVLVFEAPTEGKGPEDKMGWRWAVEKGQTVKMGQALG  504


 Score = 43.9 bits (102),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +1

Query  403  KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalple-eyaslR  579
            +   M  LPL++ISR WG    +  P +LR   ++ ++  F  NL E A P    Y +L 
Sbjct  106  QVQVMSTLPLKAISRLWGRFNELTIPYYLRVPGFKLYSWIFGVNLSEVAEPDLHTYPNLA  165

Query  580  DFFVRTLKEGSRPVDSDPCCLVT  648
             FF R LK G+RP+D  P  L++
Sbjct  166  SFFYRELKPGARPLDPSPNALLS  188



>emb|CDY18315.1| BnaC09g30650D [Brassica napus]
Length=235

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 97/141 (69%), Gaps = 29/141 (21%)
 Frame = +2

Query  1115  LSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVEN  1294
               C+PMKGL+YCVIYL+P DYHRIHSPADWN L+RRHF+GRLFPVNE ATRTI+NLY   
Sbjct  102   FCCTPMKGLYYCVIYLRPVDYHRIHSPADWNALVRRHFAGRLFPVNECATRTIKNLY---  158

Query  1295  ERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT  1474
               VVLEG W++GFMA+   GATNIGSI                        E+VY+P G 
Sbjct  159   --VVLEGIWKQGFMALDVDGATNIGSI------------------------EQVYDPQGH  192

Query  1475  GIRMKKGDELAAFNMGSTVVL  1537
             G++++KG E+  FNMGSTV +
Sbjct  193   GVKLEKGKEVGVFNMGSTVAV  213


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 50/84 (60%), Gaps = 18/84 (21%)
 Frame = +2

Query  650  VSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESSD  829
            VS VDGT+LRFGELKE+ GM EQVKG SYS P             +D+SE++        
Sbjct  34   VSRVDGTVLRFGELKESRGMNEQVKGHSYSAP------------GKDESEKEVV------  75

Query  830  TDANKKSWWRVSLASPKVRDPAPA  901
             D   KSW R+SLASPK+R+   A
Sbjct  76   ADKIDKSWLRISLASPKLRESISA  99



>ref|XP_382041.1| hypothetical protein FG01865.1 [Fusarium graminearum PH-1]
Length=535

 Score =   158 bits (399),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 116/362 (32%), Positives = 171/362 (47%), Gaps = 77/362 (21%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             LV P DG +L++G+++  GG IEQVKG +YS+  LLG               KN+   +S
Sbjct  213   LVCPSDGKVLQYGQIQ--GGDIEQVKGMTYSIDALLG---------------KNTPP-AS  254

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
              +  +  S    SLAS  V D           LV  +                A+F    
Sbjct  255   VSGTSGTSTPATSLASNDVSD--------EEALVKQD----------------AEFAQVN  290

Query  1007  NNWYSFLILYEKTNRRGSFL--------PSTMQHANFDYFFSSK-----LSCSPMKGLFY  1147
                Y+   L   T +RG  +        P T+   + +     +     +S      L+Y
Sbjct  291   GISYTLPDLLSGTGKRGPSVKDESMPASPGTVSEVSAELALGERPWYDVVSPDKTTALYY  350

Query  1148  CVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQE  1327
              VIYL PGDYHR HSP +W V  RRHF+G L+ V+    RT+  L+  NERVVL GRW+ 
Sbjct  351   AVIYLAPGDYHRFHSPTNWVVDRRRHFAGELYSVSPYLQRTLPGLFTLNERVVLLGRWRW  410

Query  1328  GFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPP-------------EERVYE--  1462
             GF +   +GATN+GSI +  +  LRTN    +                     E  YE  
Sbjct  411   GFFSYVPVGATNVGSIVVNFDKELRTNSLLTDTAADRAAEEAANRGEVYQGFAEATYEAA  470

Query  1463  -PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSD------FRFCIKKGERIRMGEAL  1621
              P   G  +++G+E+  F +GST+VLVF+AP +   +      + + ++KG++++MG+AL
Sbjct  471   SPILRGHALRRGEEMGGFQLGSTIVLVFEAPANKVGENNQHIGWDWAVEKGQQVKMGQAL  530

Query  1622  GR  1627
             GR
Sbjct  531   GR  532


 Score = 48.5 bits (114),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 50/112 (45%), Gaps = 14/112 (13%)
 Frame = +1

Query  328  RRLYDDNKIEGAREKGIELEFHPDV--KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYV  501
             R+  ++  EG R         PD   +   M  LPL++ISR WG    +  P +LR   
Sbjct  111  ERIEMEDGQEGTRTPKKRARIRPDGPWQVQVMSTLPLKAISRLWGRFNELTIPYYLR---  167

Query  502  YRAWARAFHSNleeaalple----eyaslRDFFVRTLKEGSRPVDSDPCCLV  645
               W    H+N        E     Y +L  FF RTLK G+RP+D DP  LV
Sbjct  168  ---WQ--IHANELSLDEVAEPDLHVYPNLASFFYRTLKPGARPLDQDPHTLV  214



>gb|EQK97863.1| phosphatidylserine decarboxylase proenzyme 1 [Ophiocordyceps 
sinensis CO18]
Length=538

 Score =   160 bits (404),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 112/358 (31%), Positives = 182/358 (51%), Gaps = 66/358 (18%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG----ATSFLSMTAEDDSE--QKN  808
             L+SP DG +L+FG ++  GG IEQVKG +YS+  LLG    A+S L  ++   S+  Q +
Sbjct  212   LLSPSDGKVLQFGRIE--GGDIEQVKGMTYSIDALLGKNTPASSLLDGSSGQGSDDGQAS  269

Query  809   SEKESSDTDANKKS--WWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI*  982
             + +   D +  K+   + RV+     + D          +L  P +  + +  T E    
Sbjct  270   ARRRRGDEEIVKQEEEFARVNGIPYTLPD----------LLFGPSSARSRKAATDEST--  317

Query  983   *AKFCGFINNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYL  1162
                               E + R  S + + +      ++    LS      L+Y V+YL
Sbjct  318   ------------------EVSQRAVSEVRADLALGEKAWY--DVLSTDKTTALYYAVVYL  357

Query  1163  KPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAM  1342
              PGDYHR HSP +W V  RRHF+G L+ V+    RT+  L+  NERVVL GRW+ GF + 
Sbjct  358   APGDYHRFHSPTNWVVERRRHFAGELYSVSPYLQRTLPGLFTLNERVVLLGRWRHGFFSY  417

Query  1343  AAIGATNIGSIELFIEPTLRTNK--------------PQKNKLHLEPPEERVYEPDGTGI  1480
               +GATN+GSI++  +  LRTN                ++ + HL   E   YE   + +
Sbjct  418   IPVGATNVGSIKINFDRELRTNSLTTDTAADQAAEEAAKRGEPHLAFAEA-TYEGASSVL  476

Query  1481  R---MKKGDELAAFNMGSTVVLVFQAPISSPSD------FRFCIKKGERIRMGEALGR  1627
             R   +++G+E+  F +GST+V+VF+AP     +      +++ +++G++++MG+ALGR
Sbjct  477   RGHALRRGEEMGGFQLGSTIVMVFEAPAEQDREGQARPGWQWSVERGQKVKMGQALGR  534


 Score = 47.0 bits (110),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +1

Query  403  KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaal-pleeyaslR  579
            +   M  LPL++ISR WG    +  P +LR   ++ ++  F  NL+EA+   L  Y +L 
Sbjct  132  QVQVMSTLPLKAISRLWGRFNELTIPYYLRVPGFKLYSLVFGVNLDEASEPDLHVYQNLA  191

Query  580  DFFVRTLKEGSRPVDSDPCCLVT  648
             FF RTLK G RP+D++P  L++
Sbjct  192  AFFYRTLKPGVRPLDANPNALLS  214



>gb|EFQ26098.1| phosphatidylserine decarboxylase [Colletotrichum graminicola 
M1.001]
Length=511

 Score =   165 bits (418),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 123/367 (34%), Positives = 173/367 (47%), Gaps = 87/367 (24%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGA-------TSFLSMTAEDDSEQK  805
             L+SP DG +L++G+++  GG IEQVKG +YS+  LLG        +S  S   E ++E  
Sbjct  186   LLSPSDGRVLQYGQIQ--GGDIEQVKGMTYSIDALLGKNTPTPSISSGWSTPQEVEAENS  243

Query  806   NSEKESSDTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**  985
             NS   S D     + + RV+  S  V                P  LS   +         
Sbjct  244   NSVSPSQDLVKTDEEFARVNGISYTV----------------PSLLSGAAM---------  278

Query  986   AKFCGFINNWYSFLILYEKTNRRGSFLPSTMQHANF--------DYFFSSK-----LSCS  1126
                                + RRGS      +H +         D     K     +S  
Sbjct  279   -------------------SQRRGSLKDEAGEHPSASAVSEVRADLALGEKPWYDLISPD  319

Query  1127  PMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVV  1306
                 L+Y VIYL PGDYHR HSPA+W V  RRHF+G LF V+    RT+  L+  NERVV
Sbjct  320   NKTALYYAVIYLAPGDYHRFHSPANWVVERRRHFAGELFSVSPYLQRTLPGLFTLNERVV  379

Query  1307  LEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHL----------EPP---E  1447
             L GRW+ GF +   +GATN+GSI++  +  LRTN    +              EP     
Sbjct  380   LLGRWRYGFFSYVPVGATNVGSIKINFDRELRTNSLTTDTAADRAAEEAANRGEPYTGFS  439

Query  1448  ERVY---EPDGTGIRMKKGDELAAFNMGSTVVLVFQAPI--SSPSD---FRFCIKKGERI  1603
             E  Y    P   G  +++G+E+  F +GST+VLVF+AP    +P D   +R+ ++KG+ +
Sbjct  440   EATYASASPVLGGHALRRGEEMGGFQLGSTIVLVFEAPTEGKTPEDKKGWRWAVEKGQTV  499

Query  1604  RMGEALG  1624
             RMG+ALG
Sbjct  500   RMGQALG  506


 Score = 41.2 bits (95),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 3/101 (3%)
 Frame = +1

Query  355  EGAREKGIELEFHPDV--KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFH  528
            +GA       +  PD   +   M  LPL++ISR WG    +  P +LR   ++ ++  F 
Sbjct  88   DGAPPPKKRAKIRPDGPWQVQVMSTLPLKAISRLWGRFNELTIPYYLRVPGFKLYSWIFG  147

Query  529  SNleeaalple-eyaslRDFFVRTLKEGSRPVDSDPCCLVT  648
             NL E A P    Y +L  FF R LK G+RP+D +   L++
Sbjct  148  VNLSEVAEPDLHTYPNLASFFYRELKPGARPLDPNSNALLS  188



>ref|XP_006967649.1| hypothetical protein TRIREDRAFT_110040 [Trichoderma reesei QM6a]
 gb|EGR46362.1| hypothetical protein TRIREDRAFT_110040 [Trichoderma reesei QM6a]
 gb|ETR99485.1| phosphatidylserine decarboxylase [Trichoderma reesei RUT C-30]
Length=497

 Score =   159 bits (403),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/366 (33%), Positives = 178/366 (49%), Gaps = 81/366 (22%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG----ATSFLSMTAEDDSEQKNS-  811
             L+ P DG +L++G+++   G IEQVKG +YS+  LLG    A+S  S  ++ +SE++ S 
Sbjct  170   LLCPSDGKVLQYGQIQS--GDIEQVKGMTYSIDALLGKHTPASSIYSGLSDQNSERRRSL  227

Query  812   EKESSDTDANKKS--WWRVS---------LASPKVRDPAPAW*PHSNVLVFPETLSA*QL  958
                +SD +  K+   + RV+         +  PK   PA    P ++  V P +  A   
Sbjct  228   SPPASDEEIIKQEEEFARVNGISYTLPDLMTGPKDAHPAH---PVTDESVTPSSPRAVSE  284

Query  959   LTCEYVI**AKFCGFINNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKG  1138
             +  E  +           WY  L                              S      
Sbjct  285   VRAELAL-------GEKPWYDLL------------------------------SPDKTTA  307

Query  1139  LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGR  1318
             L+Y VIYL PGDYHR HSP +W V  RRHF+G LF V+    RT+  L+  NERVVL GR
Sbjct  308   LYYAVIYLAPGDYHRFHSPTNWVVESRRHFAGELFSVSPYLQRTLPGLFTLNERVVLLGR  367

Query  1319  WQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHL----------EPP---EERVY  1459
             W+ GF +   +GATN+GSI++  +  LRTN    +              EP     E  Y
Sbjct  368   WRWGFFSYVPVGATNVGSIKINFDRELRTNSLTTDTAADLAAEEAAKRGEPYLGFAEATY  427

Query  1460  E---PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPS-------DFRFCIKKGERIRM  1609
             E   P   G  +++G+E+  F +GST+VLVF+AP +  +        + + ++KG++++M
Sbjct  428   EGASPVLHGHALRRGEEMGGFQLGSTIVLVFEAPATVETVDGQVKKGWEWAVQKGQKVKM  487

Query  1610  GEALGR  1627
             G+ALGR
Sbjct  488   GQALGR  493


 Score = 46.6 bits (109),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query  403  KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalple-eyaslR  579
            +   M  LPL++ISR WG    +  P +LR   ++ ++  F  NL+E + P    Y +L 
Sbjct  90   QVQVMSTLPLKAISRLWGKFNELTIPYYLRVPGFKLYSFIFGVNLDEVSEPDLHVYPNLA  149

Query  580  DFFVRTLKEGSRPVDSDPCCLV  645
             FF RTLK G+RP+D DP  L+
Sbjct  150  AFFYRTLKPGARPLDPDPHVLL  171



>gb|ETM50170.1| phosphatidylserine decarboxylase [Phytophthora parasitica]
Length=397

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 117/176 (66%), Gaps = 8/176 (5%)
 Frame = +2

Query  1100  FFSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRN  1279
             FF+   S S  K +F+CV+YL PGDYHRIH+P +W V  RRHF G LFPVN+ A R I +
Sbjct  228   FFTKNPSASKGKKMFHCVLYLAPGDYHRIHAPVNWQVEERRHFPGNLFPVNQTAARLIPS  287

Query  1280  LYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVY  1459
             L+VENERV L G W+ GF ++ A+GATN+GSI +  EP  RTN   ++ L      + + 
Sbjct  288   LFVENERVALLGEWEHGFFSLTAVGATNVGSIVITKEPEFRTNTAAQDPL----VGQCIT  343

Query  1460  EPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
             +  G  +   +G+E+A F +GSTVVLVF+AP S    F+F IK G+++ +G+ +G+
Sbjct  344   KNYGGKVDTTRGEEMAQFKLGSTVVLVFEAPES----FQFTIKPGDKLSLGKCIGK  395


 Score = 58.2 bits (139),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  415  MGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVR  594
            + + P R+ SR WG +   E P+W+R  VY+AW   F+  L+E   PL++YA+L +FF R
Sbjct  110  LKLFPYRAASRLWGEVHDKELPLWMREPVYKAWTAVFNCKLDEMKYPLQDYANLGEFFSR  169

Query  595  TLKEGSRPVDSDPCCLVT  648
             LKEG+RP D+ P  L +
Sbjct  170  PLKEGARPFDTAPGHLAS  187


 Score = 32.0 bits (71),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (62%), Gaps = 2/39 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGM--IEQVKGFSYSVPKLLG  757
            L SPVDGT+   G + ++  +  +EQ+KG  Y + + LG
Sbjct  185  LASPVDGTVASIGVVDDSTNIPTLEQIKGARYRLDEFLG  223



>ref|XP_008400809.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Poecilia reticulata]
Length=379

 Score =   170 bits (431),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 117/181 (65%), Gaps = 14/181 (8%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L  SP + LF+ V+YL PGDYH  HSPADW V LRRHF G L  VN    R ++ L
Sbjct  204   FQDRLLSSPDRALFHVVVYLAPGDYHCFHSPADWRVELRRHFPGSLMSVNPGVARWVKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G+W+ GF ++ A+GATN+GSI ++ +  LRTN P+ +K      ++R Y 
Sbjct  264   FCLNERVVLSGQWRHGFFSLTAVGATNVGSIRVYFDQELRTNAPRYSKGSF---QDRSYV  320

Query  1463  PDGT-------GIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEAL  1621
               G        G+ ++KG+ +  FN+GST+VL+F+A    P+DF F ++ G+RIRMGE L
Sbjct  321   AAGDQVKTGEGGVALRKGEPVGEFNLGSTIVLLFEA----PADFTFDLQPGQRIRMGETL  376

Query  1622  G  1624
             G
Sbjct  377   G  377


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 48/101 (48%), Gaps = 1/101 (1%)
 Frame = +1

Query  337  YDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWA  516
            Y   K  G +++          + +     P R +SR WG L G++ P WLR  VY  + 
Sbjct  57   YQQYKWRGQQDEEAAPHLATPTQVALYRTFPTRLVSRAWGRLNGLDLPTWLRKPVYSLYI  116

Query  517  RAFHSNleeaalple-eyaslRDFFVRTLKEGSRPVDSDPC  636
              F  N++EAA+     Y +L +FF R LK   RPV +  C
Sbjct  117  WTFGVNMQEAAVEDLHHYKNLGEFFRRRLKPAVRPVCAASC  157


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATS  766
            L SP DG IL FG ++ +   +EQVKG +YS+   LG  S
Sbjct  158  LTSPADGRILHFGRVQNS--QVEQVKGVTYSLENFLGPPS  195



>gb|ETI50565.1| phosphatidylserine decarboxylase [Phytophthora parasitica P1569]
 gb|ETL43851.1| phosphatidylserine decarboxylase [Phytophthora parasitica]
 gb|ETL97021.1| phosphatidylserine decarboxylase [Phytophthora parasitica]
 gb|ETP20338.1| phosphatidylserine decarboxylase [Phytophthora parasitica CJ01A1]
Length=397

 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 117/176 (66%), Gaps = 8/176 (5%)
 Frame = +2

Query  1100  FFSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRN  1279
             FF+   S S  K +F+CV+YL PGDYHRIH+P +W V  RRHF G LFPVN+ A R I +
Sbjct  228   FFTKNPSASKGKKMFHCVLYLAPGDYHRIHAPVNWQVEERRHFPGNLFPVNQTAARLIPS  287

Query  1280  LYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVY  1459
             L+VENERV L G W+ GF ++ A+GATN+GSI +  EP  RTN   ++ L      + + 
Sbjct  288   LFVENERVALLGEWEHGFFSLTAVGATNVGSIVITKEPEFRTNTAAQDPL----VGQCIT  343

Query  1460  EPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
             +  G  +   +G+E+A F +GSTVVLVF+AP S    F+F IK G+++ +G+ +G+
Sbjct  344   KNYGGKVDTTRGEEMAQFKLGSTVVLVFEAPES----FQFTIKPGDKLSLGKCIGK  395


 Score = 60.1 bits (144),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +1

Query  415  MGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVR  594
            + + P R+ SR WG +   E P+W+R  VY+AW  AF+  L+E   PL++YA+L +FF R
Sbjct  110  LKLFPYRAASRLWGEVHDKELPLWMREPVYKAWTAAFNCKLDEMKYPLQDYANLGEFFSR  169

Query  595  TLKEGSRPVDSDPCCLVT  648
             LKEG+RP D+ P  L +
Sbjct  170  PLKEGARPFDTAPGHLAS  187


 Score = 32.0 bits (71),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (62%), Gaps = 2/39 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGM--IEQVKGFSYSVPKLLG  757
            L SPVDGT+   G + ++  +  +EQ+KG  Y + + LG
Sbjct  185  LASPVDGTVASIGVVDDSTNIPTLEQIKGARYRLDEFLG  223



>gb|ETK90438.1| phosphatidylserine decarboxylase [Phytophthora parasitica]
Length=397

 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 117/176 (66%), Gaps = 8/176 (5%)
 Frame = +2

Query  1100  FFSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRN  1279
             FF+   S S  K +F+CV+YL PGDYHRIH+P +W V  RRHF G LFPVN+ A R I +
Sbjct  228   FFTKNPSASKGKKMFHCVLYLAPGDYHRIHAPVNWQVEERRHFPGNLFPVNQTAARLIPS  287

Query  1280  LYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVY  1459
             L+VENERV L G W+ GF ++ A+GATN+GSI +  EP  RTN   ++ L      + + 
Sbjct  288   LFVENERVALLGEWEHGFFSLTAVGATNVGSIVITKEPEFRTNTAAQDPL----VGQCIT  343

Query  1460  EPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
             +  G  +   +G+E+A F +GSTVVLVF+AP S    F+F IK G+++ +G+ +G+
Sbjct  344   KNYGGKVDTTRGEEMAQFKLGSTVVLVFEAPES----FQFTIKPGDKLSLGKCIGK  395


 Score = 58.2 bits (139),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  415  MGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVR  594
            + + P R+ SR WG +   E P+W+R  VY+AW   F+  L+E   PL++YA+L +FF R
Sbjct  110  LKLFPYRAASRLWGEVHDKELPLWMREPVYKAWTAVFNCKLDEMKYPLQDYANLGEFFSR  169

Query  595  TLKEGSRPVDSDPCCLVT  648
             LKEG+RP D+ P  L +
Sbjct  170  PLKEGARPFDTAPGHLAS  187


 Score = 31.6 bits (70),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (62%), Gaps = 2/39 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGM--IEQVKGFSYSVPKLLG  757
            L SPVDGT+   G + ++  +  +EQ+KG  Y + + LG
Sbjct  185  LASPVDGTVASIGVVDDSTNIPTLEQIKGARYRLDEFLG  223



>ref|XP_008400810.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Poecilia reticulata]
Length=366

 Score =   170 bits (430),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 117/181 (65%), Gaps = 14/181 (8%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L  SP + LF+ V+YL PGDYH  HSPADW V LRRHF G L  VN    R ++ L
Sbjct  191   FQDRLLSSPDRALFHVVVYLAPGDYHCFHSPADWRVELRRHFPGSLMSVNPGVARWVKEL  250

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G+W+ GF ++ A+GATN+GSI ++ +  LRTN P+ +K      ++R Y 
Sbjct  251   FCLNERVVLSGQWRHGFFSLTAVGATNVGSIRVYFDQELRTNAPRYSKGSF---QDRSYV  307

Query  1463  PDGT-------GIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEAL  1621
               G        G+ ++KG+ +  FN+GST+VL+F+A    P+DF F ++ G+RIRMGE L
Sbjct  308   AAGDQVKTGEGGVALRKGEPVGEFNLGSTIVLLFEA----PADFTFDLQPGQRIRMGETL  363

Query  1622  G  1624
             G
Sbjct  364   G  364


 Score = 40.8 bits (94),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +1

Query  427  PLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalple-eyaslRDFFVRTLK  603
            P R +SR WG L G++ P WLR  VY  +   F  N++EAA+     Y +L +FF R LK
Sbjct  74   PTRLVSRAWGRLNGLDLPTWLRKPVYSLYIWTFGVNMQEAAVEDLHHYKNLGEFFRRRLK  133

Query  604  EGSRPVDSDPC  636
               RPV +  C
Sbjct  134  PAVRPVCAASC  144


 Score = 38.5 bits (88),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATS  766
            L SP DG IL FG ++ +   +EQVKG +YS+   LG  S
Sbjct  145  LTSPADGRILHFGRVQNS--QVEQVKGVTYSLENFLGPPS  182



>ref|XP_007601707.1| phosphatidylserine decarboxylase [Colletotrichum fioriniae PJ7]
 gb|EXF74636.1| phosphatidylserine decarboxylase [Colletotrichum fioriniae PJ7]
Length=509

 Score =   164 bits (415),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 117/360 (33%), Positives = 172/360 (48%), Gaps = 74/360 (21%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             L+SP DG +L++G+++  GG IEQVKG +YS+  LLG  +  S  A   S  + +E + +
Sbjct  185   LLSPSDGRVLQYGQIE--GGDIEQVKGMTYSIDALLGKNTPTSSIASGWSTPQEAEADKA  242

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
             +                          P+ +++   E                A+  G  
Sbjct  243   NIS------------------------PNEDLVKTDEEF--------------ARVNGIS  264

Query  1007  NNWYSFLILYEKTNRRGSF--------LPSTMQHANFDYFFSSK-----LSCSPMKGLFY  1147
                 S L     + R+GS          PS +     D     K     +S      L+Y
Sbjct  265   YTVPSLLSGAAMSVRKGSLKDEAVEPPSPSAVSEVRADLALGEKPWYDLISPDNKTSLYY  324

Query  1148  CVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQE  1327
              VIYL PGDYHR HSPA+W V  RRHF+G L+ V+    RT+  L+  NERVVL GRW+ 
Sbjct  325   AVIYLAPGDYHRFHSPANWVVERRRHFAGELYSVSPYLQRTLPGLFTLNERVVLLGRWRY  384

Query  1328  GFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHL----------EPP---EERVY---  1459
             GF +   +GATN+GSI++  +  LRTN    +              EP     E  Y   
Sbjct  385   GFFSYVPVGATNVGSIKINFDRELRTNSLTTDTAADRAAEEAAARGEPYTGFAEATYASA  444

Query  1460  EPDGTGIRMKKGDELAAFNMGSTVVLVFQAPIS--SPSD---FRFCIKKGERIRMGEALG  1624
              P   G  +++G+E+  F +GST+VLVF+AP    +P D   +R+ ++KG+ +RMG+ALG
Sbjct  445   SPVLGGHALRRGEEMGGFQLGSTIVLVFEAPTEGKTPDDKSGWRWAVEKGQTVRMGQALG  504


 Score = 41.2 bits (95),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +1

Query  403  KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalple-eyaslR  579
            +   M  LPL++ISR WG    +  P +LR   ++ ++  F  NL E A P    Y +L 
Sbjct  105  QVQVMSTLPLKAISRLWGRFNELTIPYYLRVPGFKLYSWIFGVNLNEVAEPDLRTYPNLA  164

Query  580  DFFVRTLKEGSRPVDSDPCCLVT  648
             FF R LK GSRP+  D   L++
Sbjct  165  SFFYRQLKPGSRPLHPDSNALLS  187



>emb|CCK70803.1| hypothetical protein KNAG_0F01350 [Kazachstania naganishii CBS 
8797]
Length=525

 Score =   166 bits (419),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 115/329 (35%), Positives = 161/329 (49%), Gaps = 30/329 (9%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             + SP DG IL+ G +    G IEQVKG +YS+ + LG  S   M   + S   + ++   
Sbjct  212   VASPSDGRILQLGIISSETGEIEQVKGMTYSLKEFLGTHSHPLMAKNESSLSLDGDELKH  271

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
                A K ++      +P   DPA    P +        +   + L               
Sbjct  272   REFAKKNNFRSQDELTPD--DPAEDSPPTNTDHSINFQMEGDKSLK--------------  315

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRI  1186
                 +F     KT +  S L S + + N    F+S  +  P   L++ VIYL PGDYH  
Sbjct  316   ----NFKSGGSKTLKLLSELSSNIPYYNL---FNSISTEPPDSALYFAVIYLSPGDYHHY  368

Query  1187  HSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNI  1366
             HSP DW    RRHF G LF V+    R +RNL+V NERV L G W+ GF +M  +GATN+
Sbjct  369   HSPTDWVCKTRRHFPGDLFSVSPYFQRNLRNLFVLNERVALLGYWKYGFFSMTPVGATNV  428

Query  1367  GSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGT---GIRMKKGDELAAFNMGSTVVL  1537
             GSI+L  +  L TN  +          E  Y        G+ + KG+E+  F +GSTVVL
Sbjct  429   GSIKLTFDKELVTNVKRAKHTAPHTCYEATYSNASKVLGGMPLVKGEEMGGFELGSTVVL  488

Query  1538  VFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              F+A    PS+F+F +K G++I+MGE LG
Sbjct  489   CFEA----PSNFKFDVKIGDKIKMGERLG  513


 Score = 39.7 bits (91),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            LPL ++SR WG    +  P+W RP+ Y+ ++  F   L+E   P   +  +L +FF RT+
Sbjct  139  LPLNAMSRLWGQFNHLALPMWFRPHGYKLYSHMFGVKLDEMQDPDLYHYRNLAEFFYRTI  198

Query  601  KEGSRPV  621
            +  +RP+
Sbjct  199  RPETRPI  205



>ref|XP_008891339.1| phosphatidylserine decarboxylase [Phytophthora parasitica INRA-310]
 gb|ETN22034.1| phosphatidylserine decarboxylase [Phytophthora parasitica INRA-310]
 gb|ETP48270.1| phosphatidylserine decarboxylase [Phytophthora parasitica P10297]
Length=397

 Score =   170 bits (431),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 117/176 (66%), Gaps = 8/176 (5%)
 Frame = +2

Query  1100  FFSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRN  1279
             FF+   S S  K +F+CV+YL PGDYHRIH+P +W V  RRHF G LFPVN+ A R I +
Sbjct  228   FFTKNPSASKGKKMFHCVLYLAPGDYHRIHAPVNWQVEERRHFPGNLFPVNQTAARLIPS  287

Query  1280  LYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVY  1459
             L+VENERV L G W+ GF ++ A+GATN+GSI +  EP  RTN   ++ L      + + 
Sbjct  288   LFVENERVALLGEWEHGFFSLTAVGATNVGSIVITKEPEFRTNTAAQDPL----VGQCIT  343

Query  1460  EPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
             +  G  +   +G+E+A F +GSTVVLVF+AP S    F+F IK G+++ +G+ +G+
Sbjct  344   KNYGGKVDTTRGEEMAQFKLGSTVVLVFEAPES----FQFTIKPGDKLILGKCIGK  395


 Score = 58.2 bits (139),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +1

Query  415  MGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVR  594
            + + P R+ SR WG +   E P+W+R  VY+AW   F+  L+E   PL++YA+L +FF R
Sbjct  110  LKLFPYRAASRLWGEVHDKELPLWMREPVYKAWTAVFNCKLDEMKYPLQDYANLGEFFSR  169

Query  595  TLKEGSRPVDSDPCCLVT  648
             LKEG+RP D+ P  L +
Sbjct  170  PLKEGARPFDTAPGHLAS  187


 Score = 31.6 bits (70),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (62%), Gaps = 2/39 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGM--IEQVKGFSYSVPKLLG  757
            L SPVDGT+   G + ++  +  +EQ+KG  Y + + LG
Sbjct  185  LASPVDGTVASIGVVDDSTNIPTLEQIKGARYRLDEFLG  223



>gb|ETO79304.1| phosphatidylserine decarboxylase [Phytophthora parasitica P1976]
Length=397

 Score =   169 bits (429),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 117/176 (66%), Gaps = 8/176 (5%)
 Frame = +2

Query  1100  FFSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRN  1279
             FF+   S S  K +F+CV+YL PGDYHRIH+P +W V  RRHF G LFPVN+ A R I +
Sbjct  228   FFTKNPSASKGKKMFHCVLYLAPGDYHRIHAPVNWQVEERRHFPGNLFPVNQTAARLIPS  287

Query  1280  LYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVY  1459
             L+VENERV L G W+ GF ++ A+GATN+GSI +  EP  RTN   ++ L      + + 
Sbjct  288   LFVENERVALLGEWEHGFFSLTAVGATNVGSIVITKEPEFRTNTAVQDPL----VGQCIT  343

Query  1460  EPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
             +  G  +   +G+E+A F +GSTVVLVF+AP S    F+F IK G+++ +G+ +G+
Sbjct  344   KNYGGKVDTTRGEEMAQFKLGSTVVLVFEAPES----FQFTIKPGDKLILGKCIGK  395


 Score = 59.7 bits (143),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +1

Query  415  MGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVR  594
            + + P R+ SR WG +   E P+W+R  VY+AW  AF+  L+E   PL++YA+L +FF R
Sbjct  110  LKLFPYRAASRLWGEVHDKELPLWMREPVYKAWTAAFNCKLDEMKYPLQDYANLGEFFSR  169

Query  595  TLKEGSRPVDSDPCCLVT  648
             LKEG+RP D+ P  L +
Sbjct  170  PLKEGARPFDTAPGHLAS  187


 Score = 31.6 bits (70),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (62%), Gaps = 2/39 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGM--IEQVKGFSYSVPKLLG  757
            L SPVDGT+   G + ++  +  +EQ+KG  Y + + LG
Sbjct  185  LASPVDGTVASIGVVDDSTNIPTLEQIKGARYRLDEFLG  223



>ref|XP_010718675.1| PREDICTED: phosphatidylserine decarboxylase proenzyme [Meleagris 
gallopavo]
Length=236

 Score =   165 bits (417),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  66    FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  125

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  126   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  184

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  185   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  234



>ref|XP_001482776.1| hypothetical protein PGUG_04731 [Meyerozyma guilliermondii ATCC 
6260]
Length=607

 Score =   155 bits (392),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 117/379 (31%), Positives = 176/379 (46%), Gaps = 82/379 (22%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             LV+P DG +L+FG +    G IEQVKG +YS+  LLG +S  ++ A   S   + + + +
Sbjct  259   LVAPSDGKVLKFGIIN--NGEIEQVKGMTYSIDALLGMSS-TNLAAPSHSPDFSRDDDDA  315

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
                   + + +++  S  V D           LV  E      +   EY     +  G  
Sbjct  316   TIFQRDEEFAKINGISYSVDD-----------LVGGENDDTYHINKLEY-----RDGGDG  359

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRI  1186
                 S   + ++ +     +PS++ +          L  S  K L++ VIYL PGDYHR 
Sbjct  360   TAMGSKSSVSQEISVAKKLVPSSVDN----------LKASNDKQLYFAVIYLAPGDYHRF  409

Query  1187  HSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNI  1366
             HSP +W   LRRHF G LF V     RT+R L+V NERV L G W+ GF +M  +GATN+
Sbjct  410   HSPTNWVATLRRHFIGELFSVAPFFQRTLRGLFVLNERVALLGYWKYGFFSMIPVGATNV  469

Query  1367  GSIELFIEPTLRTNKPQKNKLHLEPPEER--------------VYEPDGT----------  1474
             GSI +  +  L+TN   +N ++L   +E+              VY  + T          
Sbjct  470   GSIIVNFDKDLKTNDIYENLIYLSSVDEKTPLLHSDEESQVGTVYSEESTQASSSAASTN  529

Query  1475  -------------------------GIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRF  1579
                                      G  + KG E+  F +GSTVVLVF+A    P++F+F
Sbjct  530   KTKPKKLKKNTVYEATYSRASRLLGGYPLVKGQEIGGFKLGSTVVLVFEA----PTNFQF  585

Query  1580  CIKKGERIRMGEALGRWHD  1636
              ++ G+++RMG+ LG   D
Sbjct  586   NLEVGQQVRMGQKLGEILD  604


 Score = 48.9 bits (115),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 2/78 (3%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaal-pleeyaslRDFFVRTL  600
            LPL++ISR WG +  +  PVW+R   Y+ ++  F  NL+E     L  Y +L DFF RTL
Sbjct  188  LPLKAISRLWGKVNLINLPVWMRSPSYKLYSAIFGVNLDEIEEPDLTTYKNLSDFFYRTL  247

Query  601  KEGSRPV-DSDPCCLVTG  651
            + G RP+ D+D      G
Sbjct  248  RPGVRPIADADLVAPSDG  265



>gb|EDK40633.2| hypothetical protein PGUG_04731 [Meyerozyma guilliermondii ATCC 
6260]
Length=607

 Score =   154 bits (388),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 116/379 (31%), Positives = 175/379 (46%), Gaps = 82/379 (22%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             LV+P DG +L+FG +    G IEQVKG +YS+  LLG +S  ++ A   S   + + + +
Sbjct  259   LVAPSDGKVLKFGIIN--NGEIEQVKGMTYSIDALLGMSS-TNLAAPSHSPDFSRDDDDA  315

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
                   + + +++  S  V D           LV  E      +   EY     +  G  
Sbjct  316   TIFQRDEEFAKINGISYSVDD-----------LVGGENDDTYHINKLEY-----RDGGDG  359

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRI  1186
                 S   + ++ +     +PS++ +          L  S  K L++ VIYL PGDYHR 
Sbjct  360   TAMGSKSSVSQEISVAKKLVPSSVDN----------LKASNDKQLYFAVIYLAPGDYHRF  409

Query  1187  HSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNI  1366
             HSP +W   LRRHF G LF V     RT+R L+V NERV L G W+ GF +M  +GATN+
Sbjct  410   HSPTNWVATLRRHFIGELFSVAPFFQRTLRGLFVLNERVALLGYWKYGFFSMIPVGATNV  469

Query  1367  GSIELFIEPTLRTNKPQKNKLHLEPPEER--------------VYEPDGT----------  1474
             GSI +  +  L+TN   +N ++    +E+              VY  + T          
Sbjct  470   GSIIVNFDKDLKTNDIYENSIYSSSVDEKTPLLHSDEESQVGTVYSEESTQASSSAASTN  529

Query  1475  -------------------------GIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRF  1579
                                      G  + KG E+  F +GSTVVLVF+A    P++F+F
Sbjct  530   KTKPKKLKKNTVYEATYSRASRLLGGYPLVKGQEIGGFKLGSTVVLVFEA----PTNFQF  585

Query  1580  CIKKGERIRMGEALGRWHD  1636
              ++ G+++RMG+ LG   D
Sbjct  586   NLEVGQQVRMGQKLGEILD  604


 Score = 50.4 bits (119),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 2/78 (3%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaal-pleeyaslRDFFVRTL  600
            LPL++ISR WG +  +  PVW+R   Y+ ++  F  NL+E     L  Y +L DFF RTL
Sbjct  188  LPLKAISRLWGKVNSINLPVWMRSPSYKLYSAIFGVNLDEIEEPDLTTYKNLSDFFYRTL  247

Query  601  KEGSRPV-DSDPCCLVTG  651
            + G RP+ D+D      G
Sbjct  248  RPGVRPIADADLVAPSDG  265



>ref|XP_003677438.1| hypothetical protein NCAS_0G01980 [Naumovozyma castellii CBS 
4309]
 emb|CCC71085.1| hypothetical protein NCAS_0G01980 [Naumovozyma castellii CBS 
4309]
Length=502

 Score =   158 bits (400),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 109/333 (33%), Positives = 163/333 (49%), Gaps = 47/333 (14%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             +V P DG IL+ G +    G IEQVKG +YS+ + LG  S   M   + +    SE+   
Sbjct  209   IVCPSDGQILQIGIIDSDTGAIEQVKGLTYSIKEFLGTHSDPLMFKSESNLNLRSEEVKH  268

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
                A +  +    + + ++ DP                                ++    
Sbjct  269   KEFAEEHEFNLAQVPTGELEDP--------------------------------RYINIK  296

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKG-LFYCVIYLKPGDYHR  1183
             N     L  ++    +   L S +  +   Y  +S     P+   L++ VIYL PGDYH 
Sbjct  297   NEGDKSLQQFQSGASKTVKLLSELSLSYPSYRMAS---TDPVDTELYFAVIYLAPGDYHH  353

Query  1184  IHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATN  1363
              HSP DW   +RRHF G LF V     R   NL+V NERV L G W+ GF +M  +GATN
Sbjct  354   FHSPIDWVCKVRRHFPGDLFSVAPYFQRNFPNLFVLNERVSLLGYWKHGFFSMTPVGATN  413

Query  1364  IGSIELFIEPTLRTNKPQKNKLHLEPP--EERVYEPDGT---GIRMKKGDELAAFNMGST  1528
             +GSI+L  +  L TN  ++NK H +P    E +YE       G+ + KG+E+  F +GST
Sbjct  414   VGSIKLNFDKELVTN-VKRNK-HKDPHICYEAIYENASKILGGMPLMKGEEMGGFELGST  471

Query  1529  VVLVFQAPISSPSDFRFCIKKGERIRMGEALGR  1627
             VVL F+A    P++F+F +K G++++MG+ LG+
Sbjct  472   VVLCFEA----PTNFKFNLKVGDKVKMGQTLGK  500


 Score = 45.4 bits (106),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = +1

Query  292  VATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGV  471
            VA    L A+H     +D   +  ++      F+ D        LPL +ISR WG +  +
Sbjct  92   VARNEQLDAMHENANENDEINKNKKKYKRIKIFNNDWLFFCYSTLPLNAISRLWGKVNSL  151

Query  472  EFPVWLRPYVYRAWARAFHSNleeaalpl-eeyaslRDFFVRTLKEGSRPVDSDPCCLV  645
              P+WLRP  Y+ ++  F+ NL+E   P    YA+L +FF R +K   RP+      +V
Sbjct  152  TLPLWLRPIGYQFYSYLFNVNLDEMEDPNFAHYANLSEFFYRNIKPEVRPISPGENVIV  210



>gb|KFQ29147.1| Phosphatidylserine decarboxylase proenzyme, partial [Mesitornis 
unicolor]
Length=302

 Score =   166 bits (421),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KGD L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGISMRKGDHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>ref|XP_003704936.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like [Megachile 
rotundata]
Length=356

 Score =   168 bits (425),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 115/185 (62%), Gaps = 11/185 (6%)
 Frame = +2

Query  1067  PSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFP  1246
             P  +   + DY+  S L+ +PM  L+  +IYL PGDYHR HSP DWN+  RRHF G+L  
Sbjct  167   PLKLTKEDDDYYIQSLLT-NPMNQLYQLIIYLAPGDYHRFHSPTDWNIEYRRHFQGKLIS  225

Query  1247  VNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK  1426
             VN +  + + NL+  NERVV  G+W  GFMA  A+GATN+GSI ++ +  LRTN  +   
Sbjct  226   VNPKIVQYLPNLFSLNERVVYIGKWANGFMAYTAVGATNVGSIRVYCDKELRTNAIK---  282

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
                 P  E   E +     +KKG+    F MGST+VL+F+A    P DF+FCI++G+ I+
Sbjct  283   ---WPKAEYWKEANLDWTHLKKGELFGEFRMGSTIVLLFEA----PKDFKFCIQEGQTIK  335

Query  1607  MGEAL  1621
             MG+AL
Sbjct  336   MGQAL  340


 Score = 58.2 bits (139),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLK  603
            LP R++S+ WG++  +E P  LRP +Y  +A+ F++NLEE  L L E+ SL DFFVR LK
Sbjct  52   LPFRTLSKLWGWIASIELPTSLRPILYEFYAKTFNANLEEIDLELSEFPSLVDFFVRPLK  111

Query  604  EGSRPVDS  627
              +RP+D 
Sbjct  112  YDARPIDQ  119


 Score = 37.7 bits (86),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 31/56 (55%), Gaps = 8/56 (14%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLS------MTAEDDS  796
            +VSP DG +L FG +      ++QVKG +Y++   LG  + L+      +T EDD 
Sbjct  123  IVSPADGKVLHFGPVTSC--CVQQVKGVTYNLRHFLGDINVLNSNHPLKLTKEDDD  176



>gb|EGW00415.1| Phosphatidylserine decarboxylase proenzyme [Cricetulus griseus]
Length=235

 Score =   164 bits (415),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F ++L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  65    FRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  124

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  125   FCHNERVVLSGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DLSFVTH  183

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  184   ANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFRLKAGQKIRFGEALG  233



>gb|KFZ59708.1| Phosphatidylserine decarboxylase proenzyme, partial [Caprimulgus 
carolinensis]
Length=302

 Score =   166 bits (420),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  LRTN P+ +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLRTNSPRYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGILMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 42.7 bits (99),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRRPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>gb|KFP44632.1| Phosphatidylserine decarboxylase proenzyme, partial [Chlamydotis 
macqueenii]
Length=302

 Score =   166 bits (420),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       LF+CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELFHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  192   FCHNERVVLRGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGISMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.9 bits (89),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>ref|XP_002611862.1| hypothetical protein BRAFLDRAFT_83114 [Branchiostoma floridae]
 gb|EEN67871.1| hypothetical protein BRAFLDRAFT_83114 [Branchiostoma floridae]
Length=522

 Score =   171 bits (433),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 110/162 (68%), Gaps = 4/162 (2%)
 Frame = +2

Query  1139  LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGR  1318
             L++C +YL PGDYHR HSPA+W VL RRHF G LF VN    R I+ L+  NERVV+ GR
Sbjct  335   LYHCTVYLAPGDYHRFHSPAEWEVLHRRHFPGELFSVNPGLVRCIQGLFNYNERVVMSGR  394

Query  1319  WQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRMKKGD  1498
             W +GF +M+A+GATN+GSI ++++  L TN P K K  L        E  GTG+ +KKG+
Sbjct  395   WDQGFFSMSAVGATNVGSIRMYMDSELHTNLPGKWKGGLFYDRVFFNETQGTGVAVKKGE  454

Query  1499  ELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
                 FN+GS++V++F+AP +    F F +K G++IR GEALG
Sbjct  455   IFGEFNLGSSIVIIFEAPRT----FSFKVKAGQKIRFGEALG  492


 Score = 45.8 bits (107),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 5/59 (8%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATS---FLSMTAEDDSEQKNSE  814
            LVSP DGT+L FG+++    M+EQVKG +YS+   LG T+   +LS    ++S+  + E
Sbjct  264  LVSPADGTVLHFGKVEH--NMLEQVKGVTYSLQTFLGRTNNNWWLSKQTLNNSKPADDE  320


 Score = 38.5 bits (88),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 37/70 (53%), Gaps = 1/70 (1%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSN-leeaalpleeyaslRDFFVRTL  600
            LPLR +SR WG +   + PVW+R  + R +   F  N  E A   L  Y++L +FF R L
Sbjct  192  LPLRLLSRLWGHIHKAQLPVWMRGPLLRLYIWLFDCNLQEAAIEDLSYYSNLNEFFRRQL  251

Query  601  KEGSRPVDSD  630
            K   R +D  
Sbjct  252  KPSVRTIDQQ  261



>emb|CCE32678.1| related to phosphatidylserine decarboxylase [Claviceps purpurea 
20.1]
Length=546

 Score =   162 bits (410),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 117/360 (33%), Positives = 171/360 (48%), Gaps = 64/360 (18%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG------ATSFLSMTAEDDSEQKN  808
             L+SP DG +L++G ++  GG IEQVKG +YSV  LLG      + S       D  E + 
Sbjct  214   LISPSDGKVLQYGRIE--GGDIEQVKGMTYSVDALLGQNTPTASISSAQNAPSDYQEHQG  271

Query  809   SEKESSDTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**A  988
             +  +  D    ++ + RV+  S                   P+ LS  Q    + V   A
Sbjct  272   AALQGQDIVQQEEEFARVNGIS----------------YTLPDLLSGGQADDEKQVQDQA  315

Query  989   KFCGFINNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKP  1168
                             E + R  + + + +      ++    LS      L+Y VIYL P
Sbjct  316   PDAS-----------TEVSQRAVTEVRAELALGEKPWY--DMLSSDRSTSLYYAVIYLAP  362

Query  1169  GDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAA  1348
             GDYHR HSP +W V  RRHF G LF V+    RT+  L+  NERVVL GRW+ GF +   
Sbjct  363   GDYHRFHSPTNWVVERRRHFPGELFSVSPYLQRTLPGLFTLNERVVLLGRWRYGFFSYVP  422

Query  1349  IGATNIGSIELFIEPTLRTNKPQKNKLHLEPPE-------------ERVYE---PDGTGI  1480
             +GATN+GSI++  +  LRTN    +    +  E             E  YE   P   G 
Sbjct  423   VGATNVGSIKINFDRELRTNSLLTDTAADQAAEEATQRGEQYLGFAEATYENASPVLRGH  482

Query  1481  RMKKGDELAAFNMGSTVVLVFQAPI-----------SSPSDFRFCIKKGERIRMGEALGR  1627
              +++G+E+  F +GST+VLVF+AP             S + + + ++KG+RI+MG+ALGR
Sbjct  483   ALRRGEEMGGFQLGSTIVLVFEAPTEKTGLTQDKTKQSSTGWHWTVQKGQRIQMGQALGR  542


 Score = 41.2 bits (95),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +1

Query  403  KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaal-pleeyaslR  579
            +   M  LPL+++SR WG    +  P +LR   ++ ++  F  NL+E +   L  Y +L 
Sbjct  134  QVQVMSTLPLKALSRLWGKFNELTIPYYLRVPGFKLYSFIFGVNLDEVSEPDLHTYPNLA  193

Query  580  DFFVRTLKEGSRPVDSDPCCLVT  648
             FF RTLK G+R VD D   L++
Sbjct  194  AFFYRTLKPGARTVDPDSRVLIS  216



>ref|XP_004084615.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like [Oryzias 
latipes]
Length=385

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 117/195 (60%), Gaps = 16/195 (8%)
 Frame = +2

Query  1067  PSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFP  1246
             P +M+  +    F   L  SP   LF+ V+YL PGDYH  HSPADW V LRRHF G L  
Sbjct  196   PQSMEQLDSSSSFRDVLLSSPDSDLFHVVVYLAPGDYHCFHSPADWKVELRRHFPGSLMS  255

Query  1247  VNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK  1426
             VN    R ++ L+  NERVVL G+WQ GF ++ A+GATN+GSI L+ +  L+TN P+  K
Sbjct  256   VNPGVARWVKELFCLNERVVLSGQWQHGFFSLTAVGATNVGSIRLYFDQELQTNAPRYRK  315

Query  1427  LHLEPPEERVYEPDGT---------GIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRF  1579
                    +R Y   G          G+ ++KG+ +  FN+GST+VL+F+A    P DF F
Sbjct  316   GSF---YDRSYVATGNQVLQRTSEGGVALQKGEAIGEFNLGSTIVLLFEA----PKDFVF  368

Query  1580  CIKKGERIRMGEALG  1624
              ++ G+RIR+GE LG
Sbjct  369   KLQPGQRIRVGEGLG  383


 Score = 40.4 bits (93),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (54%), Gaps = 4/63 (6%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            L SP DG IL FG +K +   +EQVKG +YS+   LG  S   +  +  S  ++    S 
Sbjct  161  LTSPADGKILHFGRVKNS--EVEQVKGVTYSLEHFLGPQSMEQL--DSSSSFRDVLLSSP  216

Query  827  DTD  835
            D+D
Sbjct  217  DSD  219


 Score = 34.3 bits (77),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 1/66 (2%)
 Frame = +1

Query  427  PLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLK  603
            P R +SR WG L  +  P WLR  +Y  +   F  N++EAA+    +  +L +FF R LK
Sbjct  90   PTRFLSRAWGRLNEMNLPTWLRKPIYSLYIWTFGVNMQEAAVEDLHHYRNLGEFFRRRLK  149

Query  604  EGSRPV  621
               RPV
Sbjct  150  PAVRPV  155



>gb|ERE87874.1| phosphatidylserine decarboxylase proenzyme isoform 1 [Cricetulus 
griseus]
Length=259

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F ++L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  89    FRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  148

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  149   FCHNERVVLSGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYNDL-SFVTH  207

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  208   ANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFRLKAGQKIRFGEALG  257



>ref|XP_006905001.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Pteropus alecto]
 ref|XP_006905002.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X3 [Pteropus alecto]
Length=340

 Score =   166 bits (419),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 111/186 (60%), Gaps = 14/186 (8%)
 Frame = +2

Query  1094  DYFFSSKLSCSPMKG---------LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFP  1246
             D  FS   SCS  K          L++CVIYL PGDYH  HSP DW V  RRHF G L  
Sbjct  158   DLPFSPDTSCSSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMS  217

Query  1247  VNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK  1426
             VN    R I+ L+  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K
Sbjct  218   VNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPEYSK  277

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
                      V   +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR
Sbjct  278   GSYN-DFSFVTHANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFDFKLKAGQKIR  332

Query  1607  MGEALG  1624
              GEALG
Sbjct  333   FGEALG  338


 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  35   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRGPVYSLYIWTFGVNMKEAAVEDLHHYR  94

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  95   NLSEFFRRKLKPQARPV  111


 Score = 38.1 bits (87),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  117  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  151



>ref|XP_009537413.1| hypothetical protein PHYSODRAFT_529613, partial [Phytophthora 
sojae]
 gb|EGZ06649.1| hypothetical protein PHYSODRAFT_529613 [Phytophthora sojae]
Length=271

 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 109/168 (65%), Gaps = 8/168 (5%)
 Frame = +2

Query  1100  FFSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRN  1279
             FF+ K + S  K +F+CV+YL PGDYHRIH+P DW V  RRHF G LFPVN+ A   I +
Sbjct  95    FFTKKTAASKGKKMFHCVLYLAPGDYHRIHAPVDWKVEERRHFPGNLFPVNQTAAHLIPS  154

Query  1280  LYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVY  1459
             L+VENERV L G W+ GF ++ A+GATN+GSI L  EP  RTN   ++ L        + 
Sbjct  155   LFVENERVALLGEWEHGFFSLTAVGATNVGSIVLTKEPEFRTNTVAQDPL----VGRCIS  210

Query  1460  EPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERI  1603
             +  G  +    G+E+A F +GSTVVLVF+AP S    F+F IK G+++
Sbjct  211   KNYGGKVDTTHGEEMAQFKLGSTVVLVFEAPES----FQFTIKPGDKV  254



>ref|XP_009789652.1| PREDICTED: phosphatidylserine decarboxylase proenzyme 1, mitochondrial-like 
[Nicotiana sylvestris]
Length=152

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 109/149 (73%), Gaps = 8/149 (5%)
 Frame = +1

Query  109  MKFRATHRVPLFTRCTRFSHLSQRRLHFTS-FLRKIQssearassnggssshgksF----  273
            MKFRA  R+P F    R +HL  +R +FTS F RK+Q++EARAS N G SS   S     
Sbjct  1    MKFRAPQRIPCFGYNGRLNHLHAQRYYFTSTFFRKVQATEARASLNSGGSSSSNSSSQGS  60

Query  274  --FLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISR  447
               LPGATVATIVMLG LHARRLYDD K+E AREKG  LEF PD KA+FM +LPLRSISR
Sbjct  61   NLLLPGATVATIVMLGLLHARRLYDDQKVEEAREKGT-LEFRPDAKATFMRLLPLRSISR  119

Query  448  FWGFLTGVEFPVWLRPYVYRAWARAFHSN  534
            FWG LT VE P+WLRPY Y+ WARAFHS+
Sbjct  120  FWGTLTSVELPMWLRPYAYKGWARAFHSS  148



>gb|KFZ67201.1| Phosphatidylserine decarboxylase proenzyme, partial [Podiceps 
cristatus]
Length=302

 Score =   164 bits (416),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>gb|KFA64705.1| hypothetical protein S40285_05269 [Stachybotrys chlorohalonata 
IBT 40285]
Length=539

 Score =   159 bits (401),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 173/365 (47%), Gaps = 81/365 (22%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATS-------FLSMTAEDDSEQK  805
             L+SP DG +L+FG+++  GG IEQVKG +YSV  LLG ++         S+    D++Q 
Sbjct  214   LLSPADGKVLQFGQIE--GGDIEQVKGMTYSVDALLGKSTPPPSISEASSVFTPGDAQQV  271

Query  806   NSE-KESSDTDANKKSWWRVS--------LASPKVRDPAPAW*PHSNVLVFPETLSA*QL  958
             + E  E  D    ++ + +V+        L S   R   PA        V  E+    Q 
Sbjct  272   HGELSEGEDLVKQEEEFAKVNGIAYTLPDLLSGSSRAKKPA--------VKDESTEVSQS  323

Query  959   LTCEYVI**AKFCGFINNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKG  1138
                E     A        WY  L                              S +    
Sbjct  324   AVSEVR---ADLALGERPWYDIL------------------------------SENKATA  350

Query  1139  LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGR  1318
             L+Y VIYL PGDYHR HSP +W V  RRHF+G L+ V+    RT+  L+  NERVVL GR
Sbjct  351   LYYAVIYLAPGDYHRFHSPTNWVVERRRHFAGELYSVSPYLQRTLPGLFTLNERVVLLGR  410

Query  1319  WQEGFMAMAAIGATNIGSIELFIEPTLRTNK--------------PQKNKLHLEPPEERV  1456
             W+ GF +   +GATN+GSI++  +  LRTN                Q+ + +L   E   
Sbjct  411   WRWGFFSYIPVGATNVGSIKINFDRELRTNSLTTDTAADRAAEEAAQRGEPYLGFVEATY  470

Query  1457  YEPDGT--GIRMKKGDELAAFNMGSTVVLVFQAPISSPSD------FRFCIKKGERIRMG  1612
                     G  +++GDE+  F +GST+VLVF+AP +   +      +++ ++KG++I+MG
Sbjct  471   AGSSAVLQGHALRRGDEMGGFQLGSTIVLVFEAPATQTGEDNGKKGWQWAVEKGQKIKMG  530

Query  1613  EALGR  1627
             +A+GR
Sbjct  531   QAIGR  535


 Score = 42.7 bits (99),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 41/81 (51%), Gaps = 3/81 (4%)
 Frame = +1

Query  415  MGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRD---F  585
            M  LPL+++SR WG    +  P +LR   ++ ++  F  N     +   +     +   F
Sbjct  136  MSTLPLKAMSRLWGKFNELTIPYYLRVPGFKLYSFIFGVNRSLDEVSEPDLHVYPNLAAF  195

Query  586  FVRTLKEGSRPVDSDPCCLVT  648
            F RTLK G+RP+D D   L++
Sbjct  196  FYRTLKPGARPLDPDSHALLS  216



>ref|XP_008170258.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Chrysemys picta bellii]
Length=303

 Score =   164 bits (416),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 112/186 (60%), Gaps = 14/186 (8%)
 Frame = +2

Query  1094  DYFFSSKLSCSPMKG---------LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFP  1246
             D  FS   SCS ++          L++CVIYL PGDYH  HSP DW V  RRHF G L  
Sbjct  121   DMQFSQTSSCSSLQNQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMS  180

Query  1247  VNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK  1426
             VN    R I+ L+  NERVVL G W+ GF ++ A+GATN+GSI ++ +  LRTN P  +K
Sbjct  181   VNPGVARWIKELFCHNERVVLSGDWKHGFFSLTAVGATNVGSIRIYFDGDLRTNSPCYSK  240

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
                      +   +  GI M+KG+ L  FN+GST+VL+F+A    P +F F +K G++IR
Sbjct  241   GSYN-DFSFITNNNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKNFSFHLKPGQKIR  295

Query  1607  MGEALG  1624
              GEALG
Sbjct  296   FGEALG  301



>gb|EAW59990.1| phosphatidylserine decarboxylase, isoform CRA_d [Homo sapiens]
Length=250

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F ++L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  80    FKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  139

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  140   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYN-DFSFVTH  198

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  G+ M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  199   TNREGVPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFQLKTGQKIRFGEALG  248



>ref|XP_005612476.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X8 [Equus caballus]
Length=303

 Score =   164 bits (415),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  133   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  192

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  193   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRYSKGSYN-DFSFVTH  251

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  252   ANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFKLKAGQKIRFGEALG  301


 Score = 38.5 bits (88),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  80   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  114


 Score = 38.1 bits (87),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  8    VPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  67

Query  601  KEGSRPV  621
            K  +RPV
Sbjct  68   KPQARPV  74



>gb|KFO85108.1| Phosphatidylserine decarboxylase proenzyme, partial [Buceros 
rhinoceros silvestris]
Length=302

 Score =   164 bits (415),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.9 bits (89),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>ref|XP_009810684.1| PREDICTED: phosphatidylserine decarboxylase proenzyme, partial 
[Gavia stellata]
 gb|KFV53785.1| Phosphatidylserine decarboxylase proenzyme, partial [Gavia stellata]
Length=302

 Score =   164 bits (415),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>ref|XP_008324402.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Cynoglossus semilaevis]
Length=395

 Score =   167 bits (422),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 113/186 (61%), Gaps = 16/186 (9%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   L  SP   LF+ V+YL PGDYH  HSP DW V LRRHF G L  VN    R ++ L
Sbjct  212   FKDLLLSSPENDLFHVVVYLAPGDYHCFHSPTDWKVALRRHFPGSLMSVNPGVARWVKEL  271

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK------------  1426
             +  NERVVL G+WQ GF ++ A+GATN+GSI ++ +  L TN P+ +K            
Sbjct  272   FCLNERVVLTGQWQHGFFSLTAVGATNVGSIRVYFDQELHTNVPRYSKGSFHDRSYVAET  331

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
             ++L  P+  V   D  G+ + KG+ L  FN+GST+VL+F+A    P DF+F +  G+RIR
Sbjct  332   INLSKPDGGVVCLDKEGVALHKGELLGEFNLGSTIVLLFEA----PKDFKFNLLPGQRIR  387

Query  1607  MGEALG  1624
             +GE LG
Sbjct  388   VGEGLG  393


 Score = 42.4 bits (98),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 6/99 (6%)
 Frame = +1

Query  364  REKGIELEFHPDVKASFMGM-----LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFH  528
            R+KG++ +  P   AS   +      P+R ISR WG +  VE P WLR  +Y  +   F 
Sbjct  59   RKKGLQEDGAPPSPASPTQVALYRSFPMRFISRTWGRINEVELPTWLRKPLYSLYIWTFG  118

Query  529  SNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
             N++EAA+    +  +L +FF R LK   RP+ +  C +
Sbjct  119  VNMQEAAVEDLHHYRNLGEFFRRRLKPAVRPLCAASCVI  157


 Score = 40.8 bits (94),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLS  775
            ++SP DG IL FG++K +   +EQVKG +YS+   LG    LS
Sbjct  156  VISPADGRILHFGQVKNS--EVEQVKGITYSLETFLGPQQHLS  196



>ref|XP_005458406.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like isoform 
X2 [Oreochromis niloticus]
Length=371

 Score =   166 bits (420),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 114/181 (63%), Gaps = 14/181 (8%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   +  SP   LF+ VIYL PGDYH  HSP DW V LRRHF G L  VN    R I+ L
Sbjct  196   FRDDILSSPDSDLFHVVIYLAPGDYHCFHSPTDWRVELRRHFPGSLMSVNPGVARWIKEL  255

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G+WQ+GF ++ A+GATN+GSI ++ +  L+TN P+ +K       +R Y 
Sbjct  256   FCLNERVVLTGQWQQGFFSLTAVGATNVGSIRIYFDQELQTNTPRYSKGSF---HDRSYI  312

Query  1463  PDGT-------GIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEAL  1621
              D T       G+ ++KG+ +  FN+GST+VL+F+A    P DF F ++ G+RIR+GE L
Sbjct  313   ADQTVNFAGEGGVTLQKGEAVGEFNLGSTIVLLFEA----PKDFSFNLQPGQRIRVGEGL  368

Query  1622  G  1624
             G
Sbjct  369   G  369


 Score = 41.6 bits (96),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +1

Query  427  PLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalple-eyaslRDFFVRTLK  603
            P R +SR WG L GVE P WLR  +Y  +   F  N++EAA+     Y +L +FF R LK
Sbjct  76   PTRLLSRAWGRLNGVELPTWLRKPIYSLYIWTFGVNMQEAAVEDLHHYRNLGEFFRRRLK  135

Query  604  EGSRPVDSDPC  636
               RP+ +  C
Sbjct  136  PAVRPLCAASC  146


 Score = 38.5 bits (88),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            L SP DG IL FG +K +   +EQVKG +YS+   LG
Sbjct  147  LTSPADGRILHFGRVKNS--EVEQVKGVTYSLENFLG  181



>gb|KFQ56775.1| Phosphatidylserine decarboxylase proenzyme, partial [Nestor notabilis]
Length=302

 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 41.6 bits (96),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K   RPV    CC+
Sbjct  67   KPQVRPV----CCV  76


 Score = 38.5 bits (88),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>ref|XP_008324404.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X3 [Cynoglossus semilaevis]
Length=380

 Score =   166 bits (421),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 113/186 (61%), Gaps = 16/186 (9%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   L  SP   LF+ V+YL PGDYH  HSP DW V LRRHF G L  VN    R ++ L
Sbjct  197   FKDLLLSSPENDLFHVVVYLAPGDYHCFHSPTDWKVALRRHFPGSLMSVNPGVARWVKEL  256

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK------------  1426
             +  NERVVL G+WQ GF ++ A+GATN+GSI ++ +  L TN P+ +K            
Sbjct  257   FCLNERVVLTGQWQHGFFSLTAVGATNVGSIRVYFDQELHTNVPRYSKGSFHDRSYVAET  316

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
             ++L  P+  V   D  G+ + KG+ L  FN+GST+VL+F+A    P DF+F +  G+RIR
Sbjct  317   INLSKPDGGVVCLDKEGVALHKGELLGEFNLGSTIVLLFEA----PKDFKFNLLPGQRIR  372

Query  1607  MGEALG  1624
             +GE LG
Sbjct  373   VGEGLG  378


 Score = 40.8 bits (94),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLS  775
            ++SP DG IL FG++K +   +EQVKG +YS+   LG    LS
Sbjct  141  VISPADGRILHFGQVKNS--EVEQVKGITYSLETFLGPQQHLS  181


 Score = 39.7 bits (91),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +1

Query  427  PLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLK  603
            P+R ISR WG +  VE P WLR  +Y  +   F  N++EAA+    +  +L +FF R LK
Sbjct  70   PMRFISRTWGRINEVELPTWLRKPLYSLYIWTFGVNMQEAAVEDLHHYRNLGEFFRRRLK  129

Query  604  EGSRPVDSDPCCL  642
               RP+ +  C +
Sbjct  130  PAVRPLCAASCVI  142



>ref|XP_004934423.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X9 [Gallus gallus]
Length=303

 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  133   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  192

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  193   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  251

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  252   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  301


 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  8    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  67

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CC+
Sbjct  68   KPQARPV----CCV  77


 Score = 38.5 bits (88),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  80   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  114



>gb|KFO13184.1| Phosphatidylserine decarboxylase proenzyme, partial [Balearica 
regulorum gibbericeps]
Length=302

 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKQGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>gb|KFQ21053.1| Phosphatidylserine decarboxylase proenzyme, partial [Merops nubicus]
Length=302

 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>ref|XP_009300123.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Danio rerio]
Length=362

 Score =   166 bits (419),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 106/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   L       LF+CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  192   FQDALVTKEGNELFHCVIYLAPGDYHCFHSPTDWRVAHRRHFPGALMSVNPGVARWIKEL  251

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W  GF ++ A+GATN+GSI ++ +  LRTN P+ NK         V  
Sbjct  252   FCHNERVVLSGEWTHGFFSLTAVGATNVGSIRIYFDKELRTNNPRYNKGTYN-DFSYVTN  310

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F ++ G++IR GEALG
Sbjct  311   NNQEGISMRKGEHLGEFNLGSTIVLLFEA----PRDFTFNLQAGQKIRFGEALG  360


 Score = 42.4 bits (98),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +   ++ + P  + +    +P R +SR WG L  V+ P WLR  +Y  +   F  N+
Sbjct  44   GALKPLAKVGWRPTSRVTIYKTIPTRLLSRAWGRLNRVDLPNWLRKPIYNLYIWTFGVNM  103

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+   ++  +L +FF R LK   RPV    C +
Sbjct  104  KEAAVEDLQHYRNLGEFFRRKLKPQVRPVCDSHCVI  139


 Score = 40.8 bits (94),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (55%), Gaps = 6/64 (9%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            ++SP DG IL FG +K     +EQVKG +YS+   LG  ++    +E  +  +N +   +
Sbjct  138  VISPADGKILHFGRVKNC--EVEQVKGVTYSLETFLGPRTW----SESLTANRNEDDPGT  191

Query  827  DTDA  838
              DA
Sbjct  192  FQDA  195



>ref|XP_008324405.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X4 [Cynoglossus semilaevis]
Length=378

 Score =   166 bits (420),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 113/186 (61%), Gaps = 16/186 (9%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   L  SP   LF+ V+YL PGDYH  HSP DW V LRRHF G L  VN    R ++ L
Sbjct  195   FKDLLLSSPENDLFHVVVYLAPGDYHCFHSPTDWKVALRRHFPGSLMSVNPGVARWVKEL  254

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK------------  1426
             +  NERVVL G+WQ GF ++ A+GATN+GSI ++ +  L TN P+ +K            
Sbjct  255   FCLNERVVLTGQWQHGFFSLTAVGATNVGSIRVYFDQELHTNVPRYSKGSFHDRSYVAET  314

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
             ++L  P+  V   D  G+ + KG+ L  FN+GST+VL+F+A    P DF+F +  G+RIR
Sbjct  315   INLSKPDGGVVCLDKEGVALHKGELLGEFNLGSTIVLLFEA----PKDFKFNLLPGQRIR  370

Query  1607  MGEALG  1624
             +GE LG
Sbjct  371   VGEGLG  376


 Score = 41.2 bits (95),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLS  775
            ++SP DG IL FG++K +   +EQVKG +YS+   LG    LS
Sbjct  139  VISPADGRILHFGQVKNS--EVEQVKGITYSLETFLGPQQHLS  179


 Score = 40.0 bits (92),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +1

Query  427  PLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLK  603
            P+R ISR WG +  VE P WLR  +Y  +   F  N++EAA+    +  +L +FF R LK
Sbjct  68   PMRFISRTWGRINEVELPTWLRKPLYSLYIWTFGVNMQEAAVEDLHHYRNLGEFFRRRLK  127

Query  604  EGSRPVDSDPCCL  642
               RP+ +  C +
Sbjct  128  PAVRPLCAASCVI  140



>ref|XP_004178447.1| hypothetical protein TBLA_0B00850 [Tetrapisispora blattae CBS 
6284]
 emb|CCH58928.1| hypothetical protein TBLA_0B00850 [Tetrapisispora blattae CBS 
6284]
Length=492

 Score =   160 bits (406),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 115/331 (35%), Positives = 165/331 (50%), Gaps = 46/331 (14%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             +VSP DGT+++FG++    G IEQVKG +YS+ + LG+     +T+   S+       S 
Sbjct  197   IVSPSDGTVIQFGKIDSETGEIEQVKGMTYSIKEFLGSHDNPYLTSSPSSDDFKGHDAS-  255

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
               D+N+ S  + S    K  D       + N     ETL++      +  I  +K    I
Sbjct  256   -LDSNELSDGKKSFTGGKEFDH------NINFSYEGETLNS------DIEIPISKTFTII  302

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRI  1186
              +    ++ YE  NR                    +L+      LFY VIYL PGDYH  
Sbjct  303   KD---LVLNYELPNR--------------------QLAEPSKTELFYAVIYLSPGDYHHY  339

Query  1187  HSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNI  1366
             HSP +W   LRRHF G L+ V+         L+V NERV L G+W  GF +M  +GATN+
Sbjct  340   HSPVNWVCNLRRHFPGELYSVSPFFQERFPKLFVLNERVALLGQWNYGFFSMTPVGATNV  399

Query  1367  GSIELFIEPTLRTNKPQKN--KLHLEPPEERVYEPDGT---GIRMKKGDELAAFNMGSTV  1531
             GSI L  +  L TN  Q +  K+ L    E  Y    T   GI + KG+E+  F +GSTV
Sbjct  400   GSITLNFDKGLTTNIKQYSGGKVPLHTCYESTYRNASTLLKGIPLLKGEEIGGFKLGSTV  459

Query  1532  VLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
             VL F+A    PS F+F ++  ++++MGE +G
Sbjct  460   VLCFEA----PSAFKFQLQINQKVKMGELIG  486


 Score = 40.0 bits (92),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +1

Query  412  FMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaal-pleeyaslRDFF  588
            +   LPL  +SR WG +  +  PV +R   ++ ++  F+ NL+E     L+ Y++L +FF
Sbjct  120  YYSTLPLNFVSRLWGKVNSLTLPVSIRSSCFQFYSSLFNVNLDEMEDPELKNYSNLGEFF  179

Query  589  VRTLKEGSRPVDSDPCCLVT  648
             R LK GSR +D     +V+
Sbjct  180  YRNLKPGSRQIDHRDNVIVS  199



>emb|CEG65911.1| Putative Phosphatidylserine decarboxylase [Rhizopus microsporus]
Length=466

 Score =   168 bits (425),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 117/179 (65%), Gaps = 9/179 (5%)
 Frame = +2

Query  1109  SKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYV  1288
             S ++  P   L++CVIYL PGDYHR HSP +W V  RRHF+G LF V+    + ++NL+V
Sbjct  293   SGMTLKPNHALYFCVIYLAPGDYHRFHSPTNWVVETRRHFAGELFSVSPYFVKLLQNLFV  352

Query  1289  ENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPD  1468
              NERV L G+W+ GF +M  +GATN+GSI++  +  L+TN+  K  L L    E  Y+  
Sbjct  353   LNERVALLGKWKHGFFSMIPVGATNVGSIKINFDEALQTNR--KEDLPLGTYTEVTYKSA  410

Query  1469  GT---GIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGRWHD  1636
                  G  ++ GDE+  F +GSTVVLVF+AP S    F+FCI  G++++MGEALG++ +
Sbjct  411   SKLLGGKPLRYGDEMGGFYLGSTVVLVFEAPTS----FKFCITSGQKVKMGEALGKYEE  465


 Score = 45.8 bits (107),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaal-pleeyaslRDFFVRTL  600
            LPLRS+SR WG    +  P  LRP  ++ ++  F  NLEE     L +Y +L  FF R L
Sbjct  104  LPLRSMSRLWGAFNSLTIPTPLRPAGFKLYSWIFGCNLEEMKNPNLYDYPNLSTFFYREL  163

Query  601  KEGSRPVDSD  630
            KEG+RP+  D
Sbjct  164  KEGARPIADD  173


 Score = 39.3 bits (90),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            LVSP DG +L FG ++  G  IEQ+KG +Y++  LLG
Sbjct  176  LVSPADGKVLHFGIVQ--GKHIEQIKGVTYNLDALLG  210



>ref|XP_010192663.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Mesitornis unicolor]
Length=374

 Score =   166 bits (419),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KGD L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  323   NNKEGISMRKGDHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  372


 Score = 45.1 bits (105),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  57   GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNM  116

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  117  KEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  148


 Score = 38.1 bits (87),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>gb|KFW09431.1| Phosphatidylserine decarboxylase proenzyme, partial [Eurypyga 
helias]
Length=302

 Score =   164 bits (414),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  192   FCHNERVVLTGGWEHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGISMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CC+
Sbjct  67   KPQARPV----CCV  76


 Score = 38.9 bits (89),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQIKNC--EVEQVKGVTYSLESFLG  113



>ref|XP_002611397.1| hypothetical protein BRAFLDRAFT_166706 [Branchiostoma floridae]
 gb|EEN67407.1| hypothetical protein BRAFLDRAFT_166706 [Branchiostoma floridae]
Length=291

 Score =   163 bits (413),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 109/165 (66%), Gaps = 4/165 (2%)
 Frame = +2

Query  1130  MKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVL  1309
             +  LF+  IYL PGDYHR HSPADW VL RRHF G L  VN      + N++  NERVVL
Sbjct  131   VNSLFHITIYLAPGDYHRFHSPADWEVLHRRHFPGALATVNPWILSCVHNVFNLNERVVL  190

Query  1310  EGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEPDGTGIRMK  1489
              GRW EGF +M+ +GATN+GSI+++ +  L TN P +N ++ +  +    +  G G+ + 
Sbjct  191   SGRWSEGFFSMSPVGATNVGSIKVYFDTALYTNNPAENHVNGDFFDHIFLDHLGRGVELN  250

Query  1490  KGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
             KGD+   FN+GST+VLVF+AP S    F F +  G++IR+G+++G
Sbjct  251   KGDQYGEFNIGSTIVLVFEAPKS----FVFNVHHGQKIRVGQSVG  291


 Score = 44.3 bits (103),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +1

Query  412  FMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpl-eeyaslRDFF  588
            F   LP R +SR WG L  +  PVWLR  + R +   F +NL+EA +    +Y  ++DFF
Sbjct  3    FYFFLPWRELSRLWGALQSLVLPVWLRGPLVRFYCWLFGANLKEALVSDPSQYTCIQDFF  62

Query  589  VRTLKEGSRPVD  624
             R LK  +RP+D
Sbjct  63   TRKLKLNARPLD  74


 Score = 38.5 bits (88),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            +VSP DGT++ FG +  +   +EQVKG +YS+ + LG
Sbjct  79   IVSPADGTVVHFGRVTNS--QLEQVKGVTYSLERFLG  113



>ref|XP_006782282.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like isoform 
X2 [Neolamprologus brichardi]
Length=373

 Score =   166 bits (419),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 113/178 (63%), Gaps = 8/178 (4%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   L  SP   LF+ VIYL PGDYH  HSP DW V LRRHF G L  VN    R I+ L
Sbjct  198   FRENLLSSPDSDLFHVVIYLAPGDYHCFHSPTDWRVELRRHFPGSLMSVNPGVARWIKEL  257

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK----LHLEPPEE  1450
             +  NERVVL G+WQ+GF ++ A+GATN+GSI ++ +  L+TN P+ +K     H    ++
Sbjct  258   FCLNERVVLTGQWQQGFFSLTAVGATNVGSIRIYFDQELQTNTPRYSKGSFHDHSYIADQ  317

Query  1451  RVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              V      G+ ++KG+ +  FN+GST+VL+F+A    P DF F ++ G+RIR+GE LG
Sbjct  318   TVKFAGEGGVALQKGESVGEFNLGSTIVLLFEA----PKDFSFNLQPGQRIRVGEGLG  371


 Score = 43.5 bits (101),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 47/101 (47%), Gaps = 1/101 (1%)
 Frame = +1

Query  337  YDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWA  516
            Y   +  G  E G         + +     P R +SR WG L GVE P WLR  +Y  + 
Sbjct  48   YKQYQKWGQGEDGAPPPVATPTQVALYRSFPTRLLSRAWGRLNGVELPTWLRKPIYSLYI  107

Query  517  RAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPC  636
              F  N++EAA+    +  +L +FF R LK   RP+ +  C
Sbjct  108  WTFGVNMQEAAVEDLHHYRNLGEFFRRRLKPAVRPLCASSC  148


 Score = 37.7 bits (86),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            L SP DG IL FG +K +   +EQVKG +YS+   LG
Sbjct  149  LTSPADGRILHFGRVKNS--EVEQVKGVTYSLEHFLG  183



>ref|XP_003688556.1| hypothetical protein TPHA_0O01550 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE66122.1| hypothetical protein TPHA_0O01550 [Tetrapisispora phaffii CBS 
4417]
Length=450

 Score =   167 bits (423),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 112/334 (34%), Positives = 159/334 (48%), Gaps = 58/334 (17%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             + SP DGTIL FG +    G IEQVKG +YS+ + LG      MT           K  S
Sbjct  164   ITSPSDGTILNFGTIDPETGEIEQVKGLTYSIREFLGTHEHPLMT-----------KSES  212

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
               D  K+ W +    S             SN+L+     SA                   
Sbjct  213   HLDLLKQKWKQSQENSTH---------SFSNLLINEGDKSA-------------------  244

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFS-SKLSCSPMKGLFYCVIYLKPGDYHR  1183
                    ++YE  N +   L S +   +    ++ + +  +    L++ VIYL PGDYH 
Sbjct  245   -------LVYETNNSKIQKLLSELTAMDTPSVYNHNNIQINHKNQLYFTVIYLGPGDYHH  297

Query  1184  IHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATN  1363
              HSP +W   +RRHF G+LF V     R  ++L+V NERV L G W+ GF +M A+GATN
Sbjct  298   FHSPINWVCKIRRHFPGKLFSVAPYFQRHFKSLFVLNERVPLLGYWKYGFFSMTAVGATN  357

Query  1364  IGSIELFIEPTLRTNKPQKNKLHLEPPEERVYEP-------DGTGIRMKKGDELAAFNMG  1522
             +GSI+L  +  LRTN  Q      +  +   YE           G+ + KG+E+  F  G
Sbjct  358   VGSIKLNFDKDLRTNVKQPKSKECKHNKNSCYEAVYVNTNEKLKGVPLLKGEEMGGFKFG  417

Query  1523  STVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
             STVVL F+AP     DF++ IK G++I++GE +G
Sbjct  418   STVVLCFEAPF----DFKYNIKCGQKIKLGEKIG  447



>ref|XP_010167823.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Caprimulgus carolinensis]
Length=374

 Score =   166 bits (419),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  LRTN P+ +K         +  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLRTNSPRYSKGSYN-DFSFISN  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  323   NNKEGILMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  372


 Score = 44.3 bits (103),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  57   GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRRPVYSLYIWTFGVNM  116

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  117  KEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  148


 Score = 38.5 bits (88),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>ref|XP_006905000.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Pteropus alecto]
 gb|ELK18695.1| Phosphatidylserine decarboxylase proenzyme [Pteropus alecto]
Length=374

 Score =   165 bits (418),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 111/186 (60%), Gaps = 14/186 (8%)
 Frame = +2

Query  1094  DYFFSSKLSCSPMKG---------LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFP  1246
             D  FS   SCS  K          L++CVIYL PGDYH  HSP DW V  RRHF G L  
Sbjct  192   DLPFSPDTSCSSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMS  251

Query  1247  VNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK  1426
             VN    R I+ L+  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K
Sbjct  252   VNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPEYSK  311

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
                      V   +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR
Sbjct  312   GSYN-DFSFVTHANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFDFKLKAGQKIR  366

Query  1607  MGEALG  1624
              GEALG
Sbjct  367   FGEALG  372


 Score = 39.3 bits (90),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  69   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRGPVYSLYIWTFGVNMKEAAVEDLHHYR  128

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  129  NLSEFFRRKLKPQARPV  145


 Score = 38.1 bits (87),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>gb|ACF22770.1| phosphatidylserine decarboxylase, partial [Brachypodium distachyon]
Length=225

 Score =   119 bits (298),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 88/126 (70%), Gaps = 22/126 (17%)
 Frame = +1

Query  271  FFLPGATVATIVMLGALHARRLYDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRF  450
            F LPGA+ A ++MLG LHA+R+YDD K+   +EKGIE EF PD+K               
Sbjct  41   FLLPGASAAALLMLGVLHAKRMYDDKKLVERKEKGIEPEFSPDLK---------------  85

Query  451  WGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVRTLKEGSRPVDSD  630
                   E PV++RP +Y+AWARAFHSNL+E+ALPLEEY SL+ FF+R+LKEGSRP+D D
Sbjct  86   -------EVPVFMRPVIYKAWARAFHSNLQESALPLEEYPSLQAFFIRSLKEGSRPIDPD  138

Query  631  PCCLVT  648
            P CLV+
Sbjct  139  PNCLVS  144


 Score = 81.3 bits (199),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
            LVSPVDG +LR G+L+  G MIEQVKGFSY V  LLGA+S L  T E D  ++ +E+  S
Sbjct  142  LVSPVDGKVLRLGQLRGPGTMIEQVKGFSYPVSSLLGASSSLHDTTEKDFSEEQTEENVS  201

Query  827  DTDANKKSWWRVSLASPKVRD  889
            +  +N KSWWRVS+ASPK+RD
Sbjct  202  E-GSNAKSWWRVSVASPKLRD  221



>ref|XP_009300122.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Danio rerio]
Length=379

 Score =   166 bits (419),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 106/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   L       LF+CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  209   FQDALVTKEGNELFHCVIYLAPGDYHCFHSPTDWRVAHRRHFPGALMSVNPGVARWIKEL  268

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W  GF ++ A+GATN+GSI ++ +  LRTN P+ NK         V  
Sbjct  269   FCHNERVVLSGEWTHGFFSLTAVGATNVGSIRIYFDKELRTNNPRYNKGTYN-DFSYVTN  327

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F ++ G++IR GEALG
Sbjct  328   NNQEGISMRKGEHLGEFNLGSTIVLLFEA----PRDFTFNLQAGQKIRFGEALG  377


 Score = 42.4 bits (98),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +   ++ + P  + +    +P R +SR WG L  V+ P WLR  +Y  +   F  N+
Sbjct  61   GALKPLAKVGWRPTSRVTIYKTIPTRLLSRAWGRLNRVDLPNWLRKPIYNLYIWTFGVNM  120

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+   ++  +L +FF R LK   RPV    C +
Sbjct  121  KEAAVEDLQHYRNLGEFFRRKLKPQVRPVCDSHCVI  156


 Score = 40.8 bits (94),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 6/53 (11%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFL-SMTA---EDD  793
            ++SP DG IL FG +K     +EQVKG +YS+   LG  ++  S+TA   EDD
Sbjct  155  VISPADGKILHFGRVKNC--EVEQVKGVTYSLETFLGPRTWSESLTANRNEDD  205



>gb|KGL74589.1| Phosphatidylserine decarboxylase proenzyme, partial [Tinamus 
guttatus]
Length=362

 Score =   165 bits (417),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  192   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  251

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  252   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  310

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  311   NNKDGISMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  360


 Score = 51.6 bits (122),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 59/112 (53%), Gaps = 3/112 (3%)
 Frame = +1

Query  301  IVMLGALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVE  474
            +   G     R Y+D K+E   ++GIE+  +   + + +    +P R +SR WG L  VE
Sbjct  24   VATGGGYAGYRKYEDYKLEELEKRGIEVPVKLASEWEVALYKSVPTRLLSRAWGRLNQVE  83

Query  475  FPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDS  627
             P WLR  VY  +   F  N++EAA+    +  +L +FF R LK  +RPV S
Sbjct  84   LPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPVCS  135


 Score = 38.5 bits (88),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  139  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  173



>ref|XP_005815031.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like [Xiphophorus 
maculatus]
Length=495

 Score =   168 bits (425),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 117/179 (65%), Gaps = 10/179 (6%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L  SP + LF+ V+YL PGDYH  HSPADW V LRRHF G L  VN    R ++ L
Sbjct  320   FQDRLLSSPDRALFHVVVYLAPGDYHCFHSPADWRVELRRHFPGSLMSVNPGVARWVKEL  379

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLE-----PPE  1447
             +  NERVVL G+W+ GF ++ A+GATN+GSI ++ +  LRTN P+ +K   +        
Sbjct  380   FCLNERVVLSGQWRHGFFSLTAVGATNVGSIRVYFDQELRTNAPRYSKGSFQDRSYVATS  439

Query  1448  ERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
             ++V   +G G+ + KG+ +  FN+GST+VL+F+A    P+DF F ++ G+RIRMGE LG
Sbjct  440   DQVKASEG-GVALCKGEPVGEFNLGSTIVLLFEA----PADFTFDLQPGQRIRMGEPLG  493


 Score = 39.7 bits (91),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +1

Query  427  PLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalple-eyaslRDFFVRTLK  603
            P R +SR WG L G++ P WLR  +Y  +   F  N++EAA+     Y +L +FF R LK
Sbjct  203  PTRFMSRAWGRLNGLDLPTWLRKPIYSLYIWTFGVNMQEAAVEDLHHYKNLGEFFRRRLK  262

Query  604  EGSRPVDSDPC  636
               RPV +  C
Sbjct  263  PAVRPVCAASC  273


 Score = 39.3 bits (90),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATS  766
            L SP DG IL FG+++ +   +EQVKG +YS+   LG  S
Sbjct  274  LTSPADGRILHFGQVQNS--QVEQVKGVTYSLENFLGPPS  311



>gb|KFV92215.1| Phosphatidylserine decarboxylase proenzyme, partial [Fulmarus 
glacialis]
Length=303

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  133   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  192

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  193   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFISN  251

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  252   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  301


 Score = 40.4 bits (93),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  8    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  67

Query  601  KEGSRPV  621
            K  +RPV
Sbjct  68   KPQARPV  74


 Score = 38.5 bits (88),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  80   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  114



>gb|KFQ57578.1| Phosphatidylserine decarboxylase proenzyme, partial [Pelecanus 
crispus]
Length=302

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 42.4 bits (98),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K   RPV    CCL
Sbjct  67   KPQVRPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>gb|KFP54178.1| Phosphatidylserine decarboxylase proenzyme, partial [Cathartes 
aura]
Length=302

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>gb|KFW73940.1| Phosphatidylserine decarboxylase proenzyme, partial [Phalacrocorax 
carbo]
Length=303

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  133   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  192

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  193   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFISN  251

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  252   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  301


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  8    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  67

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  68   KPQARPV----CCL  77


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  80   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  114



>gb|KFQ88013.1| Phosphatidylserine decarboxylase proenzyme, partial [Phoenicopterus 
ruber ruber]
Length=302

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++I  GEALG
Sbjct  251   NNKEGISMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIHFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.9 bits (89),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>gb|KGK39684.1| hypothetical protein JL09_g1210 [Pichia kudriavzevii]
Length=481

 Score =   162 bits (411),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 165/341 (48%), Gaps = 58/341 (17%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             LVSP DG +L+FG +  A G I+QVKGFSY++  LLG          D + QK +  +S 
Sbjct  189   LVSPSDGKVLKFGNV-NADGTIDQVKGFSYNLKALLG----------DSTSQKVAHSQSI  237

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
             D +   K    V     +          +++ +  P+  SA                   
Sbjct  238   DFNHQDKDHDEVYQLEQEFLSHLEN---NTHKVSTPQPQSA-------------------  275

Query  1007  NNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPM---KGLFYCVIYLKPGDY  1177
                   LI +     R    P+T +  N      +  + +P      LFY VIYL PGDY
Sbjct  276   ---QRSLITFSHEGERSILHPTTREILN------ATTALTPSGEETDLFYTVIYLAPGDY  326

Query  1178  HRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGA  1357
             HR HSP  W   +RRHF G L+ V      T+ NL+V NERV L G W+ GF +M  +GA
Sbjct  327   HRFHSPVTWVSTIRRHFVGELYSVAPYFQNTLNNLFVLNERVALLGYWKHGFFSMTPVGA  386

Query  1358  TNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE-------PDGTGIRMKKGDELAAFN  1516
             TN+GSI+L  +  L TN   +N    +  +   YE       P   G  + KG+E+  F 
Sbjct  387   TNVGSIKLNFDKDLVTNTRHQNGKRSK--KNTCYEAHYNNASPTLKGQPLFKGEEVGGFR  444

Query  1517  MGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALGRWHDS  1639
             +GSTVVLVF+A    P +F+F +++G+ ++MG+ +G   +S
Sbjct  445   LGSTVVLVFEA----PKNFKFNLQEGQIVKMGQKIGDVENS  481


 Score = 37.4 bits (85),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaal-pleeyaslRDFFVRTL  600
            LPL +ISR WG    +  P  LR   ++ ++  F+  L+E     LE Y +L DFF R +
Sbjct  117  LPLNTISRLWGSFNNITLPKGLREPTFKFYSYLFNVKLDEMLDPNLENYKNLGDFFYREI  176

Query  601  KEGSRPVD  624
            K   RP+D
Sbjct  177  KPSCRPID  184



>gb|KFV19714.1| Phosphatidylserine decarboxylase proenzyme, partial [Tauraco 
erythrolophus]
Length=302

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 42.4 bits (98),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CC+
Sbjct  67   KPQARPV----CCV  76


 Score = 37.4 bits (85),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG+++     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVENC--EVEQVKGVTYSLESFLG  113



>ref|XP_010124270.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Chlamydotis macqueenii]
Length=374

 Score =   165 bits (418),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       LF+CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FQQQLVTKEGNELFHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  264   FCHNERVVLRGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  323   NNKEGISMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  372


 Score = 45.1 bits (105),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  57   GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNM  116

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  117  KEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  148


 Score = 38.5 bits (88),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>gb|KFV52855.1| Phosphatidylserine decarboxylase proenzyme, partial [Tyto alba]
Length=303

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  133   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  192

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  193   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFISN  251

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  252   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  301


 Score = 44.3 bits (103),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  8    VPTRPLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  67

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  68   KPQARPV----CCL  77


 Score = 38.9 bits (89),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  80   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  114



>ref|XP_005458405.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like isoform 
X1 [Oreochromis niloticus]
Length=428

 Score =   166 bits (421),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 114/181 (63%), Gaps = 14/181 (8%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   +  SP   LF+ VIYL PGDYH  HSP DW V LRRHF G L  VN    R I+ L
Sbjct  253   FRDDILSSPDSDLFHVVIYLAPGDYHCFHSPTDWRVELRRHFPGSLMSVNPGVARWIKEL  312

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G+WQ+GF ++ A+GATN+GSI ++ +  L+TN P+ +K       +R Y 
Sbjct  313   FCLNERVVLTGQWQQGFFSLTAVGATNVGSIRIYFDQELQTNTPRYSKGSF---HDRSYI  369

Query  1463  PDGT-------GIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEAL  1621
              D T       G+ ++KG+ +  FN+GST+VL+F+A    P DF F ++ G+RIR+GE L
Sbjct  370   ADQTVNFAGEGGVTLQKGEAVGEFNLGSTIVLLFEA----PKDFSFNLQPGQRIRVGEGL  425

Query  1622  G  1624
             G
Sbjct  426   G  426


 Score = 44.3 bits (103),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 48/101 (48%), Gaps = 1/101 (1%)
 Frame = +1

Query  337  YDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWA  516
            Y   +  G +E G         + +     P R +SR WG L GVE P WLR  +Y  + 
Sbjct  103  YKQYQKWGQQEDGAPPPVATPTQVALYRSFPTRLLSRAWGRLNGVELPTWLRKPIYSLYI  162

Query  517  RAFHSNleeaalple-eyaslRDFFVRTLKEGSRPVDSDPC  636
              F  N++EAA+     Y +L +FF R LK   RP+ +  C
Sbjct  163  WTFGVNMQEAAVEDLHHYRNLGEFFRRRLKPAVRPLCAASC  203


 Score = 38.1 bits (87),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            L SP DG IL FG +K +   +EQVKG +YS+   LG
Sbjct  204  LTSPADGRILHFGRVKNS--EVEQVKGVTYSLENFLG  238



>ref|XP_006894871.1| PREDICTED: phosphatidylserine decarboxylase proenzyme [Elephantulus 
edwardii]
Length=413

 Score =   166 bits (420),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  243   FRSRLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  302

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN PQ +K         V  
Sbjct  303   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRELHTNSPQYSKGSYN-DLSFVTR  361

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  362   ANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFQLKAGQKIRFGEALG  411


 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 6/48 (13%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAED  790
            ++SP DG IL FG++K     +EQVKG +YS+   LG  +    +AED
Sbjct  193  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLGPRT----SAED  234


 Score = 38.5 bits (88),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  111  PVSRVTLYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  170

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  171  NLSEFFRRKLKPQARPV  187



>ref|XP_005869845.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X4 [Myotis brandtii]
Length=340

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  170   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  229

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V +
Sbjct  230   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFVTQ  288

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  289   ANREGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFDFKLKAGQKIRFGEALG  338


 Score = 40.0 bits (92),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  35   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  94

Query  571  slRDFFVRTLKEGSRPVDSDPCCL  642
            +L +FF R LK  +RPV    C +
Sbjct  95   NLSEFFRRKLKPQARPVCGLHCVI  118


 Score = 38.5 bits (88),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K +   +EQVKG +YS+   LG
Sbjct  117  VISPSDGKILNFGQVKNS--EVEQVKGVTYSLESFLG  151



>gb|KFP69151.1| Phosphatidylserine decarboxylase proenzyme, partial [Cariama 
cristata]
Length=302

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>ref|NP_001072442.1| phosphatidylserine decarboxylase proenzyme [Xenopus (Silurana) 
tropicalis]
 gb|AAI21695.1| hypothetical protein MGC147577 [Xenopus (Silurana) tropicalis]
Length=413

 Score =   166 bits (420),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 110/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DWNV  RRHF G L  VN    R I+ L
Sbjct  243   FQDQLVTQEGNELYHCVIYLAPGDYHCFHSPTDWNVYHRRHFPGSLMSVNPGVARWIKEL  302

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI+++ +  L+TN P+ +K         V  
Sbjct  303   FCYNERVVLTGGWKHGFFSLTAVGATNVGSIQIYFDRGLQTNSPRYSKGSYN-DLSYVTN  361

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KGD+L  FN+GST+VL+F+A    P DF F +K G++I  GEA+G
Sbjct  362   NNQDGIVMRKGDQLGEFNLGSTIVLIFEA----PKDFNFNLKPGQKIHFGEAVG  411


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +1

Query  376  IELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalp  555
            + + + P  + +    +P R +SR WG L  VE P WLR  VY+ +   F  N++EAA+ 
Sbjct  107  VRVGWRPTSRVAIYKSVPTRLLSRAWGRLNQVELPTWLRKPVYQLYIWTFGVNMKEAAVE  166

Query  556  leeya-slRDFFVRTLKEGSRPV  621
                  +L +FF R LK  +RPV
Sbjct  167  DLHQYRNLSEFFRRKLKPQARPV  189


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (54%), Gaps = 2/52 (4%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQ  802
            ++SP DG IL FG +K     +EQVKG +YS+   LG  ++        S Q
Sbjct  195  VISPSDGKILHFGRVKNC--EVEQVKGVTYSLESFLGPQTWTENQLHKTSFQ  244



>gb|KFP98015.1| Phosphatidylserine decarboxylase proenzyme, partial [Haliaeetus 
albicilla]
Length=302

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>ref|XP_006105607.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X4 [Myotis lucifugus]
 ref|XP_006105608.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X5 [Myotis lucifugus]
 ref|XP_006105609.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X6 [Myotis lucifugus]
Length=340

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  170   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  229

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V +
Sbjct  230   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFVTQ  288

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  289   ANREGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFDFKLKAGQKIRFGEALG  338


 Score = 40.0 bits (92),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  35   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  94

Query  571  slRDFFVRTLKEGSRPVDSDPCCL  642
            +L +FF R LK  +RPV    C +
Sbjct  95   NLSEFFRRKLKPQARPVCGVHCVI  118


 Score = 38.5 bits (88),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K +   +EQVKG +YS+   LG
Sbjct  117  VISPSDGKILNFGQVKNS--EVEQVKGVTYSLESFLG  151



>gb|KFO57891.1| Phosphatidylserine decarboxylase proenzyme, partial [Corvus brachyrhynchos]
Length=361

 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 6/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  192   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGVARWIKEL  251

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K      +     
Sbjct  252   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN--DFSFIS  309

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  310   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFNLKAGQKIRFGEALG  359


 Score = 51.6 bits (122),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 7/117 (6%)
 Frame = +1

Query  301  IVMLGALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVE  474
            +   G     R Y+D K+E   ++GIE+  +   + + +    +P R +SR WG L  VE
Sbjct  24   VATGGGYAGYRKYEDYKLEQLEKRGIEVPVKLASEWEVALYKSVPTRLLSRAWGRLNQVE  83

Query  475  FPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
             P WLR  VY  +   F  N++EAA+    +  +L +FF R LK   RPV    CC+
Sbjct  84   LPRWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQVRPV----CCV  136


 Score = 38.5 bits (88),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  139  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  173



>gb|KFV02595.1| Phosphatidylserine decarboxylase proenzyme, partial [Pterocles 
gutturalis]
Length=302

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFQLKAGQKIRFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>ref|NP_001073170.1| phosphatidylserine decarboxylase proenzyme [Danio rerio]
 gb|AAI28796.1| Zgc:158135 [Danio rerio]
Length=426

 Score =   166 bits (420),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 106/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   L       LF+CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  256   FQDALVTKEGNELFHCVIYLAPGDYHCFHSPTDWRVAHRRHFPGALMSVNPGVARWIKEL  315

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W  GF ++ A+GATN+GSI ++ +  LRTN P+ NK         V  
Sbjct  316   FCHNERVVLSGEWTHGFFSLTAVGATNVGSIRIYFDKELRTNNPRYNKGTYN-DFSYVTN  374

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F ++ G++IR GEALG
Sbjct  375   NNQEGISMRKGEHLGEFNLGSTIVLLFEA----PRDFTFNLQAGQKIRFGEALG  424


 Score = 42.0 bits (97),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +   ++ + P  + +    +P R +SR WG L  V+ P WLR  +Y  +   F  N+
Sbjct  108  GALKPLAKVGWRPTSRVTIYKTIPTRLLSRAWGRLNRVDLPNWLRKPIYNLYIWTFGVNM  167

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+   ++  +L +FF R LK   RPV    C +
Sbjct  168  KEAAVEDLQHYRNLGEFFRRKLKPQVRPVCDSHCVI  203


 Score = 40.8 bits (94),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 6/53 (11%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFL-SMTA---EDD  793
            ++SP DG IL FG +K     +EQVKG +YS+   LG  ++  S+TA   EDD
Sbjct  202  VISPADGKILHFGRVKNC--EVEQVKGVTYSLETFLGPRTWSESLTANRNEDD  252



>gb|KFQ15196.1| Phosphatidylserine decarboxylase proenzyme, partial [Leptosomus 
discolor]
Length=302

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>gb|KFP92700.1| Phosphatidylserine decarboxylase proenzyme, partial [Apaloderma 
vittatum]
Length=302

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>gb|ENH82841.1| phosphatidylserine decarboxylase proenzyme [Colletotrichum orbiculare 
MAFF 240422]
Length=501

 Score =   159 bits (402),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 119/359 (33%), Positives = 170/359 (47%), Gaps = 70/359 (19%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             L+SP DG +L+FG+++  GG IEQVKG +YS+  LLG  +  +  A   S  +  E E++
Sbjct  175   LLSPSDGRVLQFGQIE--GGDIEQVKGMTYSIDALLGKNTPTASIASGWSTPQ--EVEAA  230

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
                 N  S                     S  LV  +          E+    A+  G  
Sbjct  231   KASENDIS--------------------SSEALVKTDE---------EF----ARVNGIS  257

Query  1007  NNWYSFLILYEKTNRRGSF--------LPSTMQHANFDYFFSSK----LSCSPMKGLFYC  1150
                 S L     + + GS          PS +     D     K    +       L+Y 
Sbjct  258   YTVPSLLSGAAMSTKSGSLKDEAVEPPSPSAVSEVRADLALGEKPWYDIISENKTSLYYA  317

Query  1151  VIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEG  1330
             VIYL PGDYHR HSPA+W V  RRHF+G L+ V+    RT+  L+  NERVVL GRW+ G
Sbjct  318   VIYLAPGDYHRFHSPANWVVERRRHFAGELYSVSPYLQRTLPGLFTLNERVVLLGRWRYG  377

Query  1331  FMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHL----------EPP---EERVYEPDG  1471
             F +   +GATN+GSI++  +  LRTN    +              EP     E  YE   
Sbjct  378   FFSYVPVGATNVGSIKINFDRELRTNSLTTDTEADRAAEEAAKRGEPYAGFAEATYESAS  437

Query  1472  ---TGIRMKKGDELAAFNMGSTVVLVFQAPISSP-----SDFRFCIKKGERIRMGEALG  1624
                 G  +++G+E+  F +GST+VLVF+AP  S      S +R+ ++KG+ ++MG+ALG
Sbjct  438   RVLGGHALRRGEEMGGFQLGSTIVLVFEAPTESKTAEARSGWRWNVEKGQTVKMGQALG  496


 Score = 40.4 bits (93),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 43/83 (52%), Gaps = 1/83 (1%)
 Frame = +1

Query  403  KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalple-eyaslR  579
            +   M  LPL++ISR WG    +  P +LR   ++ ++  F  NL E        Y +L 
Sbjct  95   QVQVMSTLPLKAISRLWGRFNEMVIPYYLRVPGFKLYSWIFGVNLNEVGEDDLHVYPNLA  154

Query  580  DFFVRTLKEGSRPVDSDPCCLVT  648
             FF R LK G+RP+D +   L++
Sbjct  155  SFFYRQLKPGARPLDPNSNALLS  177



>ref|XP_004615636.1| PREDICTED: phosphatidylserine decarboxylase proenzyme [Sorex 
araneus]
Length=374

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFVSH  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              + TGI M+KG+ L  FN+GST+VL+F+A    P DF F ++ G++IR GEALG
Sbjct  323   ANKTGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFDFKLQAGQKIRFGEALG  372


 Score = 39.7 bits (91),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  69   PVSRVALYKSVPTRLLSRAWGRLNQVELPYWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  128

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  129  NLSEFFRRKLKPQARPV  145


 Score = 38.5 bits (88),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K +   +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNS--EVEQVKGVTYSLESFLG  185



>ref|XP_005421556.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Geospiza fortis]
Length=374

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FQKQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGVARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DFRF +K G++IR GEALG
Sbjct  323   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFRFNLKAGQKIRFGEALG  372


 Score = 41.6 bits (96),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 47/89 (53%), Gaps = 1/89 (1%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  57   GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNM  116

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPV  621
            +EAA+    +  +L +FF R LK  +RPV
Sbjct  117  KEAAVEDLHHYRNLSEFFRRKLKPQARPV  145


 Score = 38.5 bits (88),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>gb|KHO00934.1| phosphatidylserine decarboxylase proenzyme 1 [Metarhizium album 
ARSEF 1941]
Length=544

 Score =   157 bits (398),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 123/368 (33%), Positives = 171/368 (46%), Gaps = 83/368 (23%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATS---------------FLSMT  781
             L+SP DG IL++G ++  GG IEQVKG +YSV  LLG  S                    
Sbjct  221   LLSPADGKILQYGRIE--GGDIEQVKGMTYSVDALLGKNSPTASIASGQSSASAQSGGSV  278

Query  782   AEDDSEQKNSEKESSDTDANKKSWWRVSLASPKVRDPAP-AW*PHSNVLVFPETLSA*QL  958
             A  D E    E+E +  +        +S   P +    P A  PHS      E       
Sbjct  279   AHGDEEIVKQEEEFAKMNG-------ISYTLPDLLSGQPDAQKPHSATDESTEV------  325

Query  959   LTCEYVI**AKFCGFINNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKG  1138
                          G ++   + L L EK                +D   + K +      
Sbjct  326   -----------SAGAVSEVRAELALGEK--------------PWYDIVSADKTTS-----  355

Query  1139  LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGR  1318
             L+Y VIYL PGDYHR HSP +W V  RRHF+G L+ V+    RT+  L+  NERVVL GR
Sbjct  356   LYYAVIYLAPGDYHRFHSPTNWVVERRRHFAGELYSVSPYLQRTLPGLFTLNERVVLLGR  415

Query  1319  WQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHL----------EP---PEERVY  1459
             W+ GF +   +GATN+GSI++  +  LRTN    +              EP     E  Y
Sbjct  416   WRYGFFSYVPVGATNVGSIKINFDRELRTNSLLTDTAADHAAEEAAKRGEPYMGYAEATY  475

Query  1460  E---PDGTGIRMKKGDELAAFNMGSTVVLVFQAPI-----SSPS-DFRFCIKKGERIRMG  1612
             E   P   G  +++G+E+  F +GST+VLVF+AP        PS  + + ++KG++I+MG
Sbjct  476   EAASPILHGHALRRGEEMGGFQLGSTIVLVFEAPSEKAQGGKPSGGWHWAVEKGQKIKMG  535

Query  1613  EALGRWHD  1636
             +ALGR  D
Sbjct  536   QALGRVVD  543


 Score = 42.0 bits (97),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 26/93 (28%), Positives = 45/93 (48%), Gaps = 11/93 (12%)
 Frame = +1

Query  403  KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRD  582
            +   M  LPL++ISR WG    +  P +LR   ++ ++  F  N  +  + ++    + +
Sbjct  131  QVQVMSTLPLKAISRLWGKFNELTIPYYLRVPGFKLYSFIFGVNPRKFLISVQSLEEVSE  190

Query  583  -----------FFVRTLKEGSRPVDSDPCCLVT  648
                       FF RTLK G+RP+D D   L++
Sbjct  191  PDLHAYPNLAAFFYRTLKPGARPLDPDSRALLS  223



>ref|XP_001515601.1| PREDICTED: phosphatidylserine decarboxylase proenzyme [Ornithorhynchus 
anatinus]
 ref|XP_007656776.1| PREDICTED: phosphatidylserine decarboxylase proenzyme [Ornithorhynchus 
anatinus]
 ref|XP_007656777.1| PREDICTED: phosphatidylserine decarboxylase proenzyme [Ornithorhynchus 
anatinus]
Length=373

 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 111/186 (60%), Gaps = 14/186 (8%)
 Frame = +2

Query  1094  DYFFSSKLSCSPMKG---------LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFP  1246
             D  FS   SCS  +          L++CVIYL PGDYH  HSP DW V  RRHF G L  
Sbjct  191   DVSFSQATSCSSFQNQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMS  250

Query  1247  VNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK  1426
             VN    R I+ L+  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K
Sbjct  251   VNPGVARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRYSK  310

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
                      +   +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR
Sbjct  311   GSYN-DFSFITNNNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFHLKTGQKIR  365

Query  1607  MGEALG  1624
              GEALG
Sbjct  366   FGEALG  371


 Score = 40.0 bits (92),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  68   PMSRVALYKSVPTRLLSRAWGRLNQVELPNWLRKPVYSLYIWTFGVNMKEAAVEDLHHYR  127

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  128  NLSEFFRRKLKPQARPV  144


 Score = 39.7 bits (91),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 28/42 (67%), Gaps = 2/42 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFL  772
            ++SP DG IL FG++K     +EQVKG +YS+   LG  +++
Sbjct  150  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLGPRTYV  189



>gb|KFV87759.1| Phosphatidylserine decarboxylase proenzyme, partial [Struthio 
camelus australis]
Length=362

 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  192   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  251

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         V  
Sbjct  252   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFVSN  310

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  311   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  360


 Score = 53.9 bits (128),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 7/117 (6%)
 Frame = +1

Query  301  IVMLGALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVE  474
            +   G     R Y+D K+E   ++G+E+  +   + + +    +P R +SR WG L  VE
Sbjct  24   VATGGGYAGYRKYEDYKLEQLEKRGLEVPVKLASEWEVALYKSVPTRLLSRAWGRLNQVE  83

Query  475  FPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
             P WLR  VY  +   F  N++EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  84   LPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  136


 Score = 38.5 bits (88),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  139  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  173



>ref|XP_008973193.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X4 [Pan paniscus]
 ref|XP_009436479.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X4 [Pan troglodytes]
Length=303

 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F ++L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  133   FKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  192

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  193   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYN-DFSFVTH  251

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  G+ M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  252   TNREGVPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFQLKTGQKIRFGEALG  301


 Score = 38.5 bits (88),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  80   VISPSDGRILNFGQVKNC--EVEQVKGVTYSLESFLG  114


 Score = 38.1 bits (87),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  8    VPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  67

Query  601  KEGSRPV  621
            K  +RPV
Sbjct  68   KPQARPV  74



>ref|XP_007170712.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X5 [Balaenoptera acutorostrata scammoni]
 ref|XP_007170713.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X6 [Balaenoptera acutorostrata scammoni]
Length=340

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  170   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  229

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  230   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFVTH  288

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  289   TNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFKLKAGQKIRFGEALG  338


 Score = 38.5 bits (88),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  35   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  94

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  95   NLSEFFRRKLKPQARPV  111


 Score = 38.1 bits (87),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  117  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  151



>emb|CCA24217.1| unnamed protein product [Albugo laibachii Nc14]
 emb|CCA26939.1| unnamed protein product [Albugo laibachii Nc14]
Length=293

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 117/193 (61%), Gaps = 11/193 (6%)
 Frame = +2

Query  1049  RRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHF  1228
             R   FL +   + N D    SK+S +    L++CV+YL PGDYHRIH   DW +  RRHF
Sbjct  104   RMDEFLGTRDLNINPDAPLLSKISNTR---LYHCVLYLAPGDYHRIHGSEDWTIFERRHF  160

Query  1229  SGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTN  1408
              G LF VN  A R I  L+VENERV L G W+ GF +M A+GATN+GSI L +EP  +TN
Sbjct  161   PGNLFSVNSVAARLIPGLFVENERVALLGSWKYGFFSMTAVGATNVGSIALCMEPDFKTN  220

Query  1409  -KPQKNKLHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCI  1585
              K           + R YE     IR  +G E A F +GSTVVL+F+A    P +F FC+
Sbjct  221   SKAHDEDFSRNIAQIRQYE---RPIRALRGQERALFKLGSTVVLIFEA----PENFEFCV  273

Query  1586  KKGERIRMGEALG  1624
             ++G+++R+G ++G
Sbjct  274   QEGQKVRLGSSIG  286



>ref|XP_005612474.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X6 [Equus caballus]
Length=340

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  170   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  229

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  230   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRYSKGSYN-DFSFVTH  288

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  289   ANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFKLKAGQKIRFGEALG  338


 Score = 38.5 bits (88),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  35   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  94

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  95   NLSEFFRRKLKPQARPV  111


 Score = 38.1 bits (87),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  117  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  151



>ref|XP_008324401.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Cynoglossus semilaevis]
Length=430

 Score =   166 bits (419),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 113/186 (61%), Gaps = 16/186 (9%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   L  SP   LF+ V+YL PGDYH  HSP DW V LRRHF G L  VN    R ++ L
Sbjct  247   FKDLLLSSPENDLFHVVVYLAPGDYHCFHSPTDWKVALRRHFPGSLMSVNPGVARWVKEL  306

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK------------  1426
             +  NERVVL G+WQ GF ++ A+GATN+GSI ++ +  L TN P+ +K            
Sbjct  307   FCLNERVVLTGQWQHGFFSLTAVGATNVGSIRVYFDQELHTNVPRYSKGSFHDRSYVAET  366

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
             ++L  P+  V   D  G+ + KG+ L  FN+GST+VL+F+A    P DF+F +  G+RIR
Sbjct  367   INLSKPDGGVVCLDKEGVALHKGELLGEFNLGSTIVLLFEA----PKDFKFNLLPGQRIR  422

Query  1607  MGEALG  1624
             +GE LG
Sbjct  423   VGEGLG  428


 Score = 41.2 bits (95),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLS  775
            ++SP DG IL FG++K +   +EQVKG +YS+   LG    LS
Sbjct  191  VISPADGRILHFGQVKNS--EVEQVKGITYSLETFLGPQQHLS  231


 Score = 40.0 bits (92),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +1

Query  427  PLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalple-eyaslRDFFVRTLK  603
            P+R ISR WG +  VE P WLR  +Y  +   F  N++EAA+     Y +L +FF R LK
Sbjct  120  PMRFISRTWGRINEVELPTWLRKPLYSLYIWTFGVNMQEAAVEDLHHYRNLGEFFRRRLK  179

Query  604  EGSRPVDSDPCCL  642
               RP+ +  C +
Sbjct  180  PAVRPLCAASCVI  192



>gb|KFW82493.1| Phosphatidylserine decarboxylase proenzyme, partial [Manacus 
vitellinus]
Length=362

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  192   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGVARWIKEL  251

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  252   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  310

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  311   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFNLKAGQKIRFGEALG  360


 Score = 50.8 bits (120),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 58/110 (53%), Gaps = 3/110 (3%)
 Frame = +1

Query  301  IVMLGALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVE  474
            +   G     R Y+D K+E   ++GIE+  +   + + +    +P R +SR WG L  VE
Sbjct  24   VATGGGYAGYRKYEDYKLEQLEKRGIEVPVKLASEWEVALYKSVPTRLLSRAWGRLNQVE  83

Query  475  FPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPV  621
             P WLR  VY  +   F  N++EAA+    +  +L +FF R LK  +RPV
Sbjct  84   LPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV  133


 Score = 38.5 bits (88),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  139  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  173



>gb|EPX74525.1| phosphatidylserine decarboxylase Psd1 [Schizosaccharomyces octosporus 
yFS286]
Length=437

 Score =   148 bits (374),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 112/334 (34%), Positives = 166/334 (50%), Gaps = 63/334 (19%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             LVSP DG +L +G ++  GG +EQVKG +Y            S+ A    E     K++ 
Sbjct  153   LVSPADGKVLNYGVIE--GGHLEQVKGLTY------------SLEALLGQEHLARLKKAH  198

Query  827   DTDANKKSWWRVSLASPKVRDPAPAW*PHSNVLVFPETLSA*QLLTCEYVI**AKFCGFI  1006
                                  P+P   PH +   F        +   EY +      G  
Sbjct  199   AI-------------------PSPEHIPHISQEEFA------LVNGIEYSL--QDLMGH-  230

Query  1007  NNWYSFLILYEKTNRRGSFLPST--MQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYH  1180
             +N YS   + + +  +   L ST     + FD+  S   +      L+Y V+YL PGDYH
Sbjct  231   DNEYSQNSIKDASANQVDLLNSTKVAMRSTFDFLRSRDQNL-----LYYAVVYLAPGDYH  285

Query  1181  RIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGAT  1360
             R HSP DW V  RRHFSG LF V+      + NL+V NERV + GR++ GFM+M  +GAT
Sbjct  286   RFHSPTDWVVERRRHFSGELFSVSPYMVSKLGNLFVLNERVAMLGRYKYGFMSMIPVGAT  345

Query  1361  NIGSIELFIEPTLRTNKPQKNKLHLEPP---EERVYEPDGT---GIRMKKGDELAAFNMG  1522
             N+GSI +  +  L TN+  K    L P    +E VY        G  + +G+E+  F +G
Sbjct  346   NVGSIRINFDKELCTNQFGK----LGPTGTYDEAVYTKSSAILHGHPLLRGEEIGNFELG  401

Query  1523  STVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
             STVVLVF+A    P++F+F I++G+ +++G+++G
Sbjct  402   STVVLVFEA----PANFQFDIQRGQHVKVGQSIG  431


 Score = 50.8 bits (120),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +1

Query  415  MGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFV  591
            +  LPLR++SR+WG++  VE P++LR   +R ++  F+ +L+EA +   +   +L +FF 
Sbjct  78   LSTLPLRTLSRWWGYVNRVEIPLYLRNPGFRLYSWLFNCDLKEAEIQDLKQYRNLAEFFT  137

Query  592  RTLKEGSRPVDSD  630
            R LK G RP+DS+
Sbjct  138  RKLKPGCRPIDSE  150



>ref|XP_009090517.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X3 [Serinus canaria]
Length=401

 Score =   165 bits (417),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  231   FQKQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGVARWIKEL  290

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  291   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  349

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DFRF +K G++IR GEALG
Sbjct  350   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFRFNLKAGQKIRFGEALG  399


 Score = 53.9 bits (128),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 7/113 (6%)
 Frame = +1

Query  313  GALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVW  486
            G     R Y+D K+E   ++GIE+  +   + + +    +P R +SR WG L  VE P W
Sbjct  67   GGYAGYRKYEDYKLEQLEKRGIEVPVKLASEWEVALYKSVPTRLLSRAWGRLNQVELPTW  126

Query  487  LRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            LR  VY  +   F  N++EAA+    +  +L +FF R LK  +RPV    CC+
Sbjct  127  LRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCV  175


 Score = 38.5 bits (88),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  178  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  212



>ref|XP_007642838.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X4 [Cricetulus griseus]
 ref|XP_007620924.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X4 [Cricetulus griseus]
Length=340

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F ++L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  170   FRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  229

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  230   FCHNERVVLSGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DLSFVTH  288

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  289   ANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFRLKAGQKIRFGEALG  338


 Score = 39.7 bits (91),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+ EAA+    +  
Sbjct  35   PVSRVALYKSVPTRLLSRAWGRLNQVELPYWLRRPVYSLYIWTFGVNMTEAAVEDLHHYR  94

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  95   NLSEFFRRKLKPQARPV  111


 Score = 39.7 bits (91),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 6/59 (10%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKES  823
            ++SP DG IL FG++K     +EQVKG +YS+   LG  ++     ED S    S ++S
Sbjct  117  VISPSDGKILTFGQVKNC--EVEQVKGVTYSLESFLGPRTY----TEDLSFPPASSRDS  169



>gb|KFW71923.1| Phosphatidylserine decarboxylase proenzyme, partial [Pygoscelis 
adeliae]
Length=361

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  191   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  250

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  251   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  309

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  310   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  359


 Score = 55.1 bits (131),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 7/117 (6%)
 Frame = +1

Query  301  IVMLGALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVE  474
            +   G     R Y+D K+E   ++GIE+  +   + + +    +P R +SR WG L  VE
Sbjct  23   VATGGGYAGYRKYEDYKLEQLEKRGIEVPVKLASEWEVALYKSVPTRLLSRAWGRLNQVE  82

Query  475  FPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
             P WLR  VY  +   F  N++EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  83   LPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  135


 Score = 38.5 bits (88),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  138  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  172



>ref|XP_010192662.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Mesitornis unicolor]
Length=423

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  253   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  312

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  313   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  371

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KGD L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  372   NNKEGISMRKGDHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  421


 Score = 45.1 bits (105),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  106  GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNM  165

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  166  KEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  197


 Score = 38.5 bits (88),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  200  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  234



>ref|XP_004556234.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like [Maylandia 
zebra]
Length=472

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 113/178 (63%), Gaps = 8/178 (4%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   L  SP   LF+ VIYL PGDYH  HSP DW V LRRHF G L  VN    R I+ L
Sbjct  297   FRDDLLSSPDSDLFHVVIYLAPGDYHCFHSPTDWRVELRRHFPGSLMSVNPGVARWIKEL  356

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK----LHLEPPEE  1450
             +  NERVVL G+WQ+GF ++ A+GATN+GSI ++ +  L+TN P+ +K     H    ++
Sbjct  357   FCLNERVVLTGQWQQGFFSLTAVGATNVGSIRIYFDQELQTNTPRYSKGSFHDHSYIADQ  416

Query  1451  RVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              V      G+ ++KG+ +  FN+GST+VL+F+A    P DF F ++ G+RIR+GE LG
Sbjct  417   TVKFAGEGGVALQKGESVGEFNLGSTIVLLFEA----PKDFSFNLQPGQRIRVGEGLG  470


 Score = 42.7 bits (99),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +1

Query  427  PLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLK  603
            P R +SR WG L GVE P WLR  +Y  +   F  N++EAA+    +  +L +FF R LK
Sbjct  177  PTRLLSRAWGRLNGVELPTWLRKPIYSLYIWTFGVNMQEAAVEDLHHYRNLGEFFRRRLK  236

Query  604  EGSRPVDSDPC  636
               RP+ +  C
Sbjct  237  PAVRPLCASSC  247


 Score = 38.1 bits (87),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            L SP DG IL FG +K +   +EQVKG +YS+   LG
Sbjct  248  LTSPADGRILHFGRVKNS--EVEQVKGVTYSLEHFLG  282



>ref|XP_010167822.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Caprimulgus carolinensis]
Length=421

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  251   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  310

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  LRTN P+ +K         +  
Sbjct  311   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLRTNSPRYSKGSYN-DFSFISN  369

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  370   NNKEGILMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  419


 Score = 44.3 bits (103),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  104  GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRRPVYSLYIWTFGVNM  163

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  164  KEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  195


 Score = 38.5 bits (88),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  198  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  232



>ref|XP_008875662.1| phosphatidylserine decarboxylase [Aphanomyces invadans]
 gb|ETV95469.1| phosphatidylserine decarboxylase [Aphanomyces invadans]
Length=340

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 111/169 (66%), Gaps = 10/169 (6%)
 Frame = +2

Query  1127  PMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVV  1306
             P K LF+CVIYL PGDYHRIHSP DW++  RRHF G LFPVN  A  T+ +L+  NERVV
Sbjct  150   PGKALFHCVIYLAPGDYHRIHSPIDWHMTERRHFPGNLFPVNSLAVATVPSLFTWNERVV  209

Query  1307  LEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTN---KPQKNKLHLEPPEERVYEPDGTG  1477
             L G+W  GF ++ A+GATN+GSI L +EP L TN      K +        +VY+P  + 
Sbjct  210   LLGQWAHGFHSLTAVGATNVGSILLDVEPELTTNMFYDHHKIRPKWGACRAKVYDPFHSV  269

Query  1478  IRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
             +R   G ++  F +GSTVVLVF+A    P+DF F +  G+++R G+A+G
Sbjct  270   VR---GTQVGQFKLGSTVVLVFEA----PADFTFTVIPGDKVRYGQAIG  311


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = +1

Query  415  MGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeyaslRDFFVR  594
            + +LP R ISR WG +  +  P  LR  VYRAW  AF   L+E   PL EY +L +FF R
Sbjct  23   LNVLPYRFISRVWGAVNDINLPSCLREPVYRAWTHAFDCQLDEMQHPLREYKNLGEFFSR  82

Query  595  TLKEGSRPVDSDP---CCLVTG  651
             LK+G RPVD DP   C  V G
Sbjct  83   QLKDGIRPVDMDPQKVCSPVDG  104



>ref|XP_010396399.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Corvus cornix cornix]
Length=373

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 6/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGVARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K      +     
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN--DFSFIS  321

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  322   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFNLKAGQKIRFGEALG  371


 Score = 42.7 bits (99),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 5/96 (5%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  57   GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNM  116

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+    +  +L +FF R LK   RPV    CC+
Sbjct  117  KEAAVEDLHHYRNLSEFFRRKLKPQVRPV----CCV  148


 Score = 38.1 bits (87),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>ref|XP_010226969.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Tinamus guttatus]
Length=374

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  323   NNKDGISMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  372


 Score = 42.7 bits (99),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 1/91 (1%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  57   GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNM  116

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDS  627
            +EAA+    +  +L +FF R LK  +RPV S
Sbjct  117  KEAAVEDLHHYRNLSEFFRRKLKPQARPVCS  147


 Score = 38.5 bits (88),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>gb|KEY65935.1| hypothetical protein S7711_07740 [Stachybotrys chartarum IBT 
7711]
 gb|KFA46705.1| hypothetical protein S40293_07771 [Stachybotrys chartarum IBT 
40293]
 gb|KFA78102.1| hypothetical protein S40288_05676 [Stachybotrys chartarum IBT 
40288]
Length=539

 Score =   156 bits (395),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 116/365 (32%), Positives = 173/365 (47%), Gaps = 81/365 (22%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATS-------FLSMTAEDDSEQK  805
             L+SP DG +L+FG+++  GG IEQVKG +YSV  LLG ++         S+    D++Q 
Sbjct  214   LLSPADGKVLQFGQIE--GGDIEQVKGMTYSVDALLGKSTPPPSISEASSVFTPGDAQQV  271

Query  806   NSE-KESSDTDANKKSWWRVS--------LASPKVRDPAPAW*PHSNVLVFPETLSA*QL  958
             + E  E  D    ++ + +V+        L S   R   PA        V  E+    Q 
Sbjct  272   HGELSEGEDLVKQEEEFAKVNGIAYTLPDLLSGSSRAKKPA--------VKDESTEVSQS  323

Query  959   LTCEYVI**AKFCGFINNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKG  1138
                E     A        WY  L                              S +    
Sbjct  324   AVSEVR---ADLALGERPWYDIL------------------------------SENKATA  350

Query  1139  LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGR  1318
             L+Y VIYL PGDYHR HSP +W V  RRHF+G L+ V+    RT+  L+  NERVVL GR
Sbjct  351   LYYAVIYLAPGDYHRFHSPTNWVVERRRHFAGELYSVSPYLQRTLPGLFTLNERVVLLGR  410

Query  1319  WQEGFMAMAAIGATNIGSIELFIEPTLRTNK--------------PQKNKLHLEPPEERV  1456
             W+ GF +   +GATN+GSI++  +  LRTN                Q+ + +L   E   
Sbjct  411   WRWGFFSYIPVGATNVGSIKINFDRELRTNSLTTDTAADHAAEEAAQRGEPYLGFVEATY  470

Query  1457  YEPDGT--GIRMKKGDELAAFNMGSTVVLVFQAPISSPSD------FRFCIKKGERIRMG  1612
                     G  +++G+E+  F +GST+VLVF+AP +   +      +++ ++KG++I+MG
Sbjct  471   AGSSAVLQGHALRRGEEMGGFQLGSTIVLVFEAPATQTGEGNIKKGWQWAVEKGQKIKMG  530

Query  1613  EALGR  1627
             +A+GR
Sbjct  531   QAIGR  535


 Score = 42.4 bits (98),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 48/103 (47%), Gaps = 5/103 (5%)
 Frame = +1

Query  355  EGAREKGIELEFHPDV--KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFH  528
            +GAR         PD   +   M  LPL+++SR WG    +  P +LR   ++ ++  F 
Sbjct  114  DGARTPKRRPRIRPDGPWQVRVMSTLPLKAMSRLWGKFNELTIPYYLRVPGFKLYSFIFG  173

Query  529  SNleeaalpleeyaslRD---FFVRTLKEGSRPVDSDPCCLVT  648
             N     +   +     +   FF RTLK G+RP+D D   L++
Sbjct  174  VNRSLDEVSEPDLHVYPNLAAFFYRTLKPGARPLDLDSHALLS  216



>gb|ETE67104.1| Phosphatidylserine decarboxylase proenzyme, partial [Ophiophagus 
hannah]
Length=444

 Score =   166 bits (419),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       LF+CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  274   FQKQLVTKDSNELFHCVIYLAPGDYHCFHSPTDWKVSHRRHFPGALMSVNPGVARWIKEL  333

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GA N+GSI ++ +  L+TN P+ +K         V  
Sbjct  334   FCHNERVVLSGYWKHGFFSLTAVGAQNVGSIRIYCDQKLQTNSPRYSKGSFN-DFSFVTS  392

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              D  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  393   KDHEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFYLKPGQKIRFGEALG  442


 Score = 41.2 bits (95),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 1/89 (1%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + S    +P R +SR WG L  VE P WLR  V   +   F  N+
Sbjct  127  GALKPLTRVRWRPVSRVSLYKSVPTRLLSRAWGRLNNVELPTWLRKPVLSLYIWTFGVNM  186

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPV  621
            +EAA+    +  +L +FF R LK  +RPV
Sbjct  187  KEAAVEDLHHYRNLSEFFRRKLKPQARPV  215


 Score = 38.9 bits (89),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (54%), Gaps = 3/67 (4%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNS-EKES  823
            ++SP DG IL FG++K     +EQVKG +YS+   LG  +       D +    S +K+ 
Sbjct  221  VISPSDGKILSFGQVKNC--EVEQVKGITYSLQSFLGPHANHDNCQNDPTSCCESFQKQL  278

Query  824  SDTDANK  844
               D+N+
Sbjct  279  VTKDSNE  285



>gb|KFQ95915.1| Phosphatidylserine decarboxylase proenzyme, partial [Nipponia 
nippon]
Length=361

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  191   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  250

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  251   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  309

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  310   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  359


 Score = 53.5 bits (127),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 7/117 (6%)
 Frame = +1

Query  301  IVMLGALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVE  474
            +   G     R Y+D ++E   ++GIE+  +   + + +    +P R +SR WG L  VE
Sbjct  23   VATGGGYAGYRKYEDYRLEQLEKRGIEVPVKLASEWEVALYKSVPTRLLSRAWGRLNQVE  82

Query  475  FPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
             P WLR  VY  +   F  N++EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  83   LPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  135


 Score = 38.5 bits (88),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  138  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  172



>ref|XP_004449819.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
6 [Dasypus novemcinctus]
Length=340

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  170   FKSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  229

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  230   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFVTH  288

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  G+ M+KG+ L  FN+GST+VL+F+A    P DF F ++ G++IR GEALG
Sbjct  289   ANKEGVPMRKGEHLGEFNLGSTIVLIFEA----PQDFSFKLQAGQKIRFGEALG  338


 Score = 38.9 bits (89),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 14/66 (21%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG------------ATSFLSMTAED  790
            ++SP DG IL FG++K     +EQVKG +YS+   LG            ATSF S  ++ 
Sbjct  117  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLGPRASAEDLSFPPATSFSSFKSQL  174

Query  791  DSEQKN  808
             + + N
Sbjct  175  VTREGN  180


 Score = 38.5 bits (88),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  35   PVSRVTLYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  94

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  95   NLSEFFRRKLKPQARPV  111



>gb|KFR12428.1| Phosphatidylserine decarboxylase proenzyme, partial [Opisthocomus 
hoazin]
Length=362

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  192   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  251

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  252   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  310

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  311   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  360


 Score = 53.5 bits (127),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 60/117 (51%), Gaps = 7/117 (6%)
 Frame = +1

Query  301  IVMLGALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVE  474
            +   G     R Y+D K E   ++GIE+  +   + + +    +P R +SR WG L  VE
Sbjct  24   VATGGGYAGYRKYEDYKSEQLEKRGIEVPVKLASEWEVALYKSVPTRLLSRAWGRLNQVE  83

Query  475  FPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
             P WLR  VY  +   F  N++EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  84   LPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  136


 Score = 38.5 bits (88),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  139  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  173



>gb|KFM08023.1| Phosphatidylserine decarboxylase proenzyme, partial [Aptenodytes 
forsteri]
Length=361

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  191   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  250

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  251   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  309

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  310   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  359


 Score = 55.1 bits (131),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 7/117 (6%)
 Frame = +1

Query  301  IVMLGALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVE  474
            +   G     R Y+D K+E   ++GIE+  +   + + +    +P R +SR WG L  VE
Sbjct  23   VATGGGYAGYRKYEDYKLEQLEKRGIEVPVKLASEWEVALYKSVPTRLLSRAWGRLNQVE  82

Query  475  FPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
             P WLR  VY  +   F  N++EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  83   LPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  135


 Score = 38.5 bits (88),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  138  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  172



>ref|XP_009928635.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X4 [Haliaeetus albicilla]
 ref|XP_010573250.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X4 [Haliaeetus leucocephalus]
Length=335

 Score =   163 bits (412),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  165   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  224

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  225   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFISN  283

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  284   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  333


 Score = 44.3 bits (103),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 44/81 (54%), Gaps = 5/81 (6%)
 Frame = +1

Query  403  KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slR  579
            K +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L 
Sbjct  33   KVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLS  92

Query  580  DFFVRTLKEGSRPVDSDPCCL  642
            +FF R LK  +RPV    CCL
Sbjct  93   EFFRRKLKPQARPV----CCL  109


 Score = 38.9 bits (89),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  112  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  146



>ref|XP_005942619.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like [Haplochromis 
burtoni]
Length=473

 Score =   166 bits (420),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 113/178 (63%), Gaps = 8/178 (4%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   L  SP   LF+ VIYL PGDYH  HSP DW V LRRHF G L  VN    R I+ L
Sbjct  298   FRDDLLSSPDSDLFHVVIYLAPGDYHCFHSPTDWRVELRRHFPGSLMSVNPGVARWIKEL  357

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK----LHLEPPEE  1450
             +  NERVVL G+WQ+GF ++ A+GATN+GSI ++ +  L+TN P+ +K     H    ++
Sbjct  358   FCLNERVVLTGQWQQGFFSLTAVGATNVGSIRIYFDQELQTNTPRYSKGSFHDHSYIADQ  417

Query  1451  RVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              V      G+ ++KG+ +  FN+GST+VL+F+A    P DF F ++ G+RIR+GE LG
Sbjct  418   TVKFAGEGGVALQKGESVGEFNLGSTIVLLFEA----PKDFSFNLQPGQRIRVGEGLG  471


 Score = 42.7 bits (99),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +1

Query  427  PLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLK  603
            P R +SR WG L GVE P WLR  +Y  +   F  N++EAA+    +  +L +FF R LK
Sbjct  178  PTRLLSRAWGRLNGVELPTWLRKPIYSLYIWTFGVNMQEAAVEDLHHYRNLGEFFRRRLK  237

Query  604  EGSRPVDSDPC  636
               RP+ +  C
Sbjct  238  PAVRPLCASSC  248


 Score = 38.1 bits (87),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            L SP DG IL FG +K +   +EQVKG +YS+   LG
Sbjct  249  LTSPADGRILHFGRVKNS--EVEQVKGVTYSLEHFLG  283



>ref|XP_005869843.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Myotis brandtii]
 ref|XP_005869844.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X3 [Myotis brandtii]
Length=374

 Score =   164 bits (415),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V +
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFVTQ  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  323   ANREGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFDFKLKAGQKIRFGEALG  372


 Score = 40.0 bits (92),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  69   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  128

Query  571  slRDFFVRTLKEGSRPVDSDPCCL  642
            +L +FF R LK  +RPV    C +
Sbjct  129  NLSEFFRRKLKPQARPVCGLHCVI  152


 Score = 38.5 bits (88),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K +   +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNS--EVEQVKGVTYSLESFLG  185



>ref|XP_006105605.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Myotis lucifugus]
 ref|XP_006105606.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X3 [Myotis lucifugus]
Length=374

 Score =   164 bits (415),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V +
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFVTQ  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  323   ANREGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFDFKLKAGQKIRFGEALG  372


 Score = 40.0 bits (92),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  69   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  128

Query  571  slRDFFVRTLKEGSRPVDSDPCCL  642
            +L +FF R LK  +RPV    C +
Sbjct  129  NLSEFFRRKLKPQARPVCGVHCVI  152


 Score = 38.5 bits (88),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K +   +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNS--EVEQVKGVTYSLESFLG  185



>gb|KFO71478.1| Phosphatidylserine decarboxylase proenzyme, partial [Cuculus 
canorus]
Length=362

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  192   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  251

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  252   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  310

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  311   NNKKGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  360


 Score = 53.5 bits (127),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 7/117 (6%)
 Frame = +1

Query  301  IVMLGALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVE  474
            +   G     R Y+D ++E   ++GIE+  +   + + +    +P R +SR WG L  VE
Sbjct  24   VATGGGYAGYRKYEDYRLEQLEKRGIEVPVKLASEWEVALYKSVPTRLLSRAWGRLNQVE  83

Query  475  FPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
             P WLR  VY  +   F  N+EEAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  84   LPTWLRKPVYSLYIWTFGVNMEEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  136


 Score = 38.5 bits (88),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  139  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  173



>ref|XP_009082342.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Acanthisitta chloris]
Length=374

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         V  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFVSN  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  323   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFNLKAGQKIRFGEALG  372


 Score = 42.4 bits (98),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  79   VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  138

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CC+
Sbjct  139  KPQARPV----CCV  148


 Score = 38.5 bits (88),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>ref|XP_005869842.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Myotis brandtii]
Length=382

 Score =   164 bits (415),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  212   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  271

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V +
Sbjct  272   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFVTQ  330

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  331   ANREGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFDFKLKAGQKIRFGEALG  380


 Score = 40.0 bits (92),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  77   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  136

Query  571  slRDFFVRTLKEGSRPVDSDPCCL  642
            +L +FF R LK  +RPV    C +
Sbjct  137  NLSEFFRRKLKPQARPVCGLHCVI  160


 Score = 38.9 bits (89),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K +   +EQVKG +YS+   LG
Sbjct  159  VISPSDGKILNFGQVKNS--EVEQVKGVTYSLESFLG  193



>ref|XP_006148020.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X3 [Tupaia chinensis]
Length=374

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FKSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRYSKGSYN-DFSFVTH  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  323   ANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFKLKAGQKIRFGEALG  372


 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  69   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  128

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  129  NLSEFFRRKLKPQARPV  145


 Score = 38.5 bits (88),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>ref|XP_009685751.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X3 [Struthio camelus australis]
Length=374

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         V  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFVSN  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  323   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  372


 Score = 45.1 bits (105),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  57   GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNM  116

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  117  KEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  148


 Score = 38.5 bits (88),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>ref|XP_010947187.1| PREDICTED: phosphatidylserine decarboxylase proenzyme [Camelus 
bactrianus]
 ref|XP_010990553.1| PREDICTED: phosphatidylserine decarboxylase proenzyme [Camelus 
dromedarius]
Length=374

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 111/186 (60%), Gaps = 14/186 (8%)
 Frame = +2

Query  1094  DYFFSSKLSCSPMKG---------LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFP  1246
             D  FS   SCS  +          L++CVIYL PGDYH  HSP DW +  RRHF G L  
Sbjct  192   DLPFSPATSCSSFRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTISHRRHFPGSLMS  251

Query  1247  VNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK  1426
             VN    R I+ L+  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K
Sbjct  252   VNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRYSK  311

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
                      V   +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR
Sbjct  312   GSYN-DFSFVTHTNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFQLKAGQKIR  366

Query  1607  MGEALG  1624
              GEALG
Sbjct  367   FGEALG  372


 Score = 38.9 bits (89),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  +Y  +   F  N++EAA+    +  
Sbjct  69   PVSRVALYKTVPTRLLSRAWGRLNQVELPHWLRRPIYSLYIWTFGVNMKEAAVEDLHHYR  128

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  129  NLSEFFRRKLKPQARPV  145


 Score = 38.9 bits (89),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 6/48 (13%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAED  790
            ++SP DG IL FG++K     +EQVKG +YS+   LG  +    +AED
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLGPRT----SAED  192



>ref|XP_008170257.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Chrysemys picta bellii]
Length=375

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 112/186 (60%), Gaps = 14/186 (8%)
 Frame = +2

Query  1094  DYFFSSKLSCSPMKG---------LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFP  1246
             D  FS   SCS ++          L++CVIYL PGDYH  HSP DW V  RRHF G L  
Sbjct  193   DMQFSQTSSCSSLQNQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMS  252

Query  1247  VNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK  1426
             VN    R I+ L+  NERVVL G W+ GF ++ A+GATN+GSI ++ +  LRTN P  +K
Sbjct  253   VNPGVARWIKELFCHNERVVLSGDWKHGFFSLTAVGATNVGSIRIYFDGDLRTNSPCYSK  312

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
                      +   +  GI M+KG+ L  FN+GST+VL+F+A    P +F F +K G++IR
Sbjct  313   GSYN-DFSFITNNNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKNFSFHLKPGQKIR  367

Query  1607  MGEALG  1624
              GEALG
Sbjct  368   FGEALG  373



>ref|XP_006105604.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Myotis lucifugus]
Length=382

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  212   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  271

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V +
Sbjct  272   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFVTQ  330

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  331   ANREGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFDFKLKAGQKIRFGEALG  380


 Score = 40.0 bits (92),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  77   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  136

Query  571  slRDFFVRTLKEGSRPVDSDPCCL  642
            +L +FF R LK  +RPV    C +
Sbjct  137  NLSEFFRRKLKPQARPVCGVHCVI  160


 Score = 38.9 bits (89),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K +   +EQVKG +YS+   LG
Sbjct  159  VISPSDGKILNFGQVKNS--EVEQVKGVTYSLESFLG  193



>gb|EHK15186.1| hypothetical protein TRIVIDRAFT_196625 [Trichoderma virens Gv29-8]
Length=495

 Score =   153 bits (387),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 117/362 (32%), Positives = 169/362 (47%), Gaps = 72/362 (20%)
 Frame = +2

Query  647   LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKESS  826
             L+SP DG +L+FG+++   G IEQVKG +YS+  LLG  +  S      S Q     + S
Sbjct  167   LLSPSDGKVLQFGQIES--GDIEQVKGMTYSIDALLGKHTPTSSIYSGLSNQAREHPQRS  224

Query  827   DTD--------ANKKSWWRVSLASPKVRD----PAPAW*PHSNVLVFPETLSA*QLLTCE  970
              +           ++ + RV+  S  + D    P  A   HS   V  E+L A       
Sbjct  225   HSAPVGDEEIVKQEEEFARVNGISYTLPDLMSGPKDA---HSKHPVTDESLKASSPRAVS  281

Query  971   YVI**AKFCGFINNWYSFLILYEKTNRRGSFLPSTMQHANFDYFFSSKLSCSPMKGLFYC  1150
              V   A+       WY  L                              S      L+Y 
Sbjct  282   EVR--AELALGEKPWYDLL------------------------------SPDKTTSLYYA  309

Query  1151  VIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNLYVENERVVLEGRWQEG  1330
             VIYL PGDYHR HSP +W V  RRHF+G L+ V+    RT+  L+  NERVVL GRW+ G
Sbjct  310   VIYLAPGDYHRFHSPTNWVVESRRHFAGELYSVSPYLQRTLPGLFTLNERVVLLGRWRWG  369

Query  1331  FMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHL----------EPP---EERVYEPDG  1471
             F +   +GATN+GSI++  +  LRTN    +              EP     E  YE   
Sbjct  370   FFSYVPVGATNVGSIKINFDRELRTNSLLTDTAADLAAEEAAKRGEPYLGFAEATYEGAS  429

Query  1472  T---GIRMKKGDELAAFNMGSTVVLVFQAPIS-------SPSDFRFCIKKGERIRMGEAL  1621
             +   G  +++G+E+  F +GST+VLVF+AP +           + + ++KG++++MG+AL
Sbjct  430   SVLHGHALRRGEEMGGFQLGSTIVLVFEAPATLKTADGQEKKGWEWAVEKGQKLKMGQAL  489

Query  1622  GR  1627
             GR
Sbjct  490   GR  491


 Score = 45.1 bits (105),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 1/83 (1%)
 Frame = +1

Query  403  KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalple-eyaslR  579
            +   M  LPL++ISR WG+   +  P +LR   ++ ++  F  NL+E + P    Y +L 
Sbjct  87   QVQVMSTLPLKAISRLWGWFNELTIPYYLRVPGFKLYSFIFGVNLDEVSEPDLHVYPNLA  146

Query  580  DFFVRTLKEGSRPVDSDPCCLVT  648
             FF RTLK G+RP+D D   L++
Sbjct  147  AFFYRTLKPGARPLDPDTHVLLS  169



>ref|XP_008924004.1| PREDICTED: phosphatidylserine decarboxylase proenzyme [Manacus 
vitellinus]
Length=375

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  205   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGVARWIKEL  264

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  265   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  323

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  324   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFNLKAGQKIRFGEALG  373


 Score = 41.6 bits (96),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 47/89 (53%), Gaps = 1/89 (1%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  58   GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNM  117

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPV  621
            +EAA+    +  +L +FF R LK  +RPV
Sbjct  118  KEAAVEDLHHYRNLSEFFRRKLKPQARPV  146


 Score = 38.1 bits (87),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  152  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  186



>ref|NP_001162202.1| phosphatidylserine decarboxylase proenzyme [Papio anubis]
 ref|XP_009215386.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Papio anubis]
 ref|XP_009215387.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Papio anubis]
 ref|XP_009215388.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Papio anubis]
 ref|XP_009215389.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Papio anubis]
 gb|ABW96819.1| phosphatidylserine decarboxylase (predicted) [Papio anubis]
Length=375

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 110/186 (59%), Gaps = 14/186 (8%)
 Frame = +2

Query  1094  DYFFSSKLSCSPMKG---------LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFP  1246
             D  FS   SC   K          L++CVIYL PGDYH  HSP DW V  RRHF G L  
Sbjct  193   DLPFSPAASCDSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMS  252

Query  1247  VNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK  1426
             VN    R I+ L+  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K
Sbjct  253   VNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRHSK  312

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
                      V   +  G+ M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR
Sbjct  313   GSYN-DFSFVTHTNREGVPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFQLKTGQKIR  367

Query  1607  MGEALG  1624
              GEALG
Sbjct  368   FGEALG  373


 Score = 39.3 bits (90),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSF  769
            ++SP DG IL FG++K     +EQVKG +YS+   LG  ++
Sbjct  152  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLGPRTY  190


 Score = 38.9 bits (89),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  70   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  129

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  130  NLSEFFRRKLKPQARPV  146



>ref|XP_007128781.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X6 [Physeter catodon]
Length=330

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW +  RRHF G L  VN    R I+ L
Sbjct  160   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTISHRRHFPGSLMSVNPGMARWIKEL  219

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  220   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRYSKGSYN-DFSFVTH  278

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  279   TNKEGIPMHKGEHLGEFNLGSTIVLIFEA----PKDFNFKLKAGQKIRFGEALG  328



>gb|KFP07816.1| Phosphatidylserine decarboxylase proenzyme, partial [Calypte 
anna]
Length=363

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  193   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  252

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         V  
Sbjct  253   FCHNERVVLTGDWKYGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFVSN  311

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  312   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  361


 Score = 57.4 bits (137),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 61/117 (52%), Gaps = 7/117 (6%)
 Frame = +1

Query  301  IVMLGALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVE  474
            +   G     R Y+D KIE   +KGIE+  +   + + +    +P R +SR WG L  VE
Sbjct  24   VATGGGYAGYRKYEDYKIEQMEKKGIEVPVKLASEWEVALYKSVPTRLLSRAWGRLNQVE  83

Query  475  FPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
             P WLR  VY  +   F  N++EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  84   LPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  136


 Score = 38.9 bits (89),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            +VSP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  140  VVSPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  174



>gb|KFV63296.1| Phosphatidylserine decarboxylase proenzyme, partial [Picoides 
pubescens]
Length=362

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  192   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  251

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  252   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  310

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  311   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFDLKAGQKIRFGEALG  360


 Score = 53.9 bits (128),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 7/117 (6%)
 Frame = +1

Query  301  IVMLGALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVE  474
            +   G     R Y++ K+E   +KGIE+  +   + + +    +P R +SR WG L  VE
Sbjct  24   VATGGGYAGYRKYENYKLEQLEKKGIEVPVKLAREWEVALYKSVPTRLLSRAWGRLNQVE  83

Query  475  FPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
             P WLR  VY  +   F  N++EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  84   LPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  136


 Score = 39.7 bits (91),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 36/67 (54%), Gaps = 8/67 (12%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG------ATSFLSMTAEDDSEQKN  808
            ++SP DG IL FG++K     +EQVKG +YS+   LG        SF    A +  +Q+ 
Sbjct  139  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLGPRICREELSFSQAPAGNSFQQQL  196

Query  809  SEKESSD  829
              KE ++
Sbjct  197  VTKEGNE  203



>ref|XP_006782281.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like isoform 
X1 [Neolamprologus brichardi]
Length=473

 Score =   166 bits (419),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 113/178 (63%), Gaps = 8/178 (4%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F   L  SP   LF+ VIYL PGDYH  HSP DW V LRRHF G L  VN    R I+ L
Sbjct  298   FRENLLSSPDSDLFHVVIYLAPGDYHCFHSPTDWRVELRRHFPGSLMSVNPGVARWIKEL  357

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK----LHLEPPEE  1450
             +  NERVVL G+WQ+GF ++ A+GATN+GSI ++ +  L+TN P+ +K     H    ++
Sbjct  358   FCLNERVVLTGQWQQGFFSLTAVGATNVGSIRIYFDQELQTNTPRYSKGSFHDHSYIADQ  417

Query  1451  RVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              V      G+ ++KG+ +  FN+GST+VL+F+A    P DF F ++ G+RIR+GE LG
Sbjct  418   TVKFAGEGGVALQKGESVGEFNLGSTIVLLFEA----PKDFSFNLQPGQRIRVGEGLG  471


 Score = 42.7 bits (99),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +1

Query  427  PLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLK  603
            P R +SR WG L GVE P WLR  +Y  +   F  N++EAA+    +  +L +FF R LK
Sbjct  178  PTRLLSRAWGRLNGVELPTWLRKPIYSLYIWTFGVNMQEAAVEDLHHYRNLGEFFRRRLK  237

Query  604  EGSRPVDSDPC  636
               RP+ +  C
Sbjct  238  PAVRPLCASSC  248


 Score = 38.1 bits (87),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            L SP DG IL FG +K +   +EQVKG +YS+   LG
Sbjct  249  LTSPADGRILHFGRVKNS--EVEQVKGVTYSLEHFLG  283



>gb|KFP33719.1| Phosphatidylserine decarboxylase proenzyme, partial [Colius striatus]
Length=302

 Score =   161 bits (408),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 106/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  132   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  191

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  192   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  250

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++I  GEALG
Sbjct  251   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKPGQKIHFGEALG  300


 Score = 43.5 bits (101),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +1

Query  424  LPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTL  600
            +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  +L +FF R L
Sbjct  7    VPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKL  66

Query  601  KEGSRPVDSDPCCL  642
            K  +RPV    CCL
Sbjct  67   KPQARPV----CCL  76


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  79   VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  113



>ref|NP_001172059.1| phosphatidylserine decarboxylase proenzyme [Sus scrofa]
 dbj|BAI48042.1| phosphatidylserine decarboxylase [Sus scrofa]
Length=409

 Score =   164 bits (416),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  239   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  298

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  299   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFVTH  357

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  358   TNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFKLKAGQKIRFGEALG  407


 Score = 39.7 bits (91),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 52/99 (53%), Gaps = 8/99 (8%)
 Frame = +1

Query  349  KIEGAREKGIE---LEFHPDV----KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYR  507
            + E  RE+ +E   LE  P +    + +    +P R +SR WG L  VE P WLR  VY 
Sbjct  82   QYEKYRERELEKLGLEIPPKLAGHWEVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYS  141

Query  508  AWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPV  621
             +   F  N++EAA+    +  +L +FF R LK  +RPV
Sbjct  142  LYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV  180


 Score = 38.5 bits (88),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  186  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  220



>ref|XP_007170710.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X3 [Balaenoptera acutorostrata scammoni]
 ref|XP_007170711.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X4 [Balaenoptera acutorostrata scammoni]
Length=374

 Score =   164 bits (414),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFVTH  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  323   TNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFKLKAGQKIRFGEALG  372


 Score = 38.9 bits (89),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  69   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  128

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  129  NLSEFFRRKLKPQARPV  145


 Score = 38.1 bits (87),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>dbj|BAE39619.1| unnamed protein product [Mus musculus]
 gb|EDL37404.1| mCG2531, isoform CRA_h [Mus musculus]
Length=259

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F ++L       L++CVIYL PGDYH  HSP DW +  RRHF G L  VN    R I+ L
Sbjct  89    FRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTISHRRHFPGSLMSVNPGMARWIKEL  148

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI +  +  L TN P+ +K         V  
Sbjct  149   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIHFDRDLHTNSPRYSKGSYN-DLSFVTH  207

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  208   ANKEGIPMRKGEPLGEFNLGSTIVLIFEA----PKDFNFRLKAGQKIRFGEALG  257



>ref|XP_006019917.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Alligator sinensis]
 ref|XP_006019918.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Alligator sinensis]
 ref|XP_006019919.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X3 [Alligator sinensis]
 ref|XP_006267038.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Alligator mississippiensis]
 ref|XP_006267039.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Alligator mississippiensis]
Length=374

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 112/186 (60%), Gaps = 14/186 (8%)
 Frame = +2

Query  1094  DYFFSSKLSCSPMKG---------LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFP  1246
             D  FS   SC+  +          L++CVIYL PGDYH  HSP DW V  RRHF G L  
Sbjct  192   DLQFSQTSSCNSFQNQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMS  251

Query  1247  VNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK  1426
             VN    R I+ L+  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K
Sbjct  252   VNPGVARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSK  311

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
                      +   +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR
Sbjct  312   GSYN-DFSFITNNNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKPGQKIR  366

Query  1607  MGEALG  1624
              GEALG
Sbjct  367   FGEALG  372


 Score = 45.4 bits (106),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  57   GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNM  116

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  117  KEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  148


 Score = 38.5 bits (88),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>ref|XP_008140615.1| PREDICTED: phosphatidylserine decarboxylase proenzyme [Eptesicus 
fuscus]
Length=374

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 109/174 (63%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V +
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRYSKGSYN-DFSFVTQ  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  323   ANREGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFDFKLKAGQKIRFGEALG  372


 Score = 38.5 bits (88),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  69   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  128

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  129  NLSEFFRRKLKPQARPV  145


 Score = 38.5 bits (88),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K +   +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNS--EVEQVKGVTYSLESFLG  185



>ref|XP_010140256.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Buceros rhinoceros silvestris]
Length=374

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  323   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  372


 Score = 45.1 bits (105),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  57   GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNM  116

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  117  KEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  148


 Score = 38.5 bits (88),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>ref|XP_009329076.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Pygoscelis adeliae]
Length=374

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  323   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  372


 Score = 44.7 bits (104),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 45/84 (54%), Gaps = 5/84 (6%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  69   PMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYR  128

Query  571  slRDFFVRTLKEGSRPVDSDPCCL  642
            +L +FF R LK  +RPV    CCL
Sbjct  129  NLSEFFRRKLKPQARPV----CCL  148


 Score = 38.5 bits (88),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>gb|AAA37015.1| phosphatidylserine decarboxylase, partial [Cricetulus griseus]
Length=370

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F ++L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  200   FRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  259

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  260   FCHNERVVLSGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DLSFVTH  318

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  319   ANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFRLKAGQKIRFGEALG  368


 Score = 40.4 bits (93),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 50/100 (50%), Gaps = 10/100 (10%)
 Frame = +1

Query  337  YDDNKIEGAREKGIELEFHPDV----KASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVY  504
            Y D K+E      + LE  P +    + +    +P R +SR WG L  VE P WLR  VY
Sbjct  47   YRDQKLEK-----LGLEIPPKLASHWEVALYKSVPTRLLSRAWGRLNQVELPYWLRRPVY  101

Query  505  RAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPV  621
              +   F  N+ EAA+    +  +L +FF R LK  +RPV
Sbjct  102  SLYIWTFGVNMTEAAVEDLHHYRNLSEFFRRKLKPQARPV  141


 Score = 39.3 bits (90),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 6/59 (10%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSFLSMTAEDDSEQKNSEKES  823
            ++SP DG IL FG++K     +EQVKG +YS+   LG  ++     ED S    S ++S
Sbjct  147  VISPSDGKILTFGQVKNC--EVEQVKGVTYSLESFLGPRTY----TEDLSFPPASSRDS  199



>ref|XP_004429802.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
3 [Ceratotherium simum simum]
Length=374

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRYSKGSYN-DFSFVTH  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  323   ANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFKLKAGQKIRFGEALG  372


 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  69   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  128

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  129  NLSEFFRRKLKPQARPV  145


 Score = 38.5 bits (88),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>ref|XP_001494498.3| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Equus caballus]
 ref|XP_005612473.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X5 [Equus caballus]
 ref|XP_005612475.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X7 [Equus caballus]
Length=374

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRYSKGSYN-DFSFVTH  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  323   ANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFKLKAGQKIRFGEALG  372


 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  69   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  128

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  129  NLSEFFRRKLKPQARPV  145


 Score = 38.5 bits (88),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>gb|KFU95054.1| Phosphatidylserine decarboxylase proenzyme, partial [Chaetura 
pelagica]
Length=362

 Score =   163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  192   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  251

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  252   FCHNERVVLTGDWKYGFFSLTAVGATNVGSIRIYFDRDLHTNSPSYSKGSYN-DFSFISN  310

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  311   NNKEGISMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  360


 Score = 53.5 bits (127),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 60/117 (51%), Gaps = 7/117 (6%)
 Frame = +1

Query  301  IVMLGALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVE  474
            +   G     R Y+D K+E   ++GIE+  +   + + +    +P R +SR WG L  VE
Sbjct  24   VATGGGYAGYRKYEDYKLEQMEKRGIEVPVKLAREWEVALYKSVPTRLLSRAWGRLNQVE  83

Query  475  FPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
             P WLR  VY  +   F  N++EAA+    +  +L +FF R LK   RPV    CCL
Sbjct  84   LPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQVRPV----CCL  136


 Score = 38.5 bits (88),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  139  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  173



>ref|XP_004890655.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X6 [Heterocephalus glaber]
 ref|XP_004890656.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X7 [Heterocephalus glaber]
 ref|XP_004843561.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X8 [Heterocephalus glaber]
 ref|XP_004843562.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X9 [Heterocephalus glaber]
Length=339

 Score =   162 bits (411),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F ++L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  169   FRNQLVTQEGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  228

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  229   FCHNERVVLSGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRYSKGSYN-DFSFVTH  287

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  G+ M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  288   ANKDGVPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFRLKAGQKIRFGEALG  337


 Score = 39.3 bits (90),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLGATSF  769
            ++SP DG IL FG++K     +EQVKG +YS+   LG  ++
Sbjct  117  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLGPRTY  155


 Score = 38.5 bits (88),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  35   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  94

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  95   NLSEFFRRKLKPQARPV  111



>ref|XP_010124269.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X1 [Chlamydotis macqueenii]
Length=423

 Score =   164 bits (416),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       LF+CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  253   FQQQLVTKEGNELFHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  312

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         +  
Sbjct  313   FCHNERVVLRGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPSYSKGSYN-DFSFISN  371

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  372   NNKEGISMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  421


 Score = 45.1 bits (105),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  106  GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNM  165

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  166  KEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  197


 Score = 38.5 bits (88),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  200  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  234



>gb|ACC68877.1| hypothetical protein [Rhinolophus ferrumequinum]
Length=340

 Score =   162 bits (411),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 110/186 (59%), Gaps = 14/186 (8%)
 Frame = +2

Query  1094  DYFFSSKLSCSPMKG---------LFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFP  1246
             D  F    SCS  +          L++CVIYL PGDYH  HSP DW V  RRHF G L  
Sbjct  158   DLPFPPATSCSSFRNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMS  217

Query  1247  VNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK  1426
             VN    R I+ L+  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K
Sbjct  218   VNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRYSK  277

Query  1427  LHLEPPEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIR  1606
                      V   +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR
Sbjct  278   GSYN-DFSFVTHANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFKLKAGQKIR  332

Query  1607  MGEALG  1624
              GEALG
Sbjct  333   FGEALG  338


 Score = 38.5 bits (88),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  35   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  94

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  95   NLSEFFRRKLKPQARPV  111


 Score = 38.5 bits (88),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K +   +EQVKG +YS+   LG
Sbjct  117  VISPSDGKILNFGQVKNS--EVEQVKGVTYSLESFLG  151



>ref|XP_009278280.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X2 [Aptenodytes forsteri]
Length=374

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  323   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  372


 Score = 45.1 bits (105),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  57   GALKPLTRVGWRPMSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNM  116

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  117  KEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  148


 Score = 38.5 bits (88),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>ref|XP_004429801.1| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
2 [Ceratotherium simum simum]
Length=388

 Score =   164 bits (414),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F S+L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  218   FRSQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKEL  277

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         V  
Sbjct  278   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRYSKGSYN-DFSFVTH  336

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF F +K G++IR GEALG
Sbjct  337   ANKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFNFKLKAGQKIRFGEALG  386


 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = +1

Query  394  PDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNleeaalpleeya-  570
            P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N++EAA+    +  
Sbjct  83   PVSRVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR  142

Query  571  slRDFFVRTLKEGSRPV  621
            +L +FF R LK  +RPV
Sbjct  143  NLSEFFRRKLKPQARPV  159


 Score = 38.5 bits (88),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  165  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  199



>ref|XP_008299636.1| PREDICTED: phosphatidylserine decarboxylase proenzyme [Stegastes 
partitus]
Length=451

 Score =   165 bits (418),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 115/201 (57%), Gaps = 18/201 (9%)
 Frame = +2

Query  1067  PSTMQHANFDYFFSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFP  1246
             P   Q  +    F   L  SP   LF+ V+YL PGDYH  HSP DW V LRRHF G L  
Sbjct  254   PQKRQGQDSSSSFRDLLLSSPDSDLFHVVVYLAPGDYHCFHSPTDWRVELRRHFPGSLMS  313

Query  1247  VNERATRTIRNLYVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNK  1426
             VN    R ++ L+  NERV L G+WQ GF ++ A+GATN+GSI ++ +  L+TN P+ +K
Sbjct  314   VNPGVARWVKELFCLNERVALTGQWQHGFFSLTAVGATNVGSIRVYFDQELQTNAPRYSK  373

Query  1427  LHLEP--------------PEERVYEPDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSP  1564
                                 E  +   DG G+ +++G+ L  FN+GST+VL+F+A    P
Sbjct  374   GSFHDRSYVSVHEVALRAIDEGGMVSVDGGGVALQRGEALGEFNLGSTIVLLFEA----P  429

Query  1565  SDFRFCIKKGERIRMGEALGR  1627
              DF F ++ G+RIR+GE LGR
Sbjct  430   KDFSFSLQPGQRIRVGEGLGR  450


 Score = 48.9 bits (115),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 1/103 (1%)
 Frame = +1

Query  337  YDDNKIEGAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWA  516
            Y   + +G +E G+        + +     P R +SR WG L GVE P WLR  +Y  + 
Sbjct  118  YQQYRRQGQKEDGVPPPLATPTQVALYRSFPTRLLSRAWGRLNGVELPTWLRKPIYSLYI  177

Query  517  RAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
              F  N++EAA+    +  +L +FF R LK   RP+ +  C +
Sbjct  178  WTFGVNMQEAAVEDLHHYRNLGEFFRRRLKPAVRPLCASSCLV  220


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            LVSP DG IL FG +K +   +EQVKG +YS+   LG
Sbjct  219  LVSPADGRILHFGRVKNS--EVEQVKGVTYSLENFLG  253



>ref|XP_415253.3| PREDICTED: phosphatidylserine decarboxylase proenzyme isoform 
X6 [Gallus gallus]
Length=374

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  204   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  263

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P+ +K         +  
Sbjct  264   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPRYSKGSYN-DFSFISN  322

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  323   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  372


 Score = 44.3 bits (103),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query  358  GAREKGIELEFHPDVKASFMGMLPLRSISRFWGFLTGVEFPVWLRPYVYRAWARAFHSNl  537
            GA +    + + P  + +    +P R +SR WG L  VE P WLR  VY  +   F  N+
Sbjct  57   GALKPLTRVGWRPVSRVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNM  116

Query  538  eeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
            +EAA+    +  +L +FF R LK  +RPV    CC+
Sbjct  117  KEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCV  148


 Score = 38.1 bits (87),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  151  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  185



>gb|KFP19305.1| Phosphatidylserine decarboxylase proenzyme, partial [Egretta 
garzetta]
Length=362

 Score =   163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  1103  FSSKLSCSPMKGLFYCVIYLKPGDYHRIHSPADWNVLLRRHFSGRLFPVNERATRTIRNL  1282
             F  +L       L++CVIYL PGDYH  HSP DW V  RRHF G L  VN    R I+ L
Sbjct  192   FQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRHFPGSLMSVNPGVARWIKEL  251

Query  1283  YVENERVVLEGRWQEGFMAMAAIGATNIGSIELFIEPTLRTNKPQKNKLHLEPPEERVYE  1462
             +  NERVVL G W+ GF ++ A+GATN+GSI ++ +  L TN P  +K         V  
Sbjct  252   FCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHTNSPCYSKGSYN-DFSFVSN  310

Query  1463  PDGTGIRMKKGDELAAFNMGSTVVLVFQAPISSPSDFRFCIKKGERIRMGEALG  1624
              +  GI M+KG+ L  FN+GST+VL+F+A    P DF+F +K G++IR GEALG
Sbjct  311   NNKEGIPMRKGEHLGEFNLGSTIVLIFEA----PKDFKFHLKAGQKIRFGEALG  360


 Score = 55.1 bits (131),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 7/117 (6%)
 Frame = +1

Query  301  IVMLGALHARRLYDDNKIEGAREKGIEL--EFHPDVKASFMGMLPLRSISRFWGFLTGVE  474
            +   G     R Y+D K+E   ++GIE+  +   + + +    +P R +SR WG L  VE
Sbjct  24   VATGGGYAGYRKYEDYKLEQLEKRGIEVPVKLASEWEVALYKSVPTRLLSRAWGRLNQVE  83

Query  475  FPVWLRPYVYRAWARAFHSNleeaalpleeya-slRDFFVRTLKEGSRPVDSDPCCL  642
             P WLR  VY  +   F  N++EAA+    +  +L +FF R LK  +RPV    CCL
Sbjct  84   LPTWLRKPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV----CCL  136


 Score = 38.5 bits (88),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +2

Query  647  LVSPVDGTILRFGELKEAGGMIEQVKGFSYSVPKLLG  757
            ++SP DG IL FG++K     +EQVKG +YS+   LG
Sbjct  139  VISPSDGKILNFGQVKNC--EVEQVKGVTYSLESFLG  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5541310262532